BB938628 ( RCC11917 )

[UP]


[1][TOP]
>UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q8L685_VOLCA
          Length = 1009

 Score =  144 bits (363), Expect = 3e-33
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P PLP PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPP 323

 Score =  143 bits (360), Expect = 7e-33
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPP 325

 Score =  143 bits (360), Expect = 7e-33
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP     SPPPP   P   P PPPP
Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPP 695

 Score =  143 bits (360), Expect = 7e-33
 Identities = 58/87 (66%), Positives = 59/87 (67%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP+     PPPP   P   P PPPP
Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPP 697

 Score =  142 bits (359), Expect = 9e-33
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   PSPPPP
Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPP 682

 Score =  142 bits (359), Expect = 9e-33
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPP 696

 Score =  142 bits (357), Expect = 2e-32
 Identities = 58/88 (65%), Positives = 59/88 (67%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
           PPPP      PPPP   P   P PPPP+
Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPL 675

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPP 327

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPP 328

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPP 329

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPP 330

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPP 331

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPP 332

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPP 333

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPP 334

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPP 335

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPP 336

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPP 337

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPP 338

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPP 339

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPP 340

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPP 341

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPP 342

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPP 343

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPP 344

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPP 345

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPP 346

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPP 347

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPP 348

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPP 349

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPP 350

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPP 351

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPP 352

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPP 353

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPP 354

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPP 355

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPP 356

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPP 357

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPP 358

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPP 359

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPP 360

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPP 361

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPP 362

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPP 363

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPP 364

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPP 365

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPP 366

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPP 367

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPP 368

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPP 369

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPP 370

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPP 371

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPP 372

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPP 373

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPP 374

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPP 375

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPP 376

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPP 377

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPP 378

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPP 379

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPP 380

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPP 381

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPP 382

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPP 383

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPP 384

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPP 385

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPP 386

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPP 387

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPP 388

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPP 389

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPP 390

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPP 391

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPP 392

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPP 393

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPP 394

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPP 395

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPP 396

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPP 397

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPP 398

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPP 399

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPP 400

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPP 401

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPP 402

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPP 403

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPP 404

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPP 405

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPP 406

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPP 407

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPP 408

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPP 409

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPP 410

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPP 411

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPP 412

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPP 413

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPP 414

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPP 415

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPP 416

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPP 417

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPP 418

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPP 419

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPP 420

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPP 421

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPP 422

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPP 423

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPP 424

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPP 425

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPP 426

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPP 427

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPP 428

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPP 429

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPP 430

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPP 431

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPP 432

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPP 433

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPP 434

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPP 435

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPP 436

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPP 437

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPP 438

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPP 439

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPP 440

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPP 441

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPP 442

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPP 443

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPP 444

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPP 445

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPP 446

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPP 447

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPP 448

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPP 449

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPP 450

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPP 451

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPP 452

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPP 453

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPP 454

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPP 455

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPP 456

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPP 457

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPP 458

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPP 459

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPP 460

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPP 461

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPP 462

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPP 463

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPP 464

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPP 465

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPP 466

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPP 467

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPP 468

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPP 469

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPP 470

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPP 471

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPP 472

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPP 473

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPP 474

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPP 475

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPP 476

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPP 477

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPP 478

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPP 479

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPP 480

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPP 481

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPP 482

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPP 483

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPP 484

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPP 485

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPP 486

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPP 487

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPP 488

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPP 489

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPP 490

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPP 491

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPP 492

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPP 493

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPP 494

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPP 495

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPP 496

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPP 497

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPP 498

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPP 499

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPP 500

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPP 501

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPP 502

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPP 503

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPP 504

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPP 505

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPP 506

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPP 507

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPP 508

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPP 509

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPP 510

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPP 511

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPP 512

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPP 513

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPP 514

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPP 515

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPP 516

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPP 517

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPP 518

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPP 519

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPP 520

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPP 521

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPP 522

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPP 523

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPP 524

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPP 525

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPP 526

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPP 527

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPP 528

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPP 529

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPP 530

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPP 531

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPP 532

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPP 533

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPP 534

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPP 535

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPP 536

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPP 537

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPP 538

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPP 539

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPP 540

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPP 541

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPP 542

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPP 543

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPP 544

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPP 545

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPP 546

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPP 547

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPP 548

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPP 549

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPP 550

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPP 551

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPP 552

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPP 553

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPP 554

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPP 555

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPP 556

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPP 557

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPP 558

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPP 559

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPP 560

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPP 561

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPP 562

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPP 563

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPP 564

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPP 565

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPP 566

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPP 567

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPP 568

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPP 569

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPP 570

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPP 571

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPP 572

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPP 573

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPP 574

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPP 575

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPP 576

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPP 577

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPP 578

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPP 579

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPP 580

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPP 581

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPP 582

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPP 583

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPP 584

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPP 585

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPP 586

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPP 587

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPP 588

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPP 589

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPP 590

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPP 591

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPP 592

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPP 593

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPP 594

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPP 595

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPP 596

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPP 597

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPP 598

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPP 599

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPP 600

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPP 601

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPP 602

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPP 603

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPP 604

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPP 605

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPP 606

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPP 607

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPP 608

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPP 609

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPP 610

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPP 611

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPP 612

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPP 613

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPP 614

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPP 615

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPP 616

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPP 617

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPP 618

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPP 619

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPP 620

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPP 621

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPP 622

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPP 623

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPP 624

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPP 625

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPP 626

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPP 627

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPP 628

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPP 629

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPP 630

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPP 631

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPP 632

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPP 633

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPP 634

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPP 635

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPP 636

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPP 637

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPP 638

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPP 639

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPP 640

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPP 641

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPP 642

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPP 643

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPP 644

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPP 645

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPP 646

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPP 647

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPP 648

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPP 649

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPP 650

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPP 651

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPP 652

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPP 653

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPP 654

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPP 655

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPP 656

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPP 657

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPP 658

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPP 659

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPP 660

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPP 661

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPP 662

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPP 663

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPP 664

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPP 665

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPP 666

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPP 667

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPP 668

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPP 669

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPP 670

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPP 671

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPP 672

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPP 673

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPP 685

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPP 686

 Score =  139 bits (351), Expect = 8e-32
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP   PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPP 311

 Score =  139 bits (351), Expect = 8e-32
 Identities = 59/89 (66%), Positives = 59/89 (66%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPL--E 99
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PPL   
Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPPPP      PPPP   P   P PPPP
Sbjct: 679 PPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707

 Score =  138 bits (348), Expect = 2e-31
 Identities = 57/87 (65%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P+PPP   PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPP 316

 Score =  138 bits (348), Expect = 2e-31
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P   PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPP 317

 Score =  138 bits (348), Expect = 2e-31
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPP 320

 Score =  138 bits (347), Expect = 2e-31
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPP 315

 Score =  138 bits (347), Expect = 2e-31
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PP  P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPP 318

 Score =  137 bits (346), Expect = 3e-31
 Identities = 56/87 (64%), Positives = 57/87 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P   PPP+P PPP   PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 219 PLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPP 305

 Score =  137 bits (346), Expect = 3e-31
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP      PPPP   P   P PPPP
Sbjct: 674 PLPPSPPPPPPPPPPPPPPPPPPPPPP 700

 Score =  137 bits (345), Expect = 4e-31
 Identities = 56/88 (63%), Positives = 58/88 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PP  P PP  PP
Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
           PPPP      PPPP   P+  P  PPP+
Sbjct: 685 PPPPPPPPPPPPPPPPPPHPPPPSPPPL 712

 Score =  135 bits (340), Expect = 1e-30
 Identities = 56/87 (64%), Positives = 56/87 (64%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PP  P P P P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPP 313

 Score =  134 bits (338), Expect = 2e-30
 Identities = 56/87 (64%), Positives = 56/87 (64%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P PLP  PP P PPP P  PP P PPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 217 PPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPP 303

 Score =  134 bits (338), Expect = 2e-30
 Identities = 55/85 (64%), Positives = 55/85 (64%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P P PP  P PPP P PP  PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPP
Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP      PPPP   P   P PPPP
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPP 306

 Score =  132 bits (332), Expect = 1e-29
 Identities = 55/87 (63%), Positives = 57/87 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP+P PP  P PPP+PPPP PPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 214 PPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPP 300

 Score =  132 bits (331), Expect = 2e-29
 Identities = 59/89 (66%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP-PPTPPPNPPPCPDPPLEP 96
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP P PP+PPP PPP P PP  P
Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
           PPPPP      PPPP   P   PSPPP V
Sbjct: 694 PPPPP------PPPPHPPP---PSPPPLV 713

 Score =  129 bits (323), Expect = 1e-28
 Identities = 54/87 (62%), Positives = 54/87 (62%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PP  P PPP   PPP P PPPP PPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 212 PSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPP 298

 Score =  127 bits (319), Expect = 4e-28
 Identities = 55/87 (63%), Positives = 57/87 (65%), Gaps = 2/87 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP--PPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P PPP P PPP P PPP PPPPPP  PPPPPPPP PP+PPP PPP PPP P PP  
Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPP 18
           PPPPPP      PPPP+  P     PP
Sbjct: 697 PPPPPP-----HPPPPSPPPLVPALPP 718

 Score =  124 bits (310), Expect = 4e-27
 Identities = 53/89 (59%), Positives = 53/89 (59%), Gaps = 6/89 (6%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPP------PPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P PP  P PPP P  PP P PPPPPP      PPPPPP PP PPP PPP PPP P PP  
Sbjct: 209 PPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPPPP      PPPP   P   P PPPP
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297

 Score =  103 bits (258), Expect = 5e-21
 Identities = 47/85 (55%), Positives = 51/85 (60%), Gaps = 4/85 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PP  PPPPPPPPPPPPP  PP PPP PPP+PPP   PPL P 
Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP--PPPPPPPPPPHPPPPSPPPLVPA 715

Query: 92  PPPP----VYKYKSPPPPAKKPYEY 30
            PP     +     PP    +PY +
Sbjct: 716 LPPSCEVCIVARLLPPAFDVRPYRF 740

 Score =  100 bits (249), Expect = 5e-20
 Identities = 42/72 (58%), Positives = 43/72 (59%)
 Frame = -2

Query: 227 CPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPA 48
           CP        PPPP PPPPPP PP+PPP  PP PPP P PPL PPPPPP      PPPP 
Sbjct: 199 CPVSTVIGYNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPP 258

Query: 47  KKPYEYPSPPPP 12
             P   P PPPP
Sbjct: 259 PPPPPPPPPPPP 270

[2][TOP]
>UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae
            RepID=UPI000186983E
          Length = 1411

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 854  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 914  PPPPPPPPPPPPPPPPPPPPPPPPPPP 940

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 855  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 915  PPPPPPPPPPPPPPPPPPPPPPPPPPP 941

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 856  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 916  PPPPPPPPPPPPPPPPPPPPPPPPPPP 942

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 857  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 917  PPPPPPPPPPPPPPPPPPPPPPPPPPP 943

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 858  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 918  PPPPPPPPPPPPPPPPPPPPPPPPPPP 944

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 859  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 919  PPPPPPPPPPPPPPPPPPPPPPPPPPP 945

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 860  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 920  PPPPPPPPPPPPPPPPPPPPPPPPPPP 946

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 861  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 921  PPPPPPPPPPPPPPPPPPPPPPPPPPP 947

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 862  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 922  PPPPPPPPPPPPPPPPPPPPPPPPPPP 948

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 863  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 923  PPPPPPPPPPPPPPPPPPPPPPPPPPP 949

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 864  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 924  PPPPPPPPPPPPPPPPPPPPPPPPPPP 950

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 865  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 925  PPPPPPPPPPPPPPPPPPPPPPPPPPP 951

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 866  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 926  PPPPPPPPPPPPPPPPPPPPPPPPPPP 952

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 867  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 927  PPPPPPPPPPPPPPPPPPPPPPPPPPP 953

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 868  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 928  PPPPPPPPPPPPPPPPPPPPPPPPPPP 954

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 869  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 929  PPPPPPPPPPPPPPPPPPPPPPPPPPP 955

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 870  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 930  PPPPPPPPPPPPPPPPPPPPPPPPPPP 956

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 871  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 931  PPPPPPPPPPPPPPPPPPPPPPPPPPP 957

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 872  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 932  PPPPPPPPPPPPPPPPPPPPPPPPPPP 958

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 873  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 933  PPPPPPPPPPPPPPPPPPPPPPPPPPP 959

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 874  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 934  PPPPPPPPPPPPPPPPPPPPPPPPPPP 960

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 875  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 935  PPPPPPPPPPPPPPPPPPPPPPPPPPP 961

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 876  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 936  PPPPPPPPPPPPPPPPPPPPPPPPPPP 962

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 884  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 944  PPPPPPPPPPPPPPPPPPPGAPPPPPP 970

 Score =  139 bits (350), Expect = 1e-31
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P   P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 851  PTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 911  PPPPPPPPPPPPPPPPPPPPPPPPPPP 937

 Score =  138 bits (348), Expect = 2e-31
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 883  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P     PPPP
Sbjct: 943  PPPPPPPPPPPPPPPPPPPPGAPPPPP 969

 Score =  138 bits (348), Expect = 2e-31
 Identities = 57/86 (66%), Positives = 57/86 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 896  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPP 15
            PPPP      PPPP   P   P PPP
Sbjct: 956  PPPPPPPGAPPPPPPALPPGAPPPPP 981

 Score =  135 bits (339), Expect = 2e-30
 Identities = 56/87 (64%), Positives = 57/87 (65%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 895  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP     +PPPP         PPPP
Sbjct: 955  PPPPPPPPGAPPPPPPALPPGAPPPPP 981

 Score =  134 bits (337), Expect = 3e-30
 Identities = 58/92 (63%), Positives = 59/92 (64%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 894  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953

Query: 92   PPPPVYKYKSPPPPAKKPYEYP-----SPPPP 12
            PPPP      PPPP   P   P     +PPPP
Sbjct: 954  PPPP-----PPPPPGAPPPPPPALPPGAPPPP 980

 Score =  133 bits (334), Expect = 7e-30
 Identities = 56/87 (64%), Positives = 57/87 (65%), Gaps = 5/87 (5%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 907  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPP 966

Query: 92   PPPPVYKYKSPPPPAKKP-----YEYP 27
            PPPP     +PPPP   P      EYP
Sbjct: 967  PPPPALPPGAPPPPPALPCFHEGQEYP 993

 Score =  132 bits (331), Expect = 2e-29
 Identities = 54/87 (62%), Positives = 55/87 (63%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P+    P   PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 843  PAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP      PPPP   P   P PPPP
Sbjct: 903  PPPPPPPPPPPPPPPPPPPPPPPPPPP 929

 Score =  107 bits (268), Expect = 3e-22
 Identities = 47/76 (61%), Positives = 48/76 (63%), Gaps = 2/76 (2%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PP  PPP PP    PP  PP
Sbjct: 921  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPAL--PPGAPP 978

Query: 92   PPP--PVYKYKSPPPP 51
            PPP  P +      PP
Sbjct: 979  PPPALPCFHEGQEYPP 994

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 41/70 (58%), Positives = 41/70 (58%)
 Frame = -2

Query: 221  EPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKK 42
            EP P     P  PPPPPPP PP PPP PPP PPP P PP  PPPPPP      PPPP   
Sbjct: 842  EPAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901

Query: 41   PYEYPSPPPP 12
            P   P PPPP
Sbjct: 902  PPPPPPPPPP 911

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 23/33 (69%), Positives = 23/33 (69%)
 Frame = -2

Query: 236 PPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTP 138
           P  CPE  P  PPPPPPPPPPPPP P  PPP P
Sbjct: 112 PMICPETTPTTPPPPPPPPPPPPPPPQPPPPEP 144

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 20/33 (60%), Positives = 21/33 (63%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPP 168
           P+  P   P  PP P PPP PPPPPP PPPP P
Sbjct: 112 PMICPETTPTTPPPPPPPPPPPPPPPQPPPPEP 144

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 20/33 (60%), Positives = 21/33 (63%)
 Frame = -2

Query: 254 PPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPP 156
           P   P+  P   PPP PPPPPPPPPP PPP  P
Sbjct: 112 PMICPETTPTTPPPPPPPPPPPPPPPQPPPPEP 144

[3][TOP]
>UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q0P2_IXOSC
          Length = 170

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 61  PPPPPPPPPPPPPPPPPPPPPPPPPPP 87

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 62  PPPPPPPPPPPPPPPPPPPPPPPPPPP 88

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 63  PPPPPPPPPPPPPPPPPPPPPPPPPPP 89

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 64  PPPPPPPPPPPPPPPPPPPPPPPPPPP 90

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 5   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 65  PPPPPPPPPPPPPPPPPPPPPPPPPPP 91

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 6   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 66  PPPPPPPPPPPPPPPPPPPPPPPPPPP 92

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 7   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 67  PPPPPPPPPPPPPPPPPPPPPPPPPPP 93

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 8   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 68  PPPPPPPPPPPPPPPPPPPPPPPPPPP 94

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 9   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 69  PPPPPPPPPPPPPPPPPPPPPPPPPPP 95

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 10  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 70  PPPPPPPPPPPPPPPPPPPPPPPPPPP 96

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 11  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 71  PPPPPPPPPPPPPPPPPPPPPPPPPPP 97

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 12  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 72  PPPPPPPPPPPPPPPPPPPPPPPPPPP 98

 Score =  125 bits (314), Expect = 1e-27
 Identities = 57/103 (55%), Positives = 60/103 (58%), Gaps = 14/103 (13%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 34  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93

Query: 92  PPPPVYKYKSPPPPA--KKPY------------EYPSPPPPVY 6
           PPPP     S P  A   +P             + P+P PP Y
Sbjct: 94  PPPPPRLVTSRPLSALFARPVPRDLREMVWSGGDSPAPEPPFY 136

[4][TOP]
>UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PKI2_IXOSC
          Length = 154

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 61  PPPPPPPPPPPPPPPPPPPPPPPPPPP 87

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 62  PPPPPPPPPPPPPPPPPPPPPPPPPPP 88

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 63  PPPPPPPPPPPPPPPPPPPPPPPPPPP 89

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 64  PPPPPPPPPPPPPPPPPPPPPPPPPPP 90

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 5   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 65  PPPPPPPPPPPPPPPPPPPPPPPPPPP 91

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 6   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 66  PPPPPPPPPPPPPPPPPPPPPPPPPPP 92

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 7   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 67  PPPPPPPPPPPPPPPPPPPPPPPPPPP 93

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 8   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 68  PPPPPPPPPPPPPPPPPPPPPPPPPPP 94

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 9   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 69  PPPPPPPPPPPPPPPPPPPPPPPPPPP 95

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 10  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 70  PPPPPPPPPPPPPPPPPPPPPPPPPPP 96

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 11  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 71  PPPPPPPPPPPPPPPPPPPPPPPPPPP 97

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 12  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 72  PPPPPPPPPPPPPPPPPPPPPPPPPPP 98

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 13  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 73  PPPPPPPPPPPPPPPPPPPPPPPPPPP 99

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 14  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 74  PPPPPPPPPPPPPPPPPPPPPPPPPPP 100

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 15  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 75  PPPPPPPPPPPPPPPPPPPPPPPPPPP 101

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 16  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 76  PPPPPPPPPPPPPPPPPPPPPPPPPPP 102

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 17  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 77  PPPPPPPPPPPPPPPPPPPPPPPPPPP 103

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 18  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 78  PPPPPPPPPPPPPPPPPPPPPPPPPPP 104

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 19  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 79  PPPPPPPPPPPPPPPPPPPPPPPPPPP 105

 Score =  141 bits (356), Expect = 2e-32
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 20  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 80  PPPPPPPPPPPPPPPPPPPPPPPPPPP 106

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/83 (65%), Positives = 56/83 (67%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 41  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--PP 98

Query: 92  PPPPVYKYKSPPPPAKKPYEYPS 24
           PPPP      PPPP ++    PS
Sbjct: 99  PPPP------PPPPQREHLPVPS 115

 Score =  124 bits (311), Expect = 3e-27
 Identities = 50/75 (66%), Positives = 52/75 (69%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 43  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102

Query: 92  PPPPVYKYKSPPPPA 48
           PPPP  ++   P  A
Sbjct: 103 PPPPQREHLPVPSSA 117

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 25/44 (56%), Positives = 26/44 (59%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPT 141
           P P P PPP P PPP P PPP PPPPPPPP     P P +   T
Sbjct: 77  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQREHLPVPSSATAT 120

[5][TOP]
>UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7QFW8_IXOSC
          Length = 185

 Score =  139 bits (350), Expect = 1e-31
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 61  PPPP------PPPPPPPPPPPPPPPPP 81

 Score =  136 bits (343), Expect = 6e-31
 Identities = 55/81 (67%), Positives = 55/81 (67%)
 Frame = -2

Query: 254 PPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVY 75
           PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP  
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61

Query: 74  KYKSPPPPAKKPYEYPSPPPP 12
               PPPP   P   P PPPP
Sbjct: 62  PPPPPPPPPPPPPPPPPPPPP 82

 Score =  130 bits (328), Expect = 3e-29
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 10  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPP 15
           PPPP      PPPP       P PPP
Sbjct: 70  PPPP------PPPP-------PPPPP 82

 Score =  107 bits (266), Expect = 5e-22
 Identities = 42/57 (73%), Positives = 42/57 (73%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPL 102
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P P L
Sbjct: 28  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQL 84

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 38/52 (73%), Positives = 38/52 (73%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPC 117
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP P  C
Sbjct: 34  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLC 85

[6][TOP]
>UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA
          Length = 599

 Score =  137 bits (346), Expect = 3e-31
 Identities = 58/94 (61%), Positives = 61/94 (64%), Gaps = 5/94 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAP-----KPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP 108
           P PLP  PP+P      PPP P PPP+PPPPPPPPPP PPP+PP PPP PPP PPP P P
Sbjct: 211 PLPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPP 270

Query: 107 PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
           P  PP PPP      PPPP   P   P PPPPVY
Sbjct: 271 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVY 304

 Score =  118 bits (296), Expect = 2e-25
 Identities = 52/90 (57%), Positives = 56/90 (62%), Gaps = 9/90 (10%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P+PPP+P PPP P PPP PPPPPPPPPPP PP PP PPP PPP PP    PP  PP
Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP----PPPPPP 298

Query: 92  PPPPVYKYK---------SPPPPAKKPYEY 30
           PPPPVY  +          PP    +PY Y
Sbjct: 299 PPPPVYPDQCSVCIVAKLQPPAIDVRPYRY 328

 Score =  116 bits (291), Expect = 7e-25
 Identities = 48/85 (56%), Positives = 51/85 (60%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P+      P P P   P P PP PPPPPPP PPP+PP PPP PPP+PPP P PP  PPPP
Sbjct: 203 PISQASTLPLPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPP 262

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP      PPPP   P   P PPPP
Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPP 287

[7][TOP]
>UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium
           modesticaldum Ice1 RepID=B0TGJ1_HELMI
          Length = 256

 Score =  136 bits (343), Expect = 6e-31
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP  P PPP PPP PPP P PP  PP
Sbjct: 28  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPP 87

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 88  PPPP-----PPPPPPPPPPPRPCPPPP 109

 Score =  134 bits (336), Expect = 4e-30
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPP P PP PPP PPP PPP P PP  PP
Sbjct: 31  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPP 90

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPP 15
           PPPP      PPPP   P   P PPP
Sbjct: 91  PPPP------PPPPPPPPRPCPPPPP 110

 Score =  132 bits (333), Expect = 9e-30
 Identities = 56/88 (63%), Positives = 57/88 (64%), Gaps = 3/88 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPP---PPPPTPPAPPPTPPPNPPPCPDPPL 102
           P P P PPP P PPP P PPP PPPPPPPPPP   PPPP PP PPP PPP PPP P PP 
Sbjct: 33  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPP 92

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPP 18
            PPPPPP      PPPP  +P   P PP
Sbjct: 93  PPPPPPPPPPRPCPPPPPARPCPPPCPP 120

 Score =  131 bits (330), Expect = 2e-29
 Identities = 54/81 (66%), Positives = 54/81 (66%)
 Frame = -2

Query: 254 PPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVY 75
           PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP   PCP PP  PPPPPP  
Sbjct: 24  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR--PCPPPPPPPPPPPPPP 81

Query: 74  KYKSPPPPAKKPYEYPSPPPP 12
               PPPP   P   P PPPP
Sbjct: 82  PPPPPPPPPPPPPPPPPPPPP 102

 Score =  131 bits (329), Expect = 3e-29
 Identities = 57/89 (64%), Positives = 59/89 (66%), Gaps = 3/89 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPP---PPPPPTPPAPPPTPPPNPPPCPDPPL 102
           P P P PPP P PPP P PPP PPPPPPPPP   PPPPP PP PPP PPP PPP P PP 
Sbjct: 34  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPP 93

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            PPPPPP  +   PPPPA+     P PPP
Sbjct: 94  PPPPPPPPPRPCPPPPPAR-----PCPPP 117

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/88 (61%), Positives = 55/88 (62%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P P P PPPPPPPPPPPPPP PP PPP PPP PPP P PP  P 
Sbjct: 46  PPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPC 105

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
           PPPP  +   PP P K     P P P V
Sbjct: 106 PPPPPARPCPPPCPPKHECGLPEPCPQV 133

 Score =  114 bits (285), Expect = 3e-24
 Identities = 52/91 (57%), Positives = 55/91 (60%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP P P P PP  P 
Sbjct: 56  PPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCP-PPPPARPC 114

Query: 92  PPPPVYKYK----SPPPPAKKPYEYPSPPPP 12
           PPP   K++     P P  +     P P PP
Sbjct: 115 PPPCPPKHECGLPEPCPQVEPIAGEPMPIPP 145

 Score =  111 bits (278), Expect = 2e-23
 Identities = 48/81 (59%), Positives = 48/81 (59%)
 Frame = -2

Query: 254 PPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVY 75
           P   PK P  P  P    PPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP  
Sbjct: 6   PTGYPKVPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 65

Query: 74  KYKSPPPPAKKPYEYPSPPPP 12
               PPPP   P   P PPPP
Sbjct: 66  PCPPPPPPPPPPPPPPPPPPP 86

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 50/99 (50%), Positives = 54/99 (54%), Gaps = 12/99 (12%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPP--PPPPPTPPAPPPTPPPN----PPPCPD 111
           P P P PPP P PPP P PPP PPPPPPPP   PPPPP  P PPP PP +    P PCP 
Sbjct: 73  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPCPPKHECGLPEPCPQ 132

Query: 110 -PPL--EPPPPPPVYKYKSP---PPPAKKPYEYPSPPPP 12
             P+  EP P PP      P    P  ++P   P P PP
Sbjct: 133 VEPIAGEPMPIPPCAPMPMPMPMEPIGRQPLPIPMPMPP 171

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 41/76 (53%), Positives = 42/76 (55%)
 Frame = -2

Query: 239 KPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSP 60
           KPP      P  P  P    PPPPP PP PPP PPP PPP P PP  PPPPPP      P
Sbjct: 4   KPPTGYPKVPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP----PPP 59

Query: 59  PPPAKKPYEYPSPPPP 12
           PPP  +P   P PPPP
Sbjct: 60  PPPPPRPCPPPPPPPP 75

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/142 (33%), Positives = 54/142 (38%), Gaps = 52/142 (36%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPP--PTPPPNPP-------- 123
           P P P PPP P PPP P PPP PPPPPPPPPPPP P PP PP  P PPP PP        
Sbjct: 69  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPCPPKHECGLPE 128

Query: 122 ------------------------------------------PCPDPPLEPPPPPPVYKY 69
                                                     PC   P+EP    P+   
Sbjct: 129 PCPQVEPIAGEPMPIPPCAPMPMPMPMEPIGRQPLPIPMPMPPCAPMPVEPVAREPMEHR 188

Query: 68  KSPPPPAKKPYEYPSPPPPVYK 3
            +P  P +      + PP + K
Sbjct: 189 PAPCDPCESYDPAITVPPEMMK 210

[8][TOP]
>UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q3U3_IXOSC
          Length = 137

 Score =  136 bits (343), Expect = 6e-31
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 61  PPPP------PPPPPPPP---PPPPPP 78

 Score =  136 bits (343), Expect = 6e-31
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 62  PPPP------PPPPPPPP---PPPPPP 79

[9][TOP]
>UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae
           RepID=A7UVF7_ANOGA
          Length = 147

 Score =  136 bits (343), Expect = 6e-31
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 25  PRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 85  PPPP------PPPPPPPP---PLPPPP 102

 Score =  132 bits (331), Expect = 2e-29
 Identities = 54/81 (66%), Positives = 55/81 (67%)
 Frame = -2

Query: 251 PPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYK 72
           PP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP   
Sbjct: 24  PPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--- 80

Query: 71  YKSPPPPAKKPYEYPSPPPPV 9
              PPPP   P   P PPPP+
Sbjct: 81  ---PPPPPPPPPPPPPPPPPL 98

 Score =  116 bits (291), Expect = 7e-25
 Identities = 48/75 (64%), Positives = 48/75 (64%)
 Frame = -2

Query: 236 PPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPP 57
           P   P  PP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP      PP
Sbjct: 20  PHLLPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79

Query: 56  PPAKKPYEYPSPPPP 12
           PP   P   P PPPP
Sbjct: 80  PPPPPPPPPPPPPPP 94

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 36/51 (70%), Positives = 36/51 (70%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPP 120
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP P P PP N  P
Sbjct: 57  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRNIIP 107

[10][TOP]
>UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f.
           nagariensis RepID=Q9SBM1_VOLCA
          Length = 409

 Score =  135 bits (339), Expect = 2e-30
 Identities = 55/86 (63%), Positives = 58/86 (67%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP   PPP P PPP PPP PPPPPPPPPP PP+PPP PPP PPP P+PP  PP
Sbjct: 85  PSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPP 144

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPP 15
           PPPP       PPP+  P   PSPPP
Sbjct: 145 PPPPSPSPPPSPPPSPPPSPPPSPPP 170

 Score =  134 bits (337), Expect = 3e-30
 Identities = 57/86 (66%), Positives = 59/86 (68%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP+P PPP P PPP PPPPPPPPPPPPPP+PP PPP PPP PPP P PP  PP
Sbjct: 75  PPPQPPLPPSPSPPP-PPPPPVPPPPPPPPPPPPPPSPPPPPPPPPP-PPPSPPPPPPPP 132

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPP 15
           PPPP      PPPP   P   PSPPP
Sbjct: 133 PPPPPNPPPPPPPPPPSPSPPPSPPP 158

 Score =  134 bits (336), Expect = 4e-30
 Identities = 54/84 (64%), Positives = 57/84 (67%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P P+PPP P PP  P PPP PPPPPPP PPPPPP PP PPP+PPP PPP P PP  PPPP
Sbjct: 83  PSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPP 142

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPP 15
           PP       PPP+  P   PSPPP
Sbjct: 143 PPPPPPSPSPPPSPPPSPPPSPPP 166

 Score =  133 bits (334), Expect = 7e-30
 Identities = 56/89 (62%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPP--PPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P PPP P  PP P PPP PPPP  PPPPPPPPPP PP+PPP PPP PPP P PP  
Sbjct: 69  PPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPP 128

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPPPP      PPPP   P   P P PP
Sbjct: 129 PPPPPPPPPNPPPPPPPPPPSPSPPPSPP 157

 Score =  131 bits (330), Expect = 2e-29
 Identities = 55/87 (63%), Positives = 57/87 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P+PP  P P P PPPPPP PPPPPPP PP PPP+PPP PPP P PP  PP
Sbjct: 67  PPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPP 126

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP   P   P PPPP
Sbjct: 127 PPPP-----PPPPPPPNPPPPPPPPPP 148

 Score =  130 bits (327), Expect = 5e-29
 Identities = 57/89 (64%), Positives = 58/89 (65%), Gaps = 3/89 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPP PPPPPPPPPP PP PPP PPP PPP P PP  PP
Sbjct: 99  PPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPP-PPPSPSPPPSPP 157

Query: 92  PPPPVYKYKSP---PPPAKKPYEYPSPPP 15
           P PP     SP   PPP+  P   PSPPP
Sbjct: 158 PSPPPSPPPSPPPSPPPSPPPSPPPSPPP 186

 Score =  129 bits (325), Expect = 8e-29
 Identities = 57/94 (60%), Positives = 60/94 (63%), Gaps = 8/94 (8%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAP-PPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P PPP+P PPP P PPP P PPPPPPPPPPPPP PP PPP PPP+P P P PP  P
Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSP 160

Query: 95  PPPPPVYKYKSP-------PPPAKKPYEYPSPPP 15
           PP PP     SP       PPP+  P   PSPPP
Sbjct: 161 PPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPP 194

 Score =  128 bits (321), Expect = 2e-28
 Identities = 57/94 (60%), Positives = 61/94 (64%), Gaps = 8/94 (8%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP---PPPPPPPPTPPAPPPTPPPNPPPC--PDP 108
           P P P PPP P PPP P PPP PPPPPP   PPPPPPPP  P+PPP+PPP+PPP   P P
Sbjct: 109 PSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSP 168

Query: 107 PLEPPPPPPVYKYKSP---PPPAKKPYEYPSPPP 15
           P  PPP PP     SP   PPP+  P   PSPPP
Sbjct: 169 PPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPP 202

 Score =  127 bits (318), Expect = 5e-28
 Identities = 57/90 (63%), Positives = 59/90 (65%), Gaps = 4/90 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPP--PPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P PPP P PPP P PPP+PPPPPPPPPPPP  PP PP PPP PPPNPPP P PP  
Sbjct: 90  PPPPPVPPPPPPPPP-PPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPP 148

Query: 98  PPPPPPVYKYKSP--PPPAKKPYEYPSPPP 15
            P PPP      P  PPP+  P   PSPPP
Sbjct: 149 SPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 178

 Score =  126 bits (317), Expect = 7e-28
 Identities = 57/92 (61%), Positives = 59/92 (64%), Gaps = 6/92 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPP-PPPPPTPPAPPPTPPPNPPPC--PDPPL 102
           P P P PPP P PPP P PPP PPPPPPPPP PPPPP PP P P+PPP+PPP   P PP 
Sbjct: 107 PPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPP 166

Query: 101 EPPPPPPVYKYKSP---PPPAKKPYEYPSPPP 15
            PPP PP     SP   PPP   P   PSPPP
Sbjct: 167 SPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPP 198

 Score =  125 bits (315), Expect = 1e-27
 Identities = 54/94 (57%), Positives = 54/94 (57%), Gaps = 9/94 (9%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPP---------PPPPPPPPTPPAPPPTPPPNPPPCP 114
           P   PPP P  P  P PPP PPPPPP         PPPPPPPP PP PPP PPP PPP P
Sbjct: 52  PPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSP 111

Query: 113 DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP  PPPPPP      PPPP   P   P PPPP
Sbjct: 112 PPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPP 145

 Score =  125 bits (314), Expect = 1e-27
 Identities = 56/95 (58%), Positives = 62/95 (65%), Gaps = 9/95 (9%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTP-------PAPPPTPPPNPPPCP 114
           P P P PPP P PPP P PPP PPP PPPPPPPPPP+P       P+PPP+PPP+PPP P
Sbjct: 113 PPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSP 172

Query: 113 DPPLEPPPPPPVYKYKSP--PPPAKKPYEYPSPPP 15
            PP  PP PPP    + P  PPP+  P   PSPPP
Sbjct: 173 -PPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPP 206

 Score =  123 bits (308), Expect = 7e-27
 Identities = 53/95 (55%), Positives = 62/95 (65%), Gaps = 8/95 (8%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPT--PPAPPPTPPPNPPPCPDPPLE 99
           P P P+PPP+P P P P PPP+PPP PPP PPP PP   PP+PPP+PPP+PPP P P   
Sbjct: 150 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPP 209

Query: 98  PPPPPPVYKYKSP------PPPAKKPYEYPSPPPP 12
           P P PP  +  SP      PPP + P+  PSPPPP
Sbjct: 210 PSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPP 244

 Score =  121 bits (304), Expect = 2e-26
 Identities = 55/93 (59%), Positives = 60/93 (64%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPT-PPAPPPTPPPNPPPC--PDPPL 102
           P P P PPP P PPP P PPP PPPP P PPP PPP+ PP+PPP+PPP+PPP   P PP 
Sbjct: 123 PSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 182

Query: 101 EPPPPPPVYKYKSP---PPPAKKPYEYPSPPPP 12
            PPP PP     SP   PPP+  P   PSP PP
Sbjct: 183 SPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPP 215

 Score =  120 bits (302), Expect = 4e-26
 Identities = 53/98 (54%), Positives = 58/98 (59%), Gaps = 11/98 (11%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP-----------PPPPPPPPTPPAPPPTPPPNP 126
           P P P PPP P PPP P PPP PPPPPP           PPP PPP  PP+PPP+PPP+P
Sbjct: 121 PPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 180

Query: 125 PPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP P PP  PP PPP      PP P  +P   P+PP P
Sbjct: 181 PPSP-PPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSP 217

 Score =  116 bits (290), Expect = 9e-25
 Identities = 51/90 (56%), Positives = 54/90 (60%), Gaps = 5/90 (5%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPA-----PPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPL 102
           P  +PPP   PP  P P P+     PPPPPPPPPPP PP PP+P P PPP PPP P PP 
Sbjct: 42  PPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPP-PPPVPPPPP 100

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPPPP      PPPP   P   P PPPP
Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPPPPP 130

 Score =  115 bits (287), Expect = 2e-24
 Identities = 53/89 (59%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPC--PEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P    PP+P+PPP   P PPP+PPPP PPPP PPPP PP P P PP  PPP P PPL 
Sbjct: 217 PRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLP 276

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP PP     SPPPP+  P   PSP PP
Sbjct: 277 PPPSPPP---PSPPPPSPLP---PSPRPP 299

 Score =  114 bits (284), Expect = 4e-24
 Identities = 54/98 (55%), Positives = 60/98 (61%), Gaps = 11/98 (11%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPT-------PPAPPPTPPP--NPPP 120
           P P P+PPP+P P P P PPP+P PP P PP P PP+       PP PPP+PPP   PPP
Sbjct: 190 PSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPP 249

Query: 119 CPDPPLEPP--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P PP  PP  PPPP+    SPPPP   P   PSPPPP
Sbjct: 250 APPPPRPPPPSPPPPLPPPPSPPPPLPPP---PSPPPP 284

 Score =  113 bits (283), Expect = 6e-24
 Identities = 56/109 (51%), Positives = 60/109 (55%), Gaps = 21/109 (19%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPP-PPPPPPPTP------------------PAP 150
           P P P+PPP+P P P P PPP+PPP PPP PPP PPP P                  P P
Sbjct: 170 PSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRP 229

Query: 149 PPTPPPNPPPCPDPPLEPP--PPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
           PP  PP PPP P PP  PP  PPPP     SPPPP   P   PSPPPP+
Sbjct: 230 PPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPP---PSPPPPL 275

 Score =  112 bits (281), Expect = 1e-23
 Identities = 50/93 (53%), Positives = 53/93 (56%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPP------PPPPPPPPPPPTPPAPPPTPPPNPPPCPD 111
           PFP P+PPP   PPP P PP  PPP      PPPP PPPP P PP+PPP  PP P P P 
Sbjct: 235 PFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPP 294

Query: 110 PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P  P P PP   +  PPPP   P   P PPPP
Sbjct: 295 SPRPPKPSPPNNPFPRPPPPNPPP---PRPPPP 324

 Score =  112 bits (279), Expect = 2e-23
 Identities = 55/98 (56%), Positives = 58/98 (59%), Gaps = 11/98 (11%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP---------PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPP 120
           P P P PPP+P PP         P P PPP  PP PPP PPPP P PPAPPP  P  PPP
Sbjct: 202 PSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRP--PPP 259

Query: 119 CPDPPLEPP--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P PPL PP  PPPP+    SPPPP+  P   PSP PP
Sbjct: 260 SPPPPLPPPPSPPPPLPPPPSPPPPSPPP---PSPLPP 294

 Score =  111 bits (278), Expect = 2e-23
 Identities = 49/88 (55%), Positives = 51/88 (57%), Gaps = 5/88 (5%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPP-----PPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P  PP   PPP   PP  PPP P     PPPPPPPPP PP PP  P P+PPP P PP+ P
Sbjct: 38  PAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPP 97

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPPP      PPPP   P   P PPPP
Sbjct: 98  PPPPP-----PPPPPPPSPPPPPPPPPP 120

 Score =  110 bits (276), Expect = 4e-23
 Identities = 50/89 (56%), Positives = 53/89 (59%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE-- 99
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP   PP P PP    
Sbjct: 249 PAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPF 308

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PPPP      PPPP+  P   P PPPP
Sbjct: 309 PRPPPPNPPPPRPPPPSPNP---PRPPPP 334

 Score =  109 bits (273), Expect = 8e-23
 Identities = 48/88 (54%), Positives = 51/88 (57%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKP-PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P  PP P P PP P PPP  PPPP PPPP PPP  P PP  PPP PPP   PP  P
Sbjct: 227 PRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSP 286

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP P+     PP P+     +P PPPP
Sbjct: 287 PPPSPLPPSPRPPKPSPPNNPFPRPPPP 314

 Score =  109 bits (273), Expect = 8e-23
 Identities = 50/89 (56%), Positives = 54/89 (60%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP P PP+P  P P+PP NP P P PP  PP
Sbjct: 259 PSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPP 318

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP      PPPP+  P   P PPPP
Sbjct: 319 PRPPPPSPNPPRPPPPSPPP---PRPPPP 344

 Score =  103 bits (258), Expect = 5e-21
 Identities = 49/106 (46%), Positives = 51/106 (48%), Gaps = 20/106 (18%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP--------------------PPPPPPPPTPPA 153
           P P P  PP P PPP   PPP+PPPP P                    PPP PPPP PP 
Sbjct: 264 PLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPP 323

Query: 152 PPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
           P P PP  PPP P PP  PPP P   +   P P   KP   PSPPP
Sbjct: 324 PSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSPPP 369

 Score =  103 bits (257), Expect = 6e-21
 Identities = 49/91 (53%), Positives = 54/91 (59%), Gaps = 7/91 (7%)
 Frame = -2

Query: 266 PLPTPP--PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP-PPTPPPN----PPPCPDP 108
           P P+PP  P P+PPP   PPP PPPP P PP PPPP+PP P PP P PN    PPP P P
Sbjct: 299 PKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPSPSP 358

Query: 107 PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
           P  PPPP P      PP P ++P   P  PP
Sbjct: 359 PKPPPPPSP------PPRPPRRPPRPPRRPP 383

 Score =  103 bits (256), Expect = 8e-21
 Identities = 52/109 (47%), Positives = 52/109 (47%), Gaps = 30/109 (27%)
 Frame = -2

Query: 248 PAPKPPPCPEP-------PPAPPP-----------------------PPPPPPPPPPPTP 159
           PA KPPP   P       P APPP                       PPPPPPPPPPP P
Sbjct: 20  PARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQP 79

Query: 158 PAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP   PP PPP P PP  PPPPPP      PPPP   P   PSPPPP
Sbjct: 80  PLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPP 128

 Score =  102 bits (255), Expect = 1e-20
 Identities = 52/100 (52%), Positives = 56/100 (56%), Gaps = 13/100 (13%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPP-----------APPPTPPP-- 132
           P PLP PPP+P PP  P P P PP PPPP P PP P PP            PPP PPP  
Sbjct: 262 PPPLP-PPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPR 320

Query: 131 NPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPP P+PP  PPP PP  +   PPPP+  P   P PPPP
Sbjct: 321 PPPPSPNPPRPPPPSPPPPR---PPPPSPNP---PRPPPP 354

 Score =  102 bits (255), Expect = 1e-20
 Identities = 49/91 (53%), Positives = 51/91 (56%), Gaps = 5/91 (5%)
 Frame = -2

Query: 272 PFPLPTPP--PAPKPP--PCPEPPPAPPPPP-PPPPPPPPPTPPAPPPTPPPNPPPCPDP 108
           P PLP  P  P P PP  P P PPP  PPPP PPPP P PP PP P P PP  PPP P+P
Sbjct: 289 PSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNP 348

Query: 107 PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
           P  PPP P   K   PP P  +P   P  PP
Sbjct: 349 PRPPPPSPSPPKPPPPPSPPPRPPRRPPRPP 379

 Score =  101 bits (251), Expect = 3e-20
 Identities = 45/84 (53%), Positives = 50/84 (59%), Gaps = 2/84 (2%)
 Frame = -2

Query: 272 PFPLPTPP--PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           PFP P PP  P P+PPP    PP PPPP PPPP PPPP+P  P P PP   PP P PP  
Sbjct: 307 PFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPS 366

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYP 27
           PPP PP    + PP P ++P   P
Sbjct: 367 PPPRPP----RRPPRPPRRPPTAP 386

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 39/66 (59%), Positives = 41/66 (62%), Gaps = 1/66 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPD-PPLEP 96
           P P P  PP P PPP   PPP+P PP PPPP P PP PP PPP+PPP PP  P  PP  P
Sbjct: 324 PSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPP-PPPSPPPRPPRRPPRPPRRP 382

Query: 95  PPPPPV 78
           P  P V
Sbjct: 383 PTAPGV 388

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 32/90 (35%), Positives = 34/90 (37%), Gaps = 19/90 (21%)
 Frame = -2

Query: 224 PEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNP-------------------PPCPDPPL 102
           P    AP   PPP   P       P   PP +P                   PP P PP 
Sbjct: 14  PHALGAPARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPP 73

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPP PP+    SPPPP   P   P PPPP
Sbjct: 74  PPPPQPPLPPSPSPPPPPPPPVPPPPPPPP 103

[11][TOP]
>UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q852P0_VOLCA
          Length = 606

 Score =  134 bits (336), Expect = 4e-30
 Identities = 56/85 (65%), Positives = 57/85 (67%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P P PPP P PPP P PPP PPPPP PPPPPPPP PP+PPP PPP PPP P PP  PPPP
Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP--PPPP 260

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
            P     SPPPP   P   P PPPP
Sbjct: 261 SP-----SPPPPPPSPSPPPPPPPP 280

 Score =  132 bits (331), Expect = 2e-29
 Identities = 55/86 (63%), Positives = 57/86 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP P PPPPPPPPPPP  PP PPP PPP+PPP P PP   P
Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSP 264

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPP 15
           PPPP     SPPPP   P   P+PPP
Sbjct: 265 PPPP--PSPSPPPPPPPPSPPPAPPP 288

 Score =  110 bits (275), Expect = 5e-23
 Identities = 46/70 (65%), Positives = 47/70 (67%)
 Frame = -2

Query: 221 EPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKK 42
           EP P PPPPPPPPP PPPP PP PPP+PPP PP  P PP  PPPPPP     SPPPP   
Sbjct: 202 EPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP--PPPPPSPPPPPPPPPPPSPPPPPPP 259

Query: 41  PYEYPSPPPP 12
           P   P PPPP
Sbjct: 260 PSPSPPPPPP 269

 Score =  109 bits (273), Expect = 8e-23
 Identities = 49/92 (53%), Positives = 54/92 (58%), Gaps = 11/92 (11%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP-PPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P PPP P PPP P PPP PPPPPP PPPPPPPP+P  PPP P P+PPP P PP  P
Sbjct: 225 PPPSPPPPPPPPPPPSPPPPP-PPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPP 283

Query: 95  PPPPP----------VYKYKSPPPPAKKPYEY 30
           P PPP           +  +  PP    PY +
Sbjct: 284 PAPPPFVPGFFDCELCFAAELTPPTDSAPYRF 315

[12][TOP]
>UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK6_CHLRE
          Length = 738

 Score =  134 bits (336), Expect = 4e-30
 Identities = 55/87 (63%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP+P PPP P PPP P PPPP PPPP PP P  PPP+PPP PPP P PP  P 
Sbjct: 328 PSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPR 387

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP     SPPPP+  P   PSPPPP
Sbjct: 388 PPPPSPPPPSPPPPSPPPPPPPSPPPP 414

 Score =  132 bits (332), Expect = 1e-29
 Identities = 56/87 (64%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PP  PPPPPP PPPPPPP+PP P P PP  PPP P PP  PP
Sbjct: 256 PPPSPPPPPPPSPPP-PPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 314

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP     SPPPP+  P   PSPPPP
Sbjct: 315 PPPPRPPPPSPPPPSPPPPPPPSPPPP 341

 Score =  132 bits (331), Expect = 2e-29
 Identities = 56/87 (64%), Positives = 60/87 (68%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP PP+PPP PPP+PPP P PP  PP
Sbjct: 228 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP-PPPPRPPP 286

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP     SPPPP+  P   PSPPPP
Sbjct: 287 PPPPSPPPPSPPPPSPPP---PSPPPP 310

 Score =  131 bits (329), Expect = 3e-29
 Identities = 55/89 (61%), Positives = 59/89 (66%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPPPPP PPPP P PP+PPP PPP+PPP P PP  PP
Sbjct: 290 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPP 349

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   P PPPP
Sbjct: 350 PRPPPPSPPPPSPPPPSPPPPSPPPPPPP 378

 Score =  130 bits (326), Expect = 6e-29
 Identities = 55/88 (62%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPN-PPPCPDPPLEP 96
           P P P PPP P+PPP   PPP+PPPP PPPP PPPP PP+PPP PPP  PPP P PP  P
Sbjct: 340 PPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPP 399

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP PP     SPPPP       PSPPPP
Sbjct: 400 PPSPPPPPPPSPPPPPPPRPPPPSPPPP 427

 Score =  129 bits (324), Expect = 1e-28
 Identities = 55/90 (61%), Positives = 59/90 (65%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPP---APPPTPPPNPPPCPDPPL 102
           P P   PPP+P PPP P PPP P PPPPPPP PPPP+PP    PPP+PPP  PP P PP 
Sbjct: 320 PPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPS 379

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPPPP     SPPPP+  P   P PPPP
Sbjct: 380 PPPPPPPRPPPPSPPPPSPPPPSPPPPPPP 409

 Score =  128 bits (322), Expect = 2e-28
 Identities = 55/89 (61%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPP-APPPPPPPPPPPPPPTPPAPPP-TPPPNPPPCPDPPLE 99
           P P P PPP+P PPP P PPP +PPPP PPPP PPPP+PP PPP +PPP PPP P PP  
Sbjct: 334 PPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSP 393

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP PP      PPPP+  P   P PPPP
Sbjct: 394 PPPSPPPPSPPPPPPPSPPPPPPPRPPPP 422

 Score =  128 bits (321), Expect = 2e-28
 Identities = 54/87 (62%), Positives = 56/87 (64%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP P PPP  PPPP PPPPPPP  PP PPP+PPP PPP P PP  P 
Sbjct: 233 PSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPS 291

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP     SPPPP+  P   P PPPP
Sbjct: 292 PPPPSPPPPSPPPPSPPPPSPPPPPPP 318

 Score =  128 bits (321), Expect = 2e-28
 Identities = 53/87 (60%), Positives = 56/87 (64%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P+PPP P P P PP PPPP PPPP P PP+PPP PPP PPP   PP  PP
Sbjct: 272 PPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPP 331

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP+  P   P PPPP
Sbjct: 332 PPPPP---SPPPPPSPPPPPPPRPPPP 355

 Score =  127 bits (319), Expect = 4e-28
 Identities = 55/89 (61%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP--PPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P  PP P PPP   PPP+PPPPPP  PPPPPPP  PP PPP PPP PPP P PP  
Sbjct: 238 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSP 297

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP PP     SPPPP+  P   P PPPP
Sbjct: 298 PPPSPPP---PSPPPPSPPPPPPPRPPPP 323

 Score =  127 bits (318), Expect = 5e-28
 Identities = 52/87 (59%), Positives = 55/87 (63%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 193 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 252

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP      PPPP+  P   PSPPPP
Sbjct: 253 PSPPPPSPPPPPPPSPPPPPPPSPPPP 279

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/87 (62%), Positives = 57/87 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P+PPP   PPP P PP  PPP PPPPPPP PP P  PPP+PPP PPP P PP  PP
Sbjct: 286 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPP 345

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP+  P   PSPPPP
Sbjct: 346 PPPP----PRPPPPSPPP---PSPPPP 365

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/87 (62%), Positives = 56/87 (64%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP P P P PP PPPP PPPPPP  P PPP+PPP PPP P PP  PP
Sbjct: 300 PSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPP 359

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP     SPPPP+  P   PSPPPP
Sbjct: 360 PSPPP---PSPPPPSPPPPPPPSPPPP 383

 Score =  127 bits (318), Expect = 5e-28
 Identities = 55/88 (62%), Positives = 58/88 (65%), Gaps = 3/88 (3%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPP---APPPTPPPNPPPCPDPPLEP 96
           P P+PPP   PPP P PP  PPPPPP PPPPPPP PP    PPP+PPP  PP P PP  P
Sbjct: 353 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPP 412

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPPP     SPPPP+  P   PSPPPP
Sbjct: 413 PPPPPRPPPPSPPPPSPPP---PSPPPP 437

 Score =  125 bits (315), Expect = 1e-27
 Identities = 53/87 (60%), Positives = 56/87 (64%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 188 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 247

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP     SPPPP+  P   PSPPPP
Sbjct: 248 PSPPP---PSPPPPSPPPPPPPSPPPP 271

 Score =  125 bits (315), Expect = 1e-27
 Identities = 53/88 (60%), Positives = 57/88 (64%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPA-PPPTPPPNPPPCPDPPLEP 96
           P P P+PPP P P P P PPP PPPPPPP PPPP P PP+ PPP+PPP  PP P PP  P
Sbjct: 262 PPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPP 321

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP PP      PPPP+  P   P PPPP
Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPSPPPPPP 349

 Score =  125 bits (313), Expect = 2e-27
 Identities = 52/87 (59%), Positives = 55/87 (63%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 203 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 262

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP+  P   P PPPP
Sbjct: 263 PPPP--SPPPPPPPSPPPPPPPRPPPP 287

 Score =  124 bits (312), Expect = 3e-27
 Identities = 55/91 (60%), Positives = 60/91 (65%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP---PPTPPPNPPPCPDPPL 102
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P   PP+PPP PPP P PP 
Sbjct: 213 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 272

Query: 101 EP-PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P PPPPP  +   PPPP+  P   PSPPPP
Sbjct: 273 PPSPPPPPPPRPPPPPPPSPPP---PSPPPP 300

 Score =  124 bits (312), Expect = 3e-27
 Identities = 54/89 (60%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPP-PPPPPPPPPPTPPAPPPTPPPN-PPPCPDPPLE 99
           P P P PP  P PPP   PPP+PPPP PPPPPPP PP PP+PPP PPP  PPP P PP  
Sbjct: 303 PPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSP 362

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP PP      PPPP+  P   P PPPP
Sbjct: 363 PPPSPPPPSPPPPPPPSPPPPPPPRPPPP 391

 Score =  124 bits (311), Expect = 3e-27
 Identities = 53/88 (60%), Positives = 55/88 (62%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP- 96
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  P 
Sbjct: 208 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 267

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPPP      PPPP   P   PSPPPP
Sbjct: 268 PPPPPPPSPPPPPPPRPPPPPPPSPPPP 295

 Score =  123 bits (308), Expect = 7e-27
 Identities = 53/87 (60%), Positives = 54/87 (62%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP   PPP P PPP P PPPPP PPPPPP  P PP  PPP+PPP   PP  PP
Sbjct: 314 PPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPP 373

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP     SPPPP       PSPPPP
Sbjct: 374 PPPP----PSPPPPPPPRPPPPSPPPP 396

 Score =  122 bits (307), Expect = 1e-26
 Identities = 54/89 (60%), Positives = 55/89 (61%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPP--PPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P PPP P PPP P PPP  PPPP  PPP PPPP  PP PPP PPP  PP P PP  
Sbjct: 274 PSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPP 333

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP PP      PPPP + P   PSPPPP
Sbjct: 334 PPPSPPPPPSPPPPPPPRPP--PPSPPPP 360

 Score =  118 bits (296), Expect = 2e-25
 Identities = 53/86 (61%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPP-PPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P   PPP+P PPP P PPP PPP PPPP PPPP P PP+PPP PPP+PPP P P   P
Sbjct: 362 PPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPP 421

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPP 18
           P PPP     SPPPP+  P   PSPP
Sbjct: 422 PSPPP----PSPPPPSPPP---PSPP 440

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 43/77 (55%), Positives = 46/77 (59%), Gaps = 5/77 (6%)
 Frame = -2

Query: 227 CPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPNPPPCPDPPLEPP---PPPPVYKYKS 63
           CP      P PPPP PPPP P PP+PPP   PPP+PPP   PP  PP   PPPP     S
Sbjct: 180 CPLSQANVPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 239

Query: 62  PPPPAKKPYEYPSPPPP 12
           PPPP+  P   PSPPPP
Sbjct: 240 PPPPSPPP---PSPPPP 253

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 32/53 (60%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
 Frame = -2

Query: 272 PFPLPTPP-PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPC 117
           P P P PP P P PPP P PPP P PPPP PPPP PP P  PPP+PP     C
Sbjct: 394 PPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPARCRVC 446

[13][TOP]
>UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK5_CHLRE
          Length = 853

 Score =  132 bits (332), Expect = 1e-29
 Identities = 54/87 (62%), Positives = 57/87 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P   PPP+P PPP P PPP PPP PPPPPPP PP P  PPP+PPP PPP P PP  PP
Sbjct: 263 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 322

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP      PPPP+  P   PSPPPP
Sbjct: 323 PSPPPPSPPPPPPPSPPPPPPPSPPPP 349

 Score =  132 bits (332), Expect = 1e-29
 Identities = 54/87 (62%), Positives = 57/87 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP+P PPP P PPP PPP PPPP PPPP  PP PPP+PPP  PP P PP   P
Sbjct: 271 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 330

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP+  P   PSPPPP
Sbjct: 331 PPPPPPSPPPPPPPSPPPPPPPSPPPP 357

 Score =  132 bits (331), Expect = 2e-29
 Identities = 58/88 (65%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPP-PPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P PPP P PPP P PPP  PPPPPPP PPPP P PP+PPP PPP+PPP P PP  P
Sbjct: 233 PPPSPPPPPPPSPPP-PSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPP-PPPPSPP 290

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPPP     SPPPP+  P   PSPPPP
Sbjct: 291 PPPPPSPPPPSPPPPSPPPPPPPSPPPP 318

 Score =  131 bits (330), Expect = 2e-29
 Identities = 58/93 (62%), Positives = 62/93 (66%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPP------PPPPPPPPPPPTPPAPPPTPPPNPPPCPD 111
           P P P PPP+P PPP P PPP PPP      PPPP PPPP P PP+PPP PPP+PPP P 
Sbjct: 328 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP-PP 386

Query: 110 PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP  PPPPPP     SPPPP+  P   PSPPPP
Sbjct: 387 PPSPPPPPPPSPPPPSPPPPSPPP---PSPPPP 416

 Score =  131 bits (330), Expect = 2e-29
 Identities = 55/86 (63%), Positives = 59/86 (68%), Gaps = 1/86 (1%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP-PLEPPP 90
           P P+PPP   PPP P PPP P PPPPPPP PPPP PP+PPP PPP+PPP P P P  P P
Sbjct: 414 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 473

Query: 89  PPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP     SPPPP+  P   PSPPPP
Sbjct: 474 PPPSPPPPSPPPPSPPPPPPPSPPPP 499

 Score =  131 bits (330), Expect = 2e-29
 Identities = 58/93 (62%), Positives = 62/93 (66%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPP------PPPPPPPPPPPTPPAPPPTPPPNPPPCPD 111
           P P P PPP+P PPP P PPP PPP      PPPP PPPP P PP+PPP PPP+PPP P 
Sbjct: 442 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP-PP 500

Query: 110 PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP  PPPPPP     SPPPP+  P   PSPPPP
Sbjct: 501 PPSPPPPPPPSPPPPSPPPPSPPP---PSPPPP 530

 Score =  131 bits (329), Expect = 3e-29
 Identities = 55/87 (63%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P   PPP+P PPP P PPP  PPPP PPPPPPP  PP PPP+PPP PPP P PP  PP
Sbjct: 245 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 304

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP     SPPPP+  P   PSPPPP
Sbjct: 305 PSPPPPPPPSPPPPSPPP---PSPPPP 328

 Score =  131 bits (329), Expect = 3e-29
 Identities = 55/87 (63%), Positives = 56/87 (64%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP  PPPPPPP PPPPP P  PPP PP  PPP P PP  PP
Sbjct: 251 PPPSPPPPPPPSPPP-PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 309

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP     SPPPP+  P   P PPPP
Sbjct: 310 PPPPSPPPPSPPPPSPPPPSPPPPPPP 336

 Score =  131 bits (329), Expect = 3e-29
 Identities = 55/88 (62%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP-PLEP 96
           P P P PPP P PPP   PPP+PPPP PPPP PPPP PP+PPP PPP+PPP P P P  P
Sbjct: 456 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 515

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP     SPPPP+  P   P PPPP
Sbjct: 516 SPPPPSPPPPSPPPPSPPPPSPPPPPPP 543

 Score =  130 bits (328), Expect = 3e-29
 Identities = 56/87 (64%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP  PPPP PPPPPPP  PP PPP+PPP PPP P PP  PP
Sbjct: 303 PPPSPPPPPPPSPPP-PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 361

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP     SPPPP+  P   PSPPPP
Sbjct: 362 PSPPP---PSPPPPSPPPPPPPSPPPP 385

 Score =  130 bits (328), Expect = 3e-29
 Identities = 55/89 (61%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP--PPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P  PP P PPP   PPP+PPPPPP  PPPPPPP  PP PPP+PPP PPP P PP  
Sbjct: 406 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 465

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PPPP     SPPPP+  P   P PPPP
Sbjct: 466 PSPPPPSPPPPSPPPPSPPPPSPPPPPPP 494

 Score =  130 bits (328), Expect = 3e-29
 Identities = 57/91 (62%), Positives = 60/91 (65%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP--PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P PPP+P PP  P P PPP  PPPP PPPPPPP  PP PPP+PPP PPP P PP  
Sbjct: 458 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 517

Query: 98  PP--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP  PPPP     SPPPP+  P   PSPPPP
Sbjct: 518 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 548

 Score =  130 bits (326), Expect = 6e-29
 Identities = 56/90 (62%), Positives = 61/90 (67%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPT--PPAPPPTPPPN-PPPCPDPPL 102
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+  PP+PPP PPP+ PPP P PP 
Sbjct: 195 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPS 254

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPPPP     SPPPP+  P   PSPPPP
Sbjct: 255 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 284

 Score =  130 bits (326), Expect = 6e-29
 Identities = 54/87 (62%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPPPPP PPPP P PP+PPP PPP+PPP P PP   P
Sbjct: 215 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPP-PSPPPPSP 273

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP+  P   PSPPPP
Sbjct: 274 PPPPPPSPPPPPPPSPPPPPPPSPPPP 300

 Score =  130 bits (326), Expect = 6e-29
 Identities = 57/89 (64%), Positives = 62/89 (69%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPP-APPPPPPPPPPPPPPTPPAPPP-TPPPNPPPCPDPPLE 99
           P P P PPP+P PPP P PPP +PPPP PPPP PPPP+PP PPP +PPP PPP P PP  
Sbjct: 336 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PPPP     SPPPP+  P   PSPPPP
Sbjct: 396 PSPPPPSPPPPSPPPPSPPP---PSPPPP 421

 Score =  130 bits (326), Expect = 6e-29
 Identities = 56/88 (63%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP-PLEP 96
           P P P PPP P PPP   PPP+PPPP PPPP PPPP PP+PPP PPP+PPP P P P  P
Sbjct: 342 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 401

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP     SPPPP+  P   PSPPPP
Sbjct: 402 SPPPPSPPPPSPPPPSPPP---PSPPPP 426

 Score =  130 bits (326), Expect = 6e-29
 Identities = 55/90 (61%), Positives = 58/90 (64%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPP---PPPPPTPPAPPPTPPPNPPPCPDPPL 102
           P P P PPP+P PPP P PPP PPP PPPPP   PPPPP P  PPP+PPP  PP P PP 
Sbjct: 426 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 485

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPPP      PPPP+  P   PSPPPP
Sbjct: 486 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 515

 Score =  130 bits (326), Expect = 6e-29
 Identities = 54/87 (62%), Positives = 56/87 (64%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP+P PPP P PPP PPP PPPPPPP PP P  PPP+PPP  PP P PP  PP
Sbjct: 434 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 493

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP     SPPPP       PSPPPP
Sbjct: 494 PSPPPPPPPSPPPPPPPSPPPPSPPPP 520

 Score =  130 bits (326), Expect = 6e-29
 Identities = 57/89 (64%), Positives = 62/89 (69%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPP-APPPPPPPPPPPPPPTPPAPPP-TPPPNPPPCPDPPLE 99
           P P P PPP+P PPP P PPP +PPPP PPPP PPPP+PP PPP +PPP PPP P PP  
Sbjct: 450 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PPPP     SPPPP+  P   PSPPPP
Sbjct: 510 PSPPPPSPPPPSPPPPSPPP---PSPPPP 535

 Score =  129 bits (325), Expect = 8e-29
 Identities = 58/98 (59%), Positives = 62/98 (63%), Gaps = 11/98 (11%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPP-----------PTPPAPPPTPPPNP 126
           P P P PPP+P PPP P PPP  PPPP PPPPPPP           P PP+PPP PPP+P
Sbjct: 279 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 338

Query: 125 PPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP P PP  PPPPPP     SPPPP+  P   PSPPPP
Sbjct: 339 PP-PPPPSPPPPPPPSPPPPSPPPPSPPP---PSPPPP 372

 Score =  129 bits (325), Expect = 8e-29
 Identities = 57/90 (63%), Positives = 61/90 (67%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPP---PPPPPPPPPPTPPAPPPTPPPNPPPCPDPPL 102
           P P P  PP P PPP   PPP+PPPP   PPPPP PPPP PP+PPP PPP+PPP P PP 
Sbjct: 401 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP-PPPPS 459

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPPPP     SPPPP+  P   PSPPPP
Sbjct: 460 PPPPPPPSPPPPSPPPPSPPP---PSPPPP 486

 Score =  129 bits (324), Expect = 1e-28
 Identities = 56/91 (61%), Positives = 59/91 (64%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP--PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P PPP+P PP  P P PPP  PPPP PPPPPPP  PP PPP+PPP PPP P PP  
Sbjct: 344 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 403

Query: 98  PP--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP  PPPP     SPPPP+  P   P PPPP
Sbjct: 404 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 434

 Score =  129 bits (323), Expect = 1e-28
 Identities = 56/94 (59%), Positives = 61/94 (64%), Gaps = 7/94 (7%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP------PCPEPPPAPPPPPPPPPPPPPPTPPAPPP-TPPPNPPPCP 114
           P P P PPP+P PP      P P PPP+PPPP PPPP PPPP+PP PPP +PPP PPP P
Sbjct: 287 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 346

Query: 113 DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP  P PPPP     SPPPP+  P   P PPPP
Sbjct: 347 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 380

 Score =  129 bits (323), Expect = 1e-28
 Identities = 55/87 (63%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP+P PPP P PPP PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 372 PSPPPPPPPSPPPPPPPSPPP-PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 430

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP+  P   PSPPPP
Sbjct: 431 PPPP--SPPPPPPPSPPPPPPPSPPPP 455

 Score =  129 bits (323), Expect = 1e-28
 Identities = 57/92 (61%), Positives = 62/92 (67%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPP-APPPPPPPPPPPPPPTPP---APPPTPPPNPPPCPDPP 105
           P P P PPP+P PPP P PPP +PPPP PPPP PPPP+PP    PPP+PPP PPP P PP
Sbjct: 380 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 439

Query: 104 LEP-PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             P PPPPP      PPPP+  P   PSPPPP
Sbjct: 440 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 471

 Score =  128 bits (322), Expect = 2e-28
 Identities = 54/90 (60%), Positives = 58/90 (64%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP---PPTPPPNPPPCPDPPL 102
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P   PP+PPP PPP P PP 
Sbjct: 190 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPS 249

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPP PP     SPPPP+  P   P PPPP
Sbjct: 250 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 279

 Score =  128 bits (322), Expect = 2e-28
 Identities = 55/87 (63%), Positives = 58/87 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP PP+PPP PPP+PPP P PP  PP
Sbjct: 396 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP-PPPPSPPP 454

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP     SPPPP       PSPPPP
Sbjct: 455 PPPP-----SPPPPPPPSPPPPSPPPP 476

 Score =  127 bits (320), Expect = 3e-28
 Identities = 55/88 (62%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPP-PPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P PP  P P P P PPP+PPPPPPP PPPPPPP+PP P P PP  PPP P PP  P
Sbjct: 316 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 375

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPPP      PPPP+  P   PSPPPP
Sbjct: 376 PPPPP--SPPPPPPPSPPPPPPPSPPPP 401

 Score =  127 bits (320), Expect = 3e-28
 Identities = 54/88 (61%), Positives = 57/88 (64%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPP-PPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P PP  P P P P PPP+PPPPPPP PPPPPPP+PP P P PP  PPP P PP  P
Sbjct: 360 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 419

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP PP      PPPP+  P   PSPPPP
Sbjct: 420 PPSPPPPSPPPPPPPSPPPPPPPSPPPP 447

 Score =  127 bits (320), Expect = 3e-28
 Identities = 54/88 (61%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP- 96
           P P P+PPP P P P P PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  P 
Sbjct: 376 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 435

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPPP      PPPP+  P   PSPPPP
Sbjct: 436 PPPPPPPSPPPPPPPSPPPPPPPSPPPP 463

 Score =  127 bits (319), Expect = 4e-28
 Identities = 54/89 (60%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP--PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P PPP+P PP  P P PPP  PPPPPPP PPPPP P  PPP PP  PPP P PP  
Sbjct: 305 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 364

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP PP      PPPP+  P   PSPPPP
Sbjct: 365 PPPSPPPPSPPPPPPPSPPPPPPPSPPPP 393

 Score =  127 bits (319), Expect = 4e-28
 Identities = 56/92 (60%), Positives = 60/92 (65%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPP--PPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P+PPP   PPP P PP  PPP PPPPPP  PPPP PP+PPP PPP+PPP   PP  
Sbjct: 348 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 407

Query: 98  PP---PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP   PPPP     SPPPP+  P   PSPPPP
Sbjct: 408 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 439

 Score =  127 bits (319), Expect = 4e-28
 Identities = 56/88 (63%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPP-PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P PP P P PPP P PPP P PPPPPPP PPPP+PP P P PP  PPP P PP  P
Sbjct: 479 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 538

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPPP     SPPPP+  P   PSPPPP
Sbjct: 539 PPPPP-----SPPPPSPPP---PSPPPP 558

 Score =  127 bits (318), Expect = 5e-28
 Identities = 53/85 (62%), Positives = 56/85 (65%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P P+PPP P P P P PPP+PPPPPPP PPPPPP  P PPP P P PPP P PP  PPP 
Sbjct: 424 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP-PPPSPPPPSPPPPS 482

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP      PPPP+  P   PSPPPP
Sbjct: 483 PPPPSPPPPPPPSPPPPPPPSPPPP 507

 Score =  126 bits (316), Expect = 9e-28
 Identities = 53/85 (62%), Positives = 56/85 (65%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P P+PPP P P P P PPP+PPPPPPP PPPP P PP+PPP  PP P P P PP  PPPP
Sbjct: 326 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 385

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP     SPPPP       PSPPPP
Sbjct: 386 PP----PSPPPPPPPSPPPPSPPPP 406

 Score =  125 bits (314), Expect = 1e-27
 Identities = 53/88 (60%), Positives = 57/88 (64%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPA-PPPTPPPNPPPCPDPPLEP 96
           P P P  PP P PPP   PPP+PPPP PPPP PPPP PP+ PPP+PPP  PP P PP  P
Sbjct: 205 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 264

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP PP      PPPP+  P   PSPPPP
Sbjct: 265 PPSPPPPSPPPPPPPSPPPPPPPSPPPP 292

 Score =  125 bits (313), Expect = 2e-27
 Identities = 54/88 (61%), Positives = 57/88 (64%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPP-PPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P+PPP P P P P PPP+PPPP PPPP PPPPP P  PPP+PPP  PP P PP  P
Sbjct: 275 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPP 334

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP PP     SPPPP       PSPPPP
Sbjct: 335 PPSPPPPPPPSPPPPPPPSPPPPSPPPP 362

 Score =  123 bits (308), Expect = 7e-27
 Identities = 52/85 (61%), Positives = 56/85 (65%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P+ TP   P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PPPP
Sbjct: 183 PISTPG-IPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 241

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP     SPPPP+  P   PSPPPP
Sbjct: 242 PPSPPPPSPPPPSPPPPPPPSPPPP 266

 Score =  122 bits (307), Expect = 1e-26
 Identities = 53/87 (60%), Positives = 54/87 (62%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP P PPP PPP PPPPPPP PP PP P P PP  PPP P PP  PP
Sbjct: 471 PSPPPPSPPPPSPPP-PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 529

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP      PPPP+  P   PSPPPP
Sbjct: 530 PSPPPPSPPPPPPPSPPP---PSPPPP 553

 Score =  106 bits (264), Expect = 9e-22
 Identities = 46/73 (63%), Positives = 51/73 (69%), Gaps = 3/73 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPP-APPPPPPPPPPPPPPTPP--APPPTPPPNPPPCPDPPL 102
           P P P PPP+P PPP P PPP +PPPP PPPP PPPP+PP  +PPP PPP+PPP   PP 
Sbjct: 494 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 553

Query: 101 EPPPPPPVYKYKS 63
            PPPP  V  Y S
Sbjct: 554 SPPPPCQVCVYIS 566

[14][TOP]
>UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata
           RepID=UPI000192638B
          Length = 557

 Score =  132 bits (331), Expect = 2e-29
 Identities = 57/88 (64%), Positives = 57/88 (64%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPK-PPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P PPP P  PPPCP  PP PPPPPPPPPPPPPP PP PPP PPP PPP P  P  P
Sbjct: 241 PAPPPCPPPPPPCPPPCP--PPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPP 298

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPPP      PPPP   P   P PPPP
Sbjct: 299 PPPPPCPPPPPPPPPPPPPCPPPPPPPP 326

 Score =  128 bits (322), Expect = 2e-28
 Identities = 56/87 (64%), Positives = 56/87 (64%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPPCP P P PPPP PPPPPPPPP PP PPP PPP PPPCP PP  PP
Sbjct: 268 PPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPP-PPPCPPPPPPPP 326

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP      PPP    P   P PPPP
Sbjct: 327 PCPPPCPPPCPPPCPPPP--PPCPPPP 351

 Score =  128 bits (321), Expect = 2e-28
 Identities = 57/97 (58%), Positives = 57/97 (58%), Gaps = 10/97 (10%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPP-----PTPPPNPPPCPDP 108
           P P P PPP P P P P PPP PPPPPPPPPPPPP  PP PP     P PPP PPPCP P
Sbjct: 248 PPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPP 307

Query: 107 PLEPPPPPPVYKYKSP-----PPPAKKPYEYPSPPPP 12
           P  PPPPPP      P     PPP   P   P PPPP
Sbjct: 308 PPPPPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPP 344

 Score =  128 bits (321), Expect = 2e-28
 Identities = 58/105 (55%), Positives = 59/105 (56%), Gaps = 17/105 (16%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPP-----------------PPPPPPTPPAPPP 144
           P P P PPP P PPPCP PPP  PPPPPPP                 PPPPPP PP PPP
Sbjct: 272 PPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPP 331

Query: 143 TPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            PPP PPPCP PP  P PPPP      PPPP   P   P PPPP+
Sbjct: 332 CPPPCPPPCPPPP-PPCPPPPCPPPPCPPPPPPCPPACPIPPPPM 375

 Score =  100 bits (248), Expect = 7e-20
 Identities = 43/72 (59%), Positives = 43/72 (59%), Gaps = 1/72 (1%)
 Frame = -2

Query: 227 CPEPPPAPPPPPPP-PPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPP 51
           CP   P  PP PPP PPPPPP  PP PPP PPP PPP P PP  PPPPPP      PPPP
Sbjct: 232 CPSAAPCHPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPP 291

Query: 50  AKKPYEYPSPPP 15
              P   P PPP
Sbjct: 292 PPCPPPPPPPPP 303

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 28/47 (59%), Positives = 28/47 (59%), Gaps = 3/47 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPP---PPPPPPPPPPPTPPAPPPT 141
           P P P PPP P PPP   PPP PPP   PPPPP PP  P PP P  T
Sbjct: 331 PCPPPCPPPCPPPPPPCPPPPCPPPPCPPPPPPCPPACPIPPPPMET 377

[15][TOP]
>UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E1896
          Length = 695

 Score =  132 bits (331), Expect = 2e-29
 Identities = 56/86 (65%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPP-PAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
           P P PPPAP PPP P PP PAPPP PPPPPPPPPP  P PPP PPP PPP P PP  PPP
Sbjct: 599 PGPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPP 658

Query: 89  PPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP      +PPPP   P   P+PPPP
Sbjct: 659 PPAPAPPPAPPPPPPPP---PAPPPP 681

 Score =  131 bits (330), Expect = 2e-29
 Identities = 58/87 (66%), Positives = 58/87 (66%), Gaps = 1/87 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP- 96
           P P P PPPAP PP  P PPPAPPPPPPPPPPP PP PPAPPP PPP PPP P PP  P 
Sbjct: 603 PPPAPAPPPAPAPP-APAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPA 661

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPP 15
           P PPP      PPPPA  P   P PPP
Sbjct: 662 PAPPPAPPPPPPPPPAPPPPPAPPPPP 688

 Score =  129 bits (323), Expect = 1e-28
 Identities = 58/89 (65%), Positives = 58/89 (65%), Gaps = 3/89 (3%)
 Frame = -2

Query: 272 PFPLPTP-PPAPKPPPCPEPPPAPPPPPPPPPP--PPPPTPPAPPPTPPPNPPPCPDPPL 102
           P P P P PPAP PPP P PPP PPPPP PPPP  PPPP PPAPPP P P PPP P PP 
Sbjct: 607 PAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPPP 666

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            PPPPPP      PPPPA  P   P PPP
Sbjct: 667 APPPPPPP-PPAPPPPPAPPPPPAPPPPP 694

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/87 (62%), Positives = 56/87 (64%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPPAPPPPPPP PPPPP  PP P P PPP PPP P PP  PP
Sbjct: 620 PPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPP 679

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP      +PPPP       P+PPPP
Sbjct: 680 PPP------APPPP-------PAPPPP 693

 Score =  102 bits (254), Expect = 1e-20
 Identities = 45/74 (60%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -2

Query: 233 PPCPEPPPAPPPPPPPPPPPPPPT-PPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPP 57
           P  P PPP P P PPP P PP P  PPAPPP PPP PPP P PP  PPPPPP      PP
Sbjct: 596 PQSPGPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPP---APPP 652

Query: 56  PPAKKPYEYPSPPP 15
           PPA  P   P+PPP
Sbjct: 653 PPAPPPPPAPAPPP 666

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 41/76 (53%), Positives = 43/76 (56%), Gaps = 5/76 (6%)
 Frame = -2

Query: 224 PEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPP-----CPDPPLEPPPPPPVYKYKSP 60
           P+ P  PPPP P PPP P P  PAPPP PPP PPP      P PP  PPPPPP       
Sbjct: 596 PQSPGPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPA 655

Query: 59  PPPAKKPYEYPSPPPP 12
           PPP   P   P+PPPP
Sbjct: 656 PPPPPAPAPPPAPPPP 671

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 32/50 (64%), Positives = 32/50 (64%), Gaps = 10/50 (20%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP----------PPPPPPPPTPPA 153
           P P P PPPAP PPP P PPPAPPPPPP          PPPPP PP PPA
Sbjct: 646 PPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPPPPPA 695

[16][TOP]
>UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2B5_EHV86
          Length = 2332

 Score =  131 bits (330), Expect = 2e-29
 Identities = 54/86 (62%), Positives = 59/86 (68%), Gaps = 1/86 (1%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPP-APPPTPPPNPPPCPDPPLEPPP 90
           P P PPP+P P P P PPP+PPPP PPPP PPPP PP APPP+PPP+PPP P P   P P
Sbjct: 721 PPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSP 780

Query: 89  PPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP     +PPPP   P   PSPPPP
Sbjct: 781 PPPTPPPPAPPPPTPPPSPPPSPPPP 806

 Score =  125 bits (313), Expect = 2e-27
 Identities = 55/88 (62%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPN-PPPCPDPPLEP 96
            P PLP PPP   PPP P PPP PPPP PPPP PPP  PP+PPP+PPP+ PPP P PP  P
Sbjct: 1093 PPPLPLPPPPSPPPPLP-PPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPP 1151

Query: 95   PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP PP     SPPPP   P   P+PPPP
Sbjct: 1152 PPAPPPSPPPSPPPPTPPP---PAPPPP 1176

 Score =  124 bits (312), Expect = 3e-27
 Identities = 57/91 (62%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPA-PPPTPPPNPPPCPDPPLEP 96
            P PLP PP  P P P P PPP+PPP PPP PPPP P PPA PPP PPP+PPP P PP  P
Sbjct: 841  PPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPP 900

Query: 95   P--PPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            P  PPPP     SPPPP   P   PSPPPP+
Sbjct: 901  PPAPPPPNPPPPSPPPPLPLP-PPPSPPPPL 930

 Score =  124 bits (312), Expect = 3e-27
 Identities = 57/91 (62%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPA-PPPTPPPNPPPCPDPPLEP 96
            P PLP PP  P P P P PPP+PPP PPP PPPP P PPA PPP PPP+PPP P PP  P
Sbjct: 1019 PPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPP 1078

Query: 95   P--PPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            P  PPPP     SPPPP   P   PSPPPP+
Sbjct: 1079 PPAPPPPNPPPPSPPPPLPLP-PPPSPPPPL 1108

 Score =  124 bits (311), Expect = 3e-27
 Identities = 56/90 (62%), Positives = 61/90 (67%), Gaps = 2/90 (2%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPP-PPPPPPPPPPPTPPAPPPTPPPN-PPPCPDPPLE 99
            P P P PPP+P P P P PPP+PPP PPPP PPPP P PP PPP+PPP+ PPP P PP  
Sbjct: 754  PAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAP 813

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            PPP PP     SPPPP   P   PSPPPP+
Sbjct: 814  PPPNPPP---PSPPPPLPLP-PPPSPPPPL 839

 Score =  124 bits (311), Expect = 3e-27
 Identities = 58/92 (63%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = -2

Query: 272  PFPLPTPP-PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPP-APPPTPPPNPPPCPDPPLE 99
            P PLP PP P P  PP P PPP PPPP PPPP PPPP+PP +PPP+PPP+PPP P PP  
Sbjct: 927  PPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTP 986

Query: 98   PP--PPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            PP  PPPP     SPPPP   P   PSPPPP+
Sbjct: 987  PPPAPPPPNPPPPSPPPPLPLP-PPPSPPPPL 1017

 Score =  124 bits (311), Expect = 3e-27
 Identities = 58/90 (64%), Positives = 63/90 (70%), Gaps = 2/90 (2%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPP-PTPPAPPPTPPPN-PPPCPDPPLE 99
            P PLP PPP+P P P P PPP+PPP PPPP PPPP P PPAPPP+PPP+ PPP P PP  
Sbjct: 1115 PPPLP-PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAP 1173

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            PPP PP     SPPPP   P   PSPPPP+
Sbjct: 1174 PPPNPPP---PSPPPPLPPP---PSPPPPL 1197

 Score =  124 bits (310), Expect = 4e-27
 Identities = 52/86 (60%), Positives = 57/86 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P+PPP P PPP P PP  PPP PPPP PPPP  PP+PPP+PPP+PPP P PP  PP
Sbjct: 690 PSPPPSPPP-PSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPP 748

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPP 15
           P PP       PPP+  P   PSPPP
Sbjct: 749 PAPPPPAPPPAPPPSPPPSPPPSPPP 774

 Score =  124 bits (310), Expect = 4e-27
 Identities = 52/88 (59%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKP-PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P+PPP+P P PP P PPP  PPPP PPP PPP  PP+PPP+PPP+PPP P PP  P
Sbjct: 727 PSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPP 786

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP PP       PPP+  P   P+PPPP
Sbjct: 787 PPAPPPPTPPPSPPPSPPP---PTPPPP 811

 Score =  124 bits (310), Expect = 4e-27
 Identities = 56/91 (61%), Positives = 62/91 (68%), Gaps = 5/91 (5%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPT-PPAPPPTPPP--NPPPCPDPPLEP 96
            P P+PPP+P P P P PPP+PPPP PPPP PPPP  PP+PPP+PPP   PPP P PP  P
Sbjct: 1120 PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPP 1179

Query: 95   P--PPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            P  PPPP+    SPPPP   P   P PPPPV
Sbjct: 1180 PPSPPPPLPPPPSPPPPLPPP---PLPPPPV 1207

 Score =  123 bits (309), Expect = 6e-27
 Identities = 54/89 (60%), Positives = 57/89 (64%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPP-PAPPPPPPPPPPPPPPTPPAP---PPTPPPNPPPCPDPPLE 99
            P P PPP   PPP P PP P PPPP PPPP PPPP PP P   PP+PPP+PPP P P   
Sbjct: 809  PPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPP 868

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P PPPP     +PPPPA  P   PSPPPP
Sbjct: 869  PSPPPPTPPPPAPPPPAPPPSPPPSPPPP 897

 Score =  123 bits (309), Expect = 6e-27
 Identities = 54/89 (60%), Positives = 57/89 (64%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPP-PAPPPPPPPPPPPPPPTPPAP---PPTPPPNPPPCPDPPLE 99
            P P PPP   PPP P PP P PPPP PPPP PPPP PP P   PP+PPP+PPP P P   
Sbjct: 987  PPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPP 1046

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P PPPP     +PPPPA  P   PSPPPP
Sbjct: 1047 PSPPPPTPPPPAPPPPAPPPSPPPSPPPP 1075

 Score =  123 bits (309), Expect = 6e-27
 Identities = 54/89 (60%), Positives = 57/89 (64%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPP-PAPPPPPPPPPPPPPPTPPAP---PPTPPPNPPPCPDPPLE 99
            P P PPP   PPP P PP P PPPP PPPP PPPP PP P   PP+PPP+PPP P P   
Sbjct: 1078 PPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPP 1137

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P PPPP     +PPPPA  P   PSPPPP
Sbjct: 1138 PSPPPPTPPPPAPPPPAPPPSPPPSPPPP 1166

 Score =  123 bits (309), Expect = 6e-27
 Identities = 52/88 (59%), Positives = 56/88 (63%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P  PP P PPP P PPP PPPP PPPP PPP  PP+PPP+PPP+PPP P PP  PP
Sbjct: 1201 PLPPPPVPPPPSPPPLP-PPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPPTPPP 1259

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            P PP      P PP   P   P PPPP+
Sbjct: 1260 PAPP-----PPTPPPSPPPPTPPPPPPL 1282

 Score =  123 bits (309), Expect = 6e-27
 Identities = 54/91 (59%), Positives = 59/91 (64%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPP-PPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
            P P P+PPP+P P P P PPP+PPPP P PPPP PPP  P PP  PPP+PPP P PPL P
Sbjct: 1579 PLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPP 1638

Query: 95   PPPPPVYKYKSP---PPPAKKPYEYPSPPPP 12
            PP PP     SP   PPP+  P   P PPPP
Sbjct: 1639 PPSPPPSPPPSPPPSPPPSPPPSPSPLPPPP 1669

 Score =  123 bits (308), Expect = 7e-27
 Identities = 52/91 (57%), Positives = 56/91 (61%), Gaps = 7/91 (7%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPA-------PPPTPPPNPPPCPDP 108
           P P+PPP   PPP P PPP+PPPP PPP PPPP  PP        PPP PPP+PPP P P
Sbjct: 676 PSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPP 735

Query: 107 PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
              P PPPP     +PPPPA  P   PSPPP
Sbjct: 736 SPPPSPPPPTPPPPAPPPPAPPPAPPPSPPP 766

 Score =  122 bits (307), Expect = 1e-26
 Identities = 58/94 (61%), Positives = 62/94 (65%), Gaps = 7/94 (7%)
 Frame = -2

Query: 272  PFPLPTPP--PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP--- 108
            P PLP PP  P P PPP   PPP+PPP PPPP PPPP  PP+PPP+PPP+PPP P P   
Sbjct: 1604 PLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPS 1663

Query: 107  PLEPP--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PL PP  PPPP     SPP PA  P   PSPPPP
Sbjct: 1664 PLPPPPTPPPPSPPLPSPPLPAPPP---PSPPPP 1694

 Score =  122 bits (306), Expect = 1e-26
 Identities = 54/90 (60%), Positives = 58/90 (64%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPP-PPPPTPPAPPPTPPP--NPPPCPDPPL 102
            P P P+PPP+P P P P PPP  PPPP PPPP PPPP+PP P P PPP   PPP P PPL
Sbjct: 963  PSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPL 1022

Query: 101  EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPP PP       PPP+  P   PSPPPP
Sbjct: 1023 PPPPLPPPPSPPPSPPPSPPPSPPPSPPPP 1052

 Score =  122 bits (305), Expect = 2e-26
 Identities = 54/89 (60%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP--NPPPCPDPPLE 99
            P P P P P P PPP   PPPAPPPP PPPP PPPP P  PPP+PPP   PPP P PPL 
Sbjct: 791  PPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLP 850

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPP PP       PPP+  P   PSPPPP
Sbjct: 851  PPPSPP-----PSPPPSPPPSPPPSPPPP 874

 Score =  122 bits (305), Expect = 2e-26
 Identities = 54/89 (60%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP--NPPPCPDPPLE 99
            P P P P P P PPP   PPPAPPPP PPPP PPPP P  PPP+PPP   PPP P PPL 
Sbjct: 1060 PPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLP 1119

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPP PP       PPP+  P   PSPPPP
Sbjct: 1120 PPPSPP-----PSPPPSPPPSPPPSPPPP 1143

 Score =  122 bits (305), Expect = 2e-26
 Identities = 53/92 (57%), Positives = 56/92 (60%), Gaps = 6/92 (6%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P P P P PPP   PPPAPPPP PPPP PPPP PP P P PP  PPP P PP+ PP
Sbjct: 1151 PPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPP 1210

Query: 92   ------PPPPVYKYKSPPPPAKKPYEYPSPPP 15
                  PPPP+     PPPP+  P   PSPPP
Sbjct: 1211 PSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 1242

 Score =  122 bits (305), Expect = 2e-26
 Identities = 53/87 (60%), Positives = 57/87 (65%), Gaps = 1/87 (1%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPP-PPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
            P P+PPP   PPP P PPP+PPPP PPP PPPP P PP PPP  PP+P P P PP  PPP
Sbjct: 1532 PSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPP 1591

Query: 89   PPPVYKYKSPPPPAKKPYEYPSPPPPV 9
             PP     SPPPP   P   PSPPPP+
Sbjct: 1592 SPPPSPPPSPPPPLPLP-PPPSPPPPL 1617

 Score =  121 bits (304), Expect = 2e-26
 Identities = 55/93 (59%), Positives = 60/93 (64%), Gaps = 7/93 (7%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPP------APPPTPPPNPPPCPDPP 105
            P P+PPP+P P P P PPP+PPPP PPPP PPPP PP       PPPTPPP  PP P+PP
Sbjct: 851  PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPP 910

Query: 104  LEPPPPP-PVYKYKSPPPPAKKPYEYPSPPPPV 9
               PPPP P+    SPPPP   P   P PPPPV
Sbjct: 911  PPSPPPPLPLPPPPSPPPPLPPP---PLPPPPV 940

 Score =  121 bits (304), Expect = 2e-26
 Identities = 53/93 (56%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPP-PCPEPPPAPPPPPPPP-----PPPPPPTPPAPPPTPPPNPPPCPD 111
            P P P+PPP P PP P P PPP PPPP PPP     P PPPP+PP PPP PPP+P P P 
Sbjct: 2127 PTPPPSPPPLPPPPTPPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPP 2186

Query: 110  PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP+ PPP PP +    PPP +  P   P PPPP
Sbjct: 2187 PPIPPPPSPPPH----PPPQSPLPPSPPPPPPP 2215

 Score =  121 bits (303), Expect = 3e-26
 Identities = 53/90 (58%), Positives = 59/90 (65%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPT-PPAPPPTPPP--NPPPCPDPPL 102
           P P P+PPP   PPP P PP  PP PPP PPP PPP+ PP+PPP+PPP   PPP P PP 
Sbjct: 735 PSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPT 794

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP PPP     +PPPPA  P   P+PPPP
Sbjct: 795 PPPSPPPSPPPPTPPPPAPPP---PNPPPP 821

 Score =  121 bits (303), Expect = 3e-26
 Identities = 54/88 (61%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPN-PPPCPDPPLEP 96
            P PLP PPP   PPP P PP  PPP PPPP PPP P PP+PPP+PPP+ PPP P PP  P
Sbjct: 824  PPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSP-PPSPPPSPPPSPPPPTPPPPAPP 882

Query: 95   PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP PP     SPPPP   P   P+PPPP
Sbjct: 883  PPAPPPSPPPSPPPPTPPP---PAPPPP 907

 Score =  121 bits (303), Expect = 3e-26
 Identities = 54/88 (61%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPN-PPPCPDPPLEP 96
            P PLP PPP   PPP P PP  PPP PPPP PPP P PP+PPP+PPP+ PPP P PP  P
Sbjct: 1002 PPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSP-PPSPPPSPPPSPPPPTPPPPAPP 1060

Query: 95   PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP PP     SPPPP   P   P+PPPP
Sbjct: 1061 PPAPPPSPPPSPPPPTPPP---PAPPPP 1085

 Score =  120 bits (302), Expect = 4e-26
 Identities = 54/94 (57%), Positives = 58/94 (61%), Gaps = 8/94 (8%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP--NPPPCPDPPLE 99
            P P P P P P PPP   PPPAPPPP PPPP PPPP P  PPP+PPP   PPP P PP+ 
Sbjct: 882  PPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVP 941

Query: 98   PP------PPPPVYKYKSPPPPAKKPYEYPSPPP 15
            PP      PPPP+     PPPP+  P   PSPPP
Sbjct: 942  PPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 975

 Score =  120 bits (301), Expect = 5e-26
 Identities = 54/90 (60%), Positives = 56/90 (62%), Gaps = 5/90 (5%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPP---PPPPPPPPPPPTPPAPPP--TPPPNPPPCPDPPL 102
            P PTPPP   PPP P PP  PPP   PPPP PPPP P PP PPP   PPP+PPP P PPL
Sbjct: 895  PPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPL 954

Query: 101  EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPP PP       PPP+  P   PSPPPP
Sbjct: 955  PPPPLPPPPSPPPSPPPSPPPSPPPSPPPP 984

 Score =  120 bits (301), Expect = 5e-26
 Identities = 54/91 (59%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPP--APPPTPPPNPPPCPDPPLE 99
            P P P+PPP+P P P P PPP  PPPP PPPP PPP+PP   PPPTPPP  PP P+PP  
Sbjct: 1031 PSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP 1090

Query: 98   PPPPP-PVYKYKSPPPPAKKPYEYPSPPPPV 9
             PPPP P+    SPPPP   P   P PPPP+
Sbjct: 1091 SPPPPLPLPPPPSPPPPLPPP---PLPPPPL 1118

 Score =  120 bits (301), Expect = 5e-26
 Identities = 53/89 (59%), Positives = 55/89 (61%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PP  P P P P PPP+PPPP PPPP PPPP PP P P PP  PPP P PPL PP
Sbjct: 1141 PPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPP 1200

Query: 92   --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PPPPV     PPPP+  P   P  PPP
Sbjct: 1201 PLPPPPV-----PPPPSPPPLPPPPLPPP 1224

 Score =  120 bits (301), Expect = 5e-26
 Identities = 56/95 (58%), Positives = 59/95 (62%), Gaps = 8/95 (8%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTP----PAPPPTPPPNPPPCPDPP 105
            P P P  PP P PPP   PPP+PPPP PPPP PPPP P    P PP  PPP+PPP P PP
Sbjct: 1161 PSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPP 1220

Query: 104  LEPPP-PPPVYKYKSP---PPPAKKPYEYPSPPPP 12
            L PPP PPP     SP   PPP+  P   PSPPPP
Sbjct: 1221 LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPP 1255

 Score =  120 bits (300), Expect = 6e-26
 Identities = 54/89 (60%), Positives = 60/89 (67%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPA--PPPTPPPNPPPC--PDPPLE 99
            P P+P P P PPP P PPP+PPPP PPPP PPPP PP+  PPP+PPP+PPP   P PP  
Sbjct: 1542 PPPSPSPPPSPPP-PSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPSPPPS 1600

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP P+    SPPPP   P   P PPPP
Sbjct: 1601 PPPPLPLPPPPSPPPPLPPP---PVPPPP 1626

 Score =  119 bits (299), Expect = 8e-26
 Identities = 56/93 (60%), Positives = 60/93 (64%), Gaps = 7/93 (7%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPNPP---PCPDP 108
            P P P+PPP   PPP P PPPAPPP PPP PPPP P PPAPPP   PPP+PP   P P P
Sbjct: 1043 PSPPPSPPPPTPPPPAP-PPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP 1101

Query: 107  PLEPP--PPPPVYKYKSPPPPAKKPYEYPSPPP 15
            P  PP  PPPP+     PPPP+  P   PSPPP
Sbjct: 1102 PSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 1134

 Score =  119 bits (299), Expect = 8e-26
 Identities = 51/88 (57%), Positives = 56/88 (63%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPP-PTPPAPPPTPPPNPPPCPDPPLEP 96
            P P P  PP P PPP   PPP+PPP PPPP PPPP P PP+PPP+PPP+PPP P P   P
Sbjct: 1191 PSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPP 1250

Query: 95   PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     +PPPP   P   P  PPP
Sbjct: 1251 SPPPPTPPPPAPPPPTPPPSPPPPTPPP 1278

 Score =  119 bits (298), Expect = 1e-25
 Identities = 55/91 (60%), Positives = 59/91 (64%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272  PFPLPTPP--PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP--NPPPCPDPP 105
            P PLP PP  P P PPP   PPP PPPP PPP PPP P PP+PPP+PPP   PPP P PP
Sbjct: 826  PLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSP-PPSPPPSPPPPTPPPPAPPPP 884

Query: 104  LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PP PPP     +PPPPA  P   P+PPPP
Sbjct: 885  APPPSPPPSPPPPTPPPPAPPP---PNPPPP 912

 Score =  119 bits (298), Expect = 1e-25
 Identities = 55/93 (59%), Positives = 59/93 (63%), Gaps = 7/93 (7%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPNPP---PCPDP 108
            P PLP PP  P P P P PPP+PPP PPP PPPP P PPAPPP   PPP+PP   P P P
Sbjct: 951  PPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP 1010

Query: 107  PLEPP--PPPPVYKYKSPPPPAKKPYEYPSPPP 15
            P  PP  PPPP+     PPPP+  P   PSPPP
Sbjct: 1011 PSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 1043

 Score =  119 bits (298), Expect = 1e-25
 Identities = 55/91 (60%), Positives = 59/91 (64%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272  PFPLPTPP--PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP--NPPPCPDPP 105
            P PLP PP  P P PPP   PPP PPPP PPP PPP P PP+PPP+PPP   PPP P PP
Sbjct: 1004 PLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSP-PPSPPPSPPPPTPPPPAPPPP 1062

Query: 104  LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PP PPP     +PPPPA  P   P+PPPP
Sbjct: 1063 APPPSPPPSPPPPTPPPPAPPP---PNPPPP 1090

 Score =  119 bits (298), Expect = 1e-25
 Identities = 55/91 (60%), Positives = 59/91 (64%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272  PFPLPTPP--PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP--NPPPCPDPP 105
            P PLP PP  P P PPP   PPP PPPP PPP PPP P PP+PPP+PPP   PPP P PP
Sbjct: 1095 PLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSP-PPSPPPSPPPPTPPPPAPPPP 1153

Query: 104  LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PP PPP     +PPPPA  P   P+PPPP
Sbjct: 1154 APPPSPPPSPPPPTPPPPAPPP---PNPPPP 1181

 Score =  119 bits (297), Expect = 1e-25
 Identities = 54/95 (56%), Positives = 60/95 (63%), Gaps = 7/95 (7%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPP------PPPPPPPPPPTPPAPPPTPPPNPPPCPD 111
            P P P+PPP+P P P P PPP+PPPP      PPPP PPP P P  PPPTPPP  PP P+
Sbjct: 758  PAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPN 817

Query: 110  PPLEPPPPP-PVYKYKSPPPPAKKPYEYPSPPPPV 9
            PP   PPPP P+    SPPPP   P   P PPPP+
Sbjct: 818  PPPPSPPPPLPLPPPPSPPPPLPPP---PLPPPPL 849

 Score =  119 bits (297), Expect = 1e-25
 Identities = 58/91 (63%), Positives = 61/91 (67%), Gaps = 5/91 (5%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPN-PPPCPDPPL 102
            P P P+PPP+P PPP P PPPAPPPP PPP PPP P PP PPP   PPPN PPP P PPL
Sbjct: 1130 PSPPPSPPPSP-PPPTP-PPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPL 1187

Query: 101  EPP--PPPPVYKYKSPPPPAKKPYEYPSPPP 15
             PP  PPPP+     PPPP   P   PSPPP
Sbjct: 1188 PPPPSPPPPLPPPPLPPPPVPPP---PSPPP 1215

 Score =  118 bits (296), Expect = 2e-25
 Identities = 54/89 (60%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPNPPPCPDPPLE 99
            P PLP PPP   PPP P PP  PPP PPPP PPP P PP PPP   PPP+PPP P PP  
Sbjct: 915  PPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSP-PPSP 973

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP PPP     +PPPPA  P   P+PPPP
Sbjct: 974  PPSPPPSPPPPTPPPPAPPP---PNPPPP 999

 Score =  118 bits (296), Expect = 2e-25
 Identities = 53/95 (55%), Positives = 57/95 (60%), Gaps = 8/95 (8%)
 Frame = -2

Query: 272  PFPLPTPP-------PAPKPPPCPEPPPAPPPPPPPPPPPPP-PTPPAPPPTPPPNPPPC 117
            P PLP PP       P P PPP   PPP+PPP PPPP PPPP P PP+PPP+PPP+PPP 
Sbjct: 917  PLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPS 976

Query: 116  PDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P P   PP PPP       PPP   P   P PPPP
Sbjct: 977  PPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPP 1011

 Score =  118 bits (295), Expect = 2e-25
 Identities = 55/93 (59%), Positives = 59/93 (63%), Gaps = 7/93 (7%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPNPP---PCPDP 108
            P P P+PPP   PPP P PPP PPP PPP PPPP P PPAPPP   PPP+PP   P P P
Sbjct: 774  PSPPPSPPPPTPPPPAP-PPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP 832

Query: 107  PLEPP--PPPPVYKYKSPPPPAKKPYEYPSPPP 15
            P  PP  PPPP+     PPPP+  P   PSPPP
Sbjct: 833  PSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 865

 Score =  117 bits (293), Expect = 4e-25
 Identities = 54/98 (55%), Positives = 60/98 (61%), Gaps = 12/98 (12%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPP--PAPPPPPPPPPPPPPPTPPAPPPTPPP----NPPPCPD 111
            P P P+PPP   PPP P PP  P+P PPP PPP PPP  PP+PPP+PPP     PPP P 
Sbjct: 1555 PSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPP 1614

Query: 110  PPLEPPP------PPPVYKYKSPPPPAKKPYEYPSPPP 15
            PPL PPP      PPP+     PPPP+  P   PSPPP
Sbjct: 1615 PPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPP 1652

 Score =  117 bits (292), Expect = 5e-25
 Identities = 55/94 (58%), Positives = 59/94 (62%), Gaps = 7/94 (7%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPNPP---PCPDP 108
            P P P+PPP   PPP P PPPAPPP PPP PPPP P PPAPPP   PPP+PP   P P P
Sbjct: 865  PSPPPSPPPPTPPPPAP-PPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP 923

Query: 107  PLEPP--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P  PP  PPPP+     PPPP+  P   P  PPP
Sbjct: 924  PSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPP 957

 Score =  116 bits (291), Expect = 7e-25
 Identities = 54/90 (60%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPA--PPPTPPPNPPPCPDPPLE 99
            P P P  PP P PPP   PPP PPPP PPP PPPP  PP   PPP+PPP+PPP P PP  
Sbjct: 1186 PLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSP-PPSP 1244

Query: 98   PPPPPPVYKYKSPPPPA-KKPYEYPSPPPP 12
            PP PPP     +PPPPA   P   PSPPPP
Sbjct: 1245 PPSPPPSPPPPTPPPPAPPPPTPPPSPPPP 1274

 Score =  116 bits (290), Expect = 9e-25
 Identities = 50/88 (56%), Positives = 55/88 (62%), Gaps = 2/88 (2%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPP--PPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P+PPP+P P P P PPP+PPPP  PPP PPPP P P  PP  PPP PPP   PP  PP
Sbjct: 1029 PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPP 1088

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            PP P      PPPP+  P   P PPPP+
Sbjct: 1089 PPSPPPPLPLPPPPSPPP---PLPPPPL 1113

 Score =  115 bits (288), Expect = 2e-24
 Identities = 50/85 (58%), Positives = 51/85 (60%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
            P P PPP   PPP P PP  PPP PPPP PPP P PP PPP  PP P P P PP  PPP 
Sbjct: 1184 PPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPS 1243

Query: 86   PPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP     SPPPP   P   P+PPPP
Sbjct: 1244 PPPSPPPSPPPPTPPP---PAPPPP 1265

 Score =  115 bits (288), Expect = 2e-24
 Identities = 52/92 (56%), Positives = 56/92 (60%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPA---PPPPPPPP--PPPPPPTPPAPPPTPPPNPPPCPDP 108
            P P P+PPP+P P P P PPP    PPPP PPP  PPPP P PP+PPP PPP  PP P P
Sbjct: 1583 PSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSP 1642

Query: 107  PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P  PPP PP     SPPP        P+PPPP
Sbjct: 1643 PPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPP 1674

 Score =  115 bits (287), Expect = 2e-24
 Identities = 52/89 (58%), Positives = 57/89 (64%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266 PLPTPPPAPKPP--PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP--NPPPCPDPPLE 99
           P P+PPP+P PP  P P PPP  PPPP PPP PPP  PP+PPP+PPP   PPP P PP  
Sbjct: 697 PPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAP 756

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP PPP       PPP+  P   PSPPPP
Sbjct: 757 PPAPPP--SPPPSPPPSPPPSPPPSPPPP 783

 Score =  115 bits (287), Expect = 2e-24
 Identities = 53/93 (56%), Positives = 55/93 (59%), Gaps = 8/93 (8%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCP-EPPPAPPPPPPPPPPPPPPTPP-------APPPTPPPNPPPCPD 111
            P P PPP   PPP P  PPP+PPPP PPPP PPPP PP        PPP PPP  PP P 
Sbjct: 905  PPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPS 964

Query: 110  PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP  PPP PP     SPPPP   P   P+PPPP
Sbjct: 965  PPPSPPPSPPPSPPPSPPPPTPPP---PAPPPP 994

 Score =  115 bits (287), Expect = 2e-24
 Identities = 51/88 (57%), Positives = 54/88 (61%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP   PPP P PP  PP PPP PPP PPP+PP P P PP  PPP P PP  PP
Sbjct: 944  PSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPP-SPP 1002

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            PP P+    SPPPP   P   P PPPP+
Sbjct: 1003 PPLPLPPPPSPPPPLPPP---PLPPPPL 1027

 Score =  115 bits (287), Expect = 2e-24
 Identities = 53/94 (56%), Positives = 57/94 (60%), Gaps = 7/94 (7%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPNPPPCPDPPLE 99
            P P   PP    PPP P PPP PPPP PPPP PPPP+PP+PPP   PPP+PPP P P   
Sbjct: 1697 PSPSSMPPSQSPPPPLP-PPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPP 1755

Query: 98   PPPPPPVYKYKSPPPPAKK-----PYEYPSPPPP 12
            PP PPP     SPPPP+       P   PSPPPP
Sbjct: 1756 PPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPP 1789

 Score =  115 bits (287), Expect = 2e-24
 Identities = 49/86 (56%), Positives = 52/86 (60%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
            P P+PP  P PPP P PPP PPPP PPP PPP P PP PPP+PPP PPP   PP  PP P
Sbjct: 2105 PPPSPPLPPSPPPLP-PPPVPPPPTPPPSPPPLPPPPTPPPSPPPLPPPPTPPPQSPPLP 2163

Query: 86   PPVYKYKSPPPPAKKPYEYPSPPPPV 9
             P       PPP   P   P PPPP+
Sbjct: 2164 SPPPPSPPTPPPLPPPSPSPLPPPPI 2189

 Score =  114 bits (284), Expect = 4e-24
 Identities = 55/118 (46%), Positives = 60/118 (50%), Gaps = 31/118 (26%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPP-------PPTPPAPPPTPPP------ 132
            P P P+PPP+P P P P PPP+P P PPPP PPP       PP P  PPP+PPP      
Sbjct: 1640 PSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSP 1699

Query: 131  ------------------NPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
                               PPP P PPL PPP PP     SPPPP+  P   PSPPPP
Sbjct: 1700 SSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPP 1757

 Score =  113 bits (282), Expect = 8e-24
 Identities = 55/95 (57%), Positives = 59/95 (62%), Gaps = 9/95 (9%)
 Frame = -2

Query: 266  PLPTPPPAPKPP--PCPEPPPAPPPPPPPPPPPPPPTPPA---PPPTPPPNPPPCPDPPL 102
            P P+PPP P PP  P P PPP+PPP PPP PPP PP  P+   PPPTPPP  PP P PPL
Sbjct: 1624 PPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPL 1683

Query: 101  EPPPPPPVYKYKSPPPP-AKKPYEYP---SPPPPV 9
              PPPP      SPPPP A  P   P   SPPPP+
Sbjct: 1684 PAPPPP------SPPPPNAPSPSSMPPSQSPPPPL 1712

 Score =  113 bits (282), Expect = 8e-24
 Identities = 52/91 (57%), Positives = 55/91 (60%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEP---PPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPL 102
            P P P PPP+P PP  P P   PP+  PPPP PPPP PP P  PPP PPP  PP P PP 
Sbjct: 1682 PLPAP-PPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPS 1740

Query: 101  EPPPPPPVYKYKSPPPPAKKPYEY-PSPPPP 12
             PPP PP     SPPPP+  P    PSPPPP
Sbjct: 1741 PPPPSPPPSPPPSPPPPSPPPPSLSPSPPPP 1771

 Score =  112 bits (279), Expect = 2e-23
 Identities = 52/91 (57%), Positives = 56/91 (61%), Gaps = 6/91 (6%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPN-PPPCPDPPLEPPP 90
            P P PPP   PPP P PP  PPP PP PPPP PP PP+PPP+PPP+ PPP P PP   P 
Sbjct: 1709 PPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPP-PPSPPPSPPPSPPPPSPPPPSLSPS 1767

Query: 89   PPPVYKYKSPPPPAKK-----PYEYPSPPPP 12
            PPP     SPPPP+       P   PSPPPP
Sbjct: 1768 PPPPSTSPSPPPPSASPSPPPPSASPSPPPP 1798

 Score =  111 bits (278), Expect = 2e-23
 Identities = 57/105 (54%), Positives = 61/105 (58%), Gaps = 18/105 (17%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPP--PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPD---- 111
            P P P+PPP P PP  P P PPP+PPP PPPP PPP P P  PPPTPPP  PP P     
Sbjct: 2110 PLP-PSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPPLPPPPTPPPQSPPLPSPPPP 2168

Query: 110  -----PPLEPP-----PPPPVYKYKSPP--PPAKKPYEYPSPPPP 12
                 PPL PP     PPPP+    SPP  PP + P   PSPPPP
Sbjct: 2169 SPPTPPPLPPPSPSPLPPPPIPPPPSPPPHPPPQSPLP-PSPPPP 2212

 Score =  110 bits (276), Expect = 4e-23
 Identities = 51/94 (54%), Positives = 55/94 (58%), Gaps = 7/94 (7%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPNPPPCPDPPLE 99
            P PLP PP  P P P P  PP+PPPP PPPP PPP  PP+PPP   PPP+  P P PP  
Sbjct: 1714 PPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPST 1773

Query: 98   PPPPPPVYKYKSPPPPAKKPYE-----YPSPPPP 12
             P PPP     SPPPP+  P        PSPPPP
Sbjct: 1774 SPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPP 1807

 Score =  110 bits (276), Expect = 4e-23
 Identities = 49/89 (55%), Positives = 53/89 (59%), Gaps = 5/89 (5%)
 Frame = -2

Query: 263  LPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP---PPTPPPNPPPCPDPPLEPP 93
            +  PPP   PP  P   P+PPPP PP PP PPP PP P   PPTPPP+PPP P PP  PP
Sbjct: 2085 MSVPPPPSPPPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPP 2144

Query: 92   PPPPVYKYKSPPPPAKKPYE--YPSPPPP 12
             PPP+     PPPP   P     PSPPPP
Sbjct: 2145 SPPPL-----PPPPTPPPQSPPLPSPPPP 2168

 Score =  109 bits (272), Expect = 1e-22
 Identities = 50/93 (53%), Positives = 53/93 (56%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPP-PPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
            P PLP PP  P PPP   PPP+PPP PPP PPPP PP P   P  PPP+  P P PP   
Sbjct: 1724 PPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSAS 1783

Query: 95   PPPPPVYKYKSPPPPA-----KKPYEYPSPPPP 12
            P PPP     SPPPP+       P   PSPPPP
Sbjct: 1784 PSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPP 1816

 Score =  109 bits (272), Expect = 1e-22
 Identities = 49/87 (56%), Positives = 51/87 (58%), Gaps = 2/87 (2%)
 Frame = -2

Query: 266  PLPTPPPAPKP-PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP-NPPPCPDPPLEPP 93
            P PTPPP+P P PP P PPP  PP P PPPP PP  PP PPP+P P  PPP P PP  PP
Sbjct: 2138 PPPTPPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPPP 2197

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPP       PPP   P   P PP P
Sbjct: 2198 HPPPQSPLPPSPPPPPPPPPLPPPPSP 2224

 Score =  108 bits (271), Expect = 1e-22
 Identities = 48/87 (55%), Positives = 52/87 (59%), Gaps = 1/87 (1%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPP-PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
            P P P+PPP P PP P P+ PP P PPPP PP PPP  PP+P P PPP  PP P PP  P
Sbjct: 2140 PTPPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPPPHP 2199

Query: 95   PPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            PP  P+     PPPP       PSPPP
Sbjct: 2200 PPQSPLPPSPPPPPPPPPLPPPPSPPP 2226

 Score =  107 bits (268), Expect = 3e-22
 Identities = 53/101 (52%), Positives = 55/101 (54%), Gaps = 14/101 (13%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPP---PPPPPPPTPPAPPP------TPPPNPPP 120
            P P P  PP P PPP P P P PP PPPP   P PPPP T P+PPP       PPP+  P
Sbjct: 1734 PSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASP 1793

Query: 119  CPDPP-LEPPPPPPVYKYKSPPPPAK----KPYEYPSPPPP 12
             P PP L P PPPP      PPPPA      P   PSPPPP
Sbjct: 1794 SPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPP 1834

 Score =  107 bits (267), Expect = 4e-22
 Identities = 47/81 (58%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPP--APPPTPPPNPPPCPDPPLE 99
            P P P PPP   PPP P PP  PP PPP PPP PPP+PP   PPPTPPP  PP P PP  
Sbjct: 1211 PSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPS 1270

Query: 98   PPPPPPVYKYKSPPPPAKKPY 36
            PPPP P      PPPP   P+
Sbjct: 1271 PPPPTP------PPPPPLAPF 1285

 Score =  101 bits (251), Expect = 3e-20
 Identities = 49/98 (50%), Positives = 54/98 (55%), Gaps = 11/98 (11%)
 Frame = -2

Query: 272 PFPLPTPPP---APKPPP---CPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPD 111
           P   P+PPP   +P PPP    P PPP    P PPP PPPP T P+PPP PPP+  P P 
Sbjct: 265 PSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPP 324

Query: 110 PPLEPPPPPPVYKYKSPPPPAKKPYE-----YPSPPPP 12
           PP   P PPP     SPPPP+  P        PSPPPP
Sbjct: 325 PPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPP 362

 Score =  100 bits (250), Expect = 4e-20
 Identities = 55/108 (50%), Positives = 59/108 (54%), Gaps = 21/108 (19%)
 Frame = -2

Query: 272 PFPLPTPPPA--PKPPP---CPEPPP-----APPPP-----PPPP-----PPPPPPTPPA 153
           P P P PPP+  P PPP    P PPP     +PPPP     PPPP     PPPP  +P  
Sbjct: 309 PSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSP 368

Query: 152 PPPTPPPN-PPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP TPPP+ PPP P PPL PPP PP      PPPP   P   P PPPP
Sbjct: 369 PPATPPPSPPPPSPPPPLPPPPSPPP---PLPPPPIPPPPSPPPPPPP 413

 Score =  100 bits (248), Expect = 7e-20
 Identities = 50/99 (50%), Positives = 54/99 (54%), Gaps = 15/99 (15%)
 Frame = -2

Query: 266  PLPTPP---PAPKPP---PCPEPPPAPPPPPPP---PPPPPPPTPPAPPP------TPPP 132
            P P PP   P+P PP   P P PP A P PPPP   P PPPP T P+PPP       PPP
Sbjct: 1766 PSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPP 1825

Query: 131  NPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            +  P P PP   P PPP     SPPPP+  P   PSPPP
Sbjct: 1826 SASPSPPPPSSSPSPPPPSSSPSPPPPSLSPSPPPSPPP 1864

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 45/75 (60%), Positives = 48/75 (64%), Gaps = 2/75 (2%)
 Frame = -2

Query: 230 PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP--NPPPCPDPPLEPPPPPPVYKYKSPP 57
           P P PPP  PPPP P PPP PP PP+PPP+PPP   PPP P PPL PPP PP       P
Sbjct: 676 PSPSPPPPSPPPPSPSPPPSPP-PPSPPPSPPPPSPPPPLPPPPLPPPPLPP-----PSP 729

Query: 56  PPAKKPYEYPSPPPP 12
           PP+  P   PSPPPP
Sbjct: 730 PPSPPPSPPPSPPPP 744

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 50/109 (45%), Positives = 55/109 (50%), Gaps = 22/109 (20%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPP--------PCPEPPPAPPPPPPP---PPPPPPPTPPAPPP------ 144
            P P P+PPP+P PP        P P PP   P PPPP   P PPPP   P+PPP      
Sbjct: 1744 PSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPS 1803

Query: 143  TPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKK-----PYEYPSPPPP 12
             PPP+  P P PP   P PPP     SPPPP+       P   PSPPPP
Sbjct: 1804 PPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPPPP 1852

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 48/84 (57%), Positives = 52/84 (61%), Gaps = 1/84 (1%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPP-CPDPPLEP 96
            P P P  PP P PPP P PP  PP PPP P P PPP P  PPP+PPP+PPP  P PP  P
Sbjct: 2153 PTPPPQSPPLPSPPP-PSPPTPPPLPPPSPSPLPPP-PIPPPPSPPPHPPPQSPLPPSPP 2210

Query: 95   PPPPPVYKYKSPPPPAKKPYEYPS 24
            PPPPP      PPPP+  P + PS
Sbjct: 2211 PPPPPP---PLPPPPSPPPSQPPS 2231

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 50/99 (50%), Positives = 58/99 (58%), Gaps = 16/99 (16%)
 Frame = -2

Query: 260 PTPPP---APKPPP---CPEPPPAPPPP---PPPPPPPPPPTPPAPPP------TPPPNP 126
           P+PPP   +P PPP    P PPP+PPPP   P PPP PPP   P+PPP       PPP+ 
Sbjct: 278 PSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSL 337

Query: 125 PPCPDPP-LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P P PP L P PPPP +   SPPPP+  P   P+ PPP
Sbjct: 338 SPSPPPPSLSPSPPPPSFS-PSPPPPSLSPSPPPATPPP 375

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 51/106 (48%), Positives = 57/106 (53%), Gaps = 19/106 (17%)
 Frame = -2

Query: 266 PLPTPP---PAPKPP---PCPEPPPAPPPPPPP---PPPPPPPTPPAPPPTPP-----PN 129
           P P PP   P+P PP   P P PP   P PPPP   P PPPP   P+PPP+PP     P+
Sbjct: 251 PSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPS 310

Query: 128 PPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYE-----YPSPPPPVY 6
           PPP P P   P PPPP     SPPPP+  P        PSPPPP +
Sbjct: 311 PPPRPPPSASPSPPPPSLS-PSPPPPSLSPSPPPPSLSPSPPPPSF 355

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 47/89 (52%), Positives = 51/89 (57%), Gaps = 12/89 (13%)
 Frame = -2

Query: 266 PLPTPP---PAPKPP---PCPEPP---PAPPPP---PPPPPPPPPPTPPAPPPTPPPNPP 123
           P P PP   P+P PP   P P PP   P+PPPP   P PPP  PPP+PP P P PP  PP
Sbjct: 330 PSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPSPPPPLPPP 389

Query: 122 PCPDPPLEPPPPPPVYKYKSPPPPAKKPY 36
           P P PPL PPP PP      PPPP   P+
Sbjct: 390 PSPPPPLPPPPIPPPPSPPPPPPPPLAPF 418

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 51/102 (50%), Positives = 57/102 (55%), Gaps = 14/102 (13%)
 Frame = -2

Query: 272 PFPLPTPPP---APKPPPCPEPPPAPPPPPPP---PPPPPPPTPPAPPP------TPPPN 129
           P P P+PPP   +P PPP P PP A P PPPP   P PPPP   P+PPP       PPP+
Sbjct: 296 PSPPPSPPPPSTSPSPPPRP-PPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPS 354

Query: 128 PPPCPDPPLEPPPPPPVYKYKSPPPPAKKP--YEYPSPPPPV 9
             P P PP   P PPP     SPPPP+  P     PSPPPP+
Sbjct: 355 FSPSPPPPSLSPSPPPATPPPSPPPPSPPPPLPPPPSPPPPL 396

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 47/100 (47%), Positives = 52/100 (52%), Gaps = 13/100 (13%)
 Frame = -2

Query: 272 PFP--LPTPP--------PAPKPP---PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP 132
           P+P  LP+PP        P+P PP   P P PP   P PPPP   P PP P   P  PPP
Sbjct: 206 PYPPSLPSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPP 265

Query: 131 NPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           +  P P PP   P PPP     SPPPP+  P   PSPPPP
Sbjct: 266 SVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPP 305

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 52/112 (46%), Positives = 59/112 (52%), Gaps = 29/112 (25%)
 Frame = -2

Query: 260 PTPPP---APKPPP---CPEPP-----PAPPPP-----PPPP-----PPPPPPTPPAPPP 144
           P+PPP   +P PPP    P PP     P+PPPP     PPPP     PPPP  +P  PPP
Sbjct: 233 PSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPP 292

Query: 143 TPPPNPPPCPDPPL---EPPPPPPVYKYKSPPPPAKKPYE-----YPSPPPP 12
           +  P+PPP P PP     PPP PP     SPPPP+  P        PSPPPP
Sbjct: 293 SLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPP 344

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/91 (49%), Positives = 50/91 (54%), Gaps = 6/91 (6%)
 Frame = -2

Query: 266  PLPTPP---PAPKPP---PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
            P P PP   P+P PP   P P PPPA P PPPP   P PP P + P  PPP+  P P PP
Sbjct: 1793 PSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPPPP 1852

Query: 104  LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
               P PPP     SPPPP+  P   P+PP P
Sbjct: 1853 SLSPSPPPSPPPSSPPPPS--PPTPPAPPRP 1881

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 48/103 (46%), Positives = 51/103 (49%), Gaps = 18/103 (17%)
 Frame = -2

Query: 266 PLPTPP---PAPKPP---PCPEPPPAPPPPPPP---PPPPPPPTPPAPPP------TPPP 132
           P P PP   P+P PP   P P PP   P PPPP   P PPPP   P+PPP       PPP
Sbjct: 224 PSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPP 283

Query: 131 NPPPCPDPPL---EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           +  P P PP     PPP PP       PPP   P   PSPPPP
Sbjct: 284 SLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPP 326

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/94 (46%), Positives = 50/94 (53%), Gaps = 17/94 (18%)
 Frame = -2

Query: 266  PLPTPPPA-PKPPP---CPEPP-----PAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCP 114
            P P PPPA P PPP    P PP     P+PPPP   P PPPP   P+PPP+PPP+ PP P
Sbjct: 1811 PSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPPPPSLSPSPPPSPPPSSPPPP 1870

Query: 113  DPPLEPPPPPP--------VYKYKSPPPPAKKPY 36
             PP  P PP P          +  S  PP + PY
Sbjct: 1871 SPPTPPAPPRPFLVSLDIIATQPSSSNPPERYPY 1904

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 46/96 (47%), Positives = 50/96 (52%), Gaps = 9/96 (9%)
 Frame = -2

Query: 272  PFPLPTPPP---APKPPP---CPEPPP---APPPPPPPPPPPPPPTPPAPPPTPPPNPPP 120
            P   P+PPP   +P PPP    P PPP   +P PPPPP  P PPP P A P  PPP+  P
Sbjct: 1780 PSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPP-PSASPSPPPPSSSP 1838

Query: 119  CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             P PP   P PPP     SP PP   P   P PP P
Sbjct: 1839 SPPPPSSSPSPPP--PSLSPSPPPSPPPSSPPPPSP 1872

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 37/61 (60%), Positives = 40/61 (65%), Gaps = 3/61 (4%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPP---PPPPPPTPPAPPPTPPPNPPPCPDPPL 102
            P PLP P P+P PPP   PPP+PPP PPP    PP PPP PP PP  PPP+PPP   P L
Sbjct: 2173 PPPLPPPSPSPLPPPPIPPPPSPPPHPPPQSPLPPSPPPPPPPPPLPPPPSPPPSQPPSL 2232

Query: 101  E 99
            E
Sbjct: 2233 E 2233

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 43/97 (44%), Positives = 48/97 (49%), Gaps = 11/97 (11%)
 Frame = -2

Query: 269 FPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP------TPPPNPPPCPDP 108
           F   T  P+P  PP    PP+ PPP   P PPPP   P+PPP       PPP+  P P P
Sbjct: 196 FAFATDIPSPPYPPSLPSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPP 255

Query: 107 PLEPPPPPPVYKYKSPPPPAKKPYE-----YPSPPPP 12
           P   P PPP     SPPPP+  P        PSPPPP
Sbjct: 256 PSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPP 292

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 35/60 (58%), Positives = 38/60 (63%), Gaps = 6/60 (10%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPP------PPPPPPPPPPTPPAPPPTPPPNPPPCPD 111
            P P P+PPP+P P P P PPP+PPPP      PPPP PPP P PP PPP PP  P  C D
Sbjct: 1230 PSPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPPTPPPPPPLAPFTCED 1289

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 34/57 (59%), Positives = 35/57 (61%), Gaps = 3/57 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPP-PPPPPPTPPAPPPTPPPNPPP--CPD 111
           P P P  PP   PPP P PP  PPP PPPP PPPP P PP+PPP PPP   P  C D
Sbjct: 366 PSPPPATPPPSPPPPSPPPPLPPPPSPPPPLPPPPIPPPPSPPPPPPPPLAPFTCED 422

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 29/57 (50%), Positives = 31/57 (54%), Gaps = 6/57 (10%)
 Frame = -2

Query: 272  PFPLPTPPP---APKPPPCPEPPPAPPP---PPPPPPPPPPPTPPAPPPTPPPNPPP 120
            P   P+PPP   +P PPP    P  PPP   P PPP PPP   PP  PPTPP  P P
Sbjct: 1825 PSASPSPPPPSSSPSPPPPSSSPSPPPPSLSPSPPPSPPPSSPPPPSPPTPPAPPRP 1881

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 2/51 (3%)
 Frame = -2

Query: 155 APPPTPPP--NPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
           AP P+PPP   PPP P PP  PPPP P     SPPPP+  P   P PPPP+
Sbjct: 675 APSPSPPPPSPPPPSPSPPPSPPPPSPP---PSPPPPSPPP---PLPPPPL 719

[17][TOP]
>UniRef100_B9SFQ6 Glycine-rich cell wall structural protein 1, putative n=1
           Tax=Ricinus communis RepID=B9SFQ6_RICCO
          Length = 313

 Score =  130 bits (328), Expect = 3e-29
 Identities = 69/94 (73%), Positives = 69/94 (73%), Gaps = 7/94 (7%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG------GGVGGGAGGVGGG 174
           GGGG G   G L GGGG      GGGGGG  GGSGHGGGFG      GGVGGGAGG GGG
Sbjct: 97  GGGGAG---GGLGGGGGA----GGGGGGGIGGGSGHGGGFGAGGGVGGGVGGGAGGGGGG 149

Query: 175 GGG-GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGGGGGGG GGGSGHGGGFGAGGGVG G G
Sbjct: 150 GGGGGGGGGGGGIGGGSGHGGGFGAGGGVGGGLG 183

 Score =  130 bits (328), Expect = 3e-29
 Identities = 65/92 (70%), Positives = 66/92 (71%), Gaps = 6/92 (6%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG------GGVGGGAGGVGGGG 177
           GGG G   G   GGGG      GGGGGG  GGSGHGGGFG      GG+GGG GG GGGG
Sbjct: 140 GGGAGGGGGGGGGGGG------GGGGGGIGGGSGHGGGFGAGGGVGGGLGGGPGGGGGGG 193

Query: 178 GGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGGGGG GGGSGHGGGFGAGGGVG G G
Sbjct: 194 GGGGGGGGGGIGGGSGHGGGFGAGGGVGGGIG 225

 Score =  128 bits (322), Expect = 2e-28
 Identities = 65/93 (69%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG------GGVGGGAGGVGGG 174
           GGGG G       GGGG      GGGGGG  GGSGHGGGFG      GG+GGGAGG GGG
Sbjct: 187 GGGGGG------GGGGG------GGGGGGIGGGSGHGGGFGAGGGVGGGIGGGAGG-GGG 233

Query: 175 GGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGGGGGG GGGSGHGGGFGAGGG+G G G
Sbjct: 234 GGGGGGGGGGGVGGGSGHGGGFGAGGGLGGGAG 266

 Score =  117 bits (294), Expect = 3e-25
 Identities = 59/88 (67%), Positives = 61/88 (69%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGG--GGGGGG 189
           GGG G   G   G GG L     GGGGG+ GG G GGG GGG+GGG G  GG  GGGG G
Sbjct: 58  GGGLGRGGGIGGGAGGGL-----GGGGGAGGGLGGGGGAGGGLGGGGGAGGGLGGGGGAG 112

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGG GGGSGHGGGFGAGGGVG G G
Sbjct: 113 GGGGGGIGGGSGHGGGFGAGGGVGGGVG 140

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 52/88 (59%), Positives = 56/88 (63%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGG--GDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GGG G+  GF AGGG  G +    GGG GG  GG G GGG GGGVGGG+G  GG G GGG
Sbjct: 205 GGGSGHGGGFGAGGGVGGGI----GGGAGGGGGGGGGGGGGGGGVGGGSGHGGGFGAGGG 260

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG G G G GH GG G G G+G G G
Sbjct: 261 LGGGAGGGLGGGHRGGGGIGVGIGIGIG 288

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 56/88 (63%), Positives = 57/88 (64%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGF--GGGVGGGAGGVGGGGGGGG 189
           GGG G   G  AGGGG      GGGGGG  GGSGHGGGF  GGG+GGGAGG  GGG  GG
Sbjct: 217 GGGVGGGIGGGAGGGGGGGGGGGGGGGGVGGGSGHGGGFGAGGGLGGGAGGGLGGGHRGG 276

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG G G G G G G G GAG G GSG G
Sbjct: 277 GGIGVGIGIGIGIGVGAGAGQGTGSGTG 304

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 37/59 (62%), Positives = 37/59 (62%)
 Frame = +1

Query: 97  GSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G   G G GGG G G  GG GG  GGG GGGGG GGG GGG G GGG G GGG G G G
Sbjct: 50  GGRFGRGRGGGLGRG--GGIGGGAGGGLGGGGGAGGGLGGGGGAGGGLGGGGGAGGGLG 106

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 46/87 (52%), Positives = 49/87 (56%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG +   +G GGG      G GGG GGG GGG GG   GGGG G 
Sbjct: 229 GGGGGGGGGG--GGGGGGVGGGSGHGGG-----FGAGGGLGGGAGGGLGGGHRGGGGIGV 281

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G G G G G G G G G G G GSG+G
Sbjct: 282 GIGIGIGIGVGAGAGQGTGSGTGSGSG 308

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 40/73 (54%), Positives = 41/73 (56%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGG G+  GF AGGG       GGG GG  GG GH GG G GVG G G   G G G G G
Sbjct: 246 GGGSGHGGGFGAGGG------LGGGAGGGLGG-GHRGGGGIGVGIGIGIGIGVGAGAGQG 298

Query: 196 GGGGAGGGSGHGG 234
            G G G GSG GG
Sbjct: 299 TGSGTGSGSGGGG 311

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 44/82 (53%), Positives = 48/82 (58%), Gaps = 1/82 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGG-GGGGG 189
           GGGG G   G  +G GG      G G GG  GG G GGG GGG  GG GG+G G G G G
Sbjct: 237 GGGGGGGGVGGGSGHGG------GFGAGGGLGG-GAGGGLGGGHRGG-GGIGVGIGIGIG 288

Query: 190 GGGGGGAGGGSGHGGGFGAGGG 255
            G G GAG G+G G G G+GGG
Sbjct: 289 IGVGAGAGQGTGSGTGSGSGGG 310

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 29/48 (60%), Positives = 31/48 (64%)
 Frame = +1

Query: 130 FGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           +G   GG  G   GGG G GGG GGGAGGG G GG  GAGGG+G G G
Sbjct: 45  WGRRCGGRFGRGRGGGLGRGGGIGGGAGGGLGGGG--GAGGGLGGGGG 90

[18][TOP]
>UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK2_CHLRE
          Length = 541

 Score =  130 bits (328), Expect = 3e-29
 Identities = 57/88 (64%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPP-PPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P PPP P PPP   PPP+PPPPPPP PPPPPPP+PP P P PP  PPP P PP  P
Sbjct: 179 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 238

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPPP     SPPPP+  P   PSPPPP
Sbjct: 239 PPPPP-----SPPPPSPPP---PSPPPP 258

 Score =  124 bits (311), Expect = 3e-27
 Identities = 52/83 (62%), Positives = 57/83 (68%), Gaps = 1/83 (1%)
 Frame = -2

Query: 257 TPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPN-PPPCPDPPLEPPPPPP 81
           +PPP P P P P PPP+PPPP PPPP PPPP PP+PPP PPP+ PPP P PP  PPP PP
Sbjct: 174 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 233

Query: 80  VYKYKSPPPPAKKPYEYPSPPPP 12
                 PPPP+  P   PSPPPP
Sbjct: 234 PPSPPPPPPPSPPP---PSPPPP 253

 Score =  105 bits (262), Expect = 2e-21
 Identities = 45/72 (62%), Positives = 47/72 (65%)
 Frame = -2

Query: 227 CPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPA 48
           CP    A PPPPPPP PPPPP P  PPP+PPP  PP P PP  PPPPPP     SPPPP+
Sbjct: 167 CPVTRGASPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 226

Query: 47  KKPYEYPSPPPP 12
             P   PSPPPP
Sbjct: 227 PPP---PSPPPP 235

 Score =  103 bits (256), Expect = 8e-21
 Identities = 47/79 (59%), Positives = 49/79 (62%), Gaps = 3/79 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPP---PPPPPPPTPPAPPPTPPPNPPPCPDPPL 102
           P P   PPP+P PPP P PPP PPP PPP   PPP PPP P  PPP+PPP PPP P PP 
Sbjct: 191 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPPPPSPPPPS 249

Query: 101 EPPPPPPVYKYKSPPPPAK 45
            PPP        SPPPP K
Sbjct: 250 PPPP--------SPPPPCK 260

[19][TOP]
>UniRef100_Q0WQG4 Putative uncharacterized protein At1g05135 (Fragment) n=1
           Tax=Arabidopsis thaliana RepID=Q0WQG4_ARATH
          Length = 153

 Score =  130 bits (327), Expect = 5e-29
 Identities = 63/88 (71%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGGAGGVGGGGGGGG 189
           GGG G+      GGGG      GGGGGG+NGGSGHG GFG  GGVGGG GG  GGGGGGG
Sbjct: 13  GGGGGFG-----GGGG------GGGGGGANGGSGHGSGFGAGGGVGGGVGGGAGGGGGGG 61

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGG GGGSGHGGGFGAGGG+G G G
Sbjct: 62  GGGGGGVGGGSGHGGGFGAGGGLGGGAG 89

 Score =  110 bits (276), Expect = 4e-23
 Identities = 58/88 (65%), Positives = 60/88 (68%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGF--GGGVGGGAGGVGGGGGGGG 189
           GGG G   G  AGGGG      GGGGGG  GGSGHGGGF  GGG+GGGAGG  GGGGG G
Sbjct: 43  GGGVGGGVGGGAGGGGGG---GGGGGGGVGGGSGHGGGFGAGGGLGGGAGGGLGGGGGAG 99

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGG G G G GGG G G G+G G G
Sbjct: 100 GGGGGGLGHGGGVGGGHGGGVGIGIGIG 127

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 53/90 (58%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GGGG G   G   G G       GGG GGG  GG+G GGG GGG GGG GG  G GGG G
Sbjct: 20  GGGGGGGGGGANGGSGHGSGFGAGGGVGGGVGGGAGGGGGGGGGGGGGVGGGSGHGGGFG 79

Query: 190 GGG--GGGAGGGSGHGGGFGAGGGVGSGNG 273
            GG  GGGAGGG G GGG G GGG G G+G
Sbjct: 80  AGGGLGGGAGGGLGGGGGAGGGGGGGLGHG 109

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 51/89 (57%), Positives = 54/89 (60%), Gaps = 5/89 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG- 192
           GGG G+  GF AGGG       GG GGG  GG G GGG GGG+G G GGVGGG GGG G 
Sbjct: 69  GGGSGHGGGFGAGGGLG-----GGAGGGLGGGGGAGGGGGGGLGHG-GGVGGGHGGGVGI 122

Query: 193 ----GGGGGAGGGSGHGGGFGAGGGVGSG 267
               G G G GGGSG G G G+G G G G
Sbjct: 123 GIGIGIGVGVGGGSGQGSGSGSGSGGGGG 151

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 37/60 (61%), Positives = 37/60 (61%)
 Frame = +1

Query: 94  GGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G    G G GGGFGGG GGG GG  G  GG G G G GAGGG G G G GAGGG G G G
Sbjct: 6   GRGRFGRGGGGGFGGGGGGGGGG--GANGGSGHGSGFGAGGGVGGGVGGGAGGGGGGGGG 63

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/73 (54%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG-GVGGGGGGGG 189
           GG G G   G  AGGGG   L  GGG GG     GHGGG G G+G G G GVGGG G G 
Sbjct: 86  GGAGGGLGGGGGAGGGGGGGLGHGGGVGG-----GHGGGVGIGIGIGIGVGVGGGSGQGS 140

Query: 190 GGGGGGAGGGSGH 228
           G G G  GGG  H
Sbjct: 141 GSGSGSGGGGGRH 153

[20][TOP]
>UniRef100_P09789 Glycine-rich cell wall structural protein 1 n=1 Tax=Petunia x
           hybrida RepID=GRP1_PETHY
          Length = 384

 Score =  130 bits (326), Expect = 6e-29
 Identities = 64/91 (70%), Positives = 64/91 (70%), Gaps = 6/91 (6%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG------GGVGGGAGGVGGG 174
           GG G G   G   GGGG       GGGGG  GGSGHGGGFG      GGVGGGA G GGG
Sbjct: 201 GGAGGGLGGGVGGGGGGG-----SGGGGGIGGGSGHGGGFGAGGGVGGGVGGGAAGGGGG 255

Query: 175 GGGGGGGGGGGAGGGSGHGGGFGAGGGVGSG 267
           GGGGGGGGGGG GGGSGHGGGFGAGGGVG G
Sbjct: 256 GGGGGGGGGGGLGGGSGHGGGFGAGGGVGGG 286

 Score =  127 bits (320), Expect = 3e-28
 Identities = 65/89 (73%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGGAGGVGGGGGGG 186
           GGG  G   G  AGGGG      GGGGGG  GGSGHGGGFG  GGVGGGA G  GGGGG 
Sbjct: 238 GGGVGGGVGGGAAGGGGGGGGGGGGGGGGLGGGSGHGGGFGAGGGVGGGAAGGVGGGGGF 297

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGG GGGSGHGGGFGAGGGVG G G
Sbjct: 298 GGGGGGGVGGGSGHGGGFGAGGGVGGGAG 326

 Score =  124 bits (312), Expect = 2e-27
 Identities = 63/93 (67%), Positives = 63/93 (67%), Gaps = 6/93 (6%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG------GGVGGGAGGVGGG 174
           GG G G   G   GGGG      GGGGGG  GGSGHGGGFG      GG GGG GG  GG
Sbjct: 157 GGVGGGAGAGGGVGGGGGF---GGGGGGGVGGGSGHGGGFGAGGGVGGGAGGGLGGGVGG 213

Query: 175 GGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGGGG GGGSGHGGGFGAGGGVG G G
Sbjct: 214 GGGGGSGGGGGIGGGSGHGGGFGAGGGVGGGVG 246

 Score =  119 bits (297), Expect = 1e-25
 Identities = 62/90 (68%), Positives = 63/90 (70%), Gaps = 4/90 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGGAGGVGGGGGGGG 189
           GGG G   G   GGGG       GGGGG  GG+G GGGFG  GGVGGGAG  GG GGGGG
Sbjct: 120 GGGLGGGGGLGGGGGGG-----AGGGGGVGGGAGSGGGFGAGGGVGGGAGAGGGVGGGGG 174

Query: 190 --GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
             GGGGGG GGGSGHGGGFGAGGGVG G G
Sbjct: 175 FGGGGGGGVGGGSGHGGGFGAGGGVGGGAG 204

 Score =  118 bits (295), Expect = 2e-25
 Identities = 61/93 (65%), Positives = 64/93 (68%), Gaps = 6/93 (6%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGG-VGGGGG--- 180
           GGG  G + G L GGGG       GGGGG  GG G GGGFGGG GGGAGG +GGGGG   
Sbjct: 72  GGGAGGGAGGGLGGGGGLGGGGGAGGGGGLGGGGGAGGGFGGGAGGGAGGGLGGGGGLGG 131

Query: 181 --GGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
             GGG GGGGG GGG+G GGGFGAGGGVG G G
Sbjct: 132 GGGGGAGGGGGVGGGAGSGGGFGAGGGVGGGAG 164

 Score =  108 bits (271), Expect = 1e-22
 Identities = 55/87 (63%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG  G + G + GGGG      GGGGGG  GGSGHGGGF  G GGG GG  GGG GGGG
Sbjct: 280 GGGVGGGAAGGVGGGGGF----GGGGGGGVGGGSGHGGGF--GAGGGVGGGAGGGLGGGG 333

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGG G G GHGGGFG G G+G G G
Sbjct: 334 GAGGGGGIGGGHGGGFGVGVGIGIGVG 360

 Score =  103 bits (256), Expect = 8e-21
 Identities = 54/89 (60%), Positives = 58/89 (65%), Gaps = 4/89 (4%)
 Frame = +1

Query: 19  GGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVG-GGAGGVGGGGGGG--- 186
           GG G S+G   G GG      GG GGG+ GG G GGG GGG G GG GG+GGGGG G   
Sbjct: 55  GGRGPSFGRGRGAGGGF---GGGAGGGAGGGLGGGGGLGGGGGAGGGGGLGGGGGAGGGF 111

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGGAGGG G GGG G GGG G+G G
Sbjct: 112 GGGAGGGAGGGLGGGGGLGGGGGGGAGGG 140

 Score =  101 bits (252), Expect = 2e-20
 Identities = 54/97 (55%), Positives = 58/97 (59%), Gaps = 11/97 (11%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGG--- 186
           G G G+  G   G GG L    GGGG G  GG+G GGG GGG GG  GG GGG GGG   
Sbjct: 66  GAGGGFGGGAGGGAGGGL---GGGGGLGGGGGAGGGGGLGGG-GGAGGGFGGGAGGGAGG 121

Query: 187 --------GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
                   GGGGGGGAGGG G GGG G+GGG G+G G
Sbjct: 122 GLGGGGGLGGGGGGGAGGGGGVGGGAGSGGGFGAGGG 158

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/96 (54%), Positives = 56/96 (58%), Gaps = 10/96 (10%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGG-------VGGG 174
           G  +G  +G    GGG      GG G     G G GGGFGGG GGGAGG       +GGG
Sbjct: 37  GNDNGCGFGRRGCGGGRF----GGRGPSFGRGRGAGGGFGGGAGGGAGGGLGGGGGLGGG 92

Query: 175 GGGGGG---GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGG   GGGGGAGGG G G G GAGGG+G G G
Sbjct: 93  GGAGGGGGLGGGGGAGGGFGGGAGGGAGGGLGGGGG 128

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 46/84 (54%), Positives = 50/84 (59%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGG G+  GF AGGG       GGG GG  GG G  GG GGG+GGG G  GG G G G G
Sbjct: 306 GGGSGHGGGFGAGGG------VGGGAGGGLGGGGGAGG-GGGIGGGHG--GGFGVGVGIG 356

Query: 196 GGGGAGGGSGHGGGFGAGGGVGSG 267
            G G G G+GHG G G+G G G G
Sbjct: 357 IGVGVGAGAGHGVGVGSGSGSGGG 380

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 49/87 (56%), Positives = 50/87 (57%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGG       GGG GG     G GGG GG  GGGAGG GG GGG GG
Sbjct: 299 GGGGGGVGGGSGHGGGFG----AGGGVGG-----GAGGGLGG--GGGAGGGGGIGGGHGG 347

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G G G G G G G G GAG GVG G+G
Sbjct: 348 GFGVGVGIGIGVGVGAGAGHGVGVGSG 374

[21][TOP]
>UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0K5_ARATH
          Length = 760

 Score =  129 bits (325), Expect = 8e-29
 Identities = 59/99 (59%), Positives = 61/99 (61%), Gaps = 10/99 (10%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP---PPPPPPPPTPP---APPPTPPPNPPP--- 120
           P  L +PPP   PPP   PPP PPPPPP   PPPPPPPP PP   +PPP PPP PPP   
Sbjct: 420 PPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPV 479

Query: 119 -CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
             P PP  PPPPPPVY    PPPP   P  Y  PPPPVY
Sbjct: 480 YSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVY 518

 Score =  124 bits (312), Expect = 3e-27
 Identities = 55/91 (60%), Positives = 56/91 (61%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPP----PPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
           P P P PPP   PPP P PPP PP    PPPPPPPPPPPP    PPP+PPP PPP   PP
Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPP 498

Query: 104 LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPPPP   Y  PPPP      Y SPPPP
Sbjct: 499 PPPPPPPPPPVYSPPPPPV-----YSSPPPP 524

 Score =  120 bits (301), Expect = 5e-26
 Identities = 53/89 (59%), Positives = 55/89 (61%), Gaps = 6/89 (6%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPP-----PPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P PPP P PPP   PPP PPPPPPPPP     PP PP PP P  +PPP PPP P PP+  
Sbjct: 452 PPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYS 511

Query: 95  PPPPPVYKYKSPPP-PAKKPYEYPSPPPP 12
           PPPPPVY    PPP PA  P     PPPP
Sbjct: 512 PPPPPVYSSPPPPPSPAPTPVYCTRPPPP 540

 Score =  114 bits (285), Expect = 3e-24
 Identities = 58/113 (51%), Positives = 61/113 (53%), Gaps = 26/113 (23%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPP----PPPPPPPPPPPTPPAPPPTPPPNPPPC---P 114
           P P P PPP   PPP P PPP PPP    PPP PPPPPPP    PPP PPP PPP    P
Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP 513

Query: 113 DPPL--EPPPPP-----PVYKYKSPP------------PPAKKPYEYPSPPPP 12
            PP+   PPPPP     PVY  + PP            PP  +PY Y SPPPP
Sbjct: 514 PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPP 566

 Score =  112 bits (279), Expect = 2e-23
 Identities = 56/120 (46%), Positives = 60/120 (50%), Gaps = 33/120 (27%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPP-----PPPPPPPTPPA-------------PPPT 141
           P P PPP P PP    PPP+PPPPPPP     PPPPPPP PP              PPP+
Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPS 526

Query: 140 ----------PPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYP-----SPPPPVY 6
                     PPP PP  P PP   PPPP  Y Y SPPPP   P  +      SPPPP+Y
Sbjct: 527 PAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIY 586

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/105 (55%), Positives = 60/105 (57%), Gaps = 24/105 (22%)
 Frame = -2

Query: 254 PPPAP-----KPPPCPEPPPAPPPPP--PPPP------PPPPPTP-PAPPPTP---PPNP 126
           PPP P      PPP   PPP  PPPP  PPPP      PPPPPTP  +PPPTP   PP P
Sbjct: 553 PPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPP 612

Query: 125 PPCPDPP-------LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPC +PP         PPPPPPV  Y SPPPP   P  Y SPPPP
Sbjct: 613 PPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPP---PVYYSSPPPP 654

 Score =  103 bits (257), Expect = 6e-21
 Identities = 62/143 (43%), Positives = 66/143 (46%), Gaps = 54/143 (37%)
 Frame = -2

Query: 272 PFPLPTPPPAP---KPPPCPEPPP----APPPPPPPPPPPP------------PPTPPAP 150
           P P P PPP P    PPP P PPP    +PPPPPPPPPPPP            PP PP+P
Sbjct: 468 PPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527

Query: 149 ---------PPTPPPNPPPCPD---------------------PPLEPPPP----PPVYK 72
                    PP PPP+ PP P                      PP  PPPP    PP+Y 
Sbjct: 528 APTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYP 587

Query: 71  YKSPPPPAKKPYEYPSPPP-PVY 6
           Y SPPPP   P    SPPP PVY
Sbjct: 588 YLSPPPP---PTPVSSPPPTPVY 607

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 49/93 (52%), Positives = 53/93 (56%), Gaps = 7/93 (7%)
 Frame = -2

Query: 269 FPLPTPPPAPKPPPCPEPPPAPPPPPPPP---PPPPPP----TPPAPPPTPPPNPPPCPD 111
           +P  +PPP P P   P P P   PPPPPP   PPPPPP    +PP PPP    + PP P 
Sbjct: 586 YPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPP 645

Query: 110 PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
                PPPPPVY Y SPPPP   P  Y SPPPP
Sbjct: 646 VYYSSPPPPPVY-YSSPPPP--PPVHYSSPPPP 675

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 56/116 (48%), Positives = 60/116 (51%), Gaps = 28/116 (24%)
 Frame = -2

Query: 272 PFPLPTPPPAP-----KPPPCPEPPPAPP-----PPPPPP------PPPPPPTPPAPPPT 141
           P P+ +PPP P      PPPC EPPP PP     PPPPPP      PPPPP    +PPP 
Sbjct: 595 PTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPP 654

Query: 140 P-----PPNPPP----CPDPP---LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
           P     PP PPP     P PP      PPP PV+ Y SPPPP   P E   PP PV
Sbjct: 655 PVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVH-YSSPPPPPSAPCEESPPPAPV 709

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 49/93 (52%), Positives = 53/93 (56%), Gaps = 15/93 (16%)
 Frame = -2

Query: 245 APKPPPC-PEPPPAPPPPPPPPP---------PPPPPTPPAP---PPTPPPNPPP--CPD 111
           +P+PP   P PPP+ P PPPP P          PPPP+PP P   PP PPP PPP   P 
Sbjct: 393 SPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPP 452

Query: 110 PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP  PPPPPPVY    PPPP   P    SPPPP
Sbjct: 453 PPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPP 485

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 52/120 (43%), Positives = 60/120 (50%), Gaps = 36/120 (30%)
 Frame = -2

Query: 260 PTPPP-----APKPPPC----PEPPP----APPPPPP----PPPPP------PPPTP--- 159
           P PPP     +P PPP     P PPP    +PPPPPP     PPPP      PPP+P   
Sbjct: 630 PPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHY 689

Query: 158 --PAPPPTPP--PNPPPCPDPPLEPPP------PPPVYKYKSPPPPAKKPYEYPSPPPPV 9
             P PPP+ P   +PPP P     PPP      PPP   ++SPPPP+    EY  P PPV
Sbjct: 690 SSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSP---EYEGPLPPV 746

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 36/73 (49%), Positives = 37/73 (50%)
 Frame = -2

Query: 224 PEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAK 45
           P PP   P PPP  P PPPP P    P    +PPP       P PPPPVY   SPPPP  
Sbjct: 394 PRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPP-------PSPPPPVY---SPPPP-- 441

Query: 44  KPYEYPSPPPPVY 6
                P PPPPVY
Sbjct: 442 -----PPPPPPVY 449

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/96 (38%), Positives = 43/96 (44%), Gaps = 7/96 (7%)
 Frame = -2

Query: 272 PFPLPTPPPAP----KPPPCP---EPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCP 114
           P    +PPP       PPP P     PP PP  P    PPP P     PP P  +  P P
Sbjct: 666 PVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSP-P 724

Query: 113 DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
            P +   PPPP  +Y+ P PP      Y SPPPP +
Sbjct: 725 PPVIHQSPPPPSPEYEGPLPPV-IGVSYASPPPPPF 759

[22][TOP]
>UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J4Y2_HUMAN
          Length = 253

 Score =  129 bits (325), Expect = 8e-29
 Identities = 57/92 (61%), Positives = 64/92 (69%), Gaps = 4/92 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP--PCPEPPPAPPPPPPPPPPPPPPTPPAP-PPTPPPNPPPC-PDPP 105
           P P P+PPP P PP  P P PPP+PPPPPP PPPPPPP+PP+P PP+PPP PPP  P PP
Sbjct: 1   PPPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPP 60

Query: 104 LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
              PPPPP      PPPP+  P   PSPPPP+
Sbjct: 61  PSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPL 92

 Score =  125 bits (315), Expect = 1e-27
 Identities = 57/97 (58%), Positives = 60/97 (61%), Gaps = 10/97 (10%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP------PCPEPPPAPPPPPPPPPPPPP--PTPPAPPPTPPPNPPPC 117
           P P P PPP P PP      P P PPP+PPPPPP  PPPPP  P PP PPP+PPP PPP 
Sbjct: 28  PPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPS 87

Query: 116 PDPPLEPPPPPPVYKYKSPPP--PAKKPYEYPSPPPP 12
           P PPL  PPPPP      PPP  P+  P   PSPPPP
Sbjct: 88  PPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPP 124

 Score =  122 bits (306), Expect = 1e-26
 Identities = 54/96 (56%), Positives = 56/96 (58%), Gaps = 9/96 (9%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPP---------PPPPTPPAPPPTPPPNPPP 120
           P P P PP +P PPP P PPP PP PPPPPPP         PPPP PP+PPP PP  PPP
Sbjct: 7   PPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPP 66

Query: 119 CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P  P  PPPPP       PPPP   P   PSPPPP
Sbjct: 67  PPSSPPPPPPPPS----PPPPPPPSPPPPLPSPPPP 98

 Score =  122 bits (306), Expect = 1e-26
 Identities = 57/97 (58%), Positives = 60/97 (61%), Gaps = 10/97 (10%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAP--PPPPPPPPPPPPPTPPAP------PPTPPPNPPPC 117
           P P P PPP+P PPP  +PPP P  PPPPPPPP PPPP PP+P      PP PPP P P 
Sbjct: 46  PSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPP 105

Query: 116 PDPPL--EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PPL   PPPPPP      PPPP   P   PSPPPP
Sbjct: 106 PPPPLPSSPPPPPP----SPPPPPLSPPPPPPSPPPP 138

 Score =  122 bits (306), Expect = 1e-26
 Identities = 57/95 (60%), Positives = 61/95 (64%), Gaps = 7/95 (7%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPP---PPPPPP----PPPPPPTPPAPPPTPPPNPPPCP 114
           P P P PPP+P PPP P PPP PP   PPPPPP    PPPPPP+PP PP +PPP PP  P
Sbjct: 78  PSPPPPPPPSP-PPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPP 136

Query: 113 DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            PPL  PPPPP      PPPP   P   PSPPPP+
Sbjct: 137 PPPLLSPPPPP--PSPPPPPPPSPPPPPPSPPPPL 169

 Score =  122 bits (306), Expect = 1e-26
 Identities = 54/95 (56%), Positives = 56/95 (58%), Gaps = 8/95 (8%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPP----PPPPPPTPPAPPPTPPPNPPPCPDPP 105
           P P   PPP P PPP P  PP PPP PPPP    PPPPPP+PP PPP  PP PPP P PP
Sbjct: 109 PLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPP 168

Query: 104 LEP----PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           L P    PPPPP   +  PP P   P   P PPPP
Sbjct: 169 LPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPP 203

 Score =  122 bits (306), Expect = 1e-26
 Identities = 54/89 (60%), Positives = 56/89 (62%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPP----PAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P PPP+P PPP P PP    P+PPPPPPP PPPPPP  P PPP P P  P  P PPL 
Sbjct: 166 PPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLP 225

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPPPP     SPPPP       PSPPPP
Sbjct: 226 PPPPPP----PSPPPPPPPSPPPPSPPPP 250

 Score =  121 bits (304), Expect = 2e-26
 Identities = 53/95 (55%), Positives = 57/95 (60%), Gaps = 9/95 (9%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPP---------PPPPPPPPPPPTPPAPPPTPPPNPPPCP 114
           P P PPP+P PPP P PPP PPP         PPPPPPP PPP PP+ PP PP +PPP P
Sbjct: 17  PPPPPPPSPPPPP-PSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPP 75

Query: 113 DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            PP  PPPPPP      P PP   P   P PPPP+
Sbjct: 76  PPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPL 110

 Score =  121 bits (304), Expect = 2e-26
 Identities = 54/92 (58%), Positives = 57/92 (61%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPP-----PCPDP 108
           P PLP  PP P PP  P PPP+ PPPPP  PPPPPP PP+PPP PPP+PP     P P P
Sbjct: 41  PSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPP-PPSPPPPPPPSPPPPLPSPPPPP 99

Query: 107 PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PL  PPPPP      PPPP   P    SPPPP
Sbjct: 100 PLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPP 131

 Score =  121 bits (303), Expect = 3e-26
 Identities = 56/98 (57%), Positives = 60/98 (61%), Gaps = 11/98 (11%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP---PPPPPPPPTPPAPPP---TPPPNPPPCPD 111
           P P P+ PP P PPP P PPP P PPPP   PPPPPP P+PP PPP   +PPP PP  P 
Sbjct: 64  PPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPP 123

Query: 110 PPLEPP-----PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPL PP     PPPP      PPPP+  P   PSPPPP
Sbjct: 124 PPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPP 161

 Score =  120 bits (300), Expect = 6e-26
 Identities = 55/96 (57%), Positives = 60/96 (62%), Gaps = 9/96 (9%)
 Frame = -2

Query: 272 PFPLPTPPPAPK-------PPPCPEPPP-APPPPPPPPPPPPPPTPPAPPPTPPPNPPPC 117
           P PLP+PPP P        PPP P PPP +PPPPPP PPPPP  +PP PPP+PPP PPP 
Sbjct: 98  PPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPS 157

Query: 116 PDPPLEPPPPPPVYKYKSPPPPAKKPYEY-PSPPPP 12
           P PP   PPPP       PPPP   P+   PSPPPP
Sbjct: 158 PPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPP 193

 Score =  119 bits (299), Expect = 8e-26
 Identities = 53/93 (56%), Positives = 57/93 (61%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPA-----PPPTPPPNPPPCPDP 108
           P   P PPP+P PPP   PPP PP PPPPPPP PPP PP+     PPP+P P PPP P  
Sbjct: 125 PLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPH 184

Query: 107 PLEP-PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PL P PPPPP      PPPP+  P   PSPP P
Sbjct: 185 PLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAP 217

 Score =  119 bits (298), Expect = 1e-25
 Identities = 57/99 (57%), Positives = 62/99 (62%), Gaps = 12/99 (12%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPC--PEPPPAPPPPP----PPPPP-PPPPTPPAPPPTPPPNPPPCP 114
           P   P PPP+P PPP   P PPP+PPPPP    PPPPP PPPP PP+PPP PP  PPP P
Sbjct: 111 PSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLP 170

Query: 113 DP-PLEPPPPPPVYKY----KSPPPPAKKPYEYPSPPPP 12
            P PL PPPP P +        PPPP+  P   PSPPPP
Sbjct: 171 PPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPP 209

 Score =  117 bits (294), Expect = 3e-25
 Identities = 53/89 (59%), Positives = 56/89 (62%), Gaps = 6/89 (6%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPP-----PPPPPTPPAP-PPTPPPNPPPCPDPPLE 99
           P PPP+P PPP P PPP PP PPPP P     PPPPP+PP P PP+PPP PPP P PP  
Sbjct: 144 PPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPP 203

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PPPP      P PPA  P   P PPPP
Sbjct: 204 PSPPPP----PLPSPPAPSPPSPPLPPPP 228

 Score =  117 bits (294), Expect = 3e-25
 Identities = 54/92 (58%), Positives = 57/92 (61%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPK-----PPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP 108
           P PLP PPP+P       PP P PP  PPPPPP PPPPP P+PPAP P  PP PPP P P
Sbjct: 172 PSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPP 231

Query: 107 PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P  PPPPPP     SPPPP+      P PPPP
Sbjct: 232 PSPPPPPPP-----SPPPPS------PPPPPP 252

 Score =  117 bits (293), Expect = 4e-25
 Identities = 53/92 (57%), Positives = 57/92 (61%), Gaps = 6/92 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAP--PPPPPPPPPPPPPTPPAPPPTPPP----NPPPCPD 111
           P PLP+PPP P  P  P PPP P  PPPPPP PPPPP +PP PPP+PPP    +PPP P 
Sbjct: 89  PPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPP 148

Query: 110 PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            P  PPPP P     SPPPP   P   P PPP
Sbjct: 149 SPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPP 180

 Score =  117 bits (292), Expect = 5e-25
 Identities = 52/93 (55%), Positives = 54/93 (58%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPP------PPPPPPTPPAPPPTPPPNPPPCPD 111
           P P P PPP   PPP P P P PPPPP PP      PPPPPP  P PPP P P PPP P 
Sbjct: 154 PPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPS 213

Query: 110 PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP   PP PP+     PPPP+  P   PSPPPP
Sbjct: 214 PPAPSPPSPPL-PPPPPPPPSPPPPPPPSPPPP 245

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 33/58 (56%), Positives = 35/58 (60%), Gaps = 10/58 (17%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP----------PAPPPPPPPPPPPPPPTPPAPPPTPPPN 129
           P P P PPP+P PPP P PP          P PPPPP PPPPPPP  PP  PP PPP+
Sbjct: 196 PSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPPPSPPPPPPS 253

[23][TOP]
>UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q948Y6_VOLCA
          Length = 1143

 Score =  129 bits (324), Expect = 1e-28
 Identities = 54/89 (60%), Positives = 58/89 (65%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P P PPP+P PPP P PPP+PPPPP PPPPP PP PP+PPP P P PPP P PP  PPPP
Sbjct: 523 PSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 582

Query: 86  PPVYKYKSPP----PPAKKPYEYPSPPPP 12
           P      SPP    PP  +P   PSP PP
Sbjct: 583 PSPRHPPSPPPRPRPPRPQPPSPPSPSPP 611

 Score =  123 bits (308), Expect = 7e-27
 Identities = 53/86 (61%), Positives = 56/86 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P    PP+P PPP P PPP+PPPPP PPPPP PP PP+PPP P P PPP P PP  PP
Sbjct: 515 PRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 574

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPP 15
           PPP      SPPPP   P   PSPPP
Sbjct: 575 PPP------SPPPP-PSPRHPPSPPP 593

 Score =  119 bits (297), Expect = 1e-25
 Identities = 50/87 (57%), Positives = 56/87 (64%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP+P PPP P PPP+PPPPP PPPPP PP PP+PPP P P PPP P  P  PP
Sbjct: 533 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPP 592

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P P   + + P PP+      PSPP P
Sbjct: 593 PRPRPPRPQPPSPPS------PSPPSP 613

 Score =  114 bits (284), Expect = 4e-24
 Identities = 54/91 (59%), Positives = 58/91 (63%), Gaps = 6/91 (6%)
 Frame = -2

Query: 266 PLPTPPPAP----KPPPCPEPP-PAPPPPPPPPPPPPPPTPPAPP-PTPPPNPPPCPDPP 105
           P   PPP+P      PP P PP P+PP PPPPP PPPPP+PP PP P PPP+PPP P PP
Sbjct: 497 PFVPPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 556

Query: 104 LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             P PPPP     SPPPP   P   PSPPPP
Sbjct: 557 PPPSPPPP----PSPPPPPSPP-PPPSPPPP 582

 Score =  106 bits (264), Expect = 9e-22
 Identities = 49/83 (59%), Positives = 54/83 (65%), Gaps = 6/83 (7%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPP-PPPPP-PPTPPAPPPTP----PPNPPPCPD 111
           P P P+PPP P PPP P PPP P PPPPP PPPPP PP PP+PPP P    PP+PPP P 
Sbjct: 537 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPR 596

Query: 110 PPLEPPPPPPVYKYKSPPPPAKK 42
           PP   PP PP     SP PP+ +
Sbjct: 597 PPRPQPPSPP-----SPSPPSPR 614

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 41/76 (53%), Positives = 42/76 (55%), Gaps = 7/76 (9%)
 Frame = -2

Query: 218 PPPAPPPPPP----PPPPPPPPTPPAPPPTPP---PNPPPCPDPPLEPPPPPPVYKYKSP 60
           PP  PPPP P    P PP P P  P+PP  PP   P PPP P PP  PPPPP      SP
Sbjct: 496 PPFVPPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 555

Query: 59  PPPAKKPYEYPSPPPP 12
           PPP   P   PSPPPP
Sbjct: 556 PPPPSPP-PPPSPPPP 570

[24][TOP]
>UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S9_EHV86
          Length = 621

 Score =  127 bits (320), Expect = 3e-28
 Identities = 55/90 (61%), Positives = 60/90 (66%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP PPP+PPP+PPP   PP  PP
Sbjct: 276 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPP 335

Query: 92  ---PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PPPP     SPPPP+  P   PSPPPP
Sbjct: 336 PPSPPPPSPPPPSPPPPSPPP---PSPPPP 362

 Score =  127 bits (320), Expect = 3e-28
 Identities = 55/90 (61%), Positives = 60/90 (66%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP PPP+PPP+PPP   PP  PP
Sbjct: 332 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPP 391

Query: 92  ---PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PPPP     SPPPP+  P   PSPPPP
Sbjct: 392 PPSPPPPSPPPPSPPPPSPPP---PSPPPP 418

 Score =  127 bits (320), Expect = 3e-28
 Identities = 53/85 (62%), Positives = 57/85 (67%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P P+PPP   PPP P PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PPPP
Sbjct: 360 PPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 419

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
            P     SPPPP+  P   PSPPPP
Sbjct: 420 SP--PPPSPPPPSPPPPSPPSPPPP 442

 Score =  127 bits (318), Expect = 5e-28
 Identities = 55/89 (61%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPPP PPPPPPPP+PP P P PP  PPP P PP  PP
Sbjct: 127 PSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 186

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   PSPPPP
Sbjct: 187 PSPPPPSPPPPSPPPPSPPP---PSPPPP 212

 Score =  126 bits (317), Expect = 7e-28
 Identities = 55/89 (61%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP P PPP PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 137 PSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 196

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   PSPPPP
Sbjct: 197 PSPPPPSPPPPSPPPPSPPP---PSPPPP 222

 Score =  126 bits (317), Expect = 7e-28
 Identities = 54/87 (62%), Positives = 57/87 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 202 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 261

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP     SPPPP+  P   PSPPPP
Sbjct: 262 PPPP----PSPPPPSPPP---PSPPPP 281

 Score =  125 bits (314), Expect = 1e-27
 Identities = 55/88 (62%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPN-PPPCPDPPLEP 96
           P P P+PPP   PPP P PPP+PPPP PPPP PPPP+PP P P PPP+ PPP P PP  P
Sbjct: 374 PSPPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPP 432

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP PP     SPPPP+  P   PSPPPP
Sbjct: 433 PPSPPSPPPPSPPPPSPPP---PSPPPP 457

 Score =  125 bits (314), Expect = 1e-27
 Identities = 54/88 (61%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPN-PPPCPDPPLEP 96
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP PP  PPP+ PPP P PP  P
Sbjct: 378 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPP 437

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP     SPPPP+  P   PSPPPP
Sbjct: 438 SPPPPSPPPPSPPPPSPPP---PSPPPP 462

 Score =  125 bits (313), Expect = 2e-27
 Identities = 56/91 (61%), Positives = 60/91 (65%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPE--PPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P PPP+P PPP P   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  
Sbjct: 145 PPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 204

Query: 98  PP--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP  PPPP     SPPPP+  P   PSPPPP
Sbjct: 205 PPPSPPPPSPPPPSPPPPSPPP---PSPPPP 232

 Score =  125 bits (313), Expect = 2e-27
 Identities = 53/89 (59%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 177 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 236

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   P PPPP
Sbjct: 237 PSPPPPSPPPPSPPPPSPPPPSPPPPPPP 265

 Score =  125 bits (313), Expect = 2e-27
 Identities = 55/90 (61%), Positives = 61/90 (67%), Gaps = 5/90 (5%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPNPPPCPDPPLEPP 93
           P P+PPP   PPP P PPP+PPPP PPPP PPPP+PP+PPP   PPP+PPP   PP  PP
Sbjct: 401 PPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPP 460

Query: 92  ---PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PPPP     SPPPP+  P   PSPPPP
Sbjct: 461 PPSPPPPSPPPPSPPPPSPPP---PSPPPP 487

 Score =  124 bits (312), Expect = 3e-27
 Identities = 56/95 (58%), Positives = 60/95 (63%), Gaps = 8/95 (8%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP------PPTPPPNPPPCPD 111
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P      PP PPP+PPP P 
Sbjct: 266 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPP 325

Query: 110 PPLEPP--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP  PP  PPPP     SPPPP+  P   PSPPPP
Sbjct: 326 PPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPP 357

 Score =  124 bits (312), Expect = 3e-27
 Identities = 56/95 (58%), Positives = 60/95 (63%), Gaps = 8/95 (8%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP------PPTPPPNPPPCPD 111
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P      PP PPP+PPP P 
Sbjct: 322 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPP 381

Query: 110 PPLEPP--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP  PP  PPPP     SPPPP+  P   PSPPPP
Sbjct: 382 PPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPP 413

 Score =  124 bits (310), Expect = 4e-27
 Identities = 54/89 (60%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 162 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 221

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   PSPPPP
Sbjct: 222 PSPPPPSPPPPSPPPPSPPP---PSPPPP 247

 Score =  124 bits (310), Expect = 4e-27
 Identities = 54/89 (60%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 167 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 226

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   PSPPPP
Sbjct: 227 PSPPPPSPPPPSPPPPSPPP---PSPPPP 252

 Score =  124 bits (310), Expect = 4e-27
 Identities = 54/89 (60%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 172 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 231

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   PSPPPP
Sbjct: 232 PSPPPPSPPPPSPPPPSPPP---PSPPPP 257

 Score =  124 bits (310), Expect = 4e-27
 Identities = 54/88 (61%), Positives = 57/88 (64%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 207 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPP 266

Query: 92  -PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP     SPPPP+  P   PSPPPP
Sbjct: 267 SPPPPSPPPPSPPPPSPPP---PSPPPP 291

 Score =  124 bits (310), Expect = 4e-27
 Identities = 53/85 (62%), Positives = 56/85 (65%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P P+PPP   PPP P PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PPP 
Sbjct: 304 PPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 363

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP     SPPPP   P   PSPPPP
Sbjct: 364 PPP---PSPPPPPPSP--PPSPPPP 383

 Score =  123 bits (309), Expect = 6e-27
 Identities = 56/88 (63%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP-PPTPPPNPPPCPDPPLEP 96
           P P P+PPP+P PPP P PPP+PPPP PPPP PPPP+PP P PP P P PPP P PP  P
Sbjct: 370 PPPPPSPPPSP-PPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPP 427

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP PP     SPPPP+  P   PSPPPP
Sbjct: 428 PPSPPPPSPPSPPPPSPPP---PSPPPP 452

 Score =  123 bits (309), Expect = 6e-27
 Identities = 54/89 (60%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PP  P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 427 PPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 486

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   PSPPPP
Sbjct: 487 PSPPPPSPPPPSPPPPSPPP---PSPPPP 512

 Score =  123 bits (309), Expect = 6e-27
 Identities = 54/89 (60%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 432 PPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 491

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   PSPPPP
Sbjct: 492 PSPPPPSPPPPSPPPPSPPP---PSPPPP 517

 Score =  123 bits (308), Expect = 7e-27
 Identities = 54/89 (60%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP  PPPPPPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 132 PSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 191

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   PSPPPP
Sbjct: 192 PSPPPPSPPPPSPPPPSPPP---PSPPPP 217

 Score =  123 bits (308), Expect = 7e-27
 Identities = 55/89 (61%), Positives = 59/89 (66%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P+PPP   PPP P PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 158 PPPPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 216

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   PSPPPP
Sbjct: 217 PSPPPPSPPPPSPPPPSPPP---PSPPPP 242

 Score =  123 bits (308), Expect = 7e-27
 Identities = 52/87 (59%), Positives = 54/87 (62%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 192 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 251

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP      PPPP   P   PSPPPP
Sbjct: 252 PSPPPPSPPPPPPPPSPP--PPSPPPP 276

 Score =  123 bits (308), Expect = 7e-27
 Identities = 55/89 (61%), Positives = 59/89 (66%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP PP  PPP+PPP P PP  PP
Sbjct: 212 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP-PPSPPPPSPPPPPPPPSPPP 270

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   PSPPPP
Sbjct: 271 PSPPPPSPPPPSPPPPSPPP---PSPPPP 296

 Score =  123 bits (308), Expect = 7e-27
 Identities = 55/89 (61%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PPP PPP P PP  PP
Sbjct: 217 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP-PPPSPPPPSPPP 275

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   PSPPPP
Sbjct: 276 PSPPPPSPPPPSPPPPSPPP---PSPPPP 301

 Score =  123 bits (308), Expect = 7e-27
 Identities = 55/89 (61%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP PPP P P PPP P PP  PP
Sbjct: 222 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSP-PPPSPPPPSPPP 280

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   PSPPPP
Sbjct: 281 PSPPPPSPPPPSPPPPSPPP---PSPPPP 306

 Score =  123 bits (308), Expect = 7e-27
 Identities = 55/89 (61%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP P PPP  PPPP PPPPPPPP+PP P P PP  PPP P PP  PP
Sbjct: 232 PSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 290

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   PSPPPP
Sbjct: 291 PSPPPPSPPPPSPPPPSPPP---PSPPPP 316

 Score =  123 bits (308), Expect = 7e-27
 Identities = 53/86 (61%), Positives = 57/86 (66%), Gaps = 3/86 (3%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPP---APPPTPPPNPPPCPDPPLEPPP 90
           P PPP P PPP   PPP+PPPP PPPP PPPP+PP    PPP+PPP  PP P PP  PP 
Sbjct: 260 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPS 319

Query: 89  PPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP     SPPPP+  P   PSPPPP
Sbjct: 320 PPPSPPPPSPPPPSPPP---PSPPPP 342

 Score =  122 bits (307), Expect = 1e-26
 Identities = 55/89 (61%), Positives = 59/89 (66%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266 PLPTPPPAPKP--PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P  TPPP+P P  PP   PPP+PPPP PPPP PPPP+PP PP  PPP PPP P PP  PP
Sbjct: 112 PPTTPPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPP 171

Query: 92  --PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP     SPPPP+  P   PSPPPP
Sbjct: 172 PSPPPPSPPPPSPPPPSPPP---PSPPPP 197

 Score =  122 bits (307), Expect = 1e-26
 Identities = 52/87 (59%), Positives = 53/87 (60%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP P PPP PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 242 PSPPPPSPPPPSPPP-PSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 300

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP      P PP   P   PSPPPP
Sbjct: 301 PSPPPPSPPPPSPPPPPPSPPPSPPPP 327

 Score =  122 bits (307), Expect = 1e-26
 Identities = 55/90 (61%), Positives = 59/90 (65%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPP---APPPTPPPNPPPCPDPPL 102
           P P   PPP P PPP P PPP+PPPP PPPP PPPP+PP    PPP+PPP  PP P PP 
Sbjct: 308 PPPPSPPPPPPSPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 366

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPPP     SPPPP+  P   PSPPPP
Sbjct: 367 PSPPPPPPSPPPSPPPPSPPP---PSPPPP 393

 Score =  122 bits (306), Expect = 1e-26
 Identities = 53/87 (60%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP-- 93
           P P+PPP   PPP P PP  PPP PPPPPP PPP+PP P P PP  PPP P PP  PP  
Sbjct: 289 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 348

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP     SPPPP+  P   PSPPPP
Sbjct: 349 PPPPSPPPPSPPPPSPPP---PSPPPP 372

 Score =  122 bits (306), Expect = 1e-26
 Identities = 56/90 (62%), Positives = 62/90 (68%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPP---APPPTPPPNPPPCPDPPL 102
           P P P+PPP+P PPP P PPP+PPPP PPPP PPPP+PP    PPP+PPP  PP P PP 
Sbjct: 314 PPPPPSPPPSP-PPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 371

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP PPP     SPPPP+  P   PSPPPP
Sbjct: 372 PPPSPPPSPPPPSPPPPSPPP---PSPPPP 398

 Score =  121 bits (304), Expect = 2e-26
 Identities = 55/92 (59%), Positives = 59/92 (64%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPNPPPCPDPPLE 99
           P P   PPP+P PPP P PPP PP PPPP PPPP P PP+PPP   PPP+PPP   PP  
Sbjct: 139 PPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 198

Query: 98  PP---PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP   PPPP     SPPPP+  P   PSPPPP
Sbjct: 199 PPPPSPPPPSPPPPSPPPPSPPP---PSPPPP 227

 Score =  121 bits (304), Expect = 2e-26
 Identities = 56/91 (61%), Positives = 60/91 (65%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP--NPPPCPDPPLE 99
           P P P  PP P PPP   PPP+PPPP PPPP PPPP PP+PPP+PPP   PPP P PP  
Sbjct: 281 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP-PPSPPPSPPPPSPPPPSPPPPSP 339

Query: 98  PP--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP  PPPP     SPPPP+  P   PSPPPP
Sbjct: 340 PPPSPPPPSPPPPSPPPPSPPP---PSPPPP 367

 Score =  121 bits (303), Expect = 3e-26
 Identities = 55/90 (61%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPP-PPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P PPP P  PP P PPP  PPPP PPPP PPPP+PP P P PP  PPP P PP  P
Sbjct: 151 PPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 210

Query: 95  P--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P  PPPP     SPPPP+  P   PSPPPP
Sbjct: 211 PPSPPPPSPPPPSPPPPSPPP---PSPPPP 237

 Score =  121 bits (303), Expect = 3e-26
 Identities = 53/87 (60%), Positives = 55/87 (63%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P  PP P PPP  PPPP PPPP PPP  P PP  PPP+PPP P PP   P
Sbjct: 255 PPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSP 313

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP     SPPPP+  P   PSPPPP
Sbjct: 314 PPPPPSPPPSPPPPSPPP---PSPPPP 337

 Score =  121 bits (303), Expect = 3e-26
 Identities = 53/87 (60%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP-- 93
           P P+PPP   PPP P PP  PPP PPPPPP PPP+PP P P PP  PPP P PP  PP  
Sbjct: 345 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 404

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP     SPPPP   P   PSPPPP
Sbjct: 405 PPPPSPPPPSPPPPPSPP--PPSPPPP 429

 Score =  121 bits (303), Expect = 3e-26
 Identities = 51/87 (58%), Positives = 54/87 (62%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 442 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 501

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP     SPPPP+  P   P  PPP
Sbjct: 502 PSPPP---PSPPPPSPPPPSPPPSPPP 525

 Score =  120 bits (302), Expect = 4e-26
 Identities = 51/85 (60%), Positives = 54/85 (63%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P P+PPP   PPP P PP  PPP PPPP PPPPP+PP P P PP  PPP P  P  P PP
Sbjct: 386 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPP 445

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP     SPPPP+  P   PSPPPP
Sbjct: 446 PPSPPPPSPPPPSPPP---PSPPPP 467

 Score =  120 bits (302), Expect = 4e-26
 Identities = 54/90 (60%), Positives = 58/90 (64%), Gaps = 5/90 (5%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPP---APPPTPPPNPPPCPDPPLEP 96
           P P+PPP   PPP P PP  PPP PPPPP PPPP+PP    PPP+PP  PPP P PP  P
Sbjct: 391 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPP 450

Query: 95  P--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P  PPPP     SPPPP+  P   PSPPPP
Sbjct: 451 PPSPPPPSPPPPSPPPPSPPP---PSPPPP 477

 Score =  120 bits (302), Expect = 4e-26
 Identities = 55/93 (59%), Positives = 57/93 (61%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPP----PPPPTPPAPPPTPPPNPPPCPDPP 105
           P P P  PP P PPP P PPP  PPPP PPPP    PPPP+PP P P PP  PPP P PP
Sbjct: 403 PSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPP 462

Query: 104 LEPP--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PP  PPPP     SPPPP+  P   PSPPPP
Sbjct: 463 SPPPPSPPPPSPPPPSPPPPSPPP---PSPPPP 492

 Score =  120 bits (302), Expect = 4e-26
 Identities = 54/90 (60%), Positives = 59/90 (65%), Gaps = 5/90 (5%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPNPPPCPDPPLEPP 93
           P P+PPP P PPP   PPP+PPPP PP PPPP P PP+PPP   PPP+PPP   PP  PP
Sbjct: 411 PPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 470

Query: 92  ---PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PPPP     SPPPP+  P   PSPPPP
Sbjct: 471 PPSPPPPSPPPPSPPPPSPPP---PSPPPP 497

 Score =  120 bits (300), Expect = 6e-26
 Identities = 51/86 (59%), Positives = 54/86 (62%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 447 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 506

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPP 15
           P PP     SPPPP+  P   PS PP
Sbjct: 507 PSPPP---PSPPPPSPPPSPPPSHPP 529

 Score =  119 bits (299), Expect = 8e-26
 Identities = 52/88 (59%), Positives = 56/88 (63%), Gaps = 3/88 (3%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPNPPPCPDPPLEPP 93
           P P+PPP   PPP P PPP PP PPPP PPPP P PP+PPP   PPP+PPP   PP  PP
Sbjct: 245 PPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 304

Query: 92  PPPPVYKYKSPPPPAKKPY-EYPSPPPP 12
           PP P      PPPP+  P    PSPPPP
Sbjct: 305 PPSPPPPSPPPPPPSPPPSPPPPSPPPP 332

 Score =  119 bits (299), Expect = 8e-26
 Identities = 55/90 (61%), Positives = 59/90 (65%), Gaps = 5/90 (5%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP-PPTPPP--NPPPCPDPPLEP 96
           P P+PPP   PPP P PP  PPPP PPPP PPPP+PP P PP+PPP   PPP P PP  P
Sbjct: 396 PPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPP 455

Query: 95  P--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P  PPPP     SPPPP+  P   PSPPPP
Sbjct: 456 PPSPPPPSPPPPSPPPPSPPP---PSPPPP 482

 Score =  119 bits (297), Expect = 1e-25
 Identities = 55/90 (61%), Positives = 58/90 (64%), Gaps = 5/90 (5%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPP-PPPPPPTPPAPPPTPPP--NPPPCPDPPLEP 96
           P P+PPP   PPP P PP  PPP PPPP PPPP P PP PPP+PPP   PPP P PP  P
Sbjct: 225 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPP 284

Query: 95  P--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P  PPPP     SPPPP+  P   PSPPPP
Sbjct: 285 PPSPPPPSPPPPSPPPPSPPP---PSPPPP 311

 Score =  118 bits (296), Expect = 2e-25
 Identities = 54/90 (60%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPP-PPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P   PPP+P PP  P PPP  PPPP PPPP PPPP+PP P P PP  PPP P PP  P
Sbjct: 421 PPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 480

Query: 95  P--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P  PPPP     SPPPP+  P   PSPPPP
Sbjct: 481 PPSPPPPSPPPPSPPPPSPPP---PSPPPP 507

 Score =  118 bits (295), Expect = 2e-25
 Identities = 53/87 (60%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPP--PPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P+PPP   PPP P PP  PPP PPP  PPPP PP P  PPP+PPP  PP P PP  PP
Sbjct: 205 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP--PP 262

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP     SPPPP+  P   PSPPPP
Sbjct: 263 PPPPSPPPPSPPPPSPPP---PSPPPP 286

 Score =  118 bits (295), Expect = 2e-25
 Identities = 49/85 (57%), Positives = 50/85 (58%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P P+PPP   PPP P PP  PPP PPPP PPPPP  P P P PP  PPP P PP  PPP 
Sbjct: 340 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPS 399

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP      P PP   P   PSPPPP
Sbjct: 400 PPPPSPPPPSPPPPSPPPPPSPPPP 424

 Score =  118 bits (295), Expect = 2e-25
 Identities = 55/92 (59%), Positives = 60/92 (65%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPNPPPCPDPPLE 99
           P P P+PPP   PPP P PPP+PP PPPP PPPP P PP+PPP   PPP+PPP   PP  
Sbjct: 415 PPPPPSPPPPSPPPPSP-PPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 473

Query: 98  PP---PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP   PPPP     SPPPP+  P   PSPPPP
Sbjct: 474 PPPPSPPPPSPPPPSPPPPSPPP---PSPPPP 502

 Score =  117 bits (293), Expect = 4e-25
 Identities = 55/93 (59%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272 PFPLPT-PPPAPKPP--PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPL 102
           P P P+ PPP+P PP  P P PPP  PPPP PPPPP PP PP PP  PPP+PPP   PP 
Sbjct: 118 PSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPP 177

Query: 101 EPP---PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP   PPPP     SPPPP+  P   PSPPPP
Sbjct: 178 SPPPPSPPPPSPPPPSPPPPSPPP---PSPPPP 207

 Score =  117 bits (292), Expect = 5e-25
 Identities = 53/90 (58%), Positives = 57/90 (63%), Gaps = 5/90 (5%)
 Frame = -2

Query: 266 PLPTPPPAPKPP--PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P+PPP+  PP  P P PPP  PPPP PPPP PPP P  PPP PPP+PPP   PP  PP
Sbjct: 116 PPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPP 175

Query: 92  ---PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PPPP     SPPPP+  P   PSPPPP
Sbjct: 176 PPSPPPPSPPPPSPPPPSPPP---PSPPPP 202

 Score =  116 bits (291), Expect = 7e-25
 Identities = 48/86 (55%), Positives = 51/86 (59%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 452 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 511

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPP 15
           P PP       PPP+  P   P  PP
Sbjct: 512 PSPPPPSPPPSPPPSHPPSHPPMHPP 537

 Score =  116 bits (290), Expect = 9e-25
 Identities = 53/91 (58%), Positives = 58/91 (63%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPP-PPPPPPPPPPPTPPAPPP--TPPPNPPPCPDPPL 102
           P P   PPP+P PP  P PPP+PPP PPPP PPPP P PP+PPP   PPP+PPP   PP 
Sbjct: 298 PPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 357

Query: 101 EPPPPPPVYKYKSPPPPAKKPY-EYPSPPPP 12
            PPPP P      PPPP+  P    PSPPPP
Sbjct: 358 SPPPPSPPPPSPPPPPPSPPPSPPPPSPPPP 388

 Score =  115 bits (288), Expect = 2e-24
 Identities = 48/89 (53%), Positives = 53/89 (59%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 457 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 516

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
           P PP      P PP   P  +P   PP++
Sbjct: 517 PSPP------PSPPPSHPPSHPPMHPPMH 539

 Score =  103 bits (258), Expect = 5e-21
 Identities = 47/87 (54%), Positives = 52/87 (59%), Gaps = 4/87 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPP--PPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P  PP P PPP   PPP+PPPP  PPP PPPP P PP+PPP  P  PPP P PP  
Sbjct: 462 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP--PPPSPPPPSP 519

Query: 98  PPPPPPVYKYKSPP--PPAKKPYEYPS 24
           PP PPP +    PP  PP   P+  P+
Sbjct: 520 PPSPPPSHPPSHPPMHPPMHPPFLPPT 546

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 45/79 (56%), Positives = 48/79 (60%), Gaps = 7/79 (8%)
 Frame = -2

Query: 227 CPEPPPAPPPPPPPPPPPPPPTPPAPPP-------TPPPNPPPCPDPPLEPPPPPPVYKY 69
           C  PP  PPP PPP  PPP P PP+PPP        PPP+PPP P PP  PPPPPP    
Sbjct: 109 CYIPPTTPPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPP--PPPPPPSPPP 166

Query: 68  KSPPPPAKKPYEYPSPPPP 12
            SPPPP+  P   PSPPPP
Sbjct: 167 PSPPPPSPPP---PSPPPP 182

[25][TOP]
>UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1
           Tax=Vitis vinifera RepID=UPI0001982DE4
          Length = 569

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/88 (61%), Positives = 55/88 (62%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P P   P PPP P PPP P PPPPP PPPPPP  P PPP+PPP PPP P PP  PP
Sbjct: 122 PPPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPP 181

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
           PPPP      PPPP   P   P PPPPV
Sbjct: 182 PPPP------PPPPPPPPPPPPPPPPPV 203

 Score =  123 bits (309), Expect = 6e-27
 Identities = 50/77 (64%), Positives = 52/77 (67%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPP PPPPP PPPP PP+PPP PPP PPP P PP  PP
Sbjct: 134 PPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 193

Query: 92  PPPPVYKYKSPPPPAKK 42
           PPPP      PPPP  +
Sbjct: 194 PPPP-----PPPPPVDR 205

 Score =  116 bits (291), Expect = 7e-25
 Identities = 49/82 (59%), Positives = 50/82 (60%), Gaps = 2/82 (2%)
 Frame = -2

Query: 251 PPAPKPPPCPEPPPAP--PPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPV 78
           PP      CP PPP P  PPPPPP PPPPPP  P PPP+PPP PPP P PP  PPPPPP 
Sbjct: 113 PPPEYEEGCPPPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPP 172

Query: 77  YKYKSPPPPAKKPYEYPSPPPP 12
                PPPP   P   P PPPP
Sbjct: 173 SPPPPPPPPPPPPPPPPPPPPP 194

[26][TOP]
>UniRef100_B9MZR3 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MZR3_POPTR
          Length = 256

 Score =  126 bits (317), Expect = 7e-28
 Identities = 67/95 (70%), Positives = 68/95 (71%), Gaps = 9/95 (9%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGG-----GDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGGAGGV--G 168
           GGG G+  GF AGGG     G      GGGGGG  GGSGHGGGFG  GGVGGG GG   G
Sbjct: 86  GGGSGHGGGFGAGGGVGGGLGGGAGGGGGGGGGIGGGSGHGGGFGAGGGVGGGHGGGAGG 145

Query: 169 GGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGGGGGGG  GGGSGHGGGFGAGGGVG G G
Sbjct: 146 GGGGGGGGGGGGCVGGGSGHGGGFGAGGGVGGGLG 180

 Score =  123 bits (309), Expect = 6e-27
 Identities = 61/88 (69%), Positives = 65/88 (73%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +GGG  G + G + GGGG      GGGGGG  GGSGHGGGFG G  GG GG  GGG GGG
Sbjct: 59  SGGGLGGGAGGGVGGGGGF----GGGGGGGVGGGSGHGGGFGAG--GGVGGGLGGGAGGG 112

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGG GGGSGHGGGFGAGGGVG G+G
Sbjct: 113 GGGGGGIGGGSGHGGGFGAGGGVGGGHG 140

 Score =  114 bits (284), Expect = 4e-24
 Identities = 63/97 (64%), Positives = 64/97 (65%), Gaps = 11/97 (11%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGG--GDLYL*TGGGGGGS---------NGGSGHGGGFGGGVGGGAGG 162
           GGG G+  GF AGGG  G      GGGGGG           GGSGHGGGF  G GGG GG
Sbjct: 120 GGGSGHGGGFGAGGGVGGGHGGGAGGGGGGGGGGGGGGCVGGGSGHGGGF--GAGGGVGG 177

Query: 163 VGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            G GGG GGGGGGGG GGGSGHGGGFGAGGGVG G G
Sbjct: 178 -GLGGGVGGGGGGGGIGGGSGHGGGFGAGGGVGGGAG 213

 Score =  107 bits (268), Expect = 3e-22
 Identities = 60/92 (65%), Positives = 63/92 (68%), Gaps = 6/92 (6%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGG--GDLY--L*TGGGGGGSNGGSGHGGGFG--GGVGGGAGGVGGGG 177
           GGG G+  GF AGGG  G L   +  GGGGGG  GGSGHGGGFG  GGVGGGAGG  GGG
Sbjct: 160 GGGSGHGGGFGAGGGVGGGLGGGVGGGGGGGGIGGGSGHGGGFGAGGGVGGGAGGGLGGG 219

Query: 178 GGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG GGG G G G G G G GAG G GSG+G
Sbjct: 220 SGGGAGGGFGVGIGVGVGIGVGAGAGKGSGSG 251

 Score =  101 bits (252), Expect = 2e-20
 Identities = 64/113 (56%), Positives = 65/113 (57%), Gaps = 27/113 (23%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNG----GSGHGGGFG--GGVGGG-AGGVGGG 174
           GGG G  +G  AGGGG      GGGGGG  G    GSGHGGGFG  GGVGGG  GGVGGG
Sbjct: 132 GGGVGGGHGGGAGGGGG-----GGGGGGGGGCVGGGSGHGGGFGAGGGVGGGLGGGVGGG 186

Query: 175 GGGGG------------------GGGGGGAGGGS--GHGGGFGAGGGVGSGNG 273
           GGGGG                  GG GGG GGGS  G GGGFG G GVG G G
Sbjct: 187 GGGGGIGGGSGHGGGFGAGGGVGGGAGGGLGGGSGGGAGGGFGVGIGVGVGIG 239

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 47/64 (73%), Positives = 48/64 (75%)
 Frame = +1

Query: 82  GGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVG 261
           G G  G  G  G G G GGG+GGGAGG  GGGGG GGGGGGG GGGSGHGGGFGAGGGVG
Sbjct: 43  GFGRRGCGGRFGGGRGSGGGLGGGAGGGVGGGGGFGGGGGGGVGGGSGHGGGFGAGGGVG 102

Query: 262 SGNG 273
            G G
Sbjct: 103 GGLG 106

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 44/87 (50%), Positives = 47/87 (54%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G  +G GG       G GGG       GGG GGG+GGG+      GGG GG
Sbjct: 184 GGGGGGGGIGGGSGHGGGF-----GAGGGV------GGGAGGGLGGGS------GGGAGG 226

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G G G G G G G G GAG G GSGNG
Sbjct: 227 GFGVGIGVGVGIGVGAGAGKGSGSGNG 253

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 38/69 (55%), Positives = 39/69 (56%), Gaps = 1/69 (1%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG-GVGGGGGGGGG 192
           GGG G+  GF AGGG       GGG GG  GG G GGG GGG G G G GVG G G G G
Sbjct: 193 GGGSGHGGGFGAGGG------VGGGAGGGLGG-GSGGGAGGGFGVGIGVGVGIGVGAGAG 245

Query: 193 GGGGGAGGG 219
            G G   GG
Sbjct: 246 KGSGSGNGG 254

[27][TOP]
>UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH
          Length = 470

 Score =  126 bits (317), Expect = 7e-28
 Identities = 56/86 (65%), Positives = 62/86 (72%), Gaps = 5/86 (5%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPP----PTPPAPPPTPPPNP-PPCPDPPLEP 96
           P+PPP P PPP P PPP PPPPPPPPPPPPP    P+PP PPP+PPP   PP P P + P
Sbjct: 377 PSPPPPPPPPP-PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYP 435

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPP 18
           PPP P Y Y  PPPP+ +PY YPSPP
Sbjct: 436 PPPSPPYVY-PPPPPSPQPYMYPSPP 460

 Score =  110 bits (276), Expect = 4e-23
 Identities = 48/72 (66%), Positives = 49/72 (68%), Gaps = 2/72 (2%)
 Frame = -2

Query: 215 PPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPP--CPDPPLEPPPPPPVYKYKSPPPPAKK 42
           PP+PPPPPPPPPPPPPP PP PPP PPP PPP   P PP  PPP PP Y Y  PPP    
Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP-PPPPSPPPYVYPPPPP---- 430

Query: 41  PYEYPSPPPPVY 6
           PY YP PP P Y
Sbjct: 431 PYVYPPPPSPPY 442

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 30/48 (62%), Positives = 31/48 (64%)
 Frame = -2

Query: 155 APPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           +PP  PPP PPP P PP  PPPPPP      PPPP   PY YPSPPPP
Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPP------PPPPPPPPYVYPSPPPP 416

[28][TOP]
>UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO
          Length = 1765

 Score =  126 bits (316), Expect = 9e-28
 Identities = 58/111 (52%), Positives = 65/111 (58%), Gaps = 21/111 (18%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPP---------------------PPPTPP 156
            P P P PPP+P PPP P PPP  PPPPP PPPP                     PPP+PP
Sbjct: 1092 PSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPDAPPPSPP 1151

Query: 155  APPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
             PPP+PPP+PPP P PP  P PPPP     SPPPP  +P   PSPPPPV++
Sbjct: 1152 PPPPSPPPSPPPSPPPPPSPMPPPP----PSPPPP--RPPPPPSPPPPVHE 1196

 Score =  122 bits (306), Expect = 1e-26
 Identities = 54/90 (60%), Positives = 61/90 (67%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPP---PTPPPNPPPCPDPPL 102
            P P P PPP+P PP    PPP+PPPPPP PPP PPP+PP PP   P PPP+PPP P PP 
Sbjct: 1128 PPPSPPPPPSPPPPTPDAPPPSPPPPPPSPPPSPPPSPPPPPSPMPPPPPSPPP-PRPPP 1186

Query: 101  EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             P PPPPV++    PPP+  P   PSPPPP
Sbjct: 1187 PPSPPPPVHE----PPPSPPPPPNPSPPPP 1212

 Score =  120 bits (302), Expect = 4e-26
 Identities = 56/97 (57%), Positives = 62/97 (63%), Gaps = 10/97 (10%)
 Frame = -2

Query: 272  PFPLPTPPPAP-----KPPPCPEPPPAPPP-----PPPPPPPPPPPTPPAPPPTPPPNPP 123
            P P P PPP+P     +PPP P PPP+PPP     PPP PPPPPP  PP+PPP+PPP P 
Sbjct: 1111 PPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPDAPPPSPPPPPPSPPPSPPPSPPPPPS 1170

Query: 122  PCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P P PP  PPPP P     SPPPP  +P   PSPPPP
Sbjct: 1171 PMPPPPPSPPPPRPP-PPPSPPPPVHEP--PPSPPPP 1204

 Score =  120 bits (301), Expect = 5e-26
 Identities = 53/89 (59%), Positives = 55/89 (61%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP--NPPPCPDPPLEPP 93
            P P  PP+P  PP P PPP P PPPPPPP PPPP PP PP  PPP   PPP P PP  PP
Sbjct: 1080 PPPPSPPSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPP 1139

Query: 92   PPPPVYKYKS--PPPPAKKPYEYPSPPPP 12
            PP P     S  PPPP+  P   PSPPPP
Sbjct: 1140 PPTPDAPPPSPPPPPPSPPPSPPPSPPPP 1168

 Score =  120 bits (301), Expect = 5e-26
 Identities = 54/97 (55%), Positives = 57/97 (58%), Gaps = 12/97 (12%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP-------PPTPPPNPPPCPD- 111
            P P  PP+P PPP P PPP PPP PPPP PPPPP+PP P       PP PP  PPP PD 
Sbjct: 1086 PSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPDA 1145

Query: 110  ----PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
                PP  PP PPP      PPPP+  P   PSPPPP
Sbjct: 1146 PPPSPPPPPPSPPPSPPPSPPPPPSPMPPPPPSPPPP 1182

 Score =  119 bits (298), Expect = 1e-25
 Identities = 54/95 (56%), Positives = 61/95 (64%), Gaps = 7/95 (7%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCP--EPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
            P P P+PPP+P PPP P   PPP+PPPP PPPPP PPP    PPP+PPP P P P PP  
Sbjct: 1155 PSPPPSPPPSPPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPPSP 1214

Query: 98   -PPPPPPVYKYKSPPPPAKKPYE----YPSPPPPV 9
             PPPP P+    SPPPP+  P       PSPPPP+
Sbjct: 1215 MPPPPSPMPPPPSPPPPSPPPPSPMPPPPSPPPPI 1249

 Score =  117 bits (292), Expect = 5e-25
 Identities = 53/89 (59%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPL-EP 96
            P P P  PP   PPP P PPP+PPP PPPPP P PP PP+PPP  PP PPP P PP+ EP
Sbjct: 1139 PPPTPDAPPPSPPPPPPSPPPSPPPSPPPPPSPMPPPPPSPPPPRPP-PPPSPPPPVHEP 1197

Query: 95   PPPPPVYKYKSPPPPA-KKPYEYPSPPPP 12
            PP PP     SPPPP+   P   P PPPP
Sbjct: 1198 PPSPPPPPNPSPPPPSPMPPPPSPMPPPP 1226

 Score =  115 bits (289), Expect = 1e-24
 Identities = 53/91 (58%), Positives = 57/91 (62%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPP---PPPPPPPPP-PTPPAPPPTPPPNPPPCPDPP 105
            P P+P PPP+P PPP P PPP+PPPP   PPP PPPPP P+PP P P PPP P P P PP
Sbjct: 1169 PSPMPPPPPSP-PPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPPP-PSPMPPPP 1226

Query: 104  LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PPP PP      PPP    P   P PPPP
Sbjct: 1227 SPPPPSPPPPSPMPPPPSPPPPIPSPPPPPP 1257

 Score =  115 bits (289), Expect = 1e-24
 Identities = 52/91 (57%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE-- 99
            P P P PPP+P PPP  EPPP+PPPPP P PPPP P PP P P PPP  PP P PP    
Sbjct: 1180 PPPRPPPPPSP-PPPVHEPPPSPPPPPNPSPPPPSPMPPPPSPMPPPPSPPPPSPPPPSP 1238

Query: 98   -PPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
             PPPP P     SPPPP   P   P  PPP+
Sbjct: 1239 MPPPPSPPPPIPSPPPPPPTPRSPPPAPPPL 1269

 Score =  114 bits (286), Expect = 3e-24
 Identities = 51/85 (60%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = -2

Query: 260  PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP--NPPPCPDPPLEPPPP 87
            P PPP+P P P P PPP P P PPPPP PPPP PP PP  PPP   PPP P PP  P PP
Sbjct: 1151 PPPPPSPPPSPPPSPPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPP 1210

Query: 86   PPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP      PPPP+  P   PSPPPP
Sbjct: 1211 PP---SPMPPPPSPMP-PPPSPPPP 1231

 Score =  114 bits (284), Expect = 4e-24
 Identities = 51/95 (53%), Positives = 53/95 (55%), Gaps = 8/95 (8%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPP--------PPPTPPAPPPTPPPNPPPC 117
            P P P PPP+P PPP P PPP  PPPPP PPPP        PPP  P+PPP  P  PPP 
Sbjct: 1161 PPPSPPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPS 1220

Query: 116  PDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P PP   PPPP        PPP   P   PSPPPP
Sbjct: 1221 PMPPPPSPPPPSPPPPSPMPPPPSPPPPIPSPPPP 1255

 Score =  107 bits (268), Expect = 3e-22
 Identities = 47/91 (51%), Positives = 49/91 (53%), Gaps = 8/91 (8%)
 Frame = -2

Query: 260  PTPPPAPK--------PPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
            P PP A          PPP P  PP+PP PPPPPPP PPP PP  PP P P PPP P PP
Sbjct: 1065 PAPPAAAMDNRPCEKPPPPSPPSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPPP 1124

Query: 104  LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            +  PPP P      PPP    P   P PPPP
Sbjct: 1125 VHEPPPSPPPPPSPPPPTPDAPPPSPPPPPP 1155

 Score =  107 bits (267), Expect = 4e-22
 Identities = 48/92 (52%), Positives = 54/92 (58%), Gaps = 4/92 (4%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPT--PPAPPPTPPPNPPPCPDPPLE 99
            P P+  PPP+P PPP P PPP  P PPPP P PPPP+  PP+PPP  P  PPP P PP+ 
Sbjct: 1191 PPPVHEPPPSPPPPPNPSPPPPSPMPPPPSPMPPPPSPPPPSPPPPSPMPPPPSPPPPIP 1250

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPP--PPV 9
             PPPPP      PP P   P +    P  PPV
Sbjct: 1251 SPPPPPPTPRSPPPAPPPLPGDVDPTPASPPV 1282

 Score =  105 bits (261), Expect = 2e-21
 Identities = 51/88 (57%), Positives = 57/88 (64%), Gaps = 2/88 (2%)
 Frame = -2

Query: 269  FPLPTPPPAPKPPPCPEPPP-APPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            FP P P  A    PC +PPP +PP PP PP PPPPP PP+PPP PPP+PPP P PP  P 
Sbjct: 1064 FPAP-PAAAMDNRPCEKPPPPSPPSPPSPPSPPPPP-PPSPPPPPPPSPPP-PRPPPPPS 1120

Query: 92   PPPPVYK-YKSPPPPAKKPYEYPSPPPP 12
            PPPPV++   SPPPP   P   P  PPP
Sbjct: 1121 PPPPVHEPPPSPPPPPSPPPPTPDAPPP 1148

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 24/44 (54%), Positives = 26/44 (59%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPT 141
            P P   PPP P PPP P  P +PPP PPP P    PTP +PP T
Sbjct: 1240 PPPPSPPPPIPSPPPPPPTPRSPPPAPPPLPGDVDPTPASPPVT 1283

[29][TOP]
>UniRef100_A4S1Y9 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901
           RepID=A4S1Y9_OSTLU
          Length = 1065

 Score =  125 bits (315), Expect = 1e-27
 Identities = 56/101 (55%), Positives = 64/101 (63%), Gaps = 14/101 (13%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPP---------PPPPPPPPPPPTPPAPPPTPPPNPPP 120
           P P P+PPP+P P P P PPP+PPP         PPP PPP PPP+PP+PPP+PPP+PPP
Sbjct: 475 PTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPP 534

Query: 119 C--PDPPLEPPPPPPVYKYKSP---PPPAKKPYEYPSPPPP 12
              P PP  PPP PP     SP   PPP+  P   PSPPPP
Sbjct: 535 SPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPP 575

 Score =  122 bits (306), Expect = 1e-26
 Identities = 53/90 (58%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPC-PDPPLEP 96
           P P PTP P P PPP P P P P PPP PPP PPP  PP+PPP+PPP+PPP  P PP  P
Sbjct: 469 PTPTPTPTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSP 528

Query: 95  PPPPPVYKYKSP---PPPAKKPYEYPSPPP 15
           PP PP     SP   PPP+  P   PSPPP
Sbjct: 529 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 558

 Score =  111 bits (278), Expect = 2e-23
 Identities = 47/80 (58%), Positives = 54/80 (67%), Gaps = 1/80 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPT-PPAPPPTPPPNPPPCPDPPLEP 96
           P P P+PPP+P P P P PP  PP PPP PPP PPP+ PP+PPP+PPP+PPP P PP  P
Sbjct: 503 PSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP-PPSPP 561

Query: 95  PPPPPVYKYKSPPPPAKKPY 36
           P PPP      PPPP   P+
Sbjct: 562 PSPPPSPPPSPPPPPHFAPF 581

 Score =  103 bits (257), Expect = 6e-21
 Identities = 44/79 (55%), Positives = 49/79 (62%), Gaps = 2/79 (2%)
 Frame = -2

Query: 245 APKPPPCPEPPPAPPPPPP--PPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYK 72
           AP P P P P P+PPP PP  PPP PPP  PP+PPP+PPP+PPP P P   P PP P   
Sbjct: 468 APTPTPTPTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPS 527

Query: 71  YKSPPPPAKKPYEYPSPPP 15
               PPP+  P   PSPPP
Sbjct: 528 PPPSPPPSPPPSPPPSPPP 546

 Score =  102 bits (255), Expect = 1e-20
 Identities = 45/78 (57%), Positives = 49/78 (62%), Gaps = 1/78 (1%)
 Frame = -2

Query: 245 APKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYK 66
           A  P P P P P P PPP PPP PPP  PP+PPP+PPP+PPP P PP  PP PPP     
Sbjct: 466 AAAPTPTPTPTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP-PPSPPPSPPPSPPSP 524

Query: 65  SP-PPPAKKPYEYPSPPP 15
            P PPP+  P   PSPPP
Sbjct: 525 PPSPPPSPPPSPPPSPPP 542

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 39/65 (60%), Positives = 46/65 (70%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P+PPP+P P P P PPP+PPP PPP PPP PP  P+PPP+PPP+PPP P PP    
Sbjct: 522 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP--PSPPPSPPPSPPPSPPPPPHFA 579

Query: 92  PPPPV 78
           P  P+
Sbjct: 580 PFVPL 584

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 43/81 (53%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -2

Query: 254 PPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVY 75
           P  A      P P P P P P PPP PPP  PP+PPP+PPP+PPP P PP  PP PPP  
Sbjct: 459 PNAAAALAAAPTPTPTPTPTPSPPPSPPPSPPPSPPPSPPPSPPPSP-PPSPPPSPPPSP 517

Query: 74  KYKSP-PPPAKKPYEYPSPPP 15
               P PPP+  P   PSPPP
Sbjct: 518 PPSPPSPPPSPPPSPPPSPPP 538

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 37/63 (58%), Positives = 42/63 (66%), Gaps = 2/63 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPP--PPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P+PPP+P P P P PPP+PPP PPP  PP PPP  PP+PPP+PPP P   P  PL 
Sbjct: 526 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPPHFAPFVPLA 585

Query: 98  PPP 90
             P
Sbjct: 586 SVP 588

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 32/61 (52%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = -2

Query: 185 PPPPPPPTP-PAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSP--PPPAKKPYEYPSPPP 15
           P P P PTP P+PPP+PPP+PPP P     PP PPP      P  PPP+  P   PSPP 
Sbjct: 469 PTPTPTPTPTPSPPPSPPPSPPPSP-----PPSPPPSPPPSPPPSPPPSPPPSPPPSPPS 523

Query: 14  P 12
           P
Sbjct: 524 P 524

[30][TOP]
>UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata
           RepID=UPI0001926FBD
          Length = 268

 Score =  125 bits (314), Expect = 1e-27
 Identities = 56/99 (56%), Positives = 56/99 (56%), Gaps = 12/99 (12%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPA----------PPPPPPPPPPPPPPTPPAPPPTPPPNPP 123
           P P P PPP P PP CP PPP           PPPPPPPPPPPPPP PP PP    P PP
Sbjct: 114 PPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPP 173

Query: 122 PCPDP--PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PCP P  P  PPPPPP      PPPP   P   P PPPP
Sbjct: 174 PCPPPPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPPPP 212

 Score =  125 bits (313), Expect = 2e-27
 Identities = 56/94 (59%), Positives = 56/94 (59%), Gaps = 7/94 (7%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPP-----PPPPPTPPAPPPTPPPNPPP--CP 114
           P   P PPP P PPP P PPP PPPPPPPPP     PPPPP PP P P PPP PPP  C 
Sbjct: 134 PMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCL 193

Query: 113 DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP  PPPPPP      PPPP   P   P PPPP
Sbjct: 194 PPPPPPPPPPPPCPLPPPPPPCPPP-PAPCPPPP 226

 Score =  121 bits (304), Expect = 2e-26
 Identities = 59/104 (56%), Positives = 59/104 (56%), Gaps = 17/104 (16%)
 Frame = -2

Query: 272 PFPLPTPPP----------APKPPPCPEPPPAPPPPPPPPPPPPPPTP----PAPPPTPP 135
           P P P PPP          AP PPP P PPP PPPPPPPPPPPPPP P    P PPP PP
Sbjct: 118 PCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPP 177

Query: 134 PNPPPCPDPPLEPP---PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P P PCP PP  PP   PPPP      PPPP   P   P PPPP
Sbjct: 178 P-PAPCPPPPPPPPMCLPPPP------PPPPPPPPCPLPPPPPP 214

 Score =  120 bits (300), Expect = 6e-26
 Identities = 58/97 (59%), Positives = 59/97 (60%), Gaps = 10/97 (10%)
 Frame = -2

Query: 272 PFPLPTPPPAPK----PPPCPEPP-PAPPPPPPPP--PPPPP---PTPPAPPPTPPPNPP 123
           P P P  PP P     PPPCP PP P PPPPPPPP  PPPPP   P PP PPP PPP PP
Sbjct: 93  PPPQPACPPPPPGCGPPPPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPP 152

Query: 122 PCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P P PP  PPPPP V+    PPPP   P   P PPPP
Sbjct: 153 PPPPPPPPPPPPPVVF---CPPPPPCPPPPAPCPPPP 186

 Score =  118 bits (296), Expect = 2e-25
 Identities = 55/91 (60%), Positives = 55/91 (60%), Gaps = 10/91 (10%)
 Frame = -2

Query: 254 PPPAPKPP-PCPEPPPAPP--PPPPP---PPPPPPPTPPAPPPTPPPNPPPCPDPP---- 105
           PPP P PP PCP PPP PP  PPPPP   PPPPPPP PP PPP PPP PPP P PP    
Sbjct: 109 PPPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVF 168

Query: 104 LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP P      PPPP   P   P PPPP
Sbjct: 169 CPPPPPCPPPPAPCPPPPPPPPMCLPPPPPP 199

 Score =  118 bits (296), Expect = 2e-25
 Identities = 53/88 (60%), Positives = 53/88 (60%), Gaps = 4/88 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPP---CPEPPPAPPPPPP-PPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
           P P P PPP P PPP   CP PPP PPPP P PPPPPPPP    PPP PPP PPPCP PP
Sbjct: 151 PPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPP 210

Query: 104 LEPPPPPPVYKYKSPPPPAKKPYEYPSP 21
             PP PPP      PPPP   P   P P
Sbjct: 211 PPPPCPPPPAPCPPPPPPPACPAPMPMP 238

 Score =  116 bits (291), Expect = 7e-25
 Identities = 56/99 (56%), Positives = 56/99 (56%), Gaps = 14/99 (14%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPP----------PPPPPPTPPAPPP----TPPPN 129
           P P PPP P PPP P PPP PPPPPPPP          PPPP P PP PPP     PPP 
Sbjct: 138 PPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPP 197

Query: 128 PPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP P PP   PPPPP      PPPPA  P   P PPPP
Sbjct: 198 PPPPPPPPCPLPPPPP----PCPPPPAPCP---PPPPPP 229

 Score =  103 bits (258), Expect = 5e-21
 Identities = 50/91 (54%), Positives = 51/91 (56%), Gaps = 6/91 (6%)
 Frame = -2

Query: 263 LPTPPPAPKPPPCPEPPPAPPPP---PPPPPPPPP---PTPPAPPPTPPPNPPPCPDPPL 102
           LP      KPPP P+P   PPPP   PPPP PPPP   P PP PPP  PP PP C  PP 
Sbjct: 82  LPPVTDGSKPPPPPQPACPPPPPGCGPPPPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPP 141

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            PPPPPP      PPPP   P   P PPPPV
Sbjct: 142 PPPPPPP------PPPPPPPPPPPPPPPPPV 166

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 48/90 (53%), Positives = 50/90 (55%), Gaps = 10/90 (11%)
 Frame = -2

Query: 245 APKPPPCPE---PPPAPPPPPPPPPP---PPPPTPPAPPPTPPPNPPP--CPDPP--LEP 96
           AP  PP  +   PPP P P  PPPPP   PPPP PP P P PPP PPP  CP PP    P
Sbjct: 79  APLLPPVTDGSKPPPPPQPACPPPPPGCGPPPPCPPPPAPCPPPPPPPPVCPPPPPMCAP 138

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
           PPPPP      PPPP   P   P PPP V+
Sbjct: 139 PPPPPPPPPPPPPPPPPPPPPPPPPPPVVF 168

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 31/48 (64%), Positives = 31/48 (64%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPC 117
           P PPP P PPPCP PPP   PPP PPPP P P PP PP  P P P PC
Sbjct: 195 PPPPPPPPPPPCPLPPP---PPPCPPPPAPCPPPPPPPACPAPMPMPC 239

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 41/91 (45%), Positives = 41/91 (45%), Gaps = 8/91 (8%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAP----PPPPPPPPPPPPPTPPAPP-PTPPPN---PPPCPDPP 105
           P  P AP P   P     P    P  PP      PP PP P  P PPP    PPPCP PP
Sbjct: 57  PVQPAAPAPLAYPMANQLPCTLAPLLPPVTDGSKPPPPPQPACPPPPPGCGPPPPCPPPP 116

Query: 104 LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PPPPP      PPPP   P   P PPPP
Sbjct: 117 APCPPPPPPPPVCPPPPPMCAPPPPPPPPPP 147

[31][TOP]
>UniRef100_Q01AC1 Meltrins, fertilins and related Zn-dependent metalloproteinases of
           the ADAMs family (ISS) n=1 Tax=Ostreococcus tauri
           RepID=Q01AC1_OSTTA
          Length = 872

 Score =  125 bits (313), Expect = 2e-27
 Identities = 54/90 (60%), Positives = 60/90 (66%), Gaps = 5/90 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEP-----PPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP 108
           P P P+PPP+P PPP P P     PP+PPPP PPPP PPPP+PP PPP+PPP+PPP P P
Sbjct: 537 PPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPP-PPPSPPPSPPPPPSP 595

Query: 107 PLEPPPPPPVYKYKSPPPPAKKPYEYPSPP 18
           P   PPPPPV    S PPP      YP PP
Sbjct: 596 PPPSPPPPPVVVVPSSPPPVLVNDMYPPPP 625

 Score =  121 bits (303), Expect = 3e-26
 Identities = 52/89 (58%), Positives = 56/89 (62%), Gaps = 5/89 (5%)
 Frame = -2

Query: 263 LPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPP 84
           LPT PP   PPP P PPP+PPP PPPP PPP P P  PPP+PP  PPP P PP  PPPPP
Sbjct: 492 LPTAPPVSSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPP 551

Query: 83  -----PVYKYKSPPPPAKKPYEYPSPPPP 12
                   +  SPPPP+  P   PSPPPP
Sbjct: 552 SPPPGSAARPPSPPPPSPPP---PSPPPP 577

 Score =  119 bits (297), Expect = 1e-25
 Identities = 52/89 (58%), Positives = 57/89 (64%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPP----LE 99
           P P+P P P PPP P PP  PP PPP PPPP PP+PP P P+PPP+PPP P PP      
Sbjct: 501 PPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAAR 560

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP PPP     SPPPP+  P   PSPPPP
Sbjct: 561 PPSPPP----PSPPPPSPPP---PSPPPP 582

 Score =  118 bits (295), Expect = 2e-25
 Identities = 57/101 (56%), Positives = 62/101 (61%), Gaps = 14/101 (13%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP-PCPEPPPAPPPPPPPPPPPPPPTP---PAPPPTPPPN-------- 129
           P P P+PPP+P PP P P PPP+PPPP PP PPPP P+P   P PPP+PPP         
Sbjct: 505 PSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSP 564

Query: 128 PPPCPDPPLEPP--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP P PP  PP  PPPP     SPPPP   P   PSPPPP
Sbjct: 565 PPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPP--PPSPPPP 603

 Score =  117 bits (294), Expect = 3e-25
 Identities = 54/98 (55%), Positives = 59/98 (60%), Gaps = 11/98 (11%)
 Frame = -2

Query: 272 PFPLPTPPPAPKP-PPCPEPPPAPPPPPPPP-PPPPPPTPPAPPPTPPPNP--------- 126
           P P P+PPP+P P PP P PPP+PPP PPPP PP PPP  P+PPP+PPP P         
Sbjct: 501 PPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAAR 560

Query: 125 PPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP P PP  PPP PP      PP P   P   PSPPPP
Sbjct: 561 PPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPP 598

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 33/63 (52%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = -2

Query: 197 PPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPP-PPAKKPYEYPSP 21
           P    P  PP + P P P+PPP+PPP P PP  PP PPP     SPP PP   P   PSP
Sbjct: 488 PSSELPTAPPVSSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSP 547

Query: 20  PPP 12
           PPP
Sbjct: 548 PPP 550

[32][TOP]
>UniRef100_B9MZQ9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MZQ9_POPTR
          Length = 252

 Score =  124 bits (312), Expect = 2e-27
 Identities = 64/88 (72%), Positives = 64/88 (72%), Gaps = 3/88 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGG-AGGVGGGGGG 183
           GGGG G   G   GGG       GGGGGG  GGSGHG GFG  GGVGGG  GG GGGGGG
Sbjct: 59  GGGGLGGGAGGGVGGGFG-----GGGGGGVGGGSGHGEGFGAGGGVGGGLGGGAGGGGGG 113

Query: 184 GGGGGGGGAGGGSGHGGGFGAGGGVGSG 267
           GGGGGGGG GGGSGHGGGFGAGGGVG G
Sbjct: 114 GGGGGGGGIGGGSGHGGGFGAGGGVGGG 141

 Score =  113 bits (283), Expect = 6e-24
 Identities = 61/95 (64%), Positives = 62/95 (65%), Gaps = 9/95 (9%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG-GVGGGGGGGG- 189
           GGG G+  GF AGGG    L  G GGGG  GG G GGG GGG G G G G GGG GGGG 
Sbjct: 84  GGGSGHGEGFGAGGGVGGGLGGGAGGGGGGGGGGGGGGIGGGSGHGGGFGAGGGVGGGGL 143

Query: 190 G-------GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G       GGGGG GGGSGHGGGFGAGGGVG G G
Sbjct: 144 GGGAGGGEGGGGGLGGGSGHGGGFGAGGGVGGGAG 178

 Score =  102 bits (253), Expect = 2e-20
 Identities = 59/94 (62%), Positives = 60/94 (63%), Gaps = 8/94 (8%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGG---GDLYL*TGGG---GGGSNGGSGHGGGF--GGGVGGGAGGVGG 171
           GGG G+  GF AGGG   G L    GGG   GGG  GGSGHGGGF  GGGVGGGAGG  G
Sbjct: 123 GGGSGHGGGFGAGGGVGGGGLGGGAGGGEGGGGGLGGGSGHGGGFGAGGGVGGGAGGGLG 182

Query: 172 GGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGG GGG G G G G G G GAG G GS  G
Sbjct: 183 GGSGGGAGGGFGVGIGVGIGVGVGAGAGQGSDIG 216

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 54/97 (55%), Positives = 59/97 (60%), Gaps = 10/97 (10%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGA---------GGV 165
           GGGG G   G  +G GG      G GGGG  GG+G G G GGG+GGG+         GGV
Sbjct: 114 GGGGGGGGIGGGSGHGGGFGAGGGVGGGGLGGGAGGGEGGGGGLGGGSGHGGGFGAGGGV 173

Query: 166 GGGGGGG-GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGG GGG GGGAGGG G G G G G GVG+G G
Sbjct: 174 GGGAGGGLGGGSGGGAGGGFGVGIGVGIGVGVGAGAG 210

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 46/64 (71%), Positives = 47/64 (73%)
 Frame = +1

Query: 82  GGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVG 261
           G G  G  GG G G G GGG+GGGAGG  G GGG GGGGGGG GGGSGHG GFGAGGGVG
Sbjct: 43  GFGRRGCGGGRGGGRGGGGGLGGGAGG--GVGGGFGGGGGGGVGGGSGHGEGFGAGGGVG 100

Query: 262 SGNG 273
            G G
Sbjct: 101 GGLG 104

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 46/87 (52%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGG-GSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GGGG G   G   GGGG L   +G GGG G+      GGG GGG GGG GG  GGG GGG
Sbjct: 139 GGGGLGGGAGGGEGGGGGLGGGSGHGGGFGA------GGGVGGGAGGGLGGGSGGGAGGG 192

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGN 270
            G G G G G G G G G G  +GSG+
Sbjct: 193 FGVGIGVGIGVGVGAGAGQGSDIGSGS 219

[33][TOP]
>UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B501E
          Length = 406

 Score =  124 bits (312), Expect = 3e-27
 Identities = 60/105 (57%), Positives = 60/105 (57%), Gaps = 20/105 (19%)
 Frame = -2

Query: 260 PTPPPAPKPPPC--PEPPPA--PPPPPPPPPPPP---PPTPPA---PPPTPPPNPPPC-- 117
           P PPP P PPP   P PPPA  PPPPPPPPPPPP   PP PPA   PPP PPP PPP   
Sbjct: 163 PPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYG 222

Query: 116 --------PDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
                   P PP  PPPPPP Y    PPPP   P  Y  PPPP Y
Sbjct: 223 PPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAY 267

 Score =  122 bits (305), Expect = 2e-26
 Identities = 61/114 (53%), Positives = 61/114 (53%), Gaps = 27/114 (23%)
 Frame = -2

Query: 272 PFPLPTPPPA--PKPPPC--PEPPPAPPPPP------------PPPPPPPPPTPPA---- 153
           P P P PPPA  P PPP   P PPP PPPPP            PPPPPPPPP PPA    
Sbjct: 165 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPP 224

Query: 152 -------PPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
                  PPP PPP PPP   PP  PPPPPP   Y  PPPPA  P   P PPPP
Sbjct: 225 PPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPP 278

 Score =  120 bits (300), Expect = 6e-26
 Identities = 55/93 (59%), Positives = 55/93 (59%), Gaps = 8/93 (8%)
 Frame = -2

Query: 260 PTPPPA---PKPPPCPEPPPAP---PPPPPPPPPPPPPTPPAPPPT--PPPNPPPCPDPP 105
           P PPPA   P PPP   PPP P   PPPPPPPPPPPP   P PPP   PPP PPP P PP
Sbjct: 91  PPPPPAYAPPPPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPP 150

Query: 104 LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
              PPPPP Y    PPPP   P  Y  PPPP Y
Sbjct: 151 AYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAY 183

 Score =  119 bits (299), Expect = 8e-26
 Identities = 58/103 (56%), Positives = 58/103 (56%), Gaps = 14/103 (13%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPP---PPPPP---PPPPPPPTPP----APPPT----PP 135
           P   P PPPA  PPP P PPP PP   PPPPP   PPPPPPP PP     PPP     PP
Sbjct: 104 PAYAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPP 163

Query: 134 PNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
           P PPP P PP   PPPPP Y    PPPP   P  Y  PPPP Y
Sbjct: 164 PPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAY 206

 Score =  119 bits (299), Expect = 8e-26
 Identities = 57/111 (51%), Positives = 58/111 (52%), Gaps = 22/111 (19%)
 Frame = -2

Query: 272 PFPLPTPPPA--PKPPPCPEPPPAPPPPPPPPP----------PPPPPTPPAPPPT---- 141
           P P P PPP+  P PPP   PPP PPPPPPPP           PPPPP PP PPP     
Sbjct: 119 PPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPP 178

Query: 140 ------PPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
                 PPP PPP P PP   PPPPP Y    PPPP   P  Y  PPPP Y
Sbjct: 179 PPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAY 229

 Score =  119 bits (298), Expect = 1e-25
 Identities = 56/99 (56%), Positives = 56/99 (56%), Gaps = 12/99 (12%)
 Frame = -2

Query: 272 PFPLPTPPPA--PKPPPCPEPPPAPPPPPPPPP----------PPPPPTPPAPPPTPPPN 129
           P P P PPPA  P PPP   PPP PPPPPPPP           PPPPP PP PPP   P 
Sbjct: 142 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPP 201

Query: 128 PPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP   PP  PPPPPP   Y  PPPPA  P   P PPPP
Sbjct: 202 PPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPP 240

 Score =  119 bits (297), Expect = 1e-25
 Identities = 57/99 (57%), Positives = 58/99 (58%), Gaps = 14/99 (14%)
 Frame = -2

Query: 260 PTPPPAPKPPPC--PEPPPAPPPPPPPPPPPPPP--TPPAPPPTPP------PNPPPC-- 117
           P PPP P PPP   P PPPA  PPPPPPPPPPPP  +PP PPP PP      P PPP   
Sbjct: 209 PPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYG 268

Query: 116 PDPPLEPPPPPPVYKY--KSPPPPAKKPYEYPSPPPPVY 6
           P PP  PPPPP  Y Y    PPPP   P  Y  PPPP Y
Sbjct: 269 PPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAY 307

 Score =  119 bits (297), Expect = 1e-25
 Identities = 56/103 (54%), Positives = 58/103 (56%), Gaps = 14/103 (13%)
 Frame = -2

Query: 272 PFPLPTPPPA---PKPPPCPEPPPAPPPPPPP----------PPPPPPPTPPAPPPTPPP 132
           P P P PPPA   P PPP   PPP PPPPPPP          PPPPPPP   +PPP P  
Sbjct: 248 PPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAY 307

Query: 131 NPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEY-PSPPPPVY 6
            PPP P PP   PPPPP Y   +PPPP   P  Y P PPPP Y
Sbjct: 308 GPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAY 350

 Score =  117 bits (294), Expect = 3e-25
 Identities = 60/102 (58%), Positives = 60/102 (58%), Gaps = 17/102 (16%)
 Frame = -2

Query: 260 PTPPPA--PKPPPCPEPPPA-----PPPPPPPPPPPP---PPTPPA----PPPTPP---P 132
           P PPPA  P PPP P PPPA     PPPPPPPPPPPP   PP PPA    PPP PP   P
Sbjct: 261 PPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPPPPPPPAYAP 320

Query: 131 NPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
            PPP   PP  PPPPPP   Y  PPPP   P   P PPPP Y
Sbjct: 321 PPPPAYGPPAPPPPPPPPPAYAPPPPP---PAYAPPPPPPAY 359

 Score =  117 bits (293), Expect = 4e-25
 Identities = 60/116 (51%), Positives = 60/116 (51%), Gaps = 27/116 (23%)
 Frame = -2

Query: 272 PFPLPTPPPA--PKPPPCPEPPPAPPPPPPPP------PPPPPPTPPA----------PP 147
           P P P PPPA  P PPP   PPP PPPPPPPP      PPPPPP P A          PP
Sbjct: 211 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPP 270

Query: 146 PTPPPNPPPC-----PDPPLEPPPPPPVYKYKSP----PPPAKKPYEYPSPPPPVY 6
           P PPP PPP      P PP  PPPPPP Y    P    PPP   P  Y  PPPP Y
Sbjct: 271 PPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPPPPPPPAYAPPPPPAY 326

 Score =  114 bits (286), Expect = 3e-24
 Identities = 57/99 (57%), Positives = 58/99 (58%), Gaps = 16/99 (16%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAP---PPPPPPPP---PPPPPT--PPAPPPTPPPNP---PPCP 114
           P PPP P PPP   PPP P   PPPPPPPP   PPPPP   PPAPPP PPP P   PP P
Sbjct: 287 PPPPPPPPPPPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPP 346

Query: 113 DPPLEPPPPPPVYKYKSPPPPAKKP-----YEYPSPPPP 12
            P   PPPPPP Y    PPPP   P     Y  P+PPPP
Sbjct: 347 PPAYAPPPPPPAYA-PPPPPPKYSPAPIVVYGPPAPPPP 384

 Score =  109 bits (273), Expect = 8e-23
 Identities = 54/96 (56%), Positives = 54/96 (56%), Gaps = 13/96 (13%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPP----PPPPP---PPPPP---PPTPPAPPPTPP---PNPPP 120
           P PP    PPP   PPP PP    PPPPP   PPPPP   PP PP PPP PP   P PPP
Sbjct: 76  PAPPAYAPPPPVYAPPPPPPAYAPPPPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPPPPP 135

Query: 119 CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PP  PPPPPP   Y  PPPPA  P   P PPPP
Sbjct: 136 AYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPP 171

 Score =  108 bits (271), Expect = 1e-22
 Identities = 55/109 (50%), Positives = 55/109 (50%), Gaps = 20/109 (18%)
 Frame = -2

Query: 272 PFPLPTPPPA--------------PKPPPCPEPPP--APPPPPP---PPPPPPPPTPPAP 150
           P P P PPP               P PP    PPP  APPPPPP   PPPPPP   PP P
Sbjct: 52  PAPQPPPPPPAYDDCDEIVLVPGKPAPPAYAPPPPVYAPPPPPPAYAPPPPPPAYAPPPP 111

Query: 149 PP-TPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
           P   PPP PPP P PP   PPPPP Y    PPPP   P  Y  PPPP Y
Sbjct: 112 PAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAY 160

 Score =  102 bits (254), Expect = 1e-20
 Identities = 54/104 (51%), Positives = 54/104 (51%), Gaps = 14/104 (13%)
 Frame = -2

Query: 272 PFPLPTPPPA--PKPPPCPEPPPAPPPP-----------PPPPPPPPPPTPP-APPPTPP 135
           P P P PPPA  P PPP   PPP PPPP           PP PPPPPPP P  APPP PP
Sbjct: 289 PPPPPPPPPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPP 348

Query: 134 PNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
              PP P P   PPPPPP Y   SP P        P PPPP  K
Sbjct: 349 AYAPPPPPPAYAPPPPPPKY---SPAPIVVYGPPAPPPPPPAPK 389

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 47/107 (43%), Positives = 47/107 (43%), Gaps = 21/107 (19%)
 Frame = -2

Query: 263 LPTPPPAPKPPPCPEPPPAPPPPPPPPPPPP-------------PPTPP--APPP---TP 138
           LP     P   P   P  A  P P PPPPPP              P PP  APPP    P
Sbjct: 31  LPYKIELPAARPAYSPVYAVVPAPQPPPPPPAYDDCDEIVLVPGKPAPPAYAPPPPVYAP 90

Query: 137 PPNPP---PCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
           PP PP   P P PP   PPPPP Y    PPPP   P  Y  PPPP Y
Sbjct: 91  PPPPPAYAPPPPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAY 137

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 44/77 (57%), Positives = 44/77 (57%), Gaps = 8/77 (10%)
 Frame = -2

Query: 272 PFPLPTPPPA---PKPPPCPEPPPA--PPPPPP--PPPPPPPP-TPPAPPPTPPPNPPPC 117
           P   P PPPA   P PPP P PPPA  PPPPPP   PPPPPP   PP PPP   P P   
Sbjct: 316 PAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPKYSPAPIVV 375

Query: 116 PDPPLEPPPPPPVYKYK 66
             PP  PPPPPP  K K
Sbjct: 376 YGPP-APPPPPPAPKRK 391

[34][TOP]
>UniRef100_C1EFP7 Receptor-like cell wall protein n=1 Tax=Micromonas sp. RCC299
            RepID=C1EFP7_9CHLO
          Length = 1985

 Score =  124 bits (312), Expect = 3e-27
 Identities = 53/83 (63%), Positives = 56/83 (67%)
 Frame = -2

Query: 260  PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
            P PPP P PPP P PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PPP PP
Sbjct: 1459 PPPPPPPSPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPP 1517

Query: 80   VYKYKSPPPPAKKPYEYPSPPPP 12
                 SPPPP+  P   PSPPPP
Sbjct: 1518 P---PSPPPPSSPPPMSPSPPPP 1537

 Score =  110 bits (274), Expect = 6e-23
 Identities = 49/88 (55%), Positives = 52/88 (59%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P  PP P PPP   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 1469 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPPPSPPPPSSPP 1528

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            P  P     SPPPP       P P PP+
Sbjct: 1529 PMSP-----SPPPP-------PPPFPPL 1544

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 35/58 (60%), Positives = 37/58 (63%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
            P P P  PP P PPP P PPP  PPPP PPPP PPP    PP +P P PPP P PPL+
Sbjct: 1489 PSPPPPSPPPPSPPP-PSPPPPSPPPPLPPPPSPPPPSSPPPMSPSPPPPPPPFPPLD 1545

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 37/66 (56%), Positives = 41/66 (62%), Gaps = 3/66 (4%)
 Frame = -2

Query: 197  PPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP---PPPPVYKYKSPPPPAKKPYEYP 27
            PPPPPPP PPP+PP      PP+PPP   PP  PP   PPPP     SPPPP+  P   P
Sbjct: 1459 PPPPPPPSPPPSPP------PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---P 1509

Query: 26   SPPPPV 9
            SPPPP+
Sbjct: 1510 SPPPPL 1515

[35][TOP]
>UniRef100_A2YLR5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2YLR5_ORYSI
          Length = 356

 Score =  123 bits (309), Expect = 6e-27
 Identities = 64/99 (64%), Positives = 65/99 (65%), Gaps = 12/99 (12%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TG-------GGGGGSNGGSGHGGGFGGGVGGGAGGVGG 171
           GGGG G   GF  GGGG L    G       GGGGG  GG G GGGFGGGVGGG GG GG
Sbjct: 63  GGGGFGGDGGFGGGGGGGLGGGGGFGGGGGAGGGGGLGGGGGKGGGFGGGVGGGGGGAGG 122

Query: 172 GGGGGGGGG-----GGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGGGGGG     GGG GGG G GGGFGAGGGVG G+G
Sbjct: 123 GLGGGGGGGLGGGGGGGVGGGGGQGGGFGAGGGVGGGSG 161

 Score =  117 bits (293), Expect = 4e-25
 Identities = 62/93 (66%), Positives = 64/93 (68%), Gaps = 6/93 (6%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGGAG---GVGGGG 177
           GGGG G   G   GGGG L    GGGGGG  GG G GGGFG  GGVGGG+G   G+GGGG
Sbjct: 114 GGGGGGAGGGLGGGGGGGL---GGGGGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGG 170

Query: 178 GGG-GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GG GGGG GGG G GGGFGAGGGVG   G
Sbjct: 171 GGGFGGDGGGGLGGGGGKGGGFGAGGGVGGAAG 203

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/93 (60%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG------GGVGGGAGGVGGG 174
           GG G G   G  AGGGG +    GGGGGG  GG G GGGFG      GG GGG G  GGG
Sbjct: 190 GGFGAGGGVGGAAGGGGGM---GGGGGGGFGGGGGKGGGFGAGGVMGGGAGGGGGLGGGG 246

Query: 175 GGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGGGG G GGG+G G G GAGGG G G G
Sbjct: 247 GGGMGGGGGSGMGGGAGGGFGGGAGGGAGQGGG 279

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/98 (59%), Positives = 60/98 (61%), Gaps = 12/98 (12%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG-----GVGGGGG 180
           GGG G   G   GGGG +     GGGGGS  G G GGGFGGG GGGAG     G+GGGGG
Sbjct: 233 GGGAGGGGGLGGGGGGGM-----GGGGGSGMGGGAGGGFGGGAGGGAGQGGGGGLGGGGG 287

Query: 181 GGGGGGGG-------GAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGGGG       GAGGG GHGGG G G G G G G
Sbjct: 288 GGLGGGGGAGGGLGGGAGGGLGHGGGLGGGLGHGGGLG 325

 Score =  105 bits (261), Expect = 2e-21
 Identities = 55/95 (57%), Positives = 57/95 (60%), Gaps = 9/95 (9%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGG---------SGHGGGFGGGVGGGAGGVG 168
           GGG G+  G  AGGGG L     GGGGG  GG          G GGG GGG GGG GG G
Sbjct: 82  GGGGGFGGGGGAGGGGGL-----GGGGGKGGGFGGGVGGGGGGAGGGLGGGGGGGLGGGG 136

Query: 169 GGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGGGG GGG G G G GGG G GGG+G G G
Sbjct: 137 GGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGGG 171

 Score =  105 bits (261), Expect = 2e-21
 Identities = 55/95 (57%), Positives = 57/95 (60%), Gaps = 8/95 (8%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGG--------GVGGGAGGVG 168
           GG G G+  G   GGG       GGGGGG  GG G GGG GG        G GGG GG  
Sbjct: 144 GGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFGGDG-GGGLGGGGGKGGGFGAGGGVGGAA 202

Query: 169 GGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGGGGGG GGG G GGGFGAGG +G G G
Sbjct: 203 GGGGGMGGGGGGGFGGGGGKGGGFGAGGVMGGGAG 237

 Score =  102 bits (255), Expect = 1e-20
 Identities = 57/94 (60%), Positives = 58/94 (61%), Gaps = 8/94 (8%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGGAGGVGGGGGGGG 189
           GGG G   G   GGGG      G GGGG  GG G GGGFG  GGVGG AGG GG GGGGG
Sbjct: 157 GGGSGTGGGLGGGGGGGF---GGDGGGGLGGGGGKGGGFGAGGGVGGAAGGGGGMGGGGG 213

Query: 190 G--GGGGGAGGGSG----HGGGFGAGGGVGSGNG 273
           G  GGGGG GGG G     GGG G GGG+G G G
Sbjct: 214 GGFGGGGGKGGGFGAGGVMGGGAGGGGGLGGGGG 247

 Score =  101 bits (252), Expect = 2e-20
 Identities = 56/88 (63%), Positives = 57/88 (64%), Gaps = 3/88 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGG-GGGGSNGGSGHGGGFGGGV-GGGAGGVGGGGGGG 186
           GGGG     G L GGGG      GG GGGG   G G GGG GGG+ GGG GGVGGGGG G
Sbjct: 88  GGGGGAGGGGGLGGGGGKGGGFGGGVGGGGGGAGGGLGGGGGGGLGGGGGGGVGGGGGQG 147

Query: 187 GG-GGGGGAGGGSGHGGGFGAGGGVGSG 267
           GG G GGG GGGSG GGG G GGG G G
Sbjct: 148 GGFGAGGGVGGGSGTGGGLGGGGGGGFG 175

 Score =  100 bits (248), Expect = 7e-20
 Identities = 56/104 (53%), Positives = 60/104 (57%), Gaps = 17/104 (16%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGG---GDLYL*TGGGGGGSNG--------------GSGHGGGFGGG 141
           GGGG G+  G   GGG   G +     GGGGG  G              G G GGGFGGG
Sbjct: 210 GGGGGGFGGGGGKGGGFGAGGVMGGGAGGGGGLGGGGGGGMGGGGGSGMGGGAGGGFGGG 269

Query: 142 VGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGAG  GGGG GGGGGGG G GGG+G G G GAGGG+G G G
Sbjct: 270 AGGGAGQGGGGGLGGGGGGGLGGGGGAGGGLGGGAGGGLGHGGG 313

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 55/91 (60%), Positives = 56/91 (61%), Gaps = 4/91 (4%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   G GG       GGG G  GG G GGG GGG+GGG GG GGG GGG G
Sbjct: 252 GGGGSGMGGGAGGGFGGG-----AGGGAGQGGGGGLGGGGGGGLGGG-GGAGGGLGGGAG 305

Query: 193 GG---GGGAGGGSGHGGGFGAGG-GVGSGNG 273
           GG   GGG GGG GHGGG G GG GVG G G
Sbjct: 306 GGLGHGGGLGGGLGHGGGLGGGGFGVGVGVG 336

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 56/100 (56%), Positives = 59/100 (59%), Gaps = 13/100 (13%)
 Frame = +1

Query: 13  GGGGDGYSY---GFLAGGGGDL--YL*TGGGGGGSNGGSGHGGGFGGGVGG--------G 153
           GGGG G+     G L GGGG    +   GG GG + GG G GGG GGG GG        G
Sbjct: 168 GGGGGGFGGDGGGGLGGGGGKGGGFGAGGGVGGAAGGGGGMGGGGGGGFGGGGGKGGGFG 227

Query: 154 AGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           AGGV GGG GGGGG GGG GGG G GGG G GGG G G G
Sbjct: 228 AGGVMGGGAGGGGGLGGGGGGGMGGGGGSGMGGGAGGGFG 267

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 51/87 (58%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGG--FGGGVGGGAGGVGGGGGGG 186
           GGGG G   G  +G GG      GG GGG+ GG+G GGG   GGG GGG GG GG GGG 
Sbjct: 244 GGGGGGMGGGGGSGMGGGA---GGGFGGGAGGGAGQGGGGGLGGGGGGGLGGGGGAGGGL 300

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSG 267
           GGG GGG G G G GGG G GGG+G G
Sbjct: 301 GGGAGGGLGHGGGLGGGLGHGGGLGGG 327

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 53/90 (58%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGG---AGGVGGGGGG 183
           GG G G   G   GGGG L    GGGGGG  GG G GGG GGG GGG    GG+GGG G 
Sbjct: 264 GGFGGGAGGGAGQGGGGGL---GGGGGGGLGGGGGAGGGLGGGAGGGLGHGGGLGGGLGH 320

Query: 184 GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGGG G G G G G G GGG G+G G
Sbjct: 321 GGGLGGGGFGVGVGVGVGVGFGGGAGAGGG 350

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 50/85 (58%), Positives = 52/85 (61%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GG G G   G   GGGG L    GG GGG  GG+G G G GGG+GGG G  GGG GGGG 
Sbjct: 272 GGAGQGGGGGLGGGGGGGLGG-GGGAGGGLGGGAGGGLGHGGGLGGGLGH-GGGLGGGGF 329

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSG 267
           G G G G G G GGG GAGGG G G
Sbjct: 330 GVGVGVGVGVGFGGGAGAGGGAGGG 354

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 44/84 (52%), Positives = 45/84 (53%), Gaps = 6/84 (7%)
 Frame = +1

Query: 40  GFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG------GGVGGGAGGVGGGGGGGGGGGG 201
           GF  GG G      G  G G   G GH   FG      GG GG  G  GGGGGG GGGGG
Sbjct: 32  GFGPGGFGH-----GPKGFGRGPGFGHDCRFGRCRGGGGGFGGDGGFGGGGGGGLGGGGG 86

Query: 202 GGAGGGSGHGGGFGAGGGVGSGNG 273
            G GGG+G GGG G GGG G G G
Sbjct: 87  FGGGGGAGGGGGLGGGGGKGGGFG 110

[36][TOP]
>UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1
            Tax=Ostreococcus tauri RepID=Q010M7_OSTTA
          Length = 1449

 Score =  123 bits (309), Expect = 6e-27
 Identities = 54/93 (58%), Positives = 60/93 (64%), Gaps = 5/93 (5%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPP-PPPTP-PAPPPTPPPNPPPCPDPPLE 99
            P P P PPP+  PPP P PPP+PPP P PPPPP PPP P P PPP+PPP+PPP P PP  
Sbjct: 828  PPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPS 887

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSP---PPPV 9
            PPPPP      SPPP +  P   P P   PPP+
Sbjct: 888  PPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPL 920

 Score =  122 bits (306), Expect = 1e-26
 Identities = 50/83 (60%), Positives = 54/83 (65%)
 Frame = -2

Query: 260  PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
            P PPP P PPP P PP  P PPPPP PPPPP +PP P P+PPP+PPP P PP  P PPP 
Sbjct: 806  PPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPA 865

Query: 80   VYKYKSPPPPAKKPYEYPSPPPP 12
                  PPPP+  P   PSPPPP
Sbjct: 866  P---TPPPPPSPPPSPPPSPPPP 885

 Score =  121 bits (304), Expect = 2e-26
 Identities = 54/89 (60%), Positives = 60/89 (67%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPP--PPPTPPAPPPTPP--PNPPPCPDPPLE 99
            P P PPP+P PPP P  PP+PPPPP PPPPP  PPP  P+PPP+PP  P+PPP P+PP  
Sbjct: 806  PPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPA 865

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P PPPP     SPPP    P   PSPPPP
Sbjct: 866  PTPPPPPSPPPSPPPSPPPP---PSPPPP 891

 Score =  120 bits (301), Expect = 5e-26
 Identities = 53/87 (60%), Positives = 55/87 (63%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PP  P PPP P PPP PPPPP PPPPP PPTPP+PPP P P PPP   PP  P 
Sbjct: 787  PPPSPPPPLPPSPPPPPSPPP-PPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPS 845

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPP      SPPPP   P   P+PPPP
Sbjct: 846  PPPSPPPAPSPPPPPNPP-PAPTPPPP 871

 Score =  120 bits (301), Expect = 5e-26
 Identities = 50/87 (57%), Positives = 53/87 (60%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P+PPP+P P P P PPP PPP P PPPPP PP  P P P PPP+PPP P PP  P 
Sbjct: 840  PPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPS 899

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPP      S PPP   P    SPPPP
Sbjct: 900  PPPSSNPPLSSPPPLSSPPPLSSPPPP 926

 Score =  120 bits (300), Expect = 6e-26
 Identities = 55/90 (61%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPP----PPPTPPAPPPTPPPNPPPCPDPP 105
            P P P PPP P  PP P PPP+PPPPP  PPPP    PP  PPAP P PPPNPPP P PP
Sbjct: 810  PPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPP 869

Query: 104  LEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
              PPP PP     SPPPP   P   PSPPP
Sbjct: 870  --PPPSPPPSPPPSPPPPPSPP-PPPSPPP 896

 Score =  118 bits (296), Expect = 2e-25
 Identities = 54/93 (58%), Positives = 60/93 (64%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPP--PNPPPCPDPPLE 99
            P P P+PPP P PPP P PPP P PPP PPP PPPP  P PPP+PP  P+PPP  +PPL 
Sbjct: 850  PPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLS 909

Query: 98   PPP----PPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PP    PPP+    SPPPP+  P   PSPP P
Sbjct: 910  SPPPLSSPPPL---SSPPPPSSPP--PPSPPLP 937

 Score =  117 bits (294), Expect = 3e-25
 Identities = 52/89 (58%), Positives = 54/89 (60%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAP--PPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
            P P P+PPPAP PPP P PPPAP  PPPP PPP PPP  PP P P PPP+PPP P PP  
Sbjct: 844  PSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPS 903

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PP       S PPP   P    SPPPP
Sbjct: 904  SNPPLSSPPPLSSPPPLSSPPPPSSPPPP 932

 Score =  108 bits (270), Expect = 2e-22
 Identities = 54/117 (46%), Positives = 59/117 (50%), Gaps = 30/117 (25%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPT---------------- 141
            P P PTPPP P PPP   PPP+PPPPP PPPPP PP  P+PPP+                
Sbjct: 862  PPPAPTPPPPPSPPP--SPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPP 919

Query: 140  ----PPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEY----------PSPPPP 12
                PPP+ PP P PPL P PP P      PPPP+  P             PSPPPP
Sbjct: 920  LSSPPPPSSPPPPSPPLPPSPPLPP---NPPPPPSPSPXXXXXXXPPRLPTPSPPPP 973

 Score =  100 bits (249), Expect = 5e-20
 Identities = 50/115 (43%), Positives = 55/115 (47%), Gaps = 28/115 (24%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPP--------------------------PPPP--PPP 177
            P P P+PPP+P PPP P PPP+PPP                          PPPP  PPP
Sbjct: 872  PSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPP 931

Query: 176  PPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P PP PP+PP  P P PPP P P       PP     SPPPP+      P PPPP
Sbjct: 932  PSPPLPPSPPLPPNPPPPPSPSPXXXXXXXPPRLPTPSPPPPSP-----PLPPPP 981

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 41/69 (59%), Positives = 46/69 (66%)
 Frame = -2

Query: 221 EPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKK 42
           + PP  PPPP PP PPPPP+P  PPP PPP+PPP P+PP  P PPPP      PPPP+  
Sbjct: 785 QSPPPSPPPPLPPSPPPPPSP--PPPPPPPSPPPPPNPPTPPSPPPPP---SPPPPPSSP 839

Query: 41  PYEYPSPPP 15
           P   PSPPP
Sbjct: 840 PPPSPSPPP 848

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 39/73 (53%), Positives = 42/73 (57%), Gaps = 11/73 (15%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPP----PPPPPTP-------PAPPPTPPPNP 126
            P PL +PPP   PPP   PPP  PP PP PP    PPPPP+P         PP  P P+P
Sbjct: 911  PPPLSSPPPLSSPPPPSSPPPPSPPLPPSPPLPPNPPPPPSPSPXXXXXXXPPRLPTPSP 970

Query: 125  PPCPDPPLEPPPP 87
            PP P PPL PPPP
Sbjct: 971  PP-PSPPLPPPPP 982

[37][TOP]
>UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2U1_EHV86
          Length = 2873

 Score =  123 bits (308), Expect = 7e-27
 Identities = 55/87 (63%), Positives = 60/87 (68%), Gaps = 4/87 (4%)
 Frame = -2

Query: 260  PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPP--TPPPNPPPCPDPPLEPP-- 93
            P+PPP P PPP P PPP+PPP PPP PPPP P PP+PPP   PPP+PPP P PP  PP  
Sbjct: 2668 PSPPPPPSPPPSP-PPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPS 2726

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP     SPPPP+  P   PSPPPP
Sbjct: 2727 PPPPSPPPPSPPPPSPPP---PSPPPP 2750

 Score =  122 bits (306), Expect = 1e-26
 Identities = 59/95 (62%), Positives = 66/95 (69%), Gaps = 7/95 (7%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPP-PCPEPPPAPPPP-PPPP-PPPPPPTPPAPPPTPPP--NPPPCPDP 108
            P P P+PPP+P PP P P PPP+PPPP PPPP PPPP P PP+PPP+PPP   PPP P P
Sbjct: 2670 PPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPP 2729

Query: 107  PLEPP--PPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            P  PP  PPPP     SPPPP+  P   PSPPPP+
Sbjct: 2730 PSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPL 2761

 Score =  122 bits (305), Expect = 2e-26
 Identities = 53/87 (60%), Positives = 55/87 (63%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P  PP P PPP P PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 2701 PSPPPPSPPPPSPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2759

Query: 92   PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P PP     SPPP    P   PSPPPP
Sbjct: 2760 PLPPA---PSPPPSPPPPSPPPSPPPP 2783

 Score =  120 bits (301), Expect = 5e-26
 Identities = 55/92 (59%), Positives = 58/92 (63%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPP--PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
            P P P+PPP+P PP  P P PPP  PPPP PPP PPPP+PP P P PP  PPP P PP  
Sbjct: 2683 PSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2742

Query: 98   PP--PPPPVYKYKSPPPP-AKKPYEYPSPPPP 12
            PP  PPPP     SPPPP    P   PSPPPP
Sbjct: 2743 PPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPP 2774

 Score =  119 bits (298), Expect = 1e-25
 Identities = 56/91 (61%), Positives = 62/91 (68%), Gaps = 6/91 (6%)
 Frame = -2

Query: 266  PLPTPPPAPKP-PPCPEPPPAPPP-PPPPPPPPPPPTPPA-PPPTPPPNPPPCPDPPLEP 96
            P P PPP+P P PP P PPP+PPP PPPP PPPP P PP+ PPP+PPP+PPP   PP  P
Sbjct: 2668 PSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSP 2727

Query: 95   P---PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P   PPPP     SPPPP+  P   PSPPPP
Sbjct: 2728 PPPSPPPPSPPPPSPPPPSPPP---PSPPPP 2755

 Score =  111 bits (278), Expect = 2e-23
 Identities = 46/75 (61%), Positives = 50/75 (66%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P+PPP   PPP P PPP+PPPP PPPP PPPP+PP P P PP  PPP P  P  PP
Sbjct: 2711 PSPPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPP 2769

Query: 92   PPPPVYKYKSPPPPA 48
             PPP     SPPPP+
Sbjct: 2770 SPPPPSPPPSPPPPS 2784

 Score =  110 bits (274), Expect = 6e-23
 Identities = 47/81 (58%), Positives = 52/81 (64%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
           P+PPP P PPP P PPP PPPP PPPP PPPP PP+PPP  PP PPP P PP  PPPPPP
Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPP-PSPP--PPPPPP 259

Query: 80  VYKYKSPPPPAKKPYEYPSPP 18
           +     P P  +  + Y   P
Sbjct: 260 L-----PTPTGRSCFSYAIGP 275

 Score =  108 bits (269), Expect = 2e-22
 Identities = 51/88 (57%), Positives = 57/88 (64%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
            P P+PPP P P P P PPP  PPPP PPPP PPP+PP PPPTPPP+PPP       P PP
Sbjct: 2253 PPPSPPP-PSPHP-PSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPP-------PSPP 2303

Query: 86   PPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
            PP     SPPPP+  P   PS PPP ++
Sbjct: 2304 PP-----SPPPPSPPP---PSQPPPCHQ 2323

 Score =  107 bits (267), Expect = 4e-22
 Identities = 48/77 (62%), Positives = 51/77 (66%), Gaps = 3/77 (3%)
 Frame = -2

Query: 233  PPCPEPPPAPP--PPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP-PPPPVYKYKS 63
            PP P PPP+PP  PPPP PPP PPP+PP P P PP  PPP P PP  PP PPPP     S
Sbjct: 2667 PPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPS 2726

Query: 62   PPPPAKKPYEYPSPPPP 12
            PPPP+  P   PSPPPP
Sbjct: 2727 PPPPSPPP---PSPPPP 2740

 Score =  107 bits (266), Expect = 5e-22
 Identities = 44/72 (61%), Positives = 48/72 (66%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP+PPPP PPPPPPP P PP+PPP PPP+PPP P PPL  P
Sbjct: 205 PPPPPPPPPLPPPPP-PPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTP 263

Query: 92  PPPPVYKYKSPP 57
                + Y   P
Sbjct: 264 TGRSCFSYAIGP 275

 Score =  102 bits (255), Expect = 1e-20
 Identities = 46/75 (61%), Positives = 50/75 (66%), Gaps = 3/75 (4%)
 Frame = -2

Query: 227  CPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP--NPPPCPDPPLEPPP-PPPVYKYKSPP 57
            C +PP  PPPP PPP PPPP  PP+PPP+PPP   PPP P PP  PPP PPP     SPP
Sbjct: 2664 CIKPPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPP 2723

Query: 56   PPAKKPYEYPSPPPP 12
            PP+  P   PSPPPP
Sbjct: 2724 PPSPPP---PSPPPP 2735

 Score =  101 bits (251), Expect = 3e-20
 Identities = 39/61 (63%), Positives = 41/61 (67%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P  PP P PPP   PPP PPP PPPPPP PPP+PP P P PP  PPP P PP +PP
Sbjct: 2260 PSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQPP 2319

Query: 92   P 90
            P
Sbjct: 2320 P 2320

 Score =  100 bits (249), Expect = 5e-20
 Identities = 42/64 (65%), Positives = 45/64 (70%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P  PP P PPP   PPP+PPPP PPPP PPPP PPA  P+PPP+PPP P PP  PP
Sbjct: 2725 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPA--PSPPPSPPP-PSPPPSPP 2781

Query: 92   PPPP 81
            PP P
Sbjct: 2782 PPSP 2785

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 41/63 (65%), Positives = 46/63 (73%), Gaps = 1/63 (1%)
 Frame = -2

Query: 260  PTPPPAPKPP-PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPP 84
            P  PP+P PP P P PPP+PPPP PPPP PPPP+P  PPP+PPP+PPP   PP  PPP P
Sbjct: 2526 PCSPPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSP--PPPSPPPSPPPPSPPPSPPPPSP 2583

Query: 83   PVY 75
            P Y
Sbjct: 2584 PPY 2586

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 38/64 (59%), Positives = 43/64 (67%)
 Frame = -2

Query: 260  PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
            P  PP P PPP P P P PP PPPP PPPP P PP+PPP+PPP  PP   PP  PPP PP
Sbjct: 2529 PPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYPP 2588

Query: 80   VYKY 69
             +++
Sbjct: 2589 CHEF 2592

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 45/75 (60%), Positives = 47/75 (62%), Gaps = 1/75 (1%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPP-PPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
            P P P PPP+P PP  P P P PP PPPP PPP PPP PP PPP+PPP  PP P PP   
Sbjct: 2253 PPPSP-PPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPS 2311

Query: 95   PPPPPVYKYKSPPPP 51
            PPPP      S PPP
Sbjct: 2312 PPPP------SQPPP 2320

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 42/69 (60%), Positives = 45/69 (65%)
 Frame = -2

Query: 242  PKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKS 63
            P  PP P PPP+PPP PPP PPPP P PP+PPP  PP P P P PP  PP PPP     S
Sbjct: 2526 PCSPPSP-PPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPP--PPSPPP-----S 2577

Query: 62   PPPPAKKPY 36
            PPPP+  PY
Sbjct: 2578 PPPPSPPPY 2586

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 40/62 (64%), Positives = 42/62 (67%)
 Frame = -2

Query: 197 PPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPP 18
           P PPPPPPPPP PP PPP PPP+PP    PP  PPPPPP     SPPPP+  P   PSPP
Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPP----PPSPPPPPPP-----SPPPPSPPPPPPPSPP 253

Query: 17  PP 12
           PP
Sbjct: 254 PP 255

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 34/52 (65%), Positives = 35/52 (67%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPC 117
            P P P  PP P PPP P PPP  PPP PPPP PPPP+PP P P PP  PPPC
Sbjct: 2270 PSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQPPPC 2321

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 39/70 (55%), Positives = 44/70 (62%)
 Frame = -2

Query: 263  LPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPP 84
            + + P +P  PP P PPP+PPP PP  PP PPP  P PP  PPP+PPP P PP  PP PP
Sbjct: 2522 ISSDPCSPPSPPPPSPPPSPPPSPP--PPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPP 2579

Query: 83   PVYKYKSPPP 54
            P     SPPP
Sbjct: 2580 P----PSPPP 2585

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 39/59 (66%), Positives = 44/59 (74%), Gaps = 1/59 (1%)
 Frame = -2

Query: 266  PLPTPPPAPKP-PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P+PPP+P P PP P PPP  PPPP PPPP PPP+P  PPP+PPP+PPP P PP  PP
Sbjct: 2533 PPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSP--PPPSPPPSPPP-PSPPPYPP 2588

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 1/57 (1%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPP-PPPPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
            P P P+PPP+P PPP P PPP+PPPP PPPP PPP P PP+PPP+PPP  PP P PP
Sbjct: 2535 PSPPPSPPPSP-PPPLP-PPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPP-PYPP 2588

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 33/54 (61%), Positives = 35/54 (64%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
            P P+PPP   PPP P PP  PPP PPPP PP P  PP+PPP  PP  PP P PP
Sbjct: 2733 PPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPP 2786

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 37/65 (56%), Positives = 39/65 (60%)
 Frame = -2

Query: 206  PPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYP 27
            P  PP PPPP PPP+PP  PP P P PPP P PP  PPP PP     SPPPP+  P   P
Sbjct: 2526 PCSPPSPPPPSPPPSPPPSPPPPLP-PPPSPPPPSPPPPSPP----PSPPPPSPPPSPPP 2580

Query: 26   SPPPP 12
              PPP
Sbjct: 2581 PSPPP 2585

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 31/43 (72%), Positives = 34/43 (79%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTP 138
            P P PPP+P PPP P PPP+PPPP PPPP PPPP+PP PPP P
Sbjct: 1173 PSPPPPPSP-PPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLP 1214

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 31/46 (67%), Positives = 33/46 (71%)
 Frame = -2

Query: 233  PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
            PP P PPP+PPPP PPPPP PPP  P PP  PPP+PPP P  PL P
Sbjct: 1172 PPSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLPLIP 1217

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 35/64 (54%), Positives = 39/64 (60%)
 Frame = -2

Query: 203  PPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPS 24
            PP PPPPP PPPP+PP PP  PPP+PPP   PP  PPPPPP+     P  P     +Y S
Sbjct: 1172 PPSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPL-----PLIPGGWKGQYVS 1226

Query: 23   PPPP 12
              PP
Sbjct: 1227 IFPP 1230

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 32/46 (69%), Positives = 34/46 (73%)
 Frame = -2

Query: 251  PPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCP 114
            PP+P PPP P PP  PPPP PPPP PPPP P  PPP+PPP PPP P
Sbjct: 1172 PPSPPPPPSPPPPSPPPPPSPPPPSPPPPLP--PPPSPPP-PPPLP 1214

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 31/46 (67%), Positives = 34/46 (73%)
 Frame = -2

Query: 215  PPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPV 78
            PP+PPPPP PPPP PPP P  PPP+PPP  PP P PP  PPPP P+
Sbjct: 1172 PPSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPP--PPPPLPL 1215

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 29/48 (60%), Positives = 31/48 (64%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPN 129
            P P P  PP P PPP   PPP PP P PPP PPPP  PP+PPP  PP+
Sbjct: 2740 PSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPPD 2787

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 33/58 (56%), Positives = 35/58 (60%)
 Frame = -2

Query: 224  PEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPP 51
            P PPP P PPPP PPPPP P PP+PPP  PP P P P PPL   P     +Y S  PP
Sbjct: 1173 PSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLPLIPGGWKGQYVSIFPP 1230

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 27/41 (65%), Positives = 29/41 (70%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP 150
            P P P+PPP   PPP   PPP+PPPP PPPP PPPP PP P
Sbjct: 1175 PPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPP-PPLP 1214

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 26/42 (61%), Positives = 27/42 (64%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPP 147
            P P   PPP+P PPP P PP  PPP PPPP PPPPP  P  P
Sbjct: 1176 PPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLPLIP 1217

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 22/37 (59%), Positives = 22/37 (59%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPT 162
            P P P PP  P P P P PPP  PPP PPPP PP  T
Sbjct: 2753 PPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPPDRT 2789

[38][TOP]
>UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum
           bicolor RepID=C5XPK9_SORBI
          Length = 613

 Score =  123 bits (308), Expect = 7e-27
 Identities = 55/92 (59%), Positives = 61/92 (66%), Gaps = 2/92 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP-PAPPPPPPPPPPPPPPTPPAP-PPTPPPNPPPCPDPPLE 99
           P P P+PPP   PPP P PP P+PPPP PPPP PPPP+PP P PP P P+PPP   PP  
Sbjct: 420 PPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPS 479

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
           PPPP P     SPPPP+  P   PSPPPP Y+
Sbjct: 480 PPPPSPSPPPPSPPPPSPPP-PSPSPPPPYYE 510

 Score =  122 bits (306), Expect = 1e-26
 Identities = 53/89 (59%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPT--PPPNPPPCPDPPLE 99
           P P P+PPP   PPP P PPP  PPPP PPPP P P PP+PPP   PPP+PPP   PP  
Sbjct: 408 PLPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPS 467

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PPPP     SPPPP+  P   PSPPPP
Sbjct: 468 PSPPPPSPPPPSPPPPSPSP-PPPSPPPP 495

 Score =  115 bits (289), Expect = 1e-24
 Identities = 55/103 (53%), Positives = 60/103 (58%), Gaps = 13/103 (12%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPP---PPPPPPTPPAPPP----TPPPNPPPCP 114
           P P P+PPP   PPP P PP  PPP PPPP   PPPP P PP+PPP     PPP+PPP  
Sbjct: 437 PPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPS 496

Query: 113 DPPLEPPPPPPVY------KYKSPPPPAKKPYEYPSPPPPVYK 3
            PP  P PPPP Y      +Y SPPPPA        PPPP Y+
Sbjct: 497 PPPPSPSPPPPYYEVSPEERYLSPPPPAYTEV----PPPPYYE 535

 Score =  115 bits (288), Expect = 2e-24
 Identities = 51/86 (59%), Positives = 54/86 (62%)
 Frame = -2

Query: 269 FPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
           F LP+PP  P  PP P PPP  P PPPP PPPP P PP+P P PP  PPP P PP  PPP
Sbjct: 402 FVLPSPPLPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPP-SPPP 460

Query: 89  PPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P P     SPPPP+  P   PSPPPP
Sbjct: 461 PSPPPPSPSPPPPSPPP---PSPPPP 483

 Score =  114 bits (286), Expect = 3e-24
 Identities = 56/100 (56%), Positives = 60/100 (60%), Gaps = 11/100 (11%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPP-PPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P   PPP+P PPP P PPP  PPPP PPPP PPPP+P  PPP+PPP  PP P P   P
Sbjct: 431 PPPPSPPPPSPSPPP-PSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPP 489

Query: 95  PPPPPVYKYKSPPPPAKKP----YE------YPSPPPPVY 6
           P PPP     SPPPP+  P    YE      Y SPPPP Y
Sbjct: 490 PSPPP----PSPPPPSPSPPPPYYEVSPEERYLSPPPPAY 525

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 52/111 (46%), Positives = 60/111 (54%), Gaps = 21/111 (18%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPP---PPPPPPPPPPTPPAPPPTPPP---------- 132
           P P   PPP+P PPP   PPP+PPPP   PPPP  PPPP+PP P P+PPP          
Sbjct: 458 PPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPP-SPPPPSPPPPSPSPPPPYYEVSPEER 516

Query: 131 --NPPPCPDPPLEPPPPPPVY------KYKSPPPPAKKPYEYPSPPPPVYK 3
             +PPP   P     PPPP Y      +Y SPPPP   P  +  PPPP Y+
Sbjct: 517 YLSPPP---PAYTEVPPPPYYEVSPEDRYLSPPPP---PVHHDPPPPPYYE 561

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 55/128 (42%), Positives = 59/128 (46%), Gaps = 41/128 (32%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP------------PPPPPPPPTPPAP------- 150
           P P P+PPP   PPP P PPP+P PPPP            PPPP     PP P       
Sbjct: 481 PPPSPSPPPPSPPPPSP-PPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPPPYYEVSPE 539

Query: 149 ----PPTPPP---NPPPCP-------DPPLEPPPPPPV----YKYKSPPPPAKKP----Y 36
                P PPP   +PPP P       D  L PPPP P     Y Y SPPPP   P    Y
Sbjct: 540 DRYLSPPPPPVHHDPPPPPYYEVSPEDRYLSPPPPSPASLPKYDYSSPPPPRALPKLPVY 599

Query: 35  EYPSPPPP 12
           +Y SPPPP
Sbjct: 600 DYSSPPPP 607

[39][TOP]
>UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri
           RepID=SSGP_VOLCA
          Length = 485

 Score =  123 bits (308), Expect = 7e-27
 Identities = 52/81 (64%), Positives = 57/81 (70%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
           P+PPP+P+PP  P P P+PPPPPPPPPPPPPP PP+PPP PPP PPP P PP  PP P P
Sbjct: 242 PSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP--PPSPSP 299

Query: 80  VYKYKSPPPPAKKPYEYPSPP 18
             K  SP PP   P   PSPP
Sbjct: 300 PRKPPSPSPPVPPP---PSPP 317

 Score =  117 bits (292), Expect = 5e-25
 Identities = 53/92 (57%), Positives = 54/92 (58%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272 PFPLPTPPPA-----PKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP 108
           P P P+P P      P PPP P PP  PPP P PPPPPPPP PP PPP P P PPP P P
Sbjct: 228 PLP-PSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPP 286

Query: 107 PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P  PPPPPP     SP PP K P   P  PPP
Sbjct: 287 PPPPPPPPP-----SPSPPRKPPSPSPPVPPP 313

 Score =  115 bits (287), Expect = 2e-24
 Identities = 50/79 (63%), Positives = 53/79 (67%), Gaps = 4/79 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPP---PPPTPPAPPPTPPPNPPPCPDPPL 102
           P P P+P P   PPP P PPP PPPPPPPPPPP   PPP PP PPP PPP PPP P PP 
Sbjct: 242 PSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPR 301

Query: 101 EPP-PPPPVYKYKSPPPPA 48
           +PP P PPV     PPPP+
Sbjct: 302 KPPSPSPPV-----PPPPS 315

 Score =  112 bits (280), Expect = 1e-23
 Identities = 43/64 (67%), Positives = 45/64 (70%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P+PPP P PPP P PPP P PPPPPPPPPPPP PP PP   PP  PP P PP+ PP
Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPP 313

Query: 92  PPPP 81
           P PP
Sbjct: 314 PSPP 317

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 43/85 (50%), Positives = 48/85 (56%), Gaps = 3/85 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP---PPPPPPPPTPPAPPPTPPPNPPPCPDPPL 102
           P P P PPP P PPP P PPP+PPPPPP   PPPPPPPP  P+PP  PP   PP P PP 
Sbjct: 256 PSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPS 315

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYP 27
            P   P    +      ++ P  YP
Sbjct: 316 PPSVLPAATGFPFCECVSRSPSSYP 340

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 44/79 (55%), Positives = 46/79 (58%)
 Frame = -2

Query: 248 PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKY 69
           PAP   P P P P P     PP PPP P PP+PPP P P+PPP P PP  PPPPPP    
Sbjct: 222 PAPNNSPLP-PSPQPTASSRPPSPPPSPRPPSPPP-PSPSPPPPPPPPPPPPPPPP---- 275

Query: 68  KSPPPPAKKPYEYPSPPPP 12
            SPPPP   P   P PPPP
Sbjct: 276 PSPPPPPPPPPPPPPPPPP 294

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 35/69 (50%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = -2

Query: 215 PPAPPPPPPPPPPPPPPTPPAPPPTPPPNP-PPCPDPPLEPPPPPPVYKYKSPPPPAKKP 39
           P  P P   P PP P PT  + PP+PPP+P PP P PP   PPPPP      PPPP   P
Sbjct: 219 PIGPAPNNSPLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSP 278

Query: 38  YEYPSPPPP 12
              P PPPP
Sbjct: 279 PPPPPPPPP 287

[40][TOP]
>UniRef100_UPI000155382B PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI000155382B
          Length = 492

 Score =  122 bits (306), Expect = 1e-26
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGGDG   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 221 GGGGDGGGRGGGGGGGG------GGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 274

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 275 GGGGGGGGGGGGGGGGGGGGGGGGGGG 301

 Score =  122 bits (305), Expect = 2e-26
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGGDG   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 240 GGGGDGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 293

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 294 GGGGGGGGGGGGGGGGGGGGGGGGGGG 320

 Score =  121 bits (304), Expect = 2e-26
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GGVGGGGGGGGG
Sbjct: 115 GGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGG 174

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 175 GGGGGGGGGGGGGGGGGGGGGGGGGGG 201

 Score =  120 bits (302), Expect = 4e-26
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 270 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 323

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG GSG G
Sbjct: 324 GGGGGGGGGGGGGGGGGGGGGGGSGGG 350

 Score =  120 bits (302), Expect = 4e-26
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 284 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 337

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGGSG GGG G GGG G G G
Sbjct: 338 GGGGGGGGGSGGGGGGGGGGGGGGGGG 364

 Score =  120 bits (302), Expect = 4e-26
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GGSG GGG GGG GGG GG GGGGGGGGG
Sbjct: 320 GGGGGGGGGGGGGGGGG------GGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGG 373

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 374 GGGGGGGGGGGGGGGGGGGGGGGGGGG 400

 Score =  120 bits (302), Expect = 4e-26
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGGS GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 324 GGGGGGGGGGGGGGGGG------GGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 377

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 378 GGGGGGGGGGGGGGGGGGGGGGGGGGG 404

 Score =  120 bits (302), Expect = 4e-26
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G S G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 340 GGGGGGGSGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 393

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 394 GGGGGGGGGGGGGGGGGGGGGGGGGGG 420

 Score =  120 bits (301), Expect = 5e-26
 Identities = 60/87 (68%), Positives = 60/87 (68%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGGVGGG GGVGGGGGGGGG
Sbjct: 82  GGGGGGGGSGGGGGGGG------GGGGGGGGGGGGGGGGGGGGVGGG-GGVGGGGGGGGG 134

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGG 161

 Score =  120 bits (300), Expect = 6e-26
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G S G   GGGG      GGGGGG  GG G GGG GGG GGG GGVGGGGG GGG
Sbjct: 73  GGGGGGGSGGGGGGGGGS----GGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGG 128

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 129 GGGGGGGGGGGGGGGGGGGGGGGGGGG 155

 Score =  120 bits (300), Expect = 6e-26
 Identities = 58/87 (66%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG     +GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 330 GGGGGGGGGGGGGGGGG-----SGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 384

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 385 GGGGGGGGGGGGGGGGGGGGGGGGGGG 411

 Score =  120 bits (300), Expect = 6e-26
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 336 GGGGGGGGGGGSGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 389

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 390 GGGGGGGGGGGGGGGGGGGGGGGGGGG 416

 Score =  119 bits (299), Expect = 8e-26
 Identities = 58/87 (66%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 288 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 341

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG+GGG G GGG G GGG G G G
Sbjct: 342 GGGGGSGGGGGGGGGGGGGGGGGGGGG 368

 Score =  119 bits (299), Expect = 8e-26
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 327 GGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 386

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 387 GGGGGGGGGGGGGGGGGGGGGGGGGGG 413

 Score =  119 bits (299), Expect = 8e-26
 Identities = 58/87 (66%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G  +GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 335 GGGGGGGGGGGGSGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 388

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 389 GGGGGGGGGGGGGGGGGGGGGGGGGGG 415

 Score =  119 bits (299), Expect = 8e-26
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 337 GGGGGGGGGGSGGGGGGG-----GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 391

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 392 GGGGGGGGGGGGGGGGGGGGGGGGGGG 418

 Score =  119 bits (299), Expect = 8e-26
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 339 GGGGGGGGSGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 392

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 393 GGGGGGGGGGGGGGGGGGGGGGGGGGG 419

 Score =  119 bits (299), Expect = 8e-26
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 343 GGGGSGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 396

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 397 GGGGGGGGGGGGGGGGGGGGGGGGGGG 423

 Score =  119 bits (299), Expect = 8e-26
 Identities = 58/88 (65%), Positives = 59/88 (67%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGG
Sbjct: 347 SGGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 400

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGG GGG G GGG G GGG G G G
Sbjct: 401 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 428

 Score =  119 bits (298), Expect = 1e-25
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGGD     GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 230 GGGGGGGGGG---GGGGD-----GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 281

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 282 GGGGGGGGGGGGGGGGGGGGGGGGGGG 308

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 233 GGGGGGGGGGGDGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 286

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 287 GGGGGGGGGGGGGGGGGGGGGGGGGGG 313

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 234 GGGGGGGGGGDGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 287

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 288 GGGGGGGGGGGGGGGGGGGGGGGGGGG 314

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 236 GGGGGGGGDGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 289

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 290 GGGGGGGGGGGGGGGGGGGGGGGGGGG 316

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 245 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 298

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 299 GGGGGGGGGGGGGGGGGGGGGGGGGGG 325

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 247 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 300

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 301 GGGGGGGGGGGGGGGGGGGGGGGGGGG 327

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 248 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 301

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 302 GGGGGGGGGGGGGGGGGGGGGGGGGGG 328

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 249 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 302

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 303 GGGGGGGGGGGGGGGGGGGGGGGGGGG 329

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 250 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 303

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 304 GGGGGGGGGGGGGGGGGGGGGGGGGGG 330

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 251 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 304

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 305 GGGGGGGGGGGGGGGGGGGGGGGGGGG 331

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 252 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 305

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 306 GGGGGGGGGGGGGGGGGGGGGGGGGGG 332

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 328 GGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 387

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 388 GGGGGGGGGGGGGGGGGGGGGGGGGGG 414

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 341 GGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 400

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 401 GGGGGGGGGGGGGGGGGGGGGGGGGGG 427

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 350 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 403

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 404 GGGGGGGGGGGGGGGGGGGGGGGGGGG 430

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 351 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 404

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 405 GGGGGGGGGGGGGGGGGGGGGGGGGGG 431

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 352 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 405

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 406 GGGGGGGGGGGGGGGGGGGGGGGGGGG 432

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 353 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 406

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 407 GGGGGGGGGGGGGGGGGGGGGGGGGGG 433

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 354 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 407

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 408 GGGGGGGGGGGGGGGGGGGGGGGGGGG 434

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 355 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 408

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 409 GGGGGGGGGGGGGGGGGGGGGGGGGGG 435

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 356 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 409

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 410 GGGGGGGGGGGGGGGGGGGGGGGGGGG 436

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 357 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 410

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 411 GGGGGGGGGGGGGGGGGGGGGGGGGGG 437

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 358 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 411

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 412 GGGGGGGGGGGGGGGGGGGGGGGGGGG 438

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 359 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 412

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 413 GGGGGGGGGGGGGGGGGGGGGGGGGGG 439

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 360 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 413

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 414 GGGGGGGGGGGGGGGGGGGGGGGGGGG 440

 Score =  118 bits (296), Expect = 2e-25
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGGVGGG GG GGGGGGGGG
Sbjct: 128 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGVGGGGGG-GGGGGGGGG 180

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 181 GGGGGGGGGGGGGGGGGGGGGGGGGGG 207

 Score =  118 bits (296), Expect = 2e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 232 GGGGGGGGGGGGDGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 285

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 286 GGGGGGGGGGGGGGGGGGGGGGGGGGG 312

 Score =  118 bits (295), Expect = 2e-25
 Identities = 59/89 (66%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGG-GGGGG 186
           +GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GG GGGGG
Sbjct: 41  SGGGGRGGGSGGGGGGGGG-----GGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGG 95

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGG GGG G GGG G GGGVG G G
Sbjct: 96  GGGGGGGGGGGGGGGGGGGGGGGVGGGGG 124

 Score =  118 bits (295), Expect = 2e-25
 Identities = 57/87 (65%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G + GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGG GGG
Sbjct: 154 GGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGG 213

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 214 GGGGGGGGGGGDGGGRGGGGGGGGGGG 240

 Score =  118 bits (295), Expect = 2e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 362 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 415

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 416 GGGGGGGGGGGGGGGGGGGGGGGGGVG 442

 Score =  117 bits (294), Expect = 3e-25
 Identities = 59/87 (67%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GGSG GGG GGG GGG GG GGGGGGGGG
Sbjct: 53  GGGGGGGGGGGGGGGGG------GGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGG 106

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG   GGG G GGGVG G G
Sbjct: 107 GGGGGGGGG---GGGVGGGGGVGGGGG 130

 Score =  117 bits (293), Expect = 4e-25
 Identities = 57/87 (65%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG +    GGGGGG  GG G GGG GGG GGG GG GGGGGGG G
Sbjct: 107 GGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVG 166

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 167 GGGGGGGGGGGGGGGGGGGGGGGGGGG 193

 Score =  117 bits (293), Expect = 4e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGG GGGGG
Sbjct: 190 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGG 249

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 250 GGGGGGGGGGGGGGGGGGGGGGGGGGG 276

 Score =  117 bits (292), Expect = 5e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 126 GGGGGGGGGG--GGGGG------GGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGG 177

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 178 GGGGGGGGGGGGGGGGGGGGGGGGGGG 204

 Score =  117 bits (292), Expect = 5e-25
 Identities = 58/87 (66%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG   +  GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 145 GGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 204

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 205 GGGGGRGGGGGGGGG-GGGGGDGGGRG 230

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGG GGGGG
Sbjct: 181 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGG 234

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 235 GGGGGGGGGDGGGGGGGGGGGGGGGGG 261

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 289 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 342

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGG  GGG G GGG G GGG G G G
Sbjct: 343 GGGGSGGGGGGGGGGGGGGGGGGGGGG 369

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 290 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 343

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG G GGG G GGG G GGG G G G
Sbjct: 344 GGGSGGGGGGGGGGGGGGGGGGGGGGG 370

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 291 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 344

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GG GGG G GGG G GGG G G G
Sbjct: 345 GGSGGGGGGGGGGGGGGGGGGGGGGGG 371

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 292 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 345

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGG GGG G GGG G GGG G G G
Sbjct: 346 GSGGGGGGGGGGGGGGGGGGGGGGGGG 372

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 293 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 346

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGG GGG G GGG G GGG G G G
Sbjct: 347 SGGGGGGGGGGGGGGGGGGGGGGGGGG 373

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGG 
Sbjct: 294 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGS 347

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 348 GGGGGGGGGGGGGGGGGGGGGGGGGGG 374

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGG G
Sbjct: 295 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSG 348

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 349 GGGGGGGGGGGGGGGGGGGGGGGGGGG 375

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGG GG
Sbjct: 296 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGG 349

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 350 GGGGGGGGGGGGGGGGGGGGGGGGGGG 376

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGG GGG
Sbjct: 297 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGG 350

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 351 GGGGGGGGGGGGGGGGGGGGGGGGGGG 377

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGG GGGG
Sbjct: 298 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGG 351

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 352 GGGGGGGGGGGGGGGGGGGGGGGGGGG 378

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGG GGGGG
Sbjct: 299 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGG 352

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 353 GGGGGGGGGGGGGGGGGGGGGGGGGGG 379

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GG GGGGGG
Sbjct: 300 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGG 353

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 354 GGGGGGGGGGGGGGGGGGGGGGGGGGG 380

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG G GGGGGGG
Sbjct: 301 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGG 354

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 355 GGGGGGGGGGGGGGGGGGGGGGGGGGG 381

 Score =  117 bits (292), Expect = 5e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG  GGGGGGGG
Sbjct: 302 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGG 355

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 356 GGGGGGGGGGGGGGGGGGGGGGGGGGG 382

 Score =  116 bits (291), Expect = 7e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   G GG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 215 GGGGGGGGGGDGGGRGG------GGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGG 268

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 269 GGGGGGGGGGGGGGGGGGGGGGGGGGG 295

 Score =  115 bits (288), Expect = 2e-24
 Identities = 58/88 (65%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG +    GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 147 GGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 206

Query: 193 GGG-GGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GG GGG G GGG G GGG G G G
Sbjct: 207 GGGRGGGGGGGGGGGGGGDGGGRGGGGG 234

 Score =  114 bits (284), Expect = 4e-24
 Identities = 56/87 (64%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG   +  GGG GG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 99  GGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 158

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG  GG G GGG G GGG G G G
Sbjct: 159 GGGGGGVGGGGGGGGGGGGGGGGGGGG 185

 Score =  114 bits (284), Expect = 4e-24
 Identities = 56/87 (64%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG +    G GGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 101 GGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 160

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGG  GGG G GGG G GGG G G G
Sbjct: 161 GGGGVGGGGGGGGGGGGGGGGGGGGGG 187

 Score =  110 bits (276), Expect = 4e-23
 Identities = 55/87 (63%), Positives = 55/87 (63%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GG GGGGGG
Sbjct: 157 GGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 216

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GG  G  GG G GGG G G G
Sbjct: 217 GGGGGGGGDGGGRGGGGGGGGGGGGGG 243

 Score =  108 bits (271), Expect = 1e-22
 Identities = 54/87 (62%), Positives = 55/87 (63%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG  G   G   GG G     +GGGGGG  GG G GGG GGG GGG GG G GGGGGGG
Sbjct: 31  GGGCSGCGGGSGGGGRGGG---SGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGG 87

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GG GGG G GGG G GGG G G G
Sbjct: 88  GGSGGGGGGGGGGGGGGGGGGGGGGGG 114

 Score =  107 bits (266), Expect = 5e-22
 Identities = 52/82 (63%), Positives = 53/82 (64%)
 Frame = +1

Query: 28  GYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGG 207
           GYS G   GG        GGG GG   G G GGG GGG GGG GG GGGGGGGGGGGGGG
Sbjct: 24  GYSGGSRGGGCSGC----GGGSGGGGRGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79

Query: 208 AGGGSGHGGGFGAGGGVGSGNG 273
           +GGG G GGG G GGG G G G
Sbjct: 80  SGGGGGGGGGSGGGGGGGGGGG 101

[41][TOP]
>UniRef100_UPI0001982D5B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982D5B
          Length = 1269

 Score =  122 bits (306), Expect = 1e-26
 Identities = 55/95 (57%), Positives = 57/95 (60%), Gaps = 9/95 (9%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPP---------PPPPPTPPAPPPTPPPNPPP 120
           P P   PPP P PPP P+PP APPPPPPPPP         PPPPP PP P P PP  PPP
Sbjct: 702 PKPPSAPPPPPPPPPAPKPPGAPPPPPPPPPTTKPLGAHPPPPPPPPPPPAPKPPGAPPP 761

Query: 119 CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            P PP  PPPPPP      PPPP K P   P+PPP
Sbjct: 762 PPKPPSAPPPPPPKPPGAPPPPPPKLP-GAPAPPP 795

 Score =  117 bits (294), Expect = 3e-25
 Identities = 57/99 (57%), Positives = 58/99 (58%), Gaps = 12/99 (12%)
 Frame = -2

Query: 272 PFPLPTPPP---APKPPPCPEPPPAPPPPP------PPPPPPPPPTPPA---PPPTPPPN 129
           P P P PPP   APKPP  P PPP PPP P      PPPPPPPP T P    PPP PPP 
Sbjct: 689 PPPHPPPPPPSLAPKPPSAPPPPPPPPPAPKPPGAPPPPPPPPPTTKPLGAHPPPPPPPP 748

Query: 128 PPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP P PP  PPPPP      +PPPP  KP   P PPPP
Sbjct: 749 PPPAPKPPGAPPPPPK--PPSAPPPPPPKPPGAPPPPPP 785

 Score =  105 bits (262), Expect = 2e-21
 Identities = 58/129 (44%), Positives = 59/129 (45%), Gaps = 42/129 (32%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPP-------PPPPPPP-------------PPPPPTPPA 153
           P P P PPP P P P P PPP PP       PPPPPPP             PPPPP PPA
Sbjct: 608 PPPPPPPPPLPGPSPPPPPPPPPPTSISSKGPPPPPPPPDFSSSSSNKPTLPPPPPPPPA 667

Query: 152 PP-----------------PTPPPNPPP-----CPDPPLEPPPPPPVYKYKSPPPPAKKP 39
           PP                   PPP+PPP      P PP  PPPPP       PPPPA KP
Sbjct: 668 PPLPMFSSSSSTSRSSSSHGVPPPHPPPPPPSLAPKPPSAPPPPP-------PPPPAPKP 720

Query: 38  YEYPSPPPP 12
              P PPPP
Sbjct: 721 PGAPPPPPP 729

 Score =  100 bits (250), Expect = 4e-20
 Identities = 49/96 (51%), Positives = 50/96 (52%), Gaps = 10/96 (10%)
 Frame = -2

Query: 272  PFPLPTPPPA-------PKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCP 114
            P P P PPP        P PPP P PPPAP PP  PPPPP PP+ P PPP  PP  PP P
Sbjct: 724  PPPPPPPPPTTKPLGAHPPPPPPPPPPPAPKPPGAPPPPPKPPSAPPPPPPKPPGAPPPP 783

Query: 113  DPPL---EPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
             P L     PPP  V     PPPP  K    P PPP
Sbjct: 784  PPKLPGAPAPPPSHVTVPGPPPPPGAKGTNAPPPPP 819

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 51/104 (49%), Positives = 54/104 (51%), Gaps = 22/104 (21%)
 Frame = -2

Query: 257 TPPPAPKPPPCPEPPPAPPPPPPPPP--------PPPPPTPPA---PPPTPPPNPPPCPD 111
           TPPP P PP      P+PPPPPPPPP        P  PPTP +   PPP PPP P P P 
Sbjct: 562 TPPPPPPPPISSNKAPSPPPPPPPPPLPNVSNGNPLMPPTPASRGPPPPPPPPPPLPGPS 621

Query: 110 PPLEPPPPPPV-YKYKSPPPP----------AKKPYEYPSPPPP 12
           PP  PPPPPP     K PPPP          + KP   P PPPP
Sbjct: 622 PPPPPPPPPPTSISSKGPPPPPPPPDFSSSSSNKPTLPPPPPPP 665

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 57/135 (42%), Positives = 57/135 (42%), Gaps = 50/135 (37%)
 Frame = -2

Query: 266  PLPTPPP--------APKPPPCPEPPPAPP-------------------PPPPPPPPPP- 171
            P P PPP         P  PP P PPPAPP                   PPP PPPPPP 
Sbjct: 640  PPPPPPPDFSSSSSNKPTLPPPPPPPPAPPLPMFSSSSSTSRSSSSHGVPPPHPPPPPPS 699

Query: 170  --------PPTPPAPPPTP-----PPNPPPCP---------DPPLEPPPPPPVYKYKSPP 57
                    PP PP PPP P     PP PPP P          PP  PPPPPP  K    P
Sbjct: 700  LAPKPPSAPPPPPPPPPAPKPPGAPPPPPPPPPTTKPLGAHPPPPPPPPPPPAPKPPGAP 759

Query: 56   PPAKKPYEYPSPPPP 12
            PP  KP   P PPPP
Sbjct: 760  PPPPKPPSAPPPPPP 774

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 54/119 (45%), Positives = 54/119 (45%), Gaps = 33/119 (27%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPP-------PPPPPPPPT--------PPAPPPTPPPNP 126
           P PPP P P P P PPP PPPPPP       PPPPPPPP         P  PPP PPP  
Sbjct: 608 PPPPPPPPPLPGPSPPPPPPPPPPTSISSKGPPPPPPPPDFSSSSSNKPTLPPPPPPPPA 667

Query: 125 PPCPD----------------PPLEPPPPPPVYKYKSP--PPPAKKPYEYPSPPPPVYK 3
           PP P                 PP  PPPPPP    K P  PPP       P PPPP  K
Sbjct: 668 PPLPMFSSSSSTSRSSSSHGVPPPHPPPPPPSLAPKPPSAPPP-------PPPPPPAPK 719

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 61/150 (40%), Positives = 63/150 (42%), Gaps = 65/150 (43%)
 Frame = -2

Query: 266  PLPTPPP-----APKPPPCPEPPPAP-----------------PPPPPPPPPP-----PP 168
            P P PPP     AP PPP P PPP P                 PPPPPPPPPP     PP
Sbjct: 564  PPPPPPPISSNKAPSPPPPPPPPPLPNVSNGNPLMPPTPASRGPPPPPPPPPPLPGPSPP 623

Query: 167  PTPPAPPPTP-----PPNPPPCPD------------PPLEPPPPPPVYKYKS-------- 63
            P PP PPPT      PP PPP PD            PP  PPP PP+  + S        
Sbjct: 624  PPPPPPPPTSISSKGPPPPPPPPDFSSSSSNKPTLPPPPPPPPAPPLPMFSSSSSTSRSS 683

Query: 62   ---------PPPP----AKKPYEYPSPPPP 12
                     PPPP    A KP   P PPPP
Sbjct: 684  SSHGVPPPHPPPPPPSLAPKPPSAPPPPPP 713

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 47/125 (37%), Positives = 50/125 (40%), Gaps = 40/125 (32%)
 Frame = -2

Query: 266 PLPTPPPAPKPP--------------PCPEPPPAPPP----------------------- 198
           P   PPP P PP              P   PPP PPP                       
Sbjct: 501 PTLPPPPPPLPPFAISGTIAPQAASLPSSAPPPLPPPLPGSALSMSQSYASNRNLLPPST 560

Query: 197 -PPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP--PPPPVYKYKSPPPPAKKPYEYP 27
             PPPPPPPP  +  AP P PPP PPP P+     P  PP P  +   PPPP   P   P
Sbjct: 561 STPPPPPPPPISSNKAPSPPPPPPPPPLPNVSNGNPLMPPTPASRGPPPPPPPPPPLPGP 620

Query: 26  SPPPP 12
           SPPPP
Sbjct: 621 SPPPP 625

[42][TOP]
>UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2Z7_EHV86
          Length = 516

 Score =  122 bits (306), Expect = 1e-26
 Identities = 56/96 (58%), Positives = 60/96 (62%), Gaps = 9/96 (9%)
 Frame = -2

Query: 272 PFPLPTPPPAPKP-PPCPEPPPAPPPPPPPP------PPPPPPTPPAPPPTPPPNPPPCP 114
           P P P PPP P P PP P PPP+PPPP PPP      PPPP P PP+PPP  PP+PPP P
Sbjct: 35  PSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSP 94

Query: 113 DPPLEPP--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP  PP  PPPP     SPPPP+  P   PSP PP
Sbjct: 95  PPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPP 130

 Score =  119 bits (299), Expect = 8e-26
 Identities = 53/88 (60%), Positives = 56/88 (63%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTP-PPNPPPCPDPPLEP 96
           P P P PP  P P P P PPP PPP PPPP PPP P PP PPP+P PP+PPP   PP  P
Sbjct: 23  PPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSP 82

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP P     SPPPP+  P   PSPPPP
Sbjct: 83  PPPSPPSPPPSPPPPSPPP---PSPPPP 107

 Score =  119 bits (297), Expect = 1e-25
 Identities = 52/89 (58%), Positives = 55/89 (61%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPP-PPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P+P P   PPP P PP  PPP PP PPP PPPP+PP P P PP  PPP P PP  P
Sbjct: 61  PLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 120

Query: 95  PPPPPVYKYKSPPPPAKKPYEY-PSPPPP 12
           P PPP     SPPPP+  P    PSPPPP
Sbjct: 121 PSPPPSPSPPSPPPPSPPPPSISPSPPPP 149

 Score =  118 bits (296), Expect = 2e-25
 Identities = 56/102 (54%), Positives = 61/102 (59%), Gaps = 15/102 (14%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP--PPPPPPPPTPP--------APPPTPPPNPP 123
           P P P  PP P PPP   PPP+PP PPP  PPP PPPP+PP         PPP+PPP+PP
Sbjct: 65  PSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPP 124

Query: 122 PCPDPPLEPPP-PPPVYKYKSPPPPA----KKPYEYPSPPPP 12
           P P PP  PPP PPP     SPPPP     + P   PSPPPP
Sbjct: 125 PSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPP 166

 Score =  118 bits (295), Expect = 2e-25
 Identities = 50/85 (58%), Positives = 53/85 (62%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P P PPP+P PP  P P P PP PPPP PP PPP+PP P P PP  PPP P PP  PPP 
Sbjct: 59  PPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 118

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP     SP PP+  P   PSPPPP
Sbjct: 119 PPPSPPPSPSPPSPPP---PSPPPP 140

 Score =  117 bits (294), Expect = 3e-25
 Identities = 55/89 (61%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPA-PPPTPPPNPPPCPDPPLEP 96
           P P P P P P PPP P PPP+PPP PPPP PPP P+PP+ PPP+PPP  PP P PP  P
Sbjct: 33  PPPSPPPLPPPLPPPSP-PPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPP 91

Query: 95  P-PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PPPP     SPPPP+  P   PSPPPP
Sbjct: 92  PSPPPPSPPPPSPPPPSPPP---PSPPPP 117

 Score =  117 bits (292), Expect = 5e-25
 Identities = 53/91 (58%), Positives = 57/91 (62%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEP--PPAPPPPPPPPPPPP--PPTPPAPPPTPPPNPPPCPDPP 105
           P P P  PP P PPP P P  PP+PPPP PPP PPP  PP  P+PP  PPP+PPP   PP
Sbjct: 25  PSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPP 84

Query: 104 LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PP PPP     SPPPP+  P   PSPPPP
Sbjct: 85  PSPPSPPPSPPPPSPPPPSPPP---PSPPPP 112

 Score =  113 bits (283), Expect = 6e-24
 Identities = 50/86 (58%), Positives = 53/86 (61%)
 Frame = -2

Query: 269 FPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
           +  P  PP P PPP   PPP+PPP PPP PPP PP P  PP  PPP PPP P PP  PPP
Sbjct: 16  YATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPP 75

Query: 89  PPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP     SPPPP+  P   PSPPPP
Sbjct: 76  SPPP---PSPPPPS-PPSPPPSPPPP 97

 Score =  111 bits (277), Expect = 3e-23
 Identities = 54/98 (55%), Positives = 61/98 (62%), Gaps = 11/98 (11%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTP---PAPPPTPPPNPPPCPDPPL 102
           P P P+PPP P PPP P PPP  PPPP PPPP PPP+P   P+PP  PPP+PPP    P 
Sbjct: 88  PSPPPSPPP-PSPPP-PSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPS 145

Query: 101 EPPPPPPVYK----YKSPPPPA----KKPYEYPSPPPP 12
            PPPPPP ++      SPPPP     + P   PSPPPP
Sbjct: 146 PPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPP 183

 Score =  102 bits (255), Expect = 1e-20
 Identities = 53/118 (44%), Positives = 58/118 (49%), Gaps = 31/118 (26%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPT-PPAPPPTPP---------PNPP 123
           P P P PP  P P P P PPP+P PP PPPP PPPP+  P+PPP PP         P+PP
Sbjct: 105 PPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPP 164

Query: 122 PCPDP--------PLEPPP-------------PPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P P P        P  PPP             PPP     SPPPP+  P   P PPPP
Sbjct: 165 PPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPP 222

 Score =  102 bits (254), Expect = 1e-20
 Identities = 49/95 (51%), Positives = 54/95 (56%), Gaps = 8/95 (8%)
 Frame = -2

Query: 272 PFPLPTPPP---APKPP----PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCP 114
           P   P+PPP   +P PP    P P PP A P PPPP PPPP P PP PPP PPP  PP P
Sbjct: 174 PSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSP 233

Query: 113 DPPLEPPPPPPVYK-YKSPPPPAKKPYEYPSPPPP 12
           +PP    P PP  +  +SPPPP       P PPPP
Sbjct: 234 NPPPSASPSPPFGRSLRSPPPP-------PPPPPP 261

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 52/128 (40%), Positives = 59/128 (46%), Gaps = 41/128 (32%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP----PCPEPP---PAPPPPPPP----------PPPPPPP------- 165
           P P P+PPP+P PP    P P PP   P+PPPPPPP          PPPPPPP       
Sbjct: 117 PSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSA 176

Query: 164 -----------------TPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPY 36
                            +P  PPP+  P+PPP   PP  PPPPPP      P PP+  P 
Sbjct: 177 SPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPP 236

Query: 35  EYPSPPPP 12
              SP PP
Sbjct: 237 PSASPSPP 244

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 46/81 (56%), Positives = 48/81 (59%), Gaps = 5/81 (6%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPL-----EP 96
           PTPPP P   P P PPP+PPPP PPPPPPPPP PP  PP+P P P   P PP       P
Sbjct: 195 PTPPP-PSASPSP-PPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSP 252

Query: 95  PPPPPVYKYKSPPPPAKKPYE 33
           PPPPP      PPPP   P E
Sbjct: 253 PPPPP------PPPPPGLPSE 267

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 36/64 (56%), Positives = 39/64 (60%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P   P+PPP   PPP P PPP PPPPPPP PP P P PP+  P+PP        PP  PP
Sbjct: 200 PSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNP-PPSASPSPPFGRSLRSPPPPPPP 258

Query: 92  PPPP 81
           PPPP
Sbjct: 259 PPPP 262

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 35/64 (54%), Positives = 36/64 (56%), Gaps = 8/64 (12%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPP-PPPPTPPAPP-------PTPPPNPPPCPD 111
           P P PP  P P P P PPP PPPPP PP P PPP   P+PP       P PPP PPP P 
Sbjct: 204 PSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPPPPG 263

Query: 110 PPLE 99
            P E
Sbjct: 264 LPSE 267

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 28/54 (51%), Positives = 29/54 (53%), Gaps = 16/54 (29%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP---------PAPP-------PPPPPPPPPPPPTP 159
           P P P PPP P PPP P PP         P+PP       PPPPPPPPPPP  P
Sbjct: 212 PPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPPPPGLP 265

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 24/45 (53%), Positives = 25/45 (55%)
 Frame = -2

Query: 143 TPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
           TPP  PPP P PP  PPP PP      PPP    P   PSPPPP+
Sbjct: 18  TPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPL 62

[43][TOP]
>UniRef100_Q3MC83 Putative uncharacterized protein n=1 Tax=Anabaena variabilis ATCC
           29413 RepID=Q3MC83_ANAVT
          Length = 387

 Score =  122 bits (306), Expect = 1e-26
 Identities = 54/85 (63%), Positives = 56/85 (65%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           PLP  P  P PPP P PPP P PPPPPPP PPPP PP PPP PPP+PPP P PP  PPPP
Sbjct: 311 PLPDNPDPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPP-PPPPDPPPPP 369

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP      PPPP   P + P PPPP
Sbjct: 370 PP-----DPPPP--PPPDPPPPPPP 387

 Score =  115 bits (288), Expect = 2e-24
 Identities = 51/86 (59%), Positives = 51/86 (59%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P    PP P P P P PPP PPPPPPP PPPPPP  P PPP P P PPP PDPP  PP
Sbjct: 311 PLPDNPDPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPP 370

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPP 15
           P PP      PPPP   P   P PPP
Sbjct: 371 PDPP------PPPPPDPP---PPPPP 387

 Score =  115 bits (287), Expect = 2e-24
 Identities = 49/80 (61%), Positives = 49/80 (61%)
 Frame = -2

Query: 251 PPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYK 72
           PP P  P  P PPP PPPPPPP PPPPPP  P PPP P P PPP PDPP  PPP PP   
Sbjct: 310 PPLPDNPDPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPP--- 366

Query: 71  YKSPPPPAKKPYEYPSPPPP 12
              PPPP   P   P PPPP
Sbjct: 367 --PPPPPDPPPPPPPDPPPP 384

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 40/67 (59%), Positives = 40/67 (59%)
 Frame = -2

Query: 212 PAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYE 33
           P PP P  P PPPPPP PP PPP  PP PPP PDPP  PPP PP      PPPP   P  
Sbjct: 308 PDPPLPDNPDPPPPPPDPPPPPPPDPPPPPP-PDPPPPPPPDPP-----PPPPPDPPPPP 361

Query: 32  YPSPPPP 12
            P PPPP
Sbjct: 362 PPDPPPP 368

[44][TOP]
>UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO
          Length = 538

 Score =  122 bits (305), Expect = 2e-26
 Identities = 55/92 (59%), Positives = 58/92 (63%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPP-----PPPPPPPPPTPPAPPPTPPPNPPPCPDP 108
           P P P PPP   PPP P PPP  PPPP     PPPP PPPP+PP P P PP   PP P P
Sbjct: 305 PSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPP 364

Query: 107 PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P  PPPPPP++   SPPPP   PY Y SPPPP
Sbjct: 365 PNSPPPPPPLF---SPPPPT--PYYYSSPPPP 391

 Score =  119 bits (299), Expect = 8e-26
 Identities = 56/93 (60%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPA--PPPTPPPNPPPCPDPPLE 99
           P P P+PPP   PPP   PPP PP PPPP PPPP P PP   PPP PPPN PP P PPL 
Sbjct: 317 PPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPP-PPPPLF 375

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYP----SPPPP 12
            PPPP  Y Y SPPPP+  P+  P    SPPPP
Sbjct: 376 SPPPPTPYYYSSPPPPS-PPHSPPPPPHSPPPP 407

 Score =  115 bits (288), Expect = 2e-24
 Identities = 58/113 (51%), Positives = 62/113 (54%), Gaps = 24/113 (21%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPP--PPPPP---------------PTPPAPP- 147
           P P P+PPP   PPP P PP   PPPPPPP  PPPPP               P PP+PP 
Sbjct: 336 PPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPH 395

Query: 146 -PTPPPNPPPCPDPPLEPP-----PPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
            P PPP+ PP P PP  PP     PPPP+Y Y SPPPP    Y    PPPPVY
Sbjct: 396 SPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYS--PPPPPVY 446

 Score =  114 bits (285), Expect = 3e-24
 Identities = 55/94 (58%), Positives = 57/94 (60%), Gaps = 11/94 (11%)
 Frame = -2

Query: 260 PTPPPA---PKPPPCPEPPPAPPPPPPPP---PPPPPP--TPPAPPPTPPPNPPPC---P 114
           P PPP    P PPP P PP   PPPPPPP   PPPPPP  +PP PPP+PPP PPP    P
Sbjct: 259 PPPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPP 318

Query: 113 DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP  PPP PP   Y  PPPP   P   PSPPPP
Sbjct: 319 PPPSPPPPSPPPPVYSPPPPPPSPP--PPSPPPP 350

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/105 (54%), Positives = 62/105 (59%), Gaps = 18/105 (17%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPP--PPPP------PPPPPTP---PAPPPTPPPNP 126
           P P  +PPP P  PP P PP +PPPPP  PPPP      PPPPP P   P PPP   P P
Sbjct: 391 PSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPP 450

Query: 125 PPCPDPPLEPPPPPPVYKYK------SPPPPAK-KPYEYPSPPPP 12
           PP P P +EPPPPPP  +Y       SPPPP + KP   PSPPPP
Sbjct: 451 PPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPP 495

 Score =  111 bits (277), Expect = 3e-23
 Identities = 53/90 (58%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = -2

Query: 263 LPTPPPAPKPPPCPEPPP-APPPPPPPPPPPPPPTPPAPPPTPPP---NPPPCPDPPLEP 96
           LP PPP   P P P PP   PPP   PPPPPP  +PP PPP+PPP   +PPP P P   P
Sbjct: 232 LPAPPPPSPPMPVPSPPVYLPPPVYSPPPPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSP 291

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
           PPPPPVY   SPPPP   P   P PPPPVY
Sbjct: 292 PPPPPVY---SPPPPPPSP---PPPPPPVY 315

 Score =  110 bits (276), Expect = 4e-23
 Identities = 61/106 (57%), Positives = 64/106 (60%), Gaps = 17/106 (16%)
 Frame = -2

Query: 272 PFPLPTPPPAPKP-PPCPEPPP--APPPPPP---PPPPPPPPTPP--APPPTPPP--NPP 123
           P P P  PP P P PP   PPP  +PPPPPP   PPPPPP P PP  +PPP PPP  +PP
Sbjct: 233 PAPPPPSPPMPVPSPPVYLPPPVYSPPPPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPP 292

Query: 122 -------PCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
                  P P PP  PPPPPPVY   SPPPP   P   PSPPPPVY
Sbjct: 293 PPPPVYSPPPPPPSPPPPPPPVY---SPPPPPSPP--PPSPPPPVY 333

 Score =  109 bits (272), Expect = 1e-22
 Identities = 54/96 (56%), Positives = 58/96 (60%), Gaps = 13/96 (13%)
 Frame = -2

Query: 260 PTPPPAPKPP---PCPEPPP--APPPPPP---PPPPPPPPTPPAP----PPTPPPNPPPC 117
           P PPP+P PP   P P PPP  +PPPPPP   PPPPPP P PP P    PP PP  PPP 
Sbjct: 268 PPPPPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPPPPPSPPPPS 327

Query: 116 PDPPL-EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP+  PPPPPP     SPPPP+  P     PPPP
Sbjct: 328 PPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPP 363

 Score =  104 bits (259), Expect = 3e-21
 Identities = 52/98 (53%), Positives = 56/98 (57%), Gaps = 13/98 (13%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCP-----EPPPAPP-PPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
           P P PP    PPP P      PPP+PP  PPPPP  PPPP+PP  PP PP +PPP   P 
Sbjct: 368 PPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPY 427

Query: 104 LEPPPPP-PVYK------YKSPPPPAKKPYEYPSPPPP 12
           L PPPPP PVY       Y  PPPP+  P   P PPPP
Sbjct: 428 LSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPP 465

 Score =  104 bits (259), Expect = 3e-21
 Identities = 53/112 (47%), Positives = 58/112 (51%), Gaps = 24/112 (21%)
 Frame = -2

Query: 269 FPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPP---PPPTPPA-----PPPTPPPNPPPCP 114
           +P  +PPP P P   P PPP   PPPPP PPP   PPP PP      PPP+P P PP   
Sbjct: 425 YPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQY 484

Query: 113 DPPLEPPPPPPVYKYKSPPPPAKKP------YE----------YPSPPPPVY 6
            PP  P PPPP   Y SPPPP++ P      YE          Y SPPPP Y
Sbjct: 485 KPPPSPSPPPPPVHYYSPPPPSQSPPPPAPVYEGPLPPITGVSYASPPPPPY 536

 Score =  102 bits (253), Expect = 2e-20
 Identities = 52/101 (51%), Positives = 56/101 (55%), Gaps = 16/101 (15%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPP-----APPPPP-----PPPPPP-PPPTPPAPPP-TPPPNPP 123
           P P+PP +P PPP   PPP     +PPPPP     PPPPP   PP PP+PPP   PP PP
Sbjct: 405 PPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPP 464

Query: 122 PC----PDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PC    P PP   PPPP  YK    P P   P  Y SPPPP
Sbjct: 465 PCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPPPP 505

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 38/69 (55%), Positives = 40/69 (57%), Gaps = 4/69 (5%)
 Frame = -2

Query: 200 PPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKP----YE 33
           P  P  P PPPP+PP P P+PP   PP   P   PPPPPPVY   SPPPP   P    Y 
Sbjct: 227 PFVPTLPAPPPPSPPMPVPSPPVYLPP---PVYSPPPPPPVY---SPPPPPPSPPPPVYS 280

Query: 32  YPSPPPPVY 6
            P PPPPVY
Sbjct: 281 PPPPPPPVY 289

[45][TOP]
>UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas
           reinhardtii RepID=A8J1N3_CHLRE
          Length = 527

 Score =  122 bits (305), Expect = 2e-26
 Identities = 56/94 (59%), Positives = 60/94 (63%), Gaps = 7/94 (7%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP-PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNP------PPCP 114
           P P   PPP+P PP P P  PP+PPPPPPPPPPPPPP PP PP  PPP+P      PP P
Sbjct: 400 PVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSP 459

Query: 113 DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP  PPPPPP     SP PP+  P   PSPPPP
Sbjct: 460 APPSPPPPPPP--PPPSPYPPSPAPPLPPSPPPP 491

 Score =  118 bits (295), Expect = 2e-25
 Identities = 55/94 (58%), Positives = 58/94 (61%), Gaps = 9/94 (9%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPP--------PPTPPAPPPTPPPNP-PPCP 114
           P P PPP P PPP P PPP PP PPPP PPPP        PP+PP PPP PPP+P PP P
Sbjct: 421 PSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSP 480

Query: 113 DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPL P PPPP     SP PP+  P   PSP PP
Sbjct: 481 APPLPPSPPPP-----SPYPPSPAPPVPPSPAPP 509

 Score =  117 bits (293), Expect = 4e-25
 Identities = 52/87 (59%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = -2

Query: 266 PLPTPPPAPKPP-PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPP-PNPPPCPDPPLEPP 93
           PLP PPP+P PP P P  PP+PPPP P PP P PP PP+PPP PP P PPP P PP  P 
Sbjct: 384 PLPPPPPSPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPFPPF 443

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP     SP PP+  P   P PPPP
Sbjct: 444 PPPPSPPPPSPGPPSPAPPSPPPPPPP 470

 Score =  114 bits (284), Expect = 4e-24
 Identities = 56/90 (62%), Positives = 58/90 (64%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP-PAPP-PPPPPPPPPPPPTPPAP-PPTPPPNPPPCPDPPL 102
           PFP P PPP   PPP P PP PAPP PPPPPPPPPP P PP+P PP PP  PPP P PP 
Sbjct: 439 PFP-PFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPPLPPSPPPPSPYPPS 497

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PP PP     SP PP+  P   PSPPPP
Sbjct: 498 PAPPVPPSPAPPSPEPPSPAP---PSPPPP 524

 Score =  112 bits (279), Expect = 2e-23
 Identities = 52/94 (55%), Positives = 57/94 (60%), Gaps = 7/94 (7%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEP-PPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P  P  P PPP P P PP+P PP PP PPPP P PP+P P  PP+PPP P PP  P
Sbjct: 374 PSPAPPSPQPPLPPPPPSPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPP 433

Query: 95  PPPPPVY----KYKSPPPPAKKPYE--YPSPPPP 12
           PPPPP +       SPPPP+  P     PSPPPP
Sbjct: 434 PPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPP 467

 Score =  107 bits (268), Expect = 3e-22
 Identities = 50/92 (54%), Positives = 55/92 (59%), Gaps = 7/92 (7%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNP----PPCPDPPLE 99
           P P+PP  P P P P  PP+P PP PP PPPP P PP PPP P P P    PP P+PP  
Sbjct: 228 PSPSPPSPPPPSPQPPVPPSPAPPTPPGPPPPSPAPPNPPPPPSPAPPSPKPPSPEPPSP 287

Query: 98  PPPP---PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP   PP  K  SP PP+ +P   P PPPP
Sbjct: 288 PPPPSPEPPSPKPPSPEPPSPQP---PLPPPP 316

 Score =  107 bits (268), Expect = 3e-22
 Identities = 50/89 (56%), Positives = 53/89 (59%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266 PLPTP-PPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
           P P+P PP P PPP P PP   PP P PP PPPPP+P  P P PP   PP P PPL PPP
Sbjct: 257 PPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPP 316

Query: 89  P---PPVYKYKSPPPPAKKPYEYPSPPPP 12
           P   PP     SPPPP+  P   PSP PP
Sbjct: 317 PSPYPPSPSPPSPPPPSPPP---PSPAPP 342

 Score =  107 bits (268), Expect = 3e-22
 Identities = 51/90 (56%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKP-PPCPEPPPAPPPPPPPPPPPPPPTPPAP-PPTPPPNPPPCPDPPLE 99
           P PLP  P  P P PP P PPP+P PP P PP PP P PP+P PP+P P  PP P PP  
Sbjct: 369 PSPLPPSPAPPSPQPPLPPPPPSPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPP 428

Query: 98  PPPPPPVYKYKSPPPPAKKPY-EYPSPPPP 12
           PPPPPP      PPPP   P+   PSPPPP
Sbjct: 429 PPPPPP------PPPPPFPPFPPPPSPPPP 452

 Score =  107 bits (266), Expect = 5e-22
 Identities = 55/102 (53%), Positives = 57/102 (55%), Gaps = 15/102 (14%)
 Frame = -2

Query: 272 PFPLPTPPPAPKP-PPCPEPPPAPPPPPP------PPPPPP----PPTPPAP-PPTPPPN 129
           P PLP  P  P P PP P PPP PPPP P      PP PPP    PP PP+P PPTPP  
Sbjct: 197 PSPLPPSPRPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTPPGP 256

Query: 128 PPPCPDPPLEPPPP---PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP P PP  PPPP   PP  K  SP PP+  P   P PP P
Sbjct: 257 PPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPPPSPEPPSP 298

 Score =  105 bits (263), Expect = 1e-21
 Identities = 50/92 (54%), Positives = 53/92 (57%), Gaps = 7/92 (7%)
 Frame = -2

Query: 266 PLPTPPPAPKPP----PCPEPPPAPPPPPPPPPPPPPPTPPAP---PPTPPPNPPPCPDP 108
           P P PPP+P PP    P PEPP  PPPP P PP P PP+P  P   PP PPP P P P  
Sbjct: 264 PNPPPPPSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPPPSPYPPS 323

Query: 107 PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P  P PPPP     SP PP+  P   PSPPPP
Sbjct: 324 PSPPSPPPPSPPPPSPAPPSPAP---PSPPPP 352

 Score =  102 bits (254), Expect = 1e-20
 Identities = 44/82 (53%), Positives = 49/82 (59%)
 Frame = -2

Query: 257 TPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPV 78
           TP P    PP P PP   PP PPPPP PPPP+P  P P+PP  PPP P PP+ P P PP 
Sbjct: 193 TPSPPSPLPPSPRPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPT 252

Query: 77  YKYKSPPPPAKKPYEYPSPPPP 12
                PPPP+  P   P+PPPP
Sbjct: 253 --PPGPPPPSPAP---PNPPPP 269

 Score =  100 bits (250), Expect = 4e-20
 Identities = 51/103 (49%), Positives = 54/103 (52%), Gaps = 15/103 (14%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEP-PPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPC------- 117
           P P P  P  P PPP P P PP+P PP PPPP PPPP+P  P P PP  PPPC       
Sbjct: 301 PSPEPPSPQPPLPPPPPSPYPPSPSPPSPPPPSPPPPSPAPPSPAPPSPPPPCECLAGER 360

Query: 116 -------PDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
                  P  PL P P PP  +   PPPP   PY  PSP PPV
Sbjct: 361 ELTCAFLPPSPLPPSPAPPSPQPPLPPPPPS-PYP-PSPAPPV 401

 Score =  100 bits (248), Expect = 7e-20
 Identities = 49/97 (50%), Positives = 54/97 (55%), Gaps = 12/97 (12%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNP----PPCPDPPLE 99
           P P  P  P P P    PP+PPPPP PPPP P P  P+PP  PPP+P    PP P PP  
Sbjct: 194 PSPPSPLPPSPRPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTP 253

Query: 98  PPPPPPVYKYKSPP------PPAKKP--YEYPSPPPP 12
           P PPPP     +PP      PP+ KP   E PSPPPP
Sbjct: 254 PGPPPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPP 290

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 52/103 (50%), Positives = 53/103 (51%), Gaps = 18/103 (17%)
 Frame = -2

Query: 266 PLPTPPPAPKP---------------PPCPEPP-PAPPPPPPP-PPPPPPPTPPAP-PPT 141
           P P PP  P P               PP P PP PAPP P PP PPPPP P PP+P PP 
Sbjct: 342 PSPAPPSPPPPCECLAGERELTCAFLPPSPLPPSPAPPSPQPPLPPPPPSPYPPSPAPPV 401

Query: 140 PPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP  PPP P PP   PP PP     SPPPP   P   P PPPP
Sbjct: 402 PPSPPPPSPYPPSPAPPAPP-----SPPPPPPPPPPPPPPPPP 439

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 50/112 (44%), Positives = 57/112 (50%), Gaps = 24/112 (21%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEP---------PPAPPPPPPPPPP---PPPPTPPAPPPTPPPN 129
           P P    PP+P PPP PEP         PP+P PP PPPPP   PP P+PP+PPP  PP 
Sbjct: 277 PKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPPPSPYPPSPSPPSPPPPSPPP 336

Query: 128 PPPCPDPPLEPPPPPP------------VYKYKSPPPPAKKPYEYPSPPPPV 9
           P P P  P  P PPPP             +   SP PP+  P   PSP PP+
Sbjct: 337 PSPAPPSPAPPSPPPPCECLAGERELTCAFLPPSPLPPSPAP---PSPQPPL 385

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 50/116 (43%), Positives = 55/116 (47%), Gaps = 31/116 (26%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTP--------------PPN 129
           PLP PPP+P PP    P P PP PPPP P PP P PP+PPP                PP+
Sbjct: 311 PLPPPPPSPYPPSPSPPSPPPPSPPPPSPAPPSPAPPSPPPPCECLAGERELTCAFLPPS 370

Query: 128 PPP------CPDPPLEPPPPPPVYKYKSPP-----------PPAKKPYEYPSPPPP 12
           P P       P PPL PPPP P     +PP           PP+  P   PSPPPP
Sbjct: 371 PLPPSPAPPSPQPPLPPPPPSPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPP 426

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 40/69 (57%), Positives = 41/69 (59%), Gaps = 5/69 (7%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP----PAPPPPPPPPPPPPPPTPPAPPPTPPPNP-PPCPDP 108
           P P   PPP P PPP P PP    P PP PPPP P PP P PP PP   PP+P PP P P
Sbjct: 459 PAPPSPPPPPPPPPPSPYPPSPAPPLPPSPPPPSPYPPSPAPPVPPSPAPPSPEPPSPAP 518

Query: 107 PLEPPPPPP 81
           P  PPPP P
Sbjct: 519 PSPPPPPSP 527

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 40/96 (41%), Positives = 44/96 (45%), Gaps = 16/96 (16%)
 Frame = -2

Query: 251 PPAPKPPP-------------CPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP---NPPP 120
           PPA  PP              CP+     P PP P PP P P  P PP +PPP    PPP
Sbjct: 165 PPAGSPPGVCTAAIFDSGNGCCPQVQAGTPSPPSPLPPSPRPPSPKPP-SPPPPPGPPPP 223

Query: 119 CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P PP   PP PP    + P PP+  P   P PPPP
Sbjct: 224 SPAPPSPSPPSPPPPSPQPPVPPSPAPPTPPGPPPP 259

[46][TOP]
>UniRef100_B7P9A9 HyFMR1 protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7P9A9_IXOSC
          Length = 506

 Score =  121 bits (303), Expect = 3e-26
 Identities = 59/88 (67%), Positives = 59/88 (67%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           TGGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGG
Sbjct: 424 TGGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 477

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGG GGG G GGG G GGG G G G
Sbjct: 478 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 505

 Score =  115 bits (289), Expect = 1e-24
 Identities = 57/90 (63%), Positives = 59/90 (65%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDG---YSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGG 183
           GGGG+    +  G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGG
Sbjct: 410 GGGGNQLILWKLGATGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 463

Query: 184 GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGGG GGG G GGG G GGG G G G
Sbjct: 464 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 493

 Score =  115 bits (288), Expect = 2e-24
 Identities = 59/94 (62%), Positives = 59/94 (62%), Gaps = 8/94 (8%)
 Frame = +1

Query: 16  GGGDGYSYGF----LAGGGGDLYL*----TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGG 171
           GG   Y  GF      GGG  L L     TGGGGGG  GG G GGG GGG GGG GG GG
Sbjct: 395 GGPPSYQGGFPLPRRGGGGNQLILWKLGATGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 454

Query: 172 GGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGGGGGGG GGG G GGG G GGG G G G
Sbjct: 455 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 488

 Score =  114 bits (286), Expect = 3e-24
 Identities = 56/83 (67%), Positives = 56/83 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 430 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 483

Query: 193 GGGGGAGGGSGHGGGFGAGGGVG 261
           GGGGG GGG G GGG G GGG G
Sbjct: 484 GGGGGGGGGGGGGGGGGGGGGGG 506

[47][TOP]
>UniRef100_B9EXV1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9EXV1_ORYSJ
          Length = 532

 Score =  121 bits (303), Expect = 3e-26
 Identities = 53/89 (59%), Positives = 57/89 (64%)
 Frame = -2

Query: 269 FPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
           F LP+PPP P  PP P PPP  P PPPP PPPP P PP+P P PP  PPP P PP  P P
Sbjct: 357 FVLPSPPPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPP-SPSP 415

Query: 89  PPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
           PPP     SPPPP+  P  Y SPPPP Y+
Sbjct: 416 PPPSPPPPSPPPPS--PVYYSSPPPPYYE 442

 Score =  120 bits (300), Expect = 6e-26
 Identities = 56/94 (59%), Positives = 59/94 (62%), Gaps = 7/94 (7%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPP---PPPPTPPAP-PPTPPPNPPPCPDPP 105
           P P P+PPP   PPP P PPP  PPPP PPPP   PPPP+PP P PP P P+PPP   PP
Sbjct: 363 PPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPP 422

Query: 104 LEPPPPPPVYKYKSPPPP---AKKPYEYPSPPPP 12
             PPPP PVY Y SPPPP         Y SPPPP
Sbjct: 423 PSPPPPSPVY-YSSPPPPYYEVSPEDRYLSPPPP 455

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/121 (45%), Positives = 62/121 (51%), Gaps = 31/121 (25%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP-PAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P+PPP   PPP P PP P+PPPP PPPP PPPP+P  PPP+PPP  PP P P    
Sbjct: 375 PPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYS 434

Query: 95  PPPPPVY------KYKSPPPP-----AKKP-------------------YEYPSPPPPVY 6
            PPPP Y      +Y SPPPP     A  P                   Y+   PPPP Y
Sbjct: 435 SPPPPYYEVSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQY 494

Query: 5   K 3
           +
Sbjct: 495 E 495

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 61/135 (45%), Positives = 66/135 (48%), Gaps = 48/135 (35%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP-PAPPPP-PPPPPPPPP-------PTPP-----------A 153
           P P P+PPP   PPP P PP P+PPPP PPPP PPPP       P PP           +
Sbjct: 392 PPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSPEDRYLS 451

Query: 152 PPPTP-----PPNP------------PPCPDPPLEPPPPPPVY------KYKSPPPPA-- 48
           PPP P     PP P            PP P    E PPPPP Y      +Y SPPPP+  
Sbjct: 452 PPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPEDRYLSPPPPSPV 511

Query: 47  --KKP-YEYPSPPPP 12
             K P YEY SPPPP
Sbjct: 512 KWKLPVYEYSSPPPP 526

[48][TOP]
>UniRef100_Q8L3T8 cDNA clone:001-201-A04, full insert sequence n=2 Tax=Oryza sativa
           RepID=Q8L3T8_ORYSJ
          Length = 570

 Score =  121 bits (303), Expect = 3e-26
 Identities = 53/89 (59%), Positives = 57/89 (64%)
 Frame = -2

Query: 269 FPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
           F LP+PPP P  PP P PPP  P PPPP PPPP P PP+P P PP  PPP P PP  P P
Sbjct: 395 FVLPSPPPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPP-SPSP 453

Query: 89  PPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
           PPP     SPPPP+  P  Y SPPPP Y+
Sbjct: 454 PPPSPPPPSPPPPS--PVYYSSPPPPYYE 480

 Score =  120 bits (300), Expect = 6e-26
 Identities = 56/94 (59%), Positives = 59/94 (62%), Gaps = 7/94 (7%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPP---PPPPTPPAP-PPTPPPNPPPCPDPP 105
           P P P+PPP   PPP P PPP  PPPP PPPP   PPPP+PP P PP P P+PPP   PP
Sbjct: 401 PPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPP 460

Query: 104 LEPPPPPPVYKYKSPPPP---AKKPYEYPSPPPP 12
             PPPP PVY Y SPPPP         Y SPPPP
Sbjct: 461 PSPPPPSPVY-YSSPPPPYYEVSPEDRYLSPPPP 493

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/121 (45%), Positives = 62/121 (51%), Gaps = 31/121 (25%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP-PAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P+PPP   PPP P PP P+PPPP PPPP PPPP+P  PPP+PPP  PP P P    
Sbjct: 413 PPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYS 472

Query: 95  PPPPPVY------KYKSPPPP-----AKKP-------------------YEYPSPPPPVY 6
            PPPP Y      +Y SPPPP     A  P                   Y+   PPPP Y
Sbjct: 473 SPPPPYYEVSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQY 532

Query: 5   K 3
           +
Sbjct: 533 E 533

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 61/135 (45%), Positives = 66/135 (48%), Gaps = 48/135 (35%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP-PAPPPP-PPPPPPPPP-------PTPP-----------A 153
           P P P+PPP   PPP P PP P+PPPP PPPP PPPP       P PP           +
Sbjct: 430 PPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSPEDRYLS 489

Query: 152 PPPTP-----PPNP------------PPCPDPPLEPPPPPPVY------KYKSPPPPA-- 48
           PPP P     PP P            PP P    E PPPPP Y      +Y SPPPP+  
Sbjct: 490 PPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPEDRYLSPPPPSPV 549

Query: 47  --KKP-YEYPSPPPP 12
             K P YEY SPPPP
Sbjct: 550 KWKLPVYEYSSPPPP 564

[49][TOP]
>UniRef100_B9IPT3 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IPT3_POPTR
          Length = 186

 Score =  120 bits (302), Expect = 4e-26
 Identities = 62/87 (71%), Positives = 62/87 (71%), Gaps = 2/87 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGF--GGGVGGGAGGVGGGGGGG 186
           GGG  G       GGGG      GGGGGG  GGSGHGGGF  GGGVGGG GG G GGGGG
Sbjct: 28  GGGAGG------GGGGG------GGGGGGIGGGSGHGGGFGAGGGVGGGLGG-GAGGGGG 74

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSG 267
           G GGGGG GGGSGHGGGFGAGGGVG G
Sbjct: 75  GAGGGGGIGGGSGHGGGFGAGGGVGGG 101

 Score =  118 bits (296), Expect = 2e-25
 Identities = 62/94 (65%), Positives = 65/94 (69%), Gaps = 8/94 (8%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGG--GDLYL*TGGGGGGSNGG------SGHGGGFGGGVGGGAGGVGG 171
           GGG G+  GF AGGG  G L    GGGGGG+ GG      SGHGGGFG G G G GG+ G
Sbjct: 46  GGGSGHGGGFGAGGGVGGGLGGGAGGGGGGAGGGGGIGGGSGHGGGFGAGGGVGGGGLRG 105

Query: 172 GGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGGGG GGG  GGGSGHGGGFGAGGGVG G G
Sbjct: 106 GAGGGGGAGGG-IGGGSGHGGGFGAGGGVGGGAG 138

 Score =  102 bits (254), Expect = 1e-20
 Identities = 60/99 (60%), Positives = 62/99 (62%), Gaps = 13/99 (13%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGG---GDLYL*TGGGGG---GSNGGSGHGGGFG--GGVGGGAGGVGG 171
           GGG G+  GF AGGG   G L    GGGGG   G  GGSGHGGGFG  GGVGGGAGG  G
Sbjct: 83  GGGSGHGGGFGAGGGVGGGGLRGGAGGGGGAGGGIGGGSGHGGGFGAGGGVGGGAGGGLG 142

Query: 172 GGGGGGGGGGG-----GAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGGG G G     G G G G G G G G G+GSGNG
Sbjct: 143 GGSGGGGFGVGIGVGIGVGVGVGVGAGAGQGSGIGSGNG 181

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 35/44 (79%), Positives = 36/44 (81%)
 Frame = +1

Query: 142 VGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           +GGGAGG GGG    GGGGGGG GGGSGHGGGFGAGGGVG G G
Sbjct: 27  LGGGAGGGGGG----GGGGGGGIGGGSGHGGGFGAGGGVGGGLG 66

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 37/73 (50%), Positives = 41/73 (56%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGG G+  GF AGGG       GGG GG  GG   GGGFG G+G G G   G G G G G
Sbjct: 118 GGGSGHGGGFGAGGG------VGGGAGGGLGGGSGGGGFGVGIGVGIGVGVGVGVGAGAG 171

Query: 196 GGGGAGGGSGHGG 234
            G G G G+G+ G
Sbjct: 172 QGSGIGSGNGNSG 184

[50][TOP]
>UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus
           RepID=Q9DVW0_9BBAC
          Length = 158

 Score =  120 bits (302), Expect = 4e-26
 Identities = 54/89 (60%), Positives = 56/89 (62%), Gaps = 3/89 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPP---CPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPL 102
           P P PTPPP P PPP    P PP APP PPPPPPPPPPP PP PPPTPPP PPP P PP 
Sbjct: 68  PTPPPTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPPPPPPPPPPPTPPPTPPPTP-PPT 126

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            PP PPP     +  PP  +P   P  PP
Sbjct: 127 PPPTPPPTPNPDAVIPPITRP---PLRPP 152

 Score =  115 bits (289), Expect = 1e-24
 Identities = 49/84 (58%), Positives = 50/84 (59%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P PT PP P P P P PPP PPP PPP PPPPP  P   PPT PP PPP P PP  PPPP
Sbjct: 50  PPPTFPPTPPPTPPPTPPPTPPPTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPPPPPPP 109

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPP 15
           PP       PPP   P   P+PPP
Sbjct: 110 PPPPTPPPTPPPTPPPTPPPTPPP 133

 Score =  114 bits (284), Expect = 4e-24
 Identities = 51/85 (60%), Positives = 53/85 (62%)
 Frame = -2

Query: 269 FPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
           FP PTPPP P P P P PPP PPP PPPPP  P P+PP  PP PPP PPP P PP  PPP
Sbjct: 54  FP-PTPPPTPPPTPPPTPPPTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPPPPP--PPP 110

Query: 89  PPPVYKYKSPPPPAKKPYEYPSPPP 15
           PPP       PPP   P   P+PPP
Sbjct: 111 PPPT------PPPTPPPTPPPTPPP 129

 Score =  111 bits (277), Expect = 3e-23
 Identities = 52/95 (54%), Positives = 53/95 (55%), Gaps = 11/95 (11%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPT-PPAPPPTPPPNP----------PP 120
           P PTPPP P   P   PP  PP PPP PPP PPPT PP PPPTPPP P          PP
Sbjct: 35  PPPTPPPTPPTSPATPPPTFPPTPPPTPPPTPPPTPPPTPPPTPPPPPIIPAPSPPTAPP 94

Query: 119 CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            P PP  PPPPPP      PPPP   P   P+PPP
Sbjct: 95  QPPPPPPPPPPPP----PPPPPPTPPPTPPPTPPP 125

 Score =  110 bits (276), Expect = 4e-23
 Identities = 51/88 (57%), Positives = 53/88 (60%), Gaps = 3/88 (3%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPP--PPPPPPPPPPTPP-APPPTPPPNPPPCPDPPLEP 96
           P P  PP P PPP P   PA PPP  PP PPP PPPTPP  PPPTPPP PPP   PP+ P
Sbjct: 29  PSPPLPPPPTPPPTPPTSPATPPPTFPPTPPPTPPPTPPPTPPPTPPPTPPP---PPIIP 85

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P PP    + PPPP   P   P PPPP
Sbjct: 86  APSPPTAPPQPPPPPPPPPPPPPPPPPP 113

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 33/63 (52%), Positives = 33/63 (52%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P P         PP PPP PPP PPPTPP P P P    PP   PPL PP
Sbjct: 103 PPPPPPPPPPPTP---------PPTPPPTPPPTPPPTPP-PTPNPDAVIPPITRPPLRPP 152

Query: 92  PPP 84
             P
Sbjct: 153 SLP 155

[51][TOP]
>UniRef100_UPI0000DA3D7B PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA3D7B
          Length = 211

 Score =  120 bits (301), Expect = 5e-26
 Identities = 59/87 (67%), Positives = 60/87 (68%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGGDG   G  AGGGG     +GGGGGG  GG G GGG GGG GGG GG GGGGGGGG 
Sbjct: 74  GGGGDGGGGGGAAGGGGGGGG-SGGGGGGGGGGDGRGGGGGGGGGGGGGGGGGGGGGGGD 132

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGG 159

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGGDG   G   GGGG      GGGGGG  GG   GGG GGG GGG GG GGGGGGGGG
Sbjct: 102 GGGGDGRGGGGGGGGGGG----GGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGG 157

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 158 GGGGGGGGGRGDGGGGGGGGGRGGGGG 184

 Score =  118 bits (296), Expect = 2e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGGD     GGGGGG  GG G GGG GGG GG  GG GGGGGGGGG
Sbjct: 89  GGGGGGSGGGGGGGGGGDG---RGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGG 145

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 146 GGGGGGGGGGGGGGGGGGGGGRGDGGG 172

 Score =  115 bits (288), Expect = 2e-24
 Identities = 57/88 (64%), Positives = 58/88 (65%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +GGGG G   G   GGGG      GGGGGG  GG G GGG  GG GGG GG GGGGGGGG
Sbjct: 95  SGGGGGGGGGGDGRGGGGG----GGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGG 150

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGG GGG G GGG G GGG G G G
Sbjct: 151 GGGGGGGGGGGGGGGGRGDGGGGGGGGG 178

 Score =  114 bits (285), Expect = 3e-24
 Identities = 58/89 (65%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG- 189
           GGGGDG   G   GGGG      GGGGGG  GG G GGG GGG GGG GG  GGGGGGG 
Sbjct: 43  GGGGDGGGGG--GGGGG------GGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGG 94

Query: 190 -GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGGGG GGG G GGG G GGG G G G
Sbjct: 95  SGGGGGGGGGGDGRGGGGGGGGGGGGGGG 123

 Score =  113 bits (283), Expect = 6e-24
 Identities = 56/87 (64%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG +GG G GGG G G GGG GG GGGGGGGGG
Sbjct: 68  GGGGGGGGGGDGGGGGGAA---GGGGGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGGGGG 124

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG G G G GGG G GGG G G G
Sbjct: 125 GGGGGGGDGGGGGGGGGGGGGGGGGGG 151

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/87 (64%), Positives = 56/87 (64%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGGS GG G GGG  G  GGG GG GGGGGGGGG
Sbjct: 66  GGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGGGGGG 125

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG  GG G GGG G GGG G G G
Sbjct: 126 GGGGGGDGGGGGGGGGGGGGGGGGGGG 152

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/88 (63%), Positives = 57/88 (64%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGG
Sbjct: 22  SGGGGGGGGGG---GGGG------GGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGG 72

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG  GGG G  GG G GGG G G G
Sbjct: 73  GGGGGDGGGGGGAAGGGGGGGGSGGGGG 100

 Score =  111 bits (277), Expect = 3e-23
 Identities = 59/89 (66%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 109 GGGGGGGGGGGGGGGGG------GGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162

Query: 193 GGGG-GAGGGSGHGGGFGAGGGVG-SGNG 273
           GGGG G GGG G GGG G GGG G SG+G
Sbjct: 163 GGGGRGDGGGGGGGGGRGGGGGDGASGSG 191

 Score =  100 bits (250), Expect = 4e-20
 Identities = 45/63 (71%), Positives = 45/63 (71%)
 Frame = +1

Query: 85  GGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGS 264
           G GGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG G G G GGG G GGG G 
Sbjct: 21  GSGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGDGG 80

Query: 265 GNG 273
           G G
Sbjct: 81  GGG 83

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 45/64 (70%), Positives = 45/64 (70%)
 Frame = +1

Query: 82  GGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVG 261
           GG G G  GG G GGG GGG GGG GG G GGGGGGGGGGGG GGG G GGG G GGG G
Sbjct: 18  GGVGSGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGGG 77

Query: 262 SGNG 273
            G G
Sbjct: 78  DGGG 81

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 44/64 (68%), Positives = 44/64 (68%)
 Frame = +1

Query: 82  GGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVG 261
           G GGGG  GG G GGG GGG GGG G  GGGGGGGGGGGGGG  GG G GGG G GG  G
Sbjct: 21  GSGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGDGG 80

Query: 262 SGNG 273
            G G
Sbjct: 81  GGGG 84

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 42/70 (60%), Positives = 42/70 (60%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGGDG   G   GGGG      GGGGGG  GG G GGG GGG G G GG GGGG GGGG
Sbjct: 128 GGGGDGGGGGGGGGGGGG----GGGGGGGGGGGGGGGGGGGGGRGDGGGGGGGGGRGGGG 183

Query: 193 GGGGGAGGGS 222
           G G    G S
Sbjct: 184 GDGASGSGVS 193

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 31/44 (70%), Positives = 31/44 (70%)
 Frame = +1

Query: 142 VGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           V GG G  GGGGGGGGGGGGGG GGG G GG  G GGG G G G
Sbjct: 16  VVGGVGSGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGG 59

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 31/44 (70%), Positives = 31/44 (70%)
 Frame = +1

Query: 142 VGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           VGG   G GGGGGGGGGGGGGG GGG G G G G GGG G G G
Sbjct: 17  VGGVGSGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGG 60

[52][TOP]
>UniRef100_Q948Y7 VMP3 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q948Y7_VOLCA
          Length = 687

 Score =  120 bits (301), Expect = 5e-26
 Identities = 52/89 (58%), Positives = 54/89 (60%), Gaps = 1/89 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  PP P PPP   PPP PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 595 PSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPP 654

Query: 92  P-PPPVYKYKSPPPPAKKPYEYPSPPPPV 9
           P PPP      PPP  + P    SPPPPV
Sbjct: 655 PSPPPPRPPPRPPPTRRSPPPTSSPPPPV 683

 Score =  115 bits (289), Expect = 1e-24
 Identities = 50/87 (57%), Positives = 55/87 (63%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P  P  P P P   PPP+PPPP PPPP PPPP+PP P P PP  PPP P PP  PP
Sbjct: 575 PSPNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPP 634

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP     SPPPP+ +P   P+PPPP
Sbjct: 635 PNPPP---PSPPPPSPRP---PTPPPP 655

 Score =  114 bits (284), Expect = 4e-24
 Identities = 49/85 (57%), Positives = 54/85 (63%), Gaps = 2/85 (2%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP--PP 87
           P+P P   PPP P PPP+PPPP PPPP PPPP PP P P PP  PPP P PP  PP  PP
Sbjct: 585 PSPDPPSAPPPSP-PPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPP 643

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP  +  +PPPP+  P   P  PPP
Sbjct: 644 PPSPRPPTPPPPSPPPPRPPPRPPP 668

 Score =  109 bits (272), Expect = 1e-22
 Identities = 59/120 (49%), Positives = 64/120 (53%), Gaps = 33/120 (27%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP------PCPEPPPAPPP------PPPPPPPPPPPTPPAPP--PTPP 135
           P P P PPP+P+PP      P P PPP PPP      PPPP P PPPP+PP+PP  P+PP
Sbjct: 502 PPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPPSPPSPPTSPSPP 561

Query: 134 ---------------PNP----PPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
                          PNP    PP PDPP  PPP PP     SPPPP   P   PSPPPP
Sbjct: 562 DPAWANLPTSPDPPSPNPPSPDPPSPDPPSAPPPSPPP---PSPPPPNPPP---PSPPPP 615

 Score =  104 bits (259), Expect = 3e-21
 Identities = 52/98 (53%), Positives = 55/98 (56%), Gaps = 11/98 (11%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP----------PAPPPPPPPPPPPPPPTPP-APPPTPPPNP 126
           P P P PP  P PP  P PP          P PP P PP P PP P PP APPP+PPP  
Sbjct: 542 PDPSPPPPSPPSPPTSPSPPDPAWANLPTSPDPPSPNPPSPDPPSPDPPSAPPPSPPPPS 601

Query: 125 PPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP P+PP  P PPPP     SPPPP+  P   PSPPPP
Sbjct: 602 PPPPNPP-PPSPPPPNPPPPSPPPPSPPP---PSPPPP 635

 Score =  103 bits (258), Expect = 5e-21
 Identities = 52/93 (55%), Positives = 55/93 (59%), Gaps = 4/93 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP-PAPPPPPPPPPPPPPPTPPAPPPTPP-PNPPPCPDP-PL 102
           P   P+PPP   PPP P PP P PP PPP P PPP P PP PPP PP P PPP P P P 
Sbjct: 476 PSAPPSPPPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPS 535

Query: 101 EPPPPPPVYKYKSPPPPA-KKPYEYPSPPPPVY 6
            P PPPP     SPPPP+   P   PSPP P +
Sbjct: 536 SPRPPPP---DPSPPPPSPPSPPTSPSPPDPAW 565

 Score =  102 bits (255), Expect = 1e-20
 Identities = 47/84 (55%), Positives = 48/84 (57%)
 Frame = -2

Query: 263 LPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPP 84
           L T P AP  PP P PPP  PPPP P PP PPP+P  PP   PPNPPP P  P  PP PP
Sbjct: 472 LETLPSAPPSPPPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPP 531

Query: 83  PVYKYKSPPPPAKKPYEYPSPPPP 12
           P      PPPP       PSPPPP
Sbjct: 532 PRPSSPRPPPPD------PSPPPP 549

 Score =  100 bits (248), Expect = 7e-20
 Identities = 50/110 (45%), Positives = 54/110 (49%), Gaps = 23/110 (20%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPP---------------------PPPPTPP 156
           P P P PPP P  P  P P P+PPPP PP PP                     P PP+P 
Sbjct: 524 PRPPPRPPPRPSSPRPPPPDPSPPPPSPPSPPTSPSPPDPAWANLPTSPDPPSPNPPSPD 583

Query: 155 APPPTPPPNPPPCPDPPLEPP--PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P P PP  PPP P PP  PP  PPPP     +PPPP+  P   PSPPPP
Sbjct: 584 PPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPP---PSPPPP 630

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 49/99 (49%), Positives = 52/99 (52%), Gaps = 12/99 (12%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPP---PPPTPP-------APPPTPPPNPP 123
           P P P  P  P PPP P PPP+P PP PPP PP   PPP PP        PPP P P PP
Sbjct: 490 PRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPP 549

Query: 122 PCPDPPLEPPPPPPVYKY--KSPPPPAKKPYEYPSPPPP 12
             P PP  P PP P +     SP PP+  P   PSP PP
Sbjct: 550 SPPSPPTSPSPPDPAWANLPTSPDPPSPNP---PSPDPP 585

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 36/74 (48%), Positives = 38/74 (51%)
 Frame = -2

Query: 233 PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPP 54
           PP       P  PP PPPP PPP  P PP   PP PPP P PP  P PP P  +  SP P
Sbjct: 467 PPLSVLETLPSAPPSPPPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRP 526

Query: 53  PAKKPYEYPSPPPP 12
           P + P    SP PP
Sbjct: 527 PPRPPPRPSSPRPP 540

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 30/69 (43%), Positives = 33/69 (47%)
 Frame = -2

Query: 218 PPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKP 39
           P   PP       P  PP+PP P P PP  PPP P PP  PP P P    + P PP + P
Sbjct: 463 PDECPPLSVLETLPSAPPSPPPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPP 522

Query: 38  YEYPSPPPP 12
              P P PP
Sbjct: 523 SPRPPPRPP 531

[53][TOP]
>UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q3HTL0_VOLCA
          Length = 590

 Score =  120 bits (301), Expect = 5e-26
 Identities = 51/79 (64%), Positives = 53/79 (67%)
 Frame = -2

Query: 254 PPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVY 75
           PPP P PPP P PPP+PPPPP PPPPPPPP PP+PPP PPP PPP P PP  PPPP    
Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP---- 260

Query: 74  KYKSPPPPAKKPYEYPSPP 18
              SPP P   P   PSPP
Sbjct: 261 ---SPPLP---PPSIPSPP 273

 Score =  116 bits (291), Expect = 7e-25
 Identities = 47/74 (63%), Positives = 50/74 (67%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP+P PPP P PPP+PPPPPPPPPPP PP PP PPP P P PPP P PP  P 
Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPL 264

Query: 92  PPPPVYKYKSPPPP 51
           PPP +     P PP
Sbjct: 265 PPPSI-----PSPP 273

 Score =  109 bits (272), Expect = 1e-22
 Identities = 47/94 (50%), Positives = 55/94 (58%), Gaps = 11/94 (11%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P+PPP+P PPP P PPP PPPPP PPPPPPPP PP+PPP P P PP  P PP   P
Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIP 270

Query: 92  PPPPVYKYKS-----------PPPPAKKPYEYPS 24
            PP  + ++             P P  +P+ Y S
Sbjct: 271 SPPFAFGFRPFCDVCIKAQLLAPFPDVRPFRYSS 304

 Score =  103 bits (257), Expect = 6e-21
 Identities = 42/70 (60%), Positives = 45/70 (64%)
 Frame = -2

Query: 218 PPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKP 39
           PPP PPPPP P PPP PP PP+PPP PPP PPP P PP  PPPPP       PPPP+  P
Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPP-----SPPPPPSPPP 259

Query: 38  YEYPSPPPPV 9
              P PPP +
Sbjct: 260 PSPPLPPPSI 269

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 41/72 (56%), Positives = 43/72 (59%)
 Frame = -2

Query: 227 CPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPA 48
           CP    +  PPPPPPPPP P  PP+PPP P P PPP P PP  PPPPPP     SPPPP 
Sbjct: 196 CPTSRASKYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 255

Query: 47  KKPYEYPSPPPP 12
             P   P  PPP
Sbjct: 256 SPPPPSPPLPPP 267

[54][TOP]
>UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO
          Length = 2618

 Score =  120 bits (300), Expect = 6e-26
 Identities = 55/108 (50%), Positives = 58/108 (53%), Gaps = 23/108 (21%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPP-----------TPPAPPPTPPPNPPP 120
            P P+PPP P PPP P PPP  PPP  PPPPPPPP            PPAP P+PPP PPP
Sbjct: 2025 PPPSPPPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPPPPLPPPAPSPSPPPPPPP 2084

Query: 119  CPDPPLEPPPPPPV------------YKYKSPPPPAKKPYEYPSPPPP 12
             P PP  PPPPPP                 SPPPP+  P   P PPPP
Sbjct: 2085 WPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSPPPPPP 2132

 Score =  119 bits (299), Expect = 8e-26
 Identities = 60/101 (59%), Positives = 61/101 (60%), Gaps = 14/101 (13%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPP-PPPPPPPPPTPPAPPP-------TPPPN---P 126
            P PLP PPP P PPP P P P PPPPP PPPP PPPP PPAPPP        PPP+   P
Sbjct: 2059 PAPLPPPPP-PLPPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPP 2117

Query: 125  PPCPDPPLEPPPPPPVYKYKSPPP---PAKKPYEYPSPPPP 12
            PP P PP  PPPPPP     SPPP   P   P   PSPPPP
Sbjct: 2118 PPSPPPPPSPPPPPP-----SPPPAPLPPPPPSPPPSPPPP 2153

 Score =  119 bits (297), Expect = 1e-25
 Identities = 53/96 (55%), Positives = 57/96 (59%), Gaps = 10/96 (10%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPP-------PPPPTPPAPPPTPPPNPPPCP 114
            P P P+P P P PPP P PP  PPPPPP PPP       PPPP+P  PPP+PPP P P P
Sbjct: 2070 PPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSPPP 2129

Query: 113  DPPLEPP---PPPPVYKYKSPPPPAKKPYEYPSPPP 15
             PP  PP   PPPP     SPPPP   P   P+PPP
Sbjct: 2130 PPPSPPPAPLPPPPPSPPPSPPPPPSPPPSPPAPPP 2165

 Score =  118 bits (295), Expect = 2e-25
 Identities = 57/98 (58%), Positives = 57/98 (58%), Gaps = 11/98 (11%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPE-PPPAPPPPPPPPP---PPPPPTPPAPPPTPPPN-------P 126
            P P P PPPAP PPP P  PPPAP P PPPPP   PPPP  PP PPP PPP        P
Sbjct: 2051 PPPPPPPPPAPLPPPPPPLPPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPP 2110

Query: 125  PPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP P PP   PPPPP     SPPPP   P   P PPPP
Sbjct: 2111 PPSPSPPPPSPPPPP-----SPPPPPPSPPPAPLPPPP 2143

 Score =  117 bits (293), Expect = 4e-25
 Identities = 54/97 (55%), Positives = 58/97 (59%), Gaps = 10/97 (10%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPC----------PEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPP 123
            P PLP+PPP P PPP           P PPPAP PPPPPP PPP P+P  PPP PP  PP
Sbjct: 2029 PPPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPPPPLPPPAPSPSPPPPPPPWPPP 2088

Query: 122  PCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P P PP  P PPP   +   PPPP+  P   PSPPPP
Sbjct: 2089 PSPPPPPPPAPPPGAAQAPWPPPPSPSP-PPPSPPPP 2124

 Score =  116 bits (290), Expect = 9e-25
 Identities = 53/95 (55%), Positives = 55/95 (57%), Gaps = 9/95 (9%)
 Frame = -2

Query: 272  PFPLPTPPPAPKP---------PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPP 120
            P P P PPPAP P         PP P PPP  PPPPP PPPPPP  PPAP P PPP+PPP
Sbjct: 2089 PSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSPPPPPPSPPPAPLPPPPPSPPP 2148

Query: 119  CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
             P PP  PPP PP      PP P  +P   PS PP
Sbjct: 2149 SPPPPPSPPPSPPA----PPPHPPPEPPAPPSFPP 2179

 Score =  114 bits (285), Expect = 3e-24
 Identities = 51/94 (54%), Positives = 54/94 (57%), Gaps = 7/94 (7%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPC-------PEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCP 114
            P P P PPP P PPP        P P P+PPPP PPPPP PPP PP+PPP P P PPP P
Sbjct: 2087 PPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSPPPPPPSPPPAPLPPPPPSP 2146

Query: 113  DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             P   PPP PP      P PPA  P+  P PP P
Sbjct: 2147 PPSPPPPPSPP------PSPPAPPPHPPPEPPAP 2174

 Score =  105 bits (263), Expect = 1e-21
 Identities = 49/83 (59%), Positives = 50/83 (60%)
 Frame = -2

Query: 260  PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
            P PPP   PPP P P P+PPP P PPPP PPP  P PPP PPP P P P PPL PP P P
Sbjct: 2018 PRPPPN-HPPPSPPPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPPPPLPPPAPSP 2076

Query: 80   VYKYKSPPPPAKKPYEYPSPPPP 12
                 SPPPP       PSPPPP
Sbjct: 2077 -----SPPPPPPPWPPPPSPPPP 2094

 Score =  100 bits (249), Expect = 5e-20
 Identities = 42/72 (58%), Positives = 47/72 (65%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
            P P P PPP+P PPP P PPPAP PPPPP PPP PP PP+PPP+PP  PP  P  P  PP
Sbjct: 2117 PPPSPPPPPSPPPPP-PSPPPAPLPPPPPSPPPSPPPPPSPPPSPPAPPPHPPPEPPAPP 2175

Query: 92   PPPPVYKYKSPP 57
              PP + +   P
Sbjct: 2176 SFPPQFDFGDEP 2187

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 40/78 (51%), Positives = 43/78 (55%)
 Frame = -2

Query: 245  APKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYK 66
            A  P    + P  PP  PPP PPP P  PP P P PPP+PPP   PP  PPPP P+    
Sbjct: 2008 AAAPKQYADAPRPPPNHPPPSPPPLPSPPPLPSP-PPPSPPPLSPPPPPPPPPAPL---P 2063

Query: 65   SPPPPAKKPYEYPSPPPP 12
             PPPP   P   PSPPPP
Sbjct: 2064 PPPPPLPPPAPSPSPPPP 2081

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 30/67 (44%), Positives = 32/67 (47%)
 Frame = -2

Query: 209  APPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEY 30
            AP      P PPP   PP+PPP P P       PPL  PPPP       PPPP   P   
Sbjct: 2010 APKQYADAPRPPPNHPPPSPPPLPSP-------PPLPSPPPPSPPPLSPPPPPPPPPAPL 2062

Query: 29   PSPPPPV 9
            P PPPP+
Sbjct: 2063 PPPPPPL 2069

[55][TOP]
>UniRef100_A8P059 Pherophorin-dz1 protein, putative n=1 Tax=Brugia malayi
           RepID=A8P059_BRUMA
          Length = 351

 Score =  120 bits (300), Expect = 6e-26
 Identities = 55/92 (59%), Positives = 60/92 (65%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272 PFPLPTPP----PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPP-PCPDP 108
           P P P PP    P P PPPCP+PPP P P PPPPPP P P PP+PPP PPP PP PCP P
Sbjct: 117 PAPPPCPPQSCPPPPLPPPCPKPPP-PIPCPPPPPPKPCPPPPSPPPCPPPPPPQPCPPP 175

Query: 107 PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PL PP PP    Y +PPPP++ P  Y  PP P
Sbjct: 176 PLPPPCPP---TYCTPPPPSQPPVTYSPPPKP 204

 Score =  115 bits (289), Expect = 1e-24
 Identities = 53/87 (60%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPP-PPPPPPPPTPPAPPPTPPPNPP-PCPDPPLEPP 93
           P P PPP P P PCP+PPP PPPPPP P PPP PP P  PPP PPP PP  CP PPL PP
Sbjct: 77  PQPCPPPPP-PVPCPKPPPCPPPPPPIPCPPPLPPKPCPPPPAPPPCPPQSCPPPPLPPP 135

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P P      PPPP  KP   P  PPP
Sbjct: 136 CPKPPPPIPCPPPPPPKPCPPPPSPPP 162

 Score =  114 bits (285), Expect = 3e-24
 Identities = 53/93 (56%), Positives = 55/93 (59%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272 PFPLPTPP-PAPKPPPCPEPP---PAPPPPPPPPPPPPPPTPPAPPPT--PPPNPPPCPD 111
           P P P PP P PKPPPCP PP   P PPP PP P PPPP  PP PP +  PPP PPPCP 
Sbjct: 79  PCPPPPPPVPCPKPPPCPPPPPPIPCPPPLPPKPCPPPPAPPPCPPQSCPPPPLPPPCPK 138

Query: 110 PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP   P PPP      PPPP+  P   P PP P
Sbjct: 139 PPPPIPCPPPPPPKPCPPPPSPPPCPPPPPPQP 171

 Score =  110 bits (275), Expect = 5e-23
 Identities = 52/96 (54%), Positives = 55/96 (57%), Gaps = 9/96 (9%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP--PCPEPPPAPPPPP-------PPPPPPPPPTPPAPPPTPPPNPPP 120
           P PL  P P P+PP  PCP PPP+PP PP       PP P PP P PP PPP P P PPP
Sbjct: 35  PRPLYQPYPRPQPPQRPCPPPPPSPPCPPQPCPSLPPPTPCPPQPCPPPPPPVPCPKPPP 94

Query: 119 CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           CP PP   P PPP+     PPPPA  P    S PPP
Sbjct: 95  CPPPPPPIPCPPPLPPKPCPPPPAPPPCPPQSCPPP 130

 Score =  110 bits (274), Expect = 6e-23
 Identities = 53/95 (55%), Positives = 54/95 (56%), Gaps = 8/95 (8%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPP---CPEP-PPAPPPPPPPPPPPPP---PTPPAPPPTPPPNPP-PC 117
           P P P PPP P PPP   CP P PP P PPPP PPP PP   P PP PPP P P PP PC
Sbjct: 86  PVPCPKPPPCPPPPPPIPCPPPLPPKPCPPPPAPPPCPPQSCPPPPLPPPCPKPPPPIPC 145

Query: 116 PDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PP   P PPP      PPPP  +P   P  PPP
Sbjct: 146 PPPPPPKPCPPPPSPPPCPPPPPPQPCPPPPLPPP 180

 Score =  109 bits (272), Expect = 1e-22
 Identities = 55/91 (60%), Positives = 55/91 (60%), Gaps = 6/91 (6%)
 Frame = -2

Query: 266 PLPTPPPAPKPPP---CPEPPPAPP-PPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P PPP PKPPP   CP PPP  P PPPP PPP PPP PP P P PPP PPPCP     
Sbjct: 129 PPPLPPPCPKPPPPIPCPPPPPPKPCPPPPSPPPCPPPPPPQPCP-PPPLPPPCPPTYCT 187

Query: 98  PPPP--PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP  PPV  Y  PP P     E PS PPP
Sbjct: 188 PPPPSQPPV-TYSPPPKPYPYVPECPSLPPP 217

 Score =  103 bits (257), Expect = 6e-21
 Identities = 55/104 (52%), Positives = 57/104 (54%), Gaps = 19/104 (18%)
 Frame = -2

Query: 266 PLPTPPPAPK--PPPCPE-PPPAP------PPPPPP---PPPPPPPTPPAPPPTPPPNPP 123
           P P PPP+P   P PCP  PPP P      PPPPPP   P PPP P PP P P PPP PP
Sbjct: 51  PCPPPPPSPPCPPQPCPSLPPPTPCPPQPCPPPPPPVPCPKPPPCPPPPPPIPCPPPLPP 110

Query: 122 -PCPDPPLEPP------PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PCP PP  PP      PPPP+     PPP  K P   P PPPP
Sbjct: 111 KPCPPPPAPPPCPPQSCPPPPL-----PPPCPKPPPPIPCPPPP 149

 Score =  102 bits (254), Expect = 1e-20
 Identities = 49/92 (53%), Positives = 52/92 (56%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPP----PPPTPPAPPPTPPPNPP-PCPDP 108
           P+P P   P P+P P   P P PPP PP PP P    PPPTP  P P PPP PP PCP P
Sbjct: 33  PYPRPLYQPYPRPQPPQRPCPPPPPSPPCPPQPCPSLPPPTPCPPQPCPPPPPPVPCPKP 92

Query: 107 PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P  PPPPPP+     PPP   KP   P  PPP
Sbjct: 93  PPCPPPPPPI---PCPPPLPPKPCPPPPAPPP 121

 Score =  102 bits (254), Expect = 1e-20
 Identities = 50/105 (47%), Positives = 52/105 (49%), Gaps = 17/105 (16%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP----------------PAPPPPPPPPPPPPPPTPPAPPPT 141
           P+P P PP  P PPP P PP                P P PPPPPP P P P P  PPP 
Sbjct: 41  PYPRPQPPQRPCPPPPPSPPCPPQPCPSLPPPTPCPPQPCPPPPPPVPCPKPPPCPPPPP 100

Query: 140 PPPNPPPCPDPPLEPPP-PPPVYKYKSPPPPAKKPYEYPSPPPPV 9
           P P PPP P  P  PPP PPP      PPPP   P   P PPPP+
Sbjct: 101 PIPCPPPLPPKPCPPPPAPPPCPPQSCPPPPLPPP--CPKPPPPI 143

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 43/78 (55%), Positives = 45/78 (57%), Gaps = 3/78 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKP-PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P PPP PKP PP P PPP PPPPPP P PPPP  PP PP    P PP  P     P
Sbjct: 142 PIPCPPPPP-PKPCPPPPSPPPCPPPPPPQPCPPPPLPPPCPPTYCTPPPPSQPPVTYSP 200

Query: 95  PPPPPVYKYKSP--PPPA 48
           PP P  Y  + P  PPP+
Sbjct: 201 PPKPYPYVPECPSLPPPS 218

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 46/95 (48%), Positives = 49/95 (51%), Gaps = 9/95 (9%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPP-PPPPPP----PTPPAPPP---TPPPNP-PP 120
           P P P PPP P PPPCP PPP  P PPPP PPP PP    P PP+ PP   +PPP P P 
Sbjct: 149 PPPKPCPPP-PSPPPCPPPPPPQPCPPPPLPPPCPPTYCTPPPPSQPPVTYSPPPKPYPY 207

Query: 119 CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            P+ P  PPP P   K  S           PS  P
Sbjct: 208 VPECPSLPPPSPSDCKTDSEVCTKCNQQSKPSKSP 242

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 34/74 (45%), Positives = 36/74 (48%)
 Frame = -2

Query: 230 PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPP 51
           P P P   P P P PP  P PP    PPP+PP  P PCP  P   P PP       PP P
Sbjct: 33  PYPRPLYQPYPRPQPPQRPCPP----PPPSPPCPPQPCPSLPPPTPCPPQPCPPPPPPVP 88

Query: 50  AKKPYEYPSPPPPV 9
             KP   P PPPP+
Sbjct: 89  CPKPPPCPPPPPPI 102

[56][TOP]
>UniRef100_B7PCR0 Cement protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PCR0_IXOSC
          Length = 229

 Score =  119 bits (299), Expect = 8e-26
 Identities = 58/88 (65%), Positives = 59/88 (67%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGG
Sbjct: 126 SGGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 179

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGG GGG G GGG G GGG G G G
Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 207

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 129 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 182

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGGGGGGG 209

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 130 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 183

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 184 GGGGGGGGGGGGGGGGGGGGGGGGGGG 210

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 131 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 184

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 185 GGGGGGGGGGGGGGGGGGGGGGGGGGG 211

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 132 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 185

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 186 GGGGGGGGGGGGGGGGGGGGGGGGGGG 212

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 133 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 186

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 187 GGGGGGGGGGGGGGGGGGGGGGGGGGG 213

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 134 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 187

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGGGGGGG 214

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 135 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 188

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 189 GGGGGGGGGGGGGGGGGGGGGGGGGGG 215

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 136 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 189

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 190 GGGGGGGGGGGGGGGGGGGGGGGGGGG 216

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 137 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 190

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 191 GGGGGGGGGGGGGGGGGGGGGGGGGGG 217

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 138 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 191

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 192 GGGGGGGGGGGGGGGGGGGGGGGGGGG 218

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 139 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 192

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 193 GGGGGGGGGGGGGGGGGGGGGGGGGGG 219

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 140 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 193

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 194 GGGGGGGGGGGGGGGGGGGGGGGGGGG 220

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 141 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 194

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 195 GGGGGGGGGGGGGGGGGGGGGGGGGGG 221

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 142 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 195

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 196 GGGGGGGGGGGGGGGGGGGGGGGGGGG 222

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 143 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 196

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 197 GGGGGGGGGGGGGGGGGGGGGGGGGGG 223

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 144 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 197

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 198 GGGGGGGGGGGGGGGGGGGGGGGGGGG 224

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 145 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 198

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 199 GGGGGGGGGGGGGGGGGGGGGGGGGGG 225

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 146 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 200 GGGGGGGGGGGGGGGGGGGGGGGGGGG 226

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 147 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 201 GGGGGGGGGGGGGGGGGGGGGGGGGGG 227

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 148 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 201

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 202 GGGGGGGGGGGGGGGGGGGGGGGGGGG 228

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 149 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 202

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 203 GGGGGGGGGGGGGGGGGGGGGGGGGGG 229

 Score =  112 bits (279), Expect = 2e-23
 Identities = 52/76 (68%), Positives = 54/76 (71%)
 Frame = +1

Query: 46  LAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSG 225
           ++GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G
Sbjct: 125 MSGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 178

Query: 226 HGGGFGAGGGVGSGNG 273
            GGG G GGG G G G
Sbjct: 179 GGGGGGGGGGGGGGGG 194

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 36/52 (69%), Positives = 36/52 (69%)
 Frame = +1

Query: 118 HGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           H     GG GGG GG GGGGGGGGGGGGGG GGG G GGG G GGG G G G
Sbjct: 121 HTSCMSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 172

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 36/61 (59%), Positives = 38/61 (62%)
 Frame = +1

Query: 91  GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGN 270
           GG S+    H       + GG GG GGGGGGGGGGGGGG GGG G GGG G GGG G G 
Sbjct: 108 GGESHQTQEHTRVHTSCMSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 167

Query: 271 G 273
           G
Sbjct: 168 G 168

[57][TOP]
>UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7QC44_IXOSC
          Length = 116

 Score =  119 bits (299), Expect = 8e-26
 Identities = 51/88 (57%), Positives = 56/88 (63%), Gaps = 9/88 (10%)
 Frame = -2

Query: 272 PFPLPTPPP---------APKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPP 120
           P  LP  PP         A  PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP
Sbjct: 24  PHSLPIFPPSLFLQQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83

Query: 119 CPDPPLEPPPPPPVYKYKSPPPPAKKPY 36
            P PP  PPPPPP  +++   PP+K P+
Sbjct: 84  PPPPPPPPPPPPPPPQWEPADPPSKWPF 111

 Score =  105 bits (262), Expect = 2e-21
 Identities = 43/66 (65%), Positives = 45/66 (68%)
 Frame = -2

Query: 212 PAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYE 33
           P PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP      PPPP  +P +
Sbjct: 45  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEPAD 104

Query: 32  YPSPPP 15
            PS  P
Sbjct: 105 PPSKWP 110

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 41/65 (63%), Positives = 43/65 (66%)
 Frame = -2

Query: 197 PPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPP 18
           PPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP      PPPP   P   P PP
Sbjct: 45  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP-----PPPPPPPPP---PPPP 96

Query: 17  PPVYK 3
           PP ++
Sbjct: 97  PPQWE 101

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 34/52 (65%), Positives = 34/52 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPC 117
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP P   P  PP   P C
Sbjct: 61  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEPADPPSKWPFC 112

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 30/51 (58%), Positives = 31/51 (60%)
 Frame = -2

Query: 164 TPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           +PP PPP PPP PPP P PP  PPPPPP      PPPP   P   P PPPP
Sbjct: 44  SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94

[58][TOP]
>UniRef100_Q5TU53 AGAP002965-PA (Fragment) n=1 Tax=Anopheles gambiae
           RepID=Q5TU53_ANOGA
          Length = 212

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 13  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 67  GGGGGGGGGGGGGGGGGGGGGGGGGGG 93

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 14  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 67

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 68  GGGGGGGGGGGGGGGGGGGGGGGGGGG 94

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 15  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 68

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 69  GGGGGGGGGGGGGGGGGGGGGGGGGGG 95

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 16  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 69

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 70  GGGGGGGGGGGGGGGGGGGGGGGGGGG 96

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 17  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 71  GGGGGGGGGGGGGGGGGGGGGGGGGGG 97

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 18  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 71

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 72  GGGGGGGGGGGGGGGGGGGGGGGGGGG 98

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 19  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 73  GGGGGGGGGGGGGGGGGGGGGGGGGGG 99

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 20  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 74  GGGGGGGGGGGGGGGGGGGGGGGGGGG 100

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 21  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 74

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 75  GGGGGGGGGGGGGGGGGGGGGGGGGGG 101

 Score =  118 bits (295), Expect = 2e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 23  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 77  GGGGGGGGGGGGGGGGGGGGGGGGGVG 103

 Score =  117 bits (294), Expect = 3e-25
 Identities = 57/84 (67%), Positives = 58/84 (69%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 27  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGS 264
           GGGGG GGG G GGG G GGGVG+
Sbjct: 81  GGGGGGGGGGGGGGGGGGGGGVGA 104

 Score =  116 bits (291), Expect = 7e-25
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GG G G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 5   GGRGKGKQGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 58

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 59  GGGGGGGGGGGGGGGGGGGGGGGGGGG 85

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/84 (66%), Positives = 56/84 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 33  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGS 264
           GGGGG GGG G GGG GA G V S
Sbjct: 87  GGGGGGGGGGGGGGGVGAYGSVRS 110

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 52/89 (58%), Positives = 53/89 (59%), Gaps = 6/89 (6%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 40  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93

Query: 193 GGGGGAGGGSGHG------GGFGAGGGVG 261
           GGGGG GG   +G         G GGG G
Sbjct: 94  GGGGGGGGVGAYGSVRSTSSDRGRGGGTG 122

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 50/87 (57%), Positives = 51/87 (58%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 42  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG  G  G      +  G G G G
Sbjct: 96  GGGGGGVGAYGSVRSTSSDRGRGGGTG 122

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/97 (49%), Positives = 50/97 (51%), Gaps = 13/97 (13%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGG 
Sbjct: 49  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGV 102

Query: 193 GG-------------GGGAGGGSGHGGGFGAGGGVGS 264
           G              GGG GG        G  GG+G+
Sbjct: 103 GAYGSVRSTSSDRGRGGGTGGSPSMVPTIGTLGGIGT 139

[59][TOP]
>UniRef100_B7QN34 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7QN34_IXOSC
          Length = 364

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 1   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 54

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 55  GGGGGGGGGGGGGGGGGGGGGGGGGGG 81

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 2   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 55

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 56  GGGGGGGGGGGGGGGGGGGGGGGGGGG 82

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 3   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 56

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 57  GGGGGGGGGGGGGGGGGGGGGGGGGGG 83

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 4   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 57

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 58  GGGGGGGGGGGGGGGGGGGGGGGGGGG 84

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 5   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 58

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 59  GGGGGGGGGGGGGGGGGGGGGGGGGGG 85

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 6   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 59

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 60  GGGGGGGGGGGGGGGGGGGGGGGGGGG 86

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 256 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 309

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 310 GGGGGGGGGGGGGGGGGGGGGGGGGGG 336

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 257 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 310

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 311 GGGGGGGGGGGGGGGGGGGGGGGGGGG 337

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 258 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 311

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 312 GGGGGGGGGGGGGGGGGGGGGGGGGGG 338

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 259 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 312

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 313 GGGGGGGGGGGGGGGGGGGGGGGGGGG 339

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 260 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 313

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 314 GGGGGGGGGGGGGGGGGGGGGGGGGGG 340

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 261 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 314

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 315 GGGGGGGGGGGGGGGGGGGGGGGGGGG 341

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 262 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 315

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 316 GGGGGGGGGGGGGGGGGGGGGGGGGGG 342

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 263 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 316

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 317 GGGGGGGGGGGGGGGGGGGGGGGGGGG 343

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 264 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 317

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 318 GGGGGGGGGGGGGGGGGGGGGGGGGGG 344

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 265 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 318

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 319 GGGGGGGGGGGGGGGGGGGGGGGGGGG 345

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 266 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 319

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 320 GGGGGGGGGGGGGGGGGGGGGGGGGGG 346

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 267 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 320

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 321 GGGGGGGGGGGGGGGGGGGGGGGGGGG 347

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 268 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 321

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 322 GGGGGGGGGGGGGGGGGGGGGGGGGGG 348

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 269 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 322

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 323 GGGGGGGGGGGGGGGGGGGGGGGGGGG 349

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 270 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 323

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 324 GGGGGGGGGGGGGGGGGGGGGGGGGGG 350

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 271 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 324

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 325 GGGGGGGGGGGGGGGGGGGGGGGGGGG 351

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 272 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 325

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 326 GGGGGGGGGGGGGGGGGGGGGGGGGGG 352

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 273 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 326

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 327 GGGGGGGGGGGGGGGGGGGGGGGGGGG 353

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 274 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 327

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 328 GGGGGGGGGGGGGGGGGGGGGGGGGGG 354

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 275 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 328

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 329 GGGGGGGGGGGGGGGGGGGGGGGGGGG 355

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 276 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 329

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 330 GGGGGGGGGGGGGGGGGGGGGGGGGGG 356

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 277 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 330

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 331 GGGGGGGGGGGGGGGGGGGGGGGGGGG 357

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 278 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 331

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 332 GGGGGGGGGGGGGGGGGGGGGGGGGGG 358

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 279 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 332

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 333 GGGGGGGGGGGGGGGGGGGGGGGGGGG 359

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 280 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 333

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 334 GGGGGGGGGGGGGGGGGGGGGGGGGGG 360

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 281 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 334

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 335 GGGGGGGGGGGGGGGGGGGGGGGGGGG 361

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 282 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 335

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 336 GGGGGGGGGGGGGGGGGGGGGGGGGGG 362

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 283 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 336

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 337 GGGGGGGGGGGGGGGGGGGGGGGGGGG 363

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 284 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 337

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 338 GGGGGGGGGGGGGGGGGGGGGGGGGGG 364

 Score =  117 bits (293), Expect = 4e-25
 Identities = 57/88 (64%), Positives = 58/88 (65%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           + GGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGG
Sbjct: 254 SAGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 307

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGG GGG G GGG G GGG G G G
Sbjct: 308 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 335

 Score =  115 bits (287), Expect = 2e-24
 Identities = 56/82 (68%), Positives = 56/82 (68%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 12  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65

Query: 193 GGGGGAGGGSGHGGGFGAGGGV 258
           GGGGG GGG G GGG G GGGV
Sbjct: 66  GGGGGGGGGGGGGGGGGGGGGV 87

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 47/70 (67%), Positives = 47/70 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 25  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78

Query: 193 GGGGGAGGGS 222
           GGGGG GG S
Sbjct: 79  GGGGGGGGVS 88

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 41/58 (70%), Positives = 42/58 (72%)
 Frame = +1

Query: 100 SNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           +N  S  GGG GGG GGG GG GGGGGGGGGGGGGG GGG G GGG G GGG G G G
Sbjct: 250 ANDRSAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 307

[60][TOP]
>UniRef100_B7QAD8 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7QAD8_IXOSC
          Length = 164

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 1   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 54

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 55  GGGGGGGGGGGGGGGGGGGGGGGGGGG 81

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 2   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 55

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 56  GGGGGGGGGGGGGGGGGGGGGGGGGGG 82

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 3   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 56

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 57  GGGGGGGGGGGGGGGGGGGGGGGGGGG 83

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 5   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 58

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 59  GGGGGGGGGGGGGGGGGGGGGGGGGTG 85

[61][TOP]
>UniRef100_B7PFE7 Cement protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PFE7_IXOSC
          Length = 254

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 19  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 73  GGGGGGGGGGGGGGGGGGGGGGGGGGG 99

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 20  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 74  GGGGGGGGGGGGGGGGGGGGGGGGGGG 100

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 21  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 74

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 75  GGGGGGGGGGGGGGGGGGGGGGGGGGG 101

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 22  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 76  GGGGGGGGGGGGGGGGGGGGGGGGGGG 102

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 23  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 77  GGGGGGGGGGGGGGGGGGGGGGGGGGG 103

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 24  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 78  GGGGGGGGGGGGGGGGGGGGGGGGGGG 104

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 25  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 79  GGGGGGGGGGGGGGGGGGGGGGGGGGG 105

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 26  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 80  GGGGGGGGGGGGGGGGGGGGGGGGGGG 106

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 27  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 81  GGGGGGGGGGGGGGGGGGGGGGGGGGG 107

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 28  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 82  GGGGGGGGGGGGGGGGGGGGGGGGGGG 108

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 29  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 83  GGGGGGGGGGGGGGGGGGGGGGGGGGG 109

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 30  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 84  GGGGGGGGGGGGGGGGGGGGGGGGGGG 110

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 31  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 85  GGGGGGGGGGGGGGGGGGGGGGGGGGG 111

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 32  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 86  GGGGGGGGGGGGGGGGGGGGGGGGGGG 112

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 33  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 87  GGGGGGGGGGGGGGGGGGGGGGGGGGG 113

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 34  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 88  GGGGGGGGGGGGGGGGGGGGGGGGGGG 114

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 35  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 89  GGGGGGGGGGGGGGGGGGGGGGGGGGG 115

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 36  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 90  GGGGGGGGGGGGGGGGGGGGGGGGGGG 116

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 37  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 91  GGGGGGGGGGGGGGGGGGGGGGGGGGG 117

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 38  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 92  GGGGGGGGGGGGGGGGGGGGGGGGGGG 118

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 39  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 93  GGGGGGGGGGGGGGGGGGGGGGGGGGG 119

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 40  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 94  GGGGGGGGGGGGGGGGGGGGGGGGGGG 120

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 41  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 95  GGGGGGGGGGGGGGGGGGGGGGGGGGG 121

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 42  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 96  GGGGGGGGGGGGGGGGGGGGGGGGGGG 122

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 43  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 97  GGGGGGGGGGGGGGGGGGGGGGGGGGG 123

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 44  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 98  GGGGGGGGGGGGGGGGGGGGGGGGGGG 124

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 45  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 99  GGGGGGGGGGGGGGGGGGGGGGGGGGG 125

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 46  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGGGGGGG 126

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 47  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 101 GGGGGGGGGGGGGGGGGGGGGGGGGGG 127

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 48  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGGG 128

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 49  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 103 GGGGGGGGGGGGGGGGGGGGGGGGGGG 129

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 50  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGGGGGGG 130

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 51  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 105 GGGGGGGGGGGGGGGGGGGGGGGGGGG 131

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 52  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 105

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 106 GGGGGGGGGGGGGGGGGGGGGGGGGGG 132

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 53  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 106

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 107 GGGGGGGGGGGGGGGGGGGGGGGGGGG 133

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 54  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 108 GGGGGGGGGGGGGGGGGGGGGGGGGGG 134

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 55  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGGGGG 135

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 56  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 110 GGGGGGGGGGGGGGGGGGGGGGGGGGG 136

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 57  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGGG 137

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 58  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGGG 138

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 59  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGG 139

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 60  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGGG 140

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 61  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGGG 141

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 62  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGGG 142

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 63  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 117 GGGGGGGGGGGGGGGGGGGGGGGGGGG 143

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 64  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 118 GGGGGGGGGGGGGGGGGGGGGGGGGGG 144

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 65  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 119 GGGGGGGGGGGGGGGGGGGGGGGGGGG 145

 Score =  115 bits (287), Expect = 2e-24
 Identities = 56/84 (66%), Positives = 57/84 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 69  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 122

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGS 264
           GGGGG GGG G GGG G GGG G+
Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGGGA 146

 Score =  113 bits (282), Expect = 8e-24
 Identities = 53/77 (68%), Positives = 54/77 (70%)
 Frame = +1

Query: 43  FLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGS 222
           F+ GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG 
Sbjct: 16  FVLGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 69

Query: 223 GHGGGFGAGGGVGSGNG 273
           G GGG G GGG G G G
Sbjct: 70  GGGGGGGGGGGGGGGGG 86

 Score =  112 bits (281), Expect = 1e-23
 Identities = 55/84 (65%), Positives = 56/84 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 72  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 125

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGS 264
           GGGGG GGG G GGG G GG + S
Sbjct: 126 GGGGGGGGGGGGGGGGGGGGAIVS 149

 Score =  112 bits (279), Expect = 2e-23
 Identities = 53/76 (69%), Positives = 53/76 (69%)
 Frame = +1

Query: 46  LAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSG 225
           L GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G
Sbjct: 18  LGGGGGG----GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73

Query: 226 HGGGFGAGGGVGSGNG 273
            GGG G GGG G G G
Sbjct: 74  GGGGGGGGGGGGGGGG 89

 Score =  109 bits (273), Expect = 8e-23
 Identities = 49/70 (70%), Positives = 52/70 (74%)
 Frame = +1

Query: 64  DLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFG 243
           +L++  GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G GGG G
Sbjct: 14  ELFVLGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73

Query: 244 AGGGVGSGNG 273
            GGG G G G
Sbjct: 74  GGGGGGGGGG 83

[62][TOP]
>UniRef100_B7PFE5 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PFE5_IXOSC
          Length = 202

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 110 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 164 GGGGGGGGGGGGGGGGGGGGGGGGGGG 190

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 111 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 165 GGGGGGGGGGGGGGGGGGGGGGGGGGG 191

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 112 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 166 GGGGGGGGGGGGGGGGGGGGGGGGGGG 192

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 113 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 167 GGGGGGGGGGGGGGGGGGGGGGGGGGG 193

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 114 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 167

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 168 GGGGGGGGGGGGGGGGGGGGGGGGGGG 194

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 115 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 168

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 169 GGGGGGGGGGGGGGGGGGGGGGGGGGG 195

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 116 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 169

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 170 GGGGGGGGGGGGGGGGGGGGGGGGGGG 196

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 117 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 170

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 171 GGGGGGGGGGGGGGGGGGGGGGGGGGG 197

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 118 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 171

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 172 GGGGGGGGGGGGGGGGGGGGGGGGGGG 198

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 119 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 172

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 173 GGGGGGGGGGGGGGGGGGGGGGGGGGG 199

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 120 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 173

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 174 GGGGGGGGGGGGGGGGGGGGGGGGGGG 200

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 121 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 174

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 175 GGGGGGGGGGGGGGGGGGGGGGGGGGG 201

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 122 GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 175

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 176 GGGGGGGGGGGGGGGGGGGGGGGGGGG 202

 Score =  112 bits (280), Expect = 1e-23
 Identities = 53/76 (69%), Positives = 53/76 (69%)
 Frame = +1

Query: 46  LAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSG 225
           L GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G
Sbjct: 109 LGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162

Query: 226 HGGGFGAGGGVGSGNG 273
            GGG G GGG G G G
Sbjct: 163 GGGGGGGGGGGGGGGG 178

 Score =  111 bits (278), Expect = 2e-23
 Identities = 54/83 (65%), Positives = 56/83 (67%)
 Frame = +1

Query: 25  DGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGG 204
           +G S+   A GGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGG
Sbjct: 100 EGISHRLEALGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 153

Query: 205 GAGGGSGHGGGFGAGGGVGSGNG 273
           G GGG G GGG G GGG G G G
Sbjct: 154 GGGGGGGGGGGGGGGGGGGGGGG 176

[63][TOP]
>UniRef100_B7PE98 Glycine rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PE98_IXOSC
          Length = 156

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 37  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 91  GGGGGGGGGGGGGGGGGGGGGGGGGGG 117

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 38  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 92  GGGGGGGGGGGGGGGGGGGGGGGGGGG 118

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 39  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 93  GGGGGGGGGGGGGGGGGGGGGGGGGGG 119

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 40  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 94  GGGGGGGGGGGGGGGGGGGGGGGGGGG 120

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 41  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 95  GGGGGGGGGGGGGGGGGGGGGGGGGGG 121

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 42  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 96  GGGGGGGGGGGGGGGGGGGGGGGGGGG 122

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 43  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 97  GGGGGGGGGGGGGGGGGGGGGGGGGGG 123

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 44  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 98  GGGGGGGGGGGGGGGGGGGGGGGGGGG 124

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 45  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 99  GGGGGGGGGGGGGGGGGGGGGGGGGGG 125

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 46  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGGGGGGG 126

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 47  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 101 GGGGGGGGGGGGGGGGGGGGGGGGGGG 127

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 48  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGGG 128

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 49  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 103 GGGGGGGGGGGGGGGGGGGGGGGGGGG 129

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 50  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGGGGGGG 130

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 51  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 105 GGGGGGGGGGGGGGGGGGGGGGGGGGG 131

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 52  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 105

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 106 GGGGGGGGGGGGGGGGGGGGGGGGGGG 132

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 53  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 106

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 107 GGGGGGGGGGGGGGGGGGGGGGGGGGG 133

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 54  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 108 GGGGGGGGGGGGGGGGGGGGGGGGGGG 134

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 55  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGGGGG 135

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 56  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 110 GGGGGGGGGGGGGGGGGGGGGGGGGGG 136

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 57  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGGG 137

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 58  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGGG 138

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 59  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGG 139

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 60  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGGG 140

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 61  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGGG 141

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 62  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGGG 142

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 63  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 117 GGGGGGGGGGGGGGGGGGGGGGGGGGG 143

 Score =  112 bits (279), Expect = 2e-23
 Identities = 53/81 (65%), Positives = 55/81 (67%)
 Frame = +1

Query: 31  YSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGA 210
           Y+   + GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG 
Sbjct: 31  YNIQGVGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84

Query: 211 GGGSGHGGGFGAGGGVGSGNG 273
           GGG G GGG G GGG G G G
Sbjct: 85  GGGGGGGGGGGGGGGGGGGGG 105

 Score =  110 bits (275), Expect = 5e-23
 Identities = 54/86 (62%), Positives = 55/86 (63%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           G G  Y    + G GG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGG
Sbjct: 23  GAGKKYRCYNIQGVGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76

Query: 196 GGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGG GGG G GGG G GGG G G G
Sbjct: 77  GGGGGGGGGGGGGGGGGGGGGGGGGG 102

 Score =  101 bits (252), Expect = 2e-20
 Identities = 50/76 (65%), Positives = 50/76 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 77  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 130

Query: 193 GGGGGAGGGSGHGGGF 240
           GGGGG GGG G G  F
Sbjct: 131 GGGGGGGGGGGGGERF 146

[64][TOP]
>UniRef100_B7PDJ6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PDJ6_IXOSC
          Length = 275

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 1   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 54

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 55  GGGGGGGGGGGGGGGGGGGGGGGGGGG 81

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 2   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 55

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 56  GGGGGGGGGGGGGGGGGGGGGGGGGGG 82

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 3   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 56

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 57  GGGGGGGGGGGGGGGGGGGGGGGGGGG 83

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 4   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 57

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 58  GGGGGGGGGGGGGGGGGGGGGGGGGGG 84

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 5   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 58

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 59  GGGGGGGGGGGGGGGGGGGGGGGGGGG 85

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 6   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 59

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 60  GGGGGGGGGGGGGGGGGGGGGGGGGGG 86

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 7   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 61  GGGGGGGGGGGGGGGGGGGGGGGGGGG 87

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 8   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 62  GGGGGGGGGGGGGGGGGGGGGGGGGGG 88

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 9   GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 62

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 63  GGGGGGGGGGGGGGGGGGGGGGGGGGG 89

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 10  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 63

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 64  GGGGGGGGGGGGGGGGGGGGGGGGGGG 90

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 11  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 65  GGGGGGGGGGGGGGGGGGGGGGGGGGG 91

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 12  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 66  GGGGGGGGGGGGGGGGGGGGGGGGGGG 92

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 13  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 67  GGGGGGGGGGGGGGGGGGGGGGGGGGG 93

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 14  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 67

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 68  GGGGGGGGGGGGGGGGGGGGGGGGGGG 94

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 15  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 68

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 69  GGGGGGGGGGGGGGGGGGGGGGGGGGG 95

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 16  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 69

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 70  GGGGGGGGGGGGGGGGGGGGGGGGGGG 96

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 17  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 71  GGGGGGGGGGGGGGGGGGGGGGGGGGG 97

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 18  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 71

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 72  GGGGGGGGGGGGGGGGGGGGGGGGGGG 98

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 19  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 73  GGGGGGGGGGGGGGGGGGGGGGGGGGG 99

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 20  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 74  GGGGGGGGGGGGGGGGGGGGGGGGGGG 100

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 21  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 74

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 75  GGGGGGGGGGGGGGGGGGGGGGGGGGG 101

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 22  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 76  GGGGGGGGGGGGGGGGGGGGGGGGGGG 102

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 23  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 77  GGGGGGGGGGGGGGGGGGGGGGGGGGG 103

 Score =  117 bits (293), Expect = 4e-25
 Identities = 57/86 (66%), Positives = 58/86 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 25  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGN 270
           GGGGG GGG G GGG G GGG G G+
Sbjct: 79  GGGGGGGGGGGGGGGGGGGGGGGGGS 104

 Score =  115 bits (287), Expect = 2e-24
 Identities = 56/86 (65%), Positives = 57/86 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 26  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGN 270
           GGGGG GGG G GGG G GGG G  +
Sbjct: 80  GGGGGGGGGGGGGGGGGGGGGGGGSH 105

 Score =  102 bits (254), Expect = 1e-20
 Identities = 50/76 (65%), Positives = 50/76 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 37  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90

Query: 193 GGGGGAGGGSGHGGGF 240
           GGGGG GGG G G  F
Sbjct: 91  GGGGGGGGGGGGGSHF 106

[65][TOP]
>UniRef100_B7P671 Cement protein, putative n=1 Tax=Ixodes scapularis
           RepID=B7P671_IXOSC
          Length = 324

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 34  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 88  GGGGGGGGGGGGGGGGGGGGGGGGGGG 114

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 35  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 89  GGGGGGGGGGGGGGGGGGGGGGGGGGG 115

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 36  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 90  GGGGGGGGGGGGGGGGGGGGGGGGGGG 116

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 37  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 91  GGGGGGGGGGGGGGGGGGGGGGGGGGG 117

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 38  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 92  GGGGGGGGGGGGGGGGGGGGGGGGGGG 118

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 39  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 93  GGGGGGGGGGGGGGGGGGGGGGGGGGG 119

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 40  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 94  GGGGGGGGGGGGGGGGGGGGGGGGGGG 120

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 41  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 95  GGGGGGGGGGGGGGGGGGGGGGGGGGG 121

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 42  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 96  GGGGGGGGGGGGGGGGGGGGGGGGGGG 122

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 43  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 97  GGGGGGGGGGGGGGGGGGGGGGGGGGG 123

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 44  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 98  GGGGGGGGGGGGGGGGGGGGGGGGGGG 124

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 45  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 99  GGGGGGGGGGGGGGGGGGGGGGGGGGG 125

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 46  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGGGGGGG 126

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 47  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 101 GGGGGGGGGGGGGGGGGGGGGGGGGGG 127

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 48  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGGG 128

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 49  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 103 GGGGGGGGGGGGGGGGGGGGGGGGGGG 129

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 50  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGGGGGGG 130

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 51  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 105 GGGGGGGGGGGGGGGGGGGGGGGGGGG 131

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 52  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 105

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 106 GGGGGGGGGGGGGGGGGGGGGGGGGGG 132

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 53  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 106

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 107 GGGGGGGGGGGGGGGGGGGGGGGGGGG 133

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 54  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 108 GGGGGGGGGGGGGGGGGGGGGGGGGGG 134

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 55  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGGGGG 135

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 56  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 110 GGGGGGGGGGGGGGGGGGGGGGGGGGG 136

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 57  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGGG 137

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 58  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGGG 138

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 59  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGG 139

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 60  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGGG 140

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 61  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGGG 141

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 62  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGGG 142

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 63  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 117 GGGGGGGGGGGGGGGGGGGGGGGGGGG 143

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 64  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 118 GGGGGGGGGGGGGGGGGGGGGGGGGGG 144

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 65  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 119 GGGGGGGGGGGGGGGGGGGGGGGGGGG 145

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 66  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 120 GGGGGGGGGGGGGGGGGGGGGGGGGGG 146

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 67  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 121 GGGGGGGGGGGGGGGGGGGGGGGGGGG 147

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 68  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 121

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 122 GGGGGGGGGGGGGGGGGGGGGGGGGGG 148

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 69  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 122

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGGGGGGG 149

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 70  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 123

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 124 GGGGGGGGGGGGGGGGGGGGGGGGGGG 150

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 71  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 124

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 125 GGGGGGGGGGGGGGGGGGGGGGGGGGG 151

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 72  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 125

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGGGGGGG 152

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 73  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 126

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 127 GGGGGGGGGGGGGGGGGGGGGGGGGGG 153

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 74  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 127

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 128 GGGGGGGGGGGGGGGGGGGGGGGGGGG 154

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 75  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 128

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 129 GGGGGGGGGGGGGGGGGGGGGGGGGGG 155

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 76  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 129

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 130 GGGGGGGGGGGGGGGGGGGGGGGGGGG 156

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 77  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 130

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 131 GGGGGGGGGGGGGGGGGGGGGGGGGGG 157

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 78  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 131

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGG 158

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 79  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 132

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGG 159

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 80  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 133

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGG 160

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 81  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 134

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGG 161

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 82  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 135

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGG 162

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 83  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 136

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGG 163

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 84  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 137

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGG 164

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 85  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 138

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGG 165

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 86  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 139

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGGG 166

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 87  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 140

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGGGG 167

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 88  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 141

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGGGGG 168

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 89  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 142

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGGGGGGG 169

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 90  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 143

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 144 GGGGGGGGGGGGGGGGGGGGGGGGGGG 170

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 91  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 144

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 145 GGGGGGGGGGGGGGGGGGGGGGGGGGG 171

 Score =  111 bits (278), Expect = 2e-23
 Identities = 54/80 (67%), Positives = 54/80 (67%)
 Frame = +1

Query: 34  SYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAG 213
           SY    GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG G
Sbjct: 31  SYKGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84

Query: 214 GGSGHGGGFGAGGGVGSGNG 273
           GG G GGG G GGG G G G
Sbjct: 85  GGGGGGGGGGGGGGGGGGGG 104

 Score =  108 bits (271), Expect = 1e-22
 Identities = 51/76 (67%), Positives = 52/76 (68%)
 Frame = +1

Query: 46  LAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSG 225
           LA    +L    GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G
Sbjct: 22  LAHNPSELLSYKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81

Query: 226 HGGGFGAGGGVGSGNG 273
            GGG G GGG G G G
Sbjct: 82  GGGGGGGGGGGGGGGG 97

[66][TOP]
>UniRef100_Q5ZB68 Os01g0594300 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5ZB68_ORYSJ
          Length = 551

 Score =  119 bits (298), Expect = 1e-25
 Identities = 53/96 (55%), Positives = 61/96 (63%), Gaps = 7/96 (7%)
 Frame = -2

Query: 269 FPLPTPPPAPKPPPCPEPP-PAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           F LP+PPP   PPP P PP P+PPPP PPPP PPPP+P  PPP+PPP  PP P P     
Sbjct: 395 FVLPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSS 454

Query: 92  PPPPVY------KYKSPPPPAKKPYEYPSPPPPVYK 3
           PPPP Y      +Y SPPPP   P  + +PPPP Y+
Sbjct: 455 PPPPYYEVSPEDRYLSPPPP---PAYHEAPPPPYYE 487

 Score =  101 bits (252), Expect = 2e-20
 Identities = 51/112 (45%), Positives = 57/112 (50%), Gaps = 22/112 (19%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTP-----PPNP------ 126
           P P   PPP+P PPP   PPP+PPPP P PPPP PP P  PPP+P     PP P      
Sbjct: 405 PPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSP 464

Query: 125 -----PPCPDPPLEPPPPPPVY------KYKSPPPPAKKPYEYPSPPPPVYK 3
                 P P P     PPPP Y      +Y SPPPP    Y+   PPPP Y+
Sbjct: 465 EDRYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPP--PAYQETPPPPPQYE 514

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 61/135 (45%), Positives = 66/135 (48%), Gaps = 48/135 (35%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP-PAPPPP-PPPPPPPPP-------PTPP-----------A 153
           P P P+PPP   PPP P PP P+PPPP PPPP PPPP       P PP           +
Sbjct: 411 PPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSPEDRYLS 470

Query: 152 PPPTP-----PPNP------------PPCPDPPLEPPPPPPVY------KYKSPPPPA-- 48
           PPP P     PP P            PP P    E PPPPP Y      +Y SPPPP+  
Sbjct: 471 PPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPEDRYLSPPPPSPV 530

Query: 47  --KKP-YEYPSPPPP 12
             K P YEY SPPPP
Sbjct: 531 KWKLPVYEYSSPPPP 545

[67][TOP]
>UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7P5E7_IXOSC
          Length = 129

 Score =  118 bits (296), Expect = 2e-25
 Identities = 46/65 (70%), Positives = 47/65 (72%)
 Frame = -2

Query: 254 PPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVY 75
           PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPP + 
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHIT 60

Query: 74  KYKSP 60
           K   P
Sbjct: 61  KISLP 65

 Score =  113 bits (282), Expect = 8e-24
 Identities = 45/65 (69%), Positives = 46/65 (70%)
 Frame = -2

Query: 248 PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKY 69
           P P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP +  
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHIT 60

Query: 68  KSPPP 54
           K   P
Sbjct: 61  KISLP 65

 Score =  110 bits (275), Expect = 5e-23
 Identities = 47/74 (63%), Positives = 48/74 (64%)
 Frame = -2

Query: 224 PEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAK 45
           P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP      PPPP  
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP------PPPP-- 52

Query: 44  KPYEYPSPPPPVYK 3
                P PPP + K
Sbjct: 53  -----PPPPPHITK 61

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/125 (44%), Positives = 57/125 (45%), Gaps = 39/125 (31%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPD------ 111
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P       
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHITKIS 63

Query: 110 ------------------PPLEP-----PPPPPVYKYKSPP----------PPAKKPYEY 30
                             PP EP     P  PPV     PP          PP  +P   
Sbjct: 64  LPFFNALIEIIFLITNTLPPEEPASLHLPELPPVTAVAHPPAMPAADALVSPPTDRPLNS 123

Query: 29  PSPPP 15
            + PP
Sbjct: 124 SADPP 128

[68][TOP]
>UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1
           Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE
          Length = 472

 Score =  118 bits (295), Expect = 2e-25
 Identities = 52/95 (54%), Positives = 59/95 (62%), Gaps = 12/95 (12%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPP---PPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
           P PPP+P+PP    P P+PPPPP   PP PPPP P PP+PPP PPP+PPP P PP  PPP
Sbjct: 220 PPPPPSPQPPSPQPPSPSPPPPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPP 279

Query: 89  PPPVYKYKSPPP---------PAKKPYEYPSPPPP 12
           PPP      PPP         PA+K    P+PPPP
Sbjct: 280 PPPPPSPSPPPPELPPAQPVTPARKRPPPPAPPPP 314

 Score =  113 bits (283), Expect = 6e-24
 Identities = 51/88 (57%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPP--PPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P PPP+P PP  P P P PP  PPPPPP PPPPP PP PPP PPP P P P PP  
Sbjct: 234 PSPSPPPPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPPPEL 293

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
           PP  P     K PPPPA      P PPP
Sbjct: 294 PPAQPVTPARKRPPPPA------PPPPP 315

 Score =  100 bits (250), Expect = 4e-20
 Identities = 45/85 (52%), Positives = 49/85 (57%), Gaps = 4/85 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKP-PPCPEPPPAPPPPPPPPPPPPPPTPPAPP---PTPPPNPPPCPDPP 105
           P P P  PP P P PP P PPP P PPPPPPPPPPPP PP PP   P PP  PP  P  P
Sbjct: 242 PSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPPPELPPAQPVTP 301

Query: 104 LEPPPPPPVYKYKSPPPPAKKPYEY 30
               PPPP     +PPPP +  + +
Sbjct: 302 ARKRPPPP-----APPPPPRSDFPF 321

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 41/78 (52%), Positives = 43/78 (55%), Gaps = 6/78 (7%)
 Frame = -2

Query: 227 CPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPN------PPPCPDPPLEPPPPPPVYKYK 66
           CP       PPPPP P PP P PP+P P PPP+      PPP P PP  PPPPPP     
Sbjct: 211 CPVSILGNAPPPPPSPQPPSPQPPSPSPPPPPSPAPPSPPPPSPLPPSPPPPPPP----- 265

Query: 65  SPPPPAKKPYEYPSPPPP 12
           SPPPP   P   P PPPP
Sbjct: 266 SPPPPPPPPPPPPPPPPP 283

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 35/66 (53%), Positives = 37/66 (56%), Gaps = 14/66 (21%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPP--------------PTPPAPPPTPP 135
           P P P PPP+P PPP P PPP PPPPPP P PPPP              P PPAPPP P 
Sbjct: 257 PSPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPPPELPPAQPVTPARKRPPPPAPPPPPR 316

Query: 134 PNPPPC 117
            + P C
Sbjct: 317 SDFPFC 322

[69][TOP]
>UniRef100_A7SGL4 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SGL4_NEMVE
          Length = 620

 Score =  118 bits (295), Expect = 2e-25
 Identities = 53/96 (55%), Positives = 56/96 (58%), Gaps = 10/96 (10%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPP-------PPPPPPPTPPAPPPTPPPNPPPCP 114
           P+P P  PP+P PPPCP P P PPPPPPP       PPPPPPP P  PPP PPP P PCP
Sbjct: 409 PYPAPYTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPPPCPIPCP 468

Query: 113 DPPLEPPPPPPVYKYKSPPP---PAKKPYEYPSPPP 15
           +P   P P P  Y   SP P   P   PY  PSP P
Sbjct: 469 EPYPVPVPIPEPYYVPSPEPYPVPVPLPYAVPSPEP 504

 Score =  111 bits (277), Expect = 3e-23
 Identities = 52/92 (56%), Positives = 56/92 (60%), Gaps = 6/92 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAP---KPPPCPEPPPAPPPPPP--PPPPPPPPTP-PAPPPTPPPNPPPCPD 111
           P+P+P P P+P    PPP P PPP+ P P P  PP PPPPP P P PPP PPP PPPCP 
Sbjct: 383 PYPVPYPYPSPVPYPPPPAPYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPPPCPV 442

Query: 110 PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
           P   PPPPPP     SPPPP   P   P P P
Sbjct: 443 PCPPPPPPPP----PSPPPPPPPPCPIPCPEP 470

 Score =  110 bits (275), Expect = 5e-23
 Identities = 49/87 (56%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = -2

Query: 272 PFPLPTPP-PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P+P P+ P PAP  PP P PPP P P PPPPPPPPPP  P P P PPP PPP P PP  P
Sbjct: 402 PYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPP 461

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPP 15
           P P P  +    P P  +PY  PSP P
Sbjct: 462 PCPIPCPEPYPVPVPIPEPYYVPSPEP 488

 Score =  107 bits (267), Expect = 4e-22
 Identities = 51/104 (49%), Positives = 57/104 (54%), Gaps = 17/104 (16%)
 Frame = -2

Query: 272 PFPLPTPPPA-PKPPPCPEPP------------PAPPPPPPPPPPPPPPTPPAP----PP 144
           P+P+P+P P  P PPPCP P             P+P P PPPP P PPP+ P P    PP
Sbjct: 358 PYPVPSPAPGYPPPPPCPGPYECLSPYPVPYPYPSPVPYPPPPAPYPPPSAPYPAPYTPP 417

Query: 143 TPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           +PPP P P P PP  PPPPPP      PPPP   P   P PPPP
Sbjct: 418 SPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPP 461

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 44/97 (45%), Positives = 46/97 (47%), Gaps = 10/97 (10%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP P P P P P P P   P   P+P P P P P P   P 
Sbjct: 443 PCPPPPPPPPPSPPP-PPPPPCPIPCPEPYPVPVPIPEPYYVPSPEPYPVPVPLPYAVPS 501

Query: 92  PPP---PVYKYKSPPP-------PAKKPYEYPSPPPP 12
           P P   PV  Y  P P       P   P   P+PPPP
Sbjct: 502 PEPYPFPVAAYPDPCPAQCPEQSPQPCPSPCPTPPPP 538

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 40/94 (42%), Positives = 42/94 (44%), Gaps = 10/94 (10%)
 Frame = -2

Query: 266 PLPTPPPA----PKPPPCPEPPPAPPPPPPPPPPP---PPPTP---PAPPPTPPPNPPPC 117
           P P PPP     P PPPCP P P P P P P P P   P P P   P P P   P+P P 
Sbjct: 446 PPPPPPPPSPPPPPPPPCPIPCPEPYPVPVPIPEPYYVPSPEPYPVPVPLPYAVPSPEPY 505

Query: 116 PDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
           P P    P P P    +  P P   P   P PPP
Sbjct: 506 PFPVAAYPDPCPAQCPEQSPQPCPSPCPTPPPPP 539

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 36/86 (41%), Positives = 39/86 (45%), Gaps = 6/86 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPP--APPPPPPPPPPPPPPTPPAPPPTPPP---NPPPCP-D 111
           P P P P P P P P P P P   P P P P P P P   P+P P P P    P PCP  
Sbjct: 460 PPPCPIPCPEPYPVPVPIPEPYYVPSPEPYPVPVPLPYAVPSPEPYPFPVAAYPDPCPAQ 519

Query: 110 PPLEPPPPPPVYKYKSPPPPAKKPYE 33
            P + P P P      PPPP   P +
Sbjct: 520 CPEQSPQPCPSPCPTPPPPPIPAPVQ 545

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 33/96 (34%), Positives = 37/96 (38%), Gaps = 30/96 (31%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPP---------------------------PPPPPPPPP 174
           P P+  P P P+P P P P PA                              P    PPP
Sbjct: 122 PLPMYIPVPVPQPVPQPVPQPASKGKSVLDKILQLQMTLKLMALLGQKNSVSPGILAPPP 181

Query: 173 PPPTPPAPPPTPPPNPPPCPDPP---LEPPPPPPVY 75
            PP   APPP PP   PP P PP   + PPP PP +
Sbjct: 182 APPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPPTF 217

[70][TOP]
>UniRef100_A0NCZ0 AGAP001055-PA (Fragment) n=1 Tax=Anopheles gambiae
           RepID=A0NCZ0_ANOGA
          Length = 208

 Score =  117 bits (294), Expect = 3e-25
 Identities = 57/87 (65%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG+    G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 17  GGGGNSGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 71  GGGGGGGGGGGGGGGGGGGGGGGGGGG 97

 Score =  117 bits (292), Expect = 5e-25
 Identities = 58/88 (65%), Positives = 59/88 (67%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGG
Sbjct: 22  SGGGGGGGGGG--GGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGG GGG G GGG G GGG G G G
Sbjct: 74  GGGGGGGGGGGGGGGGGGGGGGGGPGGG 101

 Score =  113 bits (283), Expect = 6e-24
 Identities = 56/85 (65%), Positives = 56/85 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 27  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSG 267
           GGGGG GGG G GGG G GGG   G
Sbjct: 81  GGGGGGGGGGGGGGGGGPGGGGWGG 105

 Score =  113 bits (282), Expect = 8e-24
 Identities = 56/87 (64%), Positives = 56/87 (64%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 25  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G G G G   G
Sbjct: 79  GGGGGGGGGGGGGGGGGGGPGGGGWGG 105

 Score =  113 bits (282), Expect = 8e-24
 Identities = 56/87 (64%), Positives = 56/87 (64%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 28  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG   GGG G   G
Sbjct: 82  GGGGGGGGGGGGGGGGPGGGGWGGWRG 108

 Score =  112 bits (281), Expect = 1e-23
 Identities = 58/93 (62%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 34  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87

Query: 193 GGGGGAGGGSGHGGGF------GAGGGVGSGNG 273
           GGGGG GGG   GGG+      GAGGG G G G
Sbjct: 88  GGGGGGGGGGPGGGGWGGWRGRGAGGGGGGGGG 120

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/87 (63%), Positives = 55/87 (63%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 44  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGG GG  G G G G GGG G G G
Sbjct: 98  PGGGGWGGWRGRGAGGGGGGGGGGGGG 124

 Score =  107 bits (266), Expect = 5e-22
 Identities = 54/87 (62%), Positives = 55/87 (63%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGG GGG
Sbjct: 48  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGPGGG 101

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GG  G G+G GGG G GGG G G G
Sbjct: 102 GWGGWRGRGAGGGGGGGGGGGGGGGGG 128

 Score =  104 bits (259), Expect = 3e-21
 Identities = 55/87 (63%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGG GGGG 
Sbjct: 50  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGPGGGGW 103

Query: 193 GG--GGGAGGGSGHGGGFGAGGGVGSG 267
           GG  G GAGGG G GGG G GGG G G
Sbjct: 104 GGWRGRGAGGGGGGGGGGGGGGGGGGG 130

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 49/82 (59%), Positives = 50/82 (60%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG G GG  G G
Sbjct: 57  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGPGGGGWGGWRGRG 110

Query: 193 GGGGGAGGGSGHGGGFGAGGGV 258
            GGGG GGG G GGG G GG +
Sbjct: 111 AGGGGGGGGGGGGGGGGGGGQI 132

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 32/44 (72%), Positives = 32/44 (72%)
 Frame = +1

Query: 142 VGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           VGGG    GGGGGGGGGGGGGG GGG G GGG G GGG G G G
Sbjct: 16  VGGGGNSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 59

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 32/44 (72%), Positives = 32/44 (72%)
 Frame = +1

Query: 142 VGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           V GG G  GGGGGGGGGGGGGG GGG G GGG G GGG G G G
Sbjct: 15  VVGGGGNSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 58

[71][TOP]
>UniRef100_A1CM40 Cytokinesis protein SepA/Bni1 n=1 Tax=Aspergillus clavatus
            RepID=A1CM40_ASPCL
          Length = 1813

 Score =  117 bits (294), Expect = 3e-25
 Identities = 55/102 (53%), Positives = 58/102 (56%), Gaps = 15/102 (14%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPP----PPPPPPPPPPTPP------APPPTPPPNPP 123
            P   P PPP P PPP P PPP PPP     PPPPPPPPPP PP       PPP PPP PP
Sbjct: 1016 PVSAPAPPPPPPPPPPPPPPPPPPPGAIGVPPPPPPPPPPPPPGGKGMGVPPPPPPPPPP 1075

Query: 122  P-----CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P      P PP  PPPPPP +    PPPP   P  + +PPPP
Sbjct: 1076 PGFGGGMPPPP--PPPPPPGFGGGMPPPPPPPPGRFGAPPPP 1115

 Score =  104 bits (260), Expect = 3e-21
 Identities = 52/104 (50%), Positives = 56/104 (53%), Gaps = 18/104 (17%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPE----PPPAPPPPPPPPP-------PPPPPTPPAP-------P 147
            P P P PPP P PPP P     PPP PPPPPPPPP       PPPPP PP P       P
Sbjct: 1024 PPPPPPPPPPPPPPPPPGAIGVPPPPPPPPPPPPPGGKGMGVPPPPPPPPPPPGFGGGMP 1083

Query: 146  PTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            P PPP PPP     + PPPPPP  ++ +PPPP         PPP
Sbjct: 1084 PPPPPPPPPGFGGGMPPPPPPPPGRFGAPPPP---------PPP 1118

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 44/81 (54%), Positives = 46/81 (56%), Gaps = 11/81 (13%)
 Frame = -2

Query: 221  EPPPAPPPPPPPPPPPPPPTPPAPPP----TPPPNPPPCPDPP-------LEPPPPPPVY 75
            +P  AP PPPPPPPPPPPP PP PPP     PPP PPP P PP       + PPPPPP  
Sbjct: 1015 KPVSAPAPPPPPPPPPPPPPPPPPPPGAIGVPPPPPPPPPPPPPGGKGMGVPPPPPPP-- 1072

Query: 74   KYKSPPPPAKKPYEYPSPPPP 12
                PPPP       P PPPP
Sbjct: 1073 ----PPPPGFGGGMPPPPPPP 1089

[72][TOP]
>UniRef100_UPI0000DA1BD4 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA1BD4
          Length = 250

 Score =  117 bits (293), Expect = 4e-25
 Identities = 58/87 (66%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGGD     GGGGGG  GG G GGG GGG  GG GG GGGGGGGGG
Sbjct: 83  GGGGGGVGGG---GGGGD----GGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGG 135

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G+G
Sbjct: 136 GGGGGGGGGDGGGGGGGGGGGGGGGDG 162

 Score =  117 bits (293), Expect = 4e-25
 Identities = 58/87 (66%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGGDG   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 93  GGGGDGGGGG--GGGGG------GGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGG 144

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGG GGG G GGG   GGGVG G G
Sbjct: 145 DGGGGGGGGGGGGGGGDGGGGVGGGGG 171

 Score =  116 bits (291), Expect = 7e-25
 Identities = 57/87 (65%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGGDG   G   GGGG      GGGGGG +GG   GGG GGGVGGG GG  GGGGGGGG
Sbjct: 50  GGGGDGGGDGGGRGGGGG----DGGGGGGGDGGGDGGGGGGGGVGGGGGGGDGGGGGGGG 105

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GG  G GGG G G G
Sbjct: 106 GGGGGGGGGGGGGGDGGGGGGGGGGGG 132

 Score =  115 bits (287), Expect = 2e-24
 Identities = 58/89 (65%), Positives = 59/89 (66%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGG--GGGGG 186
           GGGGDG   G   GGGG      GGGGGG +GG G GGG GGG GGG GG GG  GGGGG
Sbjct: 72  GGGGDGGGDGGGGGGGG-----VGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGDGGGGGG 126

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGG GGG G GGG   GGG G G G
Sbjct: 127 GGGGGGGGGGGGGGGGGGDGGGGGGGGGG 155

 Score =  114 bits (285), Expect = 3e-24
 Identities = 56/87 (64%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGGDG   G   GGGG      GGGGGG  GG G GGG GGG G G GGVGGGGGGG G
Sbjct: 116 GGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGGDG 175

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG  GG G GGG G G G G G+G
Sbjct: 176 GGGGGGDGGGGGGGGGGGGDGSGGGDG 202

 Score =  112 bits (279), Expect = 2e-23
 Identities = 55/87 (63%), Positives = 56/87 (64%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGGD     GGGGGG  GG G GG  GGGVGGG GG  GGGGGGG 
Sbjct: 128 GGGGGGGGGGGGGGGGGD-----GGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGGD 182

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G  G  G  GGVG G+G
Sbjct: 183 GGGGGGGGGGGGDGSGGGDGGVGGGSG 209

 Score =  108 bits (269), Expect = 2e-22
 Identities = 55/87 (63%), Positives = 55/87 (63%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGGDG   G   GGGG      GGGG G  GG G GGG GGG GGG GG GGGGG G G
Sbjct: 141 GGGGDGGGGGGGGGGGGGGG--DGGGGVGGGGGGGDGGGGGGGDGGGGGGGGGGGGDGSG 198

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GG GGGSG G G G GGG G G G
Sbjct: 199 GGDGGVGGGSGGGDGGGGGGGGGGGGG 225

 Score =  105 bits (261), Expect = 2e-21
 Identities = 55/87 (63%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGGD     GGGGGG +GG G GGG GGG GGG GG G G GGG G
Sbjct: 146 GGGGGGGGGG--GGGGGDGGGGVGGGGGGGDGGGG-GGGDGGGGGGGGGGGGDGSGGGDG 202

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGG+GGG G GGG G GGG G G G
Sbjct: 203 GVGGGSGGGDGGGGGGGGGGGGGVGGG 229

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 54/89 (60%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGG--VGGGAGGVGGGGGGG 186
           GGGGDG       GGGGD     GGGGGG +GG G GGG GGG   GGG GGVGGG GGG
Sbjct: 157 GGGGDGGGGVGGGGGGGD-----GGGGGGGDGGGGGGGGGGGGDGSGGGDGGVGGGSGGG 211

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGGGG GGG         GGGVG G+G
Sbjct: 212 DGGGGGGGGGG---------GGGVGGGDG 231

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 49/77 (63%), Positives = 50/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query: 46  LAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGG-GAGGGS 222
           +AGGGG       GGGGG  GG G G G GGG GGG GG  GGG GGGGGGGG G GGG 
Sbjct: 43  VAGGGG-------GGGGGDGGGDGGGRGGGGGDGGGGGGGDGGGDGGGGGGGGVGGGGGG 95

Query: 223 GHGGGFGAGGGVGSGNG 273
           G GGG G GGG G G G
Sbjct: 96  GDGGGGGGGGGGGGGGG 112

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 45/71 (63%), Positives = 45/71 (63%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGGDG       GGGGD     GGGGGG  GG G GGG GG  GG  GG GGGGGGGGG
Sbjct: 170 GGGGDGGG-----GGGGDG---GGGGGGGGGGGDGSGGGDGGVGGGSGGGDGGGGGGGGG 221

Query: 193 GGGGGAGGGSG 225
           GGGG  GG  G
Sbjct: 222 GGGGVGGGDGG 232

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 27/38 (71%), Positives = 27/38 (71%), Gaps = 1/38 (2%)
 Frame = +1

Query: 163 VGGGGGGGGGGG-GGGAGGGSGHGGGFGAGGGVGSGNG 273
           V  GGGGGGGGG GGG GGG G GGG G GGG G G G
Sbjct: 42  VVAGGGGGGGGGDGGGDGGGRGGGGGDGGGGGGGDGGG 79

[73][TOP]
>UniRef100_A4S1A8 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901
           RepID=A4S1A8_OSTLU
          Length = 388

 Score =  117 bits (293), Expect = 4e-25
 Identities = 51/90 (56%), Positives = 60/90 (66%), Gaps = 2/90 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPC--PDPPLE 99
           P P P+PPP+P P P P PPP+PPP PPP PPP PP  P+PPP+PPP+PPP   P+PP  
Sbjct: 88  PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP--PSPPPSPPPSPPPSPPPNPPPS 145

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
           PPP PP       PPP+  P   PSPP P+
Sbjct: 146 PPPSPP-----PSPPPSPPPSPPPSPPVPI 170

 Score =  103 bits (257), Expect = 6e-21
 Identities = 46/78 (58%), Positives = 51/78 (65%), Gaps = 7/78 (8%)
 Frame = -2

Query: 227 CPEPPPAPP--PPPPPPPPPPPPTPPAPPPTPPPNPPPC--PDPPLEPPPPPPVYKYKSP 60
           CP PPP+PP  PPP PPP PPP  PP+PPP+PPP+PPP   P PP  PPP PP     SP
Sbjct: 87  CPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSP 146

Query: 59  ---PPPAKKPYEYPSPPP 15
              PPP+  P   PSPPP
Sbjct: 147 PPSPPPSPPPSPPPSPPP 164

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 37/60 (61%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPP--PPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P P+PPP+P P P P PPP+PPP PPP  PP PPP  PP+PPP+PPP+PPP P  P++
Sbjct: 112 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSPPPSPPPSPPVPID 171

[74][TOP]
>UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B541C
          Length = 661

 Score =  117 bits (292), Expect = 5e-25
 Identities = 55/99 (55%), Positives = 59/99 (59%), Gaps = 12/99 (12%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAP-PPPPPPPPPPPPPTPPAPPPTPPP----NPP----- 123
           P P P+ PP+    P   PP +P PPPPPPPPPPP P PP PPP+ PP     PP     
Sbjct: 463 PSPPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSY 522

Query: 122 PCPDPPLEPPPPPPVYKYKSPPPPAKKP--YEYPSPPPP 12
           P P PP  PPPPP  Y Y SPPPP   P  Y YPSPPPP
Sbjct: 523 PSPPPPPPPPPPPVTYNYPSPPPPPSLPVTYNYPSPPPP 561

 Score =  108 bits (271), Expect = 1e-22
 Identities = 59/111 (53%), Positives = 62/111 (55%), Gaps = 24/111 (21%)
 Frame = -2

Query: 272 PFPLP---TPPPAPKPP---PCPEPP-PAPPPPPPP-----PP--PPPPPTPPAP-PPTP 138
           P PLP   TP P P PP   P P P  P+PPP  PP     PP  PP  P+PP P PP P
Sbjct: 436 PLPLPSTSTPSPPPSPPSSTPSPSPSTPSPPPSRPPSTPSLPPSRPPSSPSPPPPPPPPP 495

Query: 137 PPNPPPCPDPPLEPPP----PPPVYKYKSPPPPAKKP-----YEYPSPPPP 12
           PP PPP P PP +PPP    PP  Y Y SPPPP   P     Y YPSPPPP
Sbjct: 496 PPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPPVTYNYPSPPPP 546

 Score =  103 bits (256), Expect = 8e-21
 Identities = 51/104 (49%), Positives = 54/104 (51%), Gaps = 17/104 (16%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPP--------------PPPPPPPPPPPPTPPAPPPTPP 135
           P P P PPP P+PPP P PP  PP              PPPPPPPPPPP T   P P PP
Sbjct: 487 PPPPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPPVTYNYPSPPPP 546

Query: 134 PNPPPC---PDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P+ P     P PP  PPPPPP Y Y +P      P   P PPPP
Sbjct: 547 PSLPVTYNYPSPP--PPPPPPSYNYPAPTYYYPSPSPRPPPPPP 588

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/108 (42%), Positives = 51/108 (47%), Gaps = 22/108 (20%)
 Frame = -2

Query: 269 FPLPTPPPAPKPPPCPEPPPAPPPPP----------PPPPPPPP-----------PTPPA 153
           +P P PPP P PPP     P+PPPPP          PPPPPPPP           P+P  
Sbjct: 522 YPSPPPPPPPPPPPVTYNYPSPPPPPSLPVTYNYPSPPPPPPPPSYNYPAPTYYYPSPSP 581

Query: 152 PPPTPPPNPPPC-PDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP PPP P P  P P + P P PP   Y  PP    +P  Y  PP P
Sbjct: 582 RPPPPPPRPRPSRPRPIITPKPIPPRATYLPPPRLTPQPRTYLPPPTP 629

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 50/119 (42%), Positives = 52/119 (43%), Gaps = 32/119 (26%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP----------------PCPEPPPAPPPPPP----PPPPPPPPTP-- 159
           P P P PPP P PP                P P PPP PPPPP     P PPPPP  P  
Sbjct: 493 PPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPPVTYNYPSPPPPPSLPVT 552

Query: 158 ---PAPPPTPPP----NPPPC---PDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              P+PPP PPP     P P    P P   PPPPPP      P P   +P   P P PP
Sbjct: 553 YNYPSPPPPPPPPSYNYPAPTYYYPSPSPRPPPPPP-----RPRPSRPRPIITPKPIPP 606

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 48/115 (41%), Positives = 53/115 (46%), Gaps = 30/115 (26%)
 Frame = -2

Query: 269 FPLPTPPPA-------PKPPPCPEPP----PAP------PPPPPPPPPP-PPPTPPAPPP 144
           +P P PPP+       P PPP P PP    PAP      P P PPPPPP P P+ P P  
Sbjct: 540 YPSPPPPPSLPVTYNYPSPPPPPPPPSYNYPAPTYYYPSPSPRPPPPPPRPRPSRPRPII 599

Query: 143 TPPPNPPPC---PDPPLEP------PPP---PPVYKYKSPPPPAKKPYEYPSPPP 15
           TP P PP     P P L P      PPP   P  + Y  PP P  + Y  P P P
Sbjct: 600 TPKPIPPRATYLPPPRLTPQPRTYLPPPTPTPQTFTYSQPPAPQSRLYLPPRPAP 654

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 33/56 (58%), Positives = 34/56 (60%), Gaps = 3/56 (5%)
 Frame = -2

Query: 272 PFPLPT---PPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCP 114
           PF LP+   P P P PPP     PAPPPPPPPPPPPPPP PP PP    P P   P
Sbjct: 53  PFGLPSHQPPSPPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPPPPRVSTPAPTYLP 108

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 35/76 (46%), Positives = 36/76 (47%), Gaps = 5/76 (6%)
 Frame = -2

Query: 215 PPAPPPPPPP-----PPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPP 51
           PP+PPPPPPP     P PPPPP PP PPP PPP PPP    P     PP         P 
Sbjct: 61  PPSPPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPPPPRVSTPAPTYLPPYTGVNYGSSPS 120

Query: 50  AKKPYEYPSPPPPVYK 3
              P    S   PV K
Sbjct: 121 YNTPSYGTSDYSPVAK 136

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 35/79 (44%), Positives = 38/79 (48%), Gaps = 10/79 (12%)
 Frame = -2

Query: 266 PLPTPPPAPK----PPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPP------PNPPPC 117
           P P PPP P     P P P PPP PPPPPPPPPPPP  + PAP   PP       + P  
Sbjct: 62  PSPPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPPPPRVSTPAPTYLPPYTGVNYGSSPSY 121

Query: 116 PDPPLEPPPPPPVYKYKSP 60
             P        PV K+  P
Sbjct: 122 NTPSYGTSDYSPVAKFSGP 140

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 32/76 (42%), Positives = 36/76 (47%)
 Frame = -2

Query: 251 PPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYK 72
           P  P   P  +PP  PPPPPP     P P PP PPP PPP PPP P P +  P P  +  
Sbjct: 50  PKVPFGLPSHQPPSPPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPPPPRVSTPAPTYLPP 109

Query: 71  YKSPPPPAKKPYEYPS 24
           Y      +   Y  PS
Sbjct: 110 YTGVNYGSSPSYNTPS 125

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 33/66 (50%), Positives = 33/66 (50%)
 Frame = -2

Query: 215 PPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPY 36
           P   PP PPPPPPP     PAPPP PPP PPP       PPPPPP      PPP    P 
Sbjct: 57  PSHQPPSPPPPPPPVTYNYPAPPPPPPPPPPP-------PPPPPP------PPPRVSTPA 103

Query: 35  EYPSPP 18
               PP
Sbjct: 104 PTYLPP 109

[75][TOP]
>UniRef100_A8JFD4 Glyoxal or galactose oxidase (Fragment) n=1 Tax=Chlamydomonas
           reinhardtii RepID=A8JFD4_CHLRE
          Length = 898

 Score =  117 bits (292), Expect = 5e-25
 Identities = 53/93 (56%), Positives = 56/93 (60%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKP-PPCPEPP----PAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP 108
           P P P  P  P P PP P PP    P+PPPP PPPP PPPP+PP P P PP  PPP P P
Sbjct: 234 PSPRPPSPSPPSPSPPSPRPPSPRPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPSP 293

Query: 107 PLEPPPPPPVYKYKSP-PPPAKKPYEYPSPPPP 12
           P   PPPPP     SP PPP+  P   PSPPPP
Sbjct: 294 PTPSPPPPPSTVLTSPSPPPSPPPPRPPSPPPP 326

 Score =  110 bits (274), Expect = 6e-23
 Identities = 49/88 (55%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPP-PNPPPCPDPPLEP 96
           P P P  P  P PPP   PPP+PPPP PPPP PPPP+PP P P+PP P+PPP P   L  
Sbjct: 249 PSPRPPSPRPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPTPSPPPPPSTVLTS 308

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PPP     SPPPP       P PPPP
Sbjct: 309 PSPPP-----SPPPPRPPSPPPPRPPPP 331

 Score =  106 bits (265), Expect = 7e-22
 Identities = 49/90 (54%), Positives = 52/90 (57%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPP---PCPDPPL 102
           P P P  PP P PPP   PPP+PPPP PPPP PPPP+P  P P+PPP P      P PP 
Sbjct: 254 PSPRPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPTPSPPPPPSTVLTSPSPPP 313

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP P     SPPPP   P   P PP P
Sbjct: 314 SPPPPRP----PSPPPPRPPP---PRPPLP 336

 Score =  103 bits (256), Expect = 8e-21
 Identities = 51/90 (56%), Positives = 54/90 (60%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKP-PPCPEPP-PAPPPPPPPPPPPPPPTPPAP-PPTPPPNPPPCPDPPL 102
           P P P  P  P P PP P PP P PP P PP P PP P PP+P PP+PPP  PP P PP 
Sbjct: 214 PSPSPPSPSPPSPSPPSPRPPSPRPPSPSPPSPSPPSPRPPSPRPPSPPPPSPPPPSPP- 272

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P PPPP     SPPPP+  P   PSPPPP
Sbjct: 273 PPSPPPPSPPPPSPPPPSPSP-PTPSPPPP 301

 Score =  100 bits (249), Expect = 5e-20
 Identities = 47/93 (50%), Positives = 52/93 (55%), Gaps = 7/93 (7%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPP---PPPPPPPPPP----TPPAPPPTPPPNPPPCP 114
           P P P  PP P PPP   PPP+PPPP   PP P PPPPP    T P+PPP+PPP  PP P
Sbjct: 264 PSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPTPSPPPPPSTVLTSPSPPPSPPPPRPPSP 323

Query: 113 DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            PP  PPP PP+     P P       +P  PP
Sbjct: 324 PPPRPPPPRPPLPGTGGPKPSGD---AFPPTPP 353

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 47/92 (51%), Positives = 52/92 (56%), Gaps = 7/92 (7%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPP-PPPPPPPPPPPTPPAPP------PTPPPNPPPCPDP 108
           P P+PPP   PPP P PP  PPP PPPP P PP P+PP PP      P+PPP+PPP P P
Sbjct: 262 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPTPSPPPPPSTVLTSPSPPPSPPP-PRP 320

Query: 107 PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P  PPP PP  +   P     KP     PP P
Sbjct: 321 PSPPPPRPPPPRPPLPGTGGPKPSGDAFPPTP 352

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 48/90 (53%), Positives = 56/90 (62%), Gaps = 5/90 (5%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP-PPTP-PPNP-PPCPDPPLEP 96
           P  + PP P  PP P P P+PP P PP P PP P+PP+P PP+P PP+P PP P PP   
Sbjct: 188 PADSSPPLPPRPPPPPPSPSPPSPSPPSPSPPSPSPPSPSPPSPRPPSPRPPSPSPPSPS 247

Query: 95  PPP--PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP   PP  +  SPPPP+  P   PSPPPP
Sbjct: 248 PPSPRPPSPRPPSPPPPSPPP---PSPPPP 274

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 48/103 (46%), Positives = 52/103 (50%), Gaps = 18/103 (17%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEP--------PPAPPPPPPPPPPPPP----------PTPPAPPPT 141
           PLP  PP P+ PP P P        PP PPP PPPP PPPP           +PP PP  
Sbjct: 140 PLPPLPPRPQTPPPPPPAQSPMSPSPPRPPPSPPPPRPPPPVVTPASRPADSSPPLPPRP 199

Query: 140 PPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP P P P  P  P P PP     SP PP+ +P   PSP PP
Sbjct: 200 PPPPPSPSPPSPSPPSPSPPSPSPPSPSPPSPRP---PSPRPP 239

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 47/99 (47%), Positives = 52/99 (52%), Gaps = 12/99 (12%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEP--------PPAPP--PPPPPPPPPPPPTPPAPPPTPPPNPP 123
           P P P+PPP   PPP   P        PP PP  PPPPP P PP P+PP+P P  P  P 
Sbjct: 166 PRPPPSPPPPRPPPPVVTPASRPADSSPPLPPRPPPPPPSPSPPSPSPPSPSPPSPSPPS 225

Query: 122 PCPDPPLEPPPPPPVYKYKSPPPPAKKP--YEYPSPPPP 12
           P P  P  P P PP     SP PP+ +P     PSPPPP
Sbjct: 226 PSPPSPRPPSPRPPSPSPPSPSPPSPRPPSPRPPSPPPP 264

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 52/110 (47%), Positives = 58/110 (52%), Gaps = 25/110 (22%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPP---------PPTPPAP-PPTPPPNPP 123
           P P P  PP P PPP   PPP+P PP P PPPPP         PP+PP P PP+PPP  P
Sbjct: 269 PSPPPPSPPPPSPPPPSPPPPSPSPPTPSPPPPPSTVLTSPSPPPSPPPPRPPSPPPPRP 328

Query: 122 PCPDPPLE------------PPPPP--PVYKYKSPPPPA-KKPYEYPSPP 18
           P P PPL             PP PP  P++   SP PPA  +P   PSPP
Sbjct: 329 PPPRPPLPGTGGPKPSGDAFPPTPPDAPLFPPLSPSPPALMRP---PSPP 375

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 48/104 (46%), Positives = 50/104 (48%), Gaps = 19/104 (18%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPP--------PPPPPPPPPPPTPPAPPPTP--------- 138
           P P  PP P  PP P+ PP PPP        PP PPP PPPP PP P  TP         
Sbjct: 134 PPPPGPPLPPLPPRPQTPPPPPPAQSPMSPSPPRPPPSPPPPRPPPPVVTPASRPADSSP 193

Query: 137 --PPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PP PPP P  P  P P PP     SP PP+  P   PSP PP
Sbjct: 194 PLPPRPPPPPPSPSPPSPSPPSPSPPSPSPPSPSP---PSPRPP 234

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/112 (44%), Positives = 54/112 (48%), Gaps = 27/112 (24%)
 Frame = -2

Query: 266 PLPTPP-PAPKPPPCPE------------PPPAPPPPPPPPPP--PPPPTPPAPPPTP-P 135
           P P PP P PKPP  P+            PPP PP PP PP P  PPPP P   P +P P
Sbjct: 106 PSPRPPRPPPKPPSPPKKKKKKVKVKKRPPPPGPPLPPLPPRPQTPPPPPPAQSPMSPSP 165

Query: 134 PNPPPCPDPPLEPPP-----------PPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PPP P PP  PPP            PP+     PPPP+  P   PSP PP
Sbjct: 166 PRPPPSPPPPRPPPPVVTPASRPADSSPPLPPRPPPPPPSPSP---PSPSPP 214

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 48/119 (40%), Positives = 50/119 (42%), Gaps = 34/119 (28%)
 Frame = -2

Query: 263 LPTPPPAPKPPPCPEPPPAP---------------------PPPPPPPPPPPPPTPPA-- 153
           L TPPP+P     P P PAP                     P P PP PPP PP+PP   
Sbjct: 65  LATPPPSPLTVATPGPVPAPMPGDSTDSADAPTAALIGGGNPSPRPPRPPPKPPSPPKKK 124

Query: 152 ----------PPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPY-EYPSPPPPV 9
                     PPP PP   PP P  P  PPPPPP     SP PP   P    P PPPPV
Sbjct: 125 KKKVKVKKRPPPPGPP--LPPLPPRPQTPPPPPPAQSPMSPSPPRPPPSPPPPRPPPPV 181

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 42/87 (48%), Positives = 46/87 (52%), Gaps = 9/87 (10%)
 Frame = -2

Query: 272 PFPLPTPPPA-----PKPPPCPEPP--PAPPPP-PPPPPPPPPPTPPAPPPTPPPNPPPC 117
           P P P PPP+     P PPP P PP  P+PPPP PPPP PP P T   P P+    PP  
Sbjct: 294 PTPSPPPPPSTVLTSPSPPPSPPPPRPPSPPPPRPPPPRPPLPGT-GGPKPSGDAFPPTP 352

Query: 116 PDPPLEPP-PPPPVYKYKSPPPPAKKP 39
           PD PL PP  P P    + P PP   P
Sbjct: 353 PDAPLFPPLSPSPPALMRPPSPPLADP 379

[76][TOP]
>UniRef100_Q8YQB7 All3916 protein n=1 Tax=Nostoc sp. PCC 7120 RepID=Q8YQB7_ANASP
          Length = 383

 Score =  116 bits (291), Expect = 7e-25
 Identities = 50/83 (60%), Positives = 52/83 (62%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
           P PPP   PPP P+PPP P PPPP PPPP PP PP PPP P P PPP PDPP  P PPPP
Sbjct: 310 PDPPPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPP 369

Query: 80  VYKYKSPPPPAKKPYEYPSPPPP 12
               + PPPP       P PPPP
Sbjct: 370 ---DRPPPPP-------PEPPPP 382

 Score =  115 bits (289), Expect = 1e-24
 Identities = 49/76 (64%), Positives = 52/76 (68%), Gaps = 2/76 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPL--E 99
           P P   PPP P PPP P+PPP  PPPP PPPPP PP PP PPP PPP+PPP PDPP    
Sbjct: 312 PPPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDR 371

Query: 98  PPPPPPVYKYKSPPPP 51
           PPPPPP    + PPPP
Sbjct: 372 PPPPPP----EPPPPP 383

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 41/70 (58%), Positives = 44/70 (62%)
 Frame = -2

Query: 221 EPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKK 42
           +P P PP  PPPPP PPPP  P PP  PPP+PPP PDPP  PP PPP      PPPP   
Sbjct: 309 QPDPPPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPP-PPPDPPPPPPPDPPPPPDPP 367

Query: 41  PYEYPSPPPP 12
           P + P PPPP
Sbjct: 368 PPDRPPPPPP 377

[77][TOP]
>UniRef100_Q8H9E1 Extensin (Fragment) n=1 Tax=Solanum tuberosum RepID=Q8H9E1_SOLTU
          Length = 152

 Score =  115 bits (289), Expect = 1e-24
 Identities = 60/109 (55%), Positives = 66/109 (60%), Gaps = 25/109 (22%)
 Frame = -2

Query: 254 PPPAPKPPPC----PEPPPAPPPPPP-----PPPPPPPPTPP----APPPTPP--PNPPP 120
           PPP+P PPP       PPP+P PPPP     PPPP P P PP    +PPP PP   +PPP
Sbjct: 21  PPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPPPVYKSPPP 80

Query: 119 ------CPDPPL----EPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
                  P PP+     PPPPPPVYKYKSPPPP    Y+Y SPPPPVYK
Sbjct: 81  PVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPV---YKYKSPPPPVYK 126

 Score =  113 bits (283), Expect = 6e-24
 Identities = 57/103 (55%), Positives = 62/103 (60%), Gaps = 19/103 (18%)
 Frame = -2

Query: 254 PPPAPKPPPC----PEPPPAPPPPPP-----PPPPPPPPTPP-----APPPTPPPNPP-- 123
           PPP+P  PP       PPP+P PPPP     PPPP P P PP      PPP+P P PP  
Sbjct: 5   PPPSPSLPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYY 64

Query: 122 ---PCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
              P P PP+   PPPPVYKYKSPPPP  K Y+ P PPPPVYK
Sbjct: 65  YKSPPPPPPVYKSPPPPVYKYKSPPPPVYK-YKSPPPPPPVYK 106

 Score =  112 bits (280), Expect = 1e-23
 Identities = 61/115 (53%), Positives = 66/115 (57%), Gaps = 25/115 (21%)
 Frame = -2

Query: 272 PFPLPTPPPA----PKPPPCPEPPP-----APPPPPPPPPPP------PPPTPPAPPP-- 144
           P P P+ PP       PPP P PPP     +PPPP P PPPP      PPP+P  PPP  
Sbjct: 5   PPPSPSLPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYY 64

Query: 143 --TPPPNPPPCPDPPLEPP------PPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
             +PPP PP    PP  PP      PPPPVYKYKSPPPP    Y+Y SPPPPVYK
Sbjct: 65  YKSPPPPPPVYKSPP--PPVYKYKSPPPPVYKYKSPPPP-PPVYKYKSPPPPVYK 116

 Score =  109 bits (272), Expect = 1e-22
 Identities = 60/119 (50%), Positives = 65/119 (54%), Gaps = 29/119 (24%)
 Frame = -2

Query: 272 PFPLPTPPPA----PKPPPCPEPPP-----APPPPPPPPPPP-----PPPTPPAPPPTPP 135
           P P P+PPP       PPP P PPP     +PPPP P PPPP     PPP PP     PP
Sbjct: 21  PPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPPPVYKSPPP 80

Query: 134 P-----NPPP----CPDPPLEPP------PPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
           P     +PPP       PP  PP      PPPPVYKYKSPPPP    Y+Y SPPPPV+K
Sbjct: 81  PVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPV---YKYKSPPPPVHK 136

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 46/92 (50%), Positives = 51/92 (55%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPL--E 99
           P+   +PPP   PPP  + PP PP      PPPP     +PPP PP      P PP+   
Sbjct: 62  PYYYKSPPP---PPPVYKSPP-PPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKY 117

Query: 98  PPPPPPVYKYKSPPPPAKK---PYEYPSPPPP 12
             PPPPVYKYKSPPPP  K   PY Y SPPPP
Sbjct: 118 KSPPPPVYKYKSPPPPVHKSPAPYYYTSPPPP 149

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 39/73 (53%), Positives = 42/73 (57%), Gaps = 8/73 (10%)
 Frame = -2

Query: 197 PPPPPPPPPPPTPPAPPPTPPPNPPP---CPDPPLEPPPPPPVYKYKSPPPPAKKP---- 39
           PPPP P  PPP     PP P P+PPP      PP   P PPP Y YKSPPPP+  P    
Sbjct: 4   PPPPSPSLPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPY 63

Query: 38  -YEYPSPPPPVYK 3
            Y+ P PPPPVYK
Sbjct: 64  YYKSPPPPPPVYK 76

[78][TOP]
>UniRef100_B3XYC5 Chitin-binding lectin n=1 Tax=Solanum lycopersicum var. cerasiforme
           RepID=B3XYC5_SOLLC
          Length = 365

 Score =  115 bits (289), Expect = 1e-24
 Identities = 50/88 (56%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P+PPP   PPP P PPP  P PPPP P PPPP+PP P P+PPP  PP P P   PP
Sbjct: 104 PPPSPSPPPPSPPPPSPSPPPPTPSPPPPAPSPPPPSPPPPSPSPPPPSPPPPSPSPPPP 163

Query: 92  PPPPVYKYKSPPPPA-KKPYEYPSPPPP 12
            P P     SPPPP    P   PSPPPP
Sbjct: 164 TPSPPPPSPSPPPPTPSPPPPAPSPPPP 191

 Score =  112 bits (281), Expect = 1e-23
 Identities = 49/84 (58%), Positives = 52/84 (61%), Gaps = 1/84 (1%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
           P+PPP   PPP P PPP  PPPP P PPPP P+PP P P+PPP  PP P P   PPPP P
Sbjct: 96  PSPPPPSPPPPSPSPPPPSPPPPSPSPPPPTPSPPPPAPSPPPPSPPPPSP--SPPPPSP 153

Query: 80  VYKYKSPPPPA-KKPYEYPSPPPP 12
                SPPPP    P   PSPPPP
Sbjct: 154 PPPSPSPPPPTPSPPPPSPSPPPP 177

 Score =  110 bits (276), Expect = 4e-23
 Identities = 51/91 (56%), Positives = 55/91 (60%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPP---PTPPAPPPTPPPNPPPCPDPPL 102
           P P   PPP+P PPP   PPP+P PPPP P PPPP   P PP+PPP  P  PPP P PP 
Sbjct: 98  PPPPSPPPPSPSPPPPSPPPPSPSPPPPTPSPPPPAPSPPPPSPPPPSPSPPPPSPPPPS 157

Query: 101 EPPPPPPVYKYKSPPPPA-KKPYEYPSPPPP 12
             PPPP      SPPPP+   P   PSPPPP
Sbjct: 158 PSPPPPT----PSPPPPSPSPPPPTPSPPPP 184

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/70 (64%), Positives = 47/70 (67%), Gaps = 4/70 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP-PPPP---PPPPTPPAPPPTPPPNPPPCPDPP 105
           P P P PPPAP PPP   PPP+P PPPP PPPP   PPPPTP  PPP+P P PPP P PP
Sbjct: 125 PTPSP-PPPAPSPPPPSPPPPSPSPPPPSPPPPSPSPPPPTPSPPPPSPSP-PPPTPSPP 182

Query: 104 LEPPPPPPVY 75
              P PPP Y
Sbjct: 183 PPAPSPPPPY 192

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 42/73 (57%), Positives = 45/73 (61%), Gaps = 1/73 (1%)
 Frame = -2

Query: 227 CPEPPPAPPP-PPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPP 51
           CP  P  PPP PPPP P PPPP+PP P P+PPP  P  P P   PPPP P     SPPPP
Sbjct: 92  CPHTPSPPPPSPPPPSPSPPPPSPPPPSPSPPPPTPSPPPPAPSPPPPSPPPPSPSPPPP 151

Query: 50  AKKPYEYPSPPPP 12
           +  P   PSPPPP
Sbjct: 152 SPPP-PSPSPPPP 163

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/134 (38%), Positives = 56/134 (41%), Gaps = 49/134 (36%)
 Frame = -2

Query: 266 PLPTPPPAPKPPP------------------------------------------CPE-- 219
           PL +PPP    PP                                          CP   
Sbjct: 37  PLSSPPPHEPSPPPPYPRCGMGGGDGKCKSNECCSIWSWCGTTESFCAPQNCQSQCPHTP 96

Query: 218 --PPPAPPP--PPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPP 51
             PPP+PPP  P PPPP PPPP+P  PPPTP P PP    PP  PPPP P     SPPPP
Sbjct: 97  SPPPPSPPPPSPSPPPPSPPPPSPSPPPPTPSPPPPAPSPPPPSPPPPSPSPPPPSPPPP 156

Query: 50  A-KKPYEYPSPPPP 12
           +   P   PSPPPP
Sbjct: 157 SPSPPPPTPSPPPP 170

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 41/108 (37%), Positives = 42/108 (38%), Gaps = 44/108 (40%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPP---------- 123
           P P P+PPP   PPP P PPP  P PPPP P PPPPTP  PPP P P PP          
Sbjct: 142 PPPSPSPPPPSPPPPSPSPPPPTPSPPPPSPSPPPPTPSPPPPAPSPPPPYPRCGMGGGG 201

Query: 122 ----------------------------------PCPDPPLEPPPPPP 81
                                             P P PP  PPPP P
Sbjct: 202 GKCKSNECCSIWSWCGTTESYCAPQNCQSQCPHTPSPSPPPTPPPPYP 249

[79][TOP]
>UniRef100_Q6AHW2 Protease-1 (PRT1),, putative (Fragment) n=1 Tax=Pneumocystis
           carinii RepID=Q6AHW2_PNECA
          Length = 619

 Score =  115 bits (289), Expect = 1e-24
 Identities = 49/86 (56%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = -2

Query: 266 PLPTPPPAPKP-PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
           P P PPPAP P PP P PPPAP P PP PPPPP P P  P P PPP P P P PP  PPP
Sbjct: 433 PAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPP 492

Query: 89  PPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPP  + +  P P  +P   P PP P
Sbjct: 493 PPPRPELEPEPEPEPEPEPEPQPPQP 518

 Score =  107 bits (268), Expect = 3e-22
 Identities = 56/103 (54%), Positives = 56/103 (54%), Gaps = 13/103 (12%)
 Frame = -2

Query: 272 PFPLPTP-PPAPKPPPCPEP-PPAPPPPPPP---PPPPPPPTPPAPPPTPPPNPPPCPD- 111
           P P P P PPAP PPP P P PPAPPPPP P   PP PPPP  PAP P PPP PPP P  
Sbjct: 437 PPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPPPR 496

Query: 110 PPLEP-------PPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
           P LEP       P P P      P PP   P   P PPPP  K
Sbjct: 497 PELEPEPEPEPEPEPEPQPPQPQPEPPVPPPKPQPPPPPPEQK 539

 Score =  103 bits (257), Expect = 6e-21
 Identities = 48/85 (56%), Positives = 50/85 (58%), Gaps = 2/85 (2%)
 Frame = -2

Query: 260 PTPPPAPKP-PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNP-PPCPDPPLEPPPP 87
           PT   + +P PP P P PAP PP PPPPP P P PPAPPP P P P PP P PP  P P 
Sbjct: 411 PTSTSSSEPSPPSPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPA 470

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP      PPPPA  P   P PPPP
Sbjct: 471 PPA----PPPPPAPAPAPAPPPPPP 491

 Score =  102 bits (254), Expect = 1e-20
 Identities = 46/83 (55%), Positives = 48/83 (57%), Gaps = 3/83 (3%)
 Frame = -2

Query: 251 PPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP---PPTPPPNPPPCPDPPLEPPPPPP 81
           PP+P P P P PP  PPPP P P PP PP PPAP   PP PPP P P P PP  PPPP P
Sbjct: 421 PPSPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAP 480

Query: 80  VYKYKSPPPPAKKPYEYPSPPPP 12
                +PPPP       P PPPP
Sbjct: 481 A-PAPAPPPP-------PPPPPP 495

 Score =  102 bits (253), Expect = 2e-20
 Identities = 46/82 (56%), Positives = 47/82 (57%), Gaps = 6/82 (7%)
 Frame = -2

Query: 266 PLPTPPPAPKP-PPCPEPPPAP-----PPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
           P P PPPAP P PP P PPPAP     PPPPPPPPPP P   P P P P P P P P  P
Sbjct: 459 PAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPPPRPELEPEPEPEPEPEPEPQPPQP 518

Query: 104 LEPPPPPPVYKYKSPPPPAKKP 39
              PP PP      PPPP +KP
Sbjct: 519 QPEPPVPPPKPQPPPPPPEQKP 540

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/107 (39%), Positives = 46/107 (42%), Gaps = 24/107 (22%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPP------------------------PPPPPPPPTPPA 153
           P   P P+PP  P+PP  P   PP                        P PP PPP P  
Sbjct: 371 PPSKPGPQPPSEPQPPSKPDLNPPSDPSSQQDPDTSLSSNPTSTSSSEPSPPSPPPAPAP 430

Query: 152 PPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP PPP P P P PP  PPPP P     +PPPP       P+PPPP
Sbjct: 431 APPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPP 477

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 33/61 (54%), Positives = 33/61 (54%), Gaps = 5/61 (8%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPC-----PEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP 108
           P P P PPP P PPP      PEP P P P P P PP P P PP PPP P P PPP    
Sbjct: 480 PAPAPAPPPPPPPPPPRPELEPEPEPEPEPEPEPQPPQPQPEPPVPPPKPQPPPPPPEQK 539

Query: 107 P 105
           P
Sbjct: 540 P 540

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 33/60 (55%), Positives = 34/60 (56%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP PE  P P P P P P P PP P   PP PPP P P P PP + P
Sbjct: 482 PAPAPPPPP-PPPPPRPELEPEPEPEPEPEPEPQPPQPQPEPPVPPPKPQPPPPPPEQKP 540

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 42/120 (35%), Positives = 47/120 (39%), Gaps = 35/120 (29%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPP--PPPPPPPPPPPTPPAPPPTP--------------- 138
           P P P P   P   PE PP+  P   PP  P P PP+ P PP  P               
Sbjct: 345 PQPQPDPGSPPSSDPESPPSSEPGYQPPSKPGPQPPSEPQPPSKPDLNPPSDPSSQQDPD 404

Query: 137 ----------------PPNPP--PCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
                           PP+PP  P P PP  PPPP P     +PPPP       P+PPPP
Sbjct: 405 TSLSSNPTSTSSSEPSPPSPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPP 464

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 32/85 (37%), Positives = 38/85 (44%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P+P     P   PPP P   P P     P P P P +PP+  P  PP+  P   PP +P 
Sbjct: 317 PYPFAHKQPTTAPPPDPGATPPPDLDANPQPQPDPGSPPSSDPESPPSSEPGYQPPSKPG 376

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPP 18
           P PP      P PP+K     PS P
Sbjct: 377 PQPP----SEPQPPSKPDLNPPSDP 397

[80][TOP]
>UniRef100_Q6AHS6 Protease-1 (PRT1) protein, putative n=1 Tax=Pneumocystis carinii
            RepID=Q6AHS6_PNECA
          Length = 947

 Score =  115 bits (289), Expect = 1e-24
 Identities = 49/86 (56%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = -2

Query: 266  PLPTPPPAPKP-PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
            P P PPPAP P PP P PPPAP P PP PPPPP P P  P P PPP P P P PP  PPP
Sbjct: 761  PAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPP 820

Query: 89   PPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPP  + +  P P  +P   P PP P
Sbjct: 821  PPPRPELEPEPEPEPEPEPEPQPPQP 846

 Score =  107 bits (268), Expect = 3e-22
 Identities = 56/103 (54%), Positives = 56/103 (54%), Gaps = 13/103 (12%)
 Frame = -2

Query: 272  PFPLPTP-PPAPKPPPCPEP-PPAPPPPPPP---PPPPPPPTPPAPPPTPPPNPPPCPD- 111
            P P P P PPAP PPP P P PPAPPPPP P   PP PPPP  PAP P PPP PPP P  
Sbjct: 765  PPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPPPR 824

Query: 110  PPLEP-------PPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
            P LEP       P P P      P PP   P   P PPPP  K
Sbjct: 825  PELEPEPEPEPEPEPEPQPPQPQPEPPVPPPKPQPPPPPPEQK 867

 Score =  103 bits (257), Expect = 6e-21
 Identities = 48/85 (56%), Positives = 50/85 (58%), Gaps = 2/85 (2%)
 Frame = -2

Query: 260 PTPPPAPKP-PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNP-PPCPDPPLEPPPP 87
           PT   + +P PP P P PAP PP PPPPP P P PPAPPP P P P PP P PP  P P 
Sbjct: 739 PTSTSSSEPSPPSPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPA 798

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP      PPPPA  P   P PPPP
Sbjct: 799 PPA----PPPPPAPAPAPAPPPPPP 819

 Score =  102 bits (254), Expect = 1e-20
 Identities = 46/83 (55%), Positives = 48/83 (57%), Gaps = 3/83 (3%)
 Frame = -2

Query: 251 PPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP---PPTPPPNPPPCPDPPLEPPPPPP 81
           PP+P P P P PP  PPPP P P PP PP PPAP   PP PPP P P P PP  PPPP P
Sbjct: 749 PPSPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAP 808

Query: 80  VYKYKSPPPPAKKPYEYPSPPPP 12
                +PPPP       P PPPP
Sbjct: 809 A-PAPAPPPP-------PPPPPP 823

 Score =  102 bits (253), Expect = 2e-20
 Identities = 46/82 (56%), Positives = 47/82 (57%), Gaps = 6/82 (7%)
 Frame = -2

Query: 266  PLPTPPPAPKP-PPCPEPPPAP-----PPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
            P P PPPAP P PP P PPPAP     PPPPPPPPPP P   P P P P P P P P  P
Sbjct: 787  PAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPPPRPELEPEPEPEPEPEPEPQPPQP 846

Query: 104  LEPPPPPPVYKYKSPPPPAKKP 39
               PP PP      PPPP +KP
Sbjct: 847  QPEPPVPPPKPQPPPPPPEQKP 868

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/107 (39%), Positives = 46/107 (42%), Gaps = 24/107 (22%)
 Frame = -2

Query: 260  PTPPPAPKPPPCPEPPPAPPPPPP------------------------PPPPPPPPTPPA 153
            P   P P+PP  P+PP  P   PP                        P PP PPP P  
Sbjct: 699  PPSKPGPQPPSEPQPPSKPDLNPPSDPSSQQDPDTSLSSNPTSTSSSEPSPPSPPPAPAP 758

Query: 152  PPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PP PPP P P P PP  PPPP P     +PPPP       P+PPPP
Sbjct: 759  APPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPP 805

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 33/61 (54%), Positives = 33/61 (54%), Gaps = 5/61 (8%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPC-----PEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP 108
           P P P PPP P PPP      PEP P P P P P PP P P PP PPP P P PPP    
Sbjct: 808 PAPAPAPPPPPPPPPPRPELEPEPEPEPEPEPEPQPPQPQPEPPVPPPKPQPPPPPPEQK 867

Query: 107 P 105
           P
Sbjct: 868 P 868

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 33/60 (55%), Positives = 34/60 (56%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP PE  P P P P P P P PP P   PP PPP P P P PP + P
Sbjct: 810 PAPAPPPPP-PPPPPRPELEPEPEPEPEPEPEPQPPQPQPEPPVPPPKPQPPPPPPEQKP 868

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 42/120 (35%), Positives = 47/120 (39%), Gaps = 35/120 (29%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPP--PPPPPPPPPPPTPPAPPPTP--------------- 138
            P P P P   P   PE PP+  P   PP  P P PP+ P PP  P               
Sbjct: 673  PQPQPDPGSPPSSDPESPPSSEPGYQPPSKPGPQPPSEPQPPSKPDLNPPSDPSSQQDPD 732

Query: 137  ----------------PPNPP--PCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
                            PP+PP  P P PP  PPPP P     +PPPP       P+PPPP
Sbjct: 733  TSLSSNPTSTSSSEPSPPSPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPP 792

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 32/85 (37%), Positives = 38/85 (44%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P+P     P   PPP P   P P     P P P P +PP+  P  PP+  P   PP +P 
Sbjct: 645 PYPFAHKQPTTAPPPDPGATPPPDLDANPQPQPDPGSPPSSDPESPPSSEPGYQPPSKPG 704

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPP 18
           P PP      P PP+K     PS P
Sbjct: 705 PQPP----SEPQPPSKPDLNPPSDP 725

[81][TOP]
>UniRef100_B7P0W1 Cement protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7P0W1_IXOSC
          Length = 144

 Score =  115 bits (288), Expect = 2e-24
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G       GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 68  GGGGGG------GGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGGG 142

 Score =  115 bits (288), Expect = 2e-24
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G       GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 69  GGGGGG------GGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 117 GGGGGGGGGGGGGGGGGGGGGGGGGGG 143

 Score =  115 bits (288), Expect = 2e-24
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G       GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 70  GGGGGG------GGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 118 GGGGGGGGGGGGGGGGGGGGGGGGGGG 144

 Score =  108 bits (271), Expect = 1e-22
 Identities = 52/77 (67%), Positives = 52/77 (67%)
 Frame = +1

Query: 43  FLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGS 222
           F   GGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG 
Sbjct: 64  FQKRGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117

Query: 223 GHGGGFGAGGGVGSGNG 273
           G GGG G GGG G G G
Sbjct: 118 GGGGGGGGGGGGGGGGG 134

[82][TOP]
>UniRef100_A4S6G3 Predicted protein (Fragment) n=1 Tax=Ostreococcus lucimarinus CCE9901
            RepID=A4S6G3_OSTLU
          Length = 2146

 Score =  115 bits (288), Expect = 2e-24
 Identities = 49/86 (56%), Positives = 52/86 (60%)
 Frame = -2

Query: 269  FPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
            FP P P P P  PP P P P+PPPP PP P PPPP+P  P P+PPP  PP P PP  PPP
Sbjct: 877  FPSPPPSPPPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPP-SPPP 935

Query: 89   PPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPV     P PP   P   P PPPP
Sbjct: 936  PPPVPSPPPPSPPPPSPPPLPPPPPP 961

 Score =  110 bits (275), Expect = 5e-23
 Identities = 49/91 (53%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCP---EPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPL 102
            P P P+PPP   PPP P    PPP+PP P PPPP P PP+P  PPP+PP   PP P PP 
Sbjct: 878  PSPPPSPPPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPP 937

Query: 101  EPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
              P PPP       PPP   P   PSPPPPV
Sbjct: 938  PVPSPPPPSPPPPSPPPLPPPPPPPSPPPPV 968

 Score =  101 bits (251), Expect = 3e-20
 Identities = 53/107 (49%), Positives = 60/107 (56%), Gaps = 20/107 (18%)
 Frame = -2

Query: 272 PFPLPTPP---PAPKPPPCPE-PPPAPPPPPPP---PPPPPPPTPPA--PPPTPPPNPP- 123
           P P P+PP   P+P PPP  E P P+PP P PP   P P PPP PP   P P+PPP PP 
Sbjct: 678 PSPPPSPPIVQPSPSPPPPVEVPSPSPPSPSPPVEVPSPSPPPQPPVEVPSPSPPPQPPV 737

Query: 122 --PCPDPPLEPP--------PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             P P PP +PP        PP P  +  SP PP + P E PSPPPP
Sbjct: 738 EVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPPPP 784

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 38/62 (61%), Positives = 42/62 (67%), Gaps = 1/62 (1%)
 Frame = -2

Query: 272  PFPLP-TPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
            P PLP +P P P  PP P PP  PPPPP P PPPP P PP+PPP PPP PPP P PP++ 
Sbjct: 911  PSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPPPSPPPPVDE 970

Query: 95   PP 90
             P
Sbjct: 971  CP 972

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 45/94 (47%), Positives = 52/94 (55%), Gaps = 8/94 (8%)
 Frame = -2

Query: 266 PLPTPP---PAPKPPPCPE---PPPAPPPPPP--PPPPPPPPTPPAPPPTPPPNPPPCPD 111
           P P+PP   P+P PPP P    P P+PPP PP   P P PPP PP   P+P P P P  +
Sbjct: 705 PSPSPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVE 764

Query: 110 PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            P   PPP P  +  SPPPP   P   PSP PP+
Sbjct: 765 VPSPSPPPQPPVEVPSPPPP--PPVAVPSPSPPI 796

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 34/65 (52%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = -2

Query: 269  FPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPP-PTP-PAPPPTPPPNPPPCPDPPLEP 96
            FP    PP+P PPP P P P+P P P P P P P P+P P P P+P P P P P PP E 
Sbjct: 1852 FPTQRSPPSPSPPPTPSPTPSPTPSPTPSPTPSPTPSPTPTPTPSPTPTPTPTPTPPTES 1911

Query: 95   PPPPP 81
             P PP
Sbjct: 1912 SPTPP 1916

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 34/80 (42%), Positives = 38/80 (47%)
 Frame = -2

Query: 248  PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKY 69
            P  + PP P PPP P P P P P P P   P+P P+P P P P P P   P P PP    
Sbjct: 1853 PTQRSPPSPSPPPTPSPTPSPTPSPTPSPTPSPTPSPTPTPTPSPTPTPTPTPTPPTESS 1912

Query: 68   KSPPPPAKKPYEYPSPPPPV 9
             +PP P    Y    P  PV
Sbjct: 1913 PTPPAPDSATYFTLQPGVPV 1932

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 34/77 (44%), Positives = 37/77 (48%), Gaps = 1/77 (1%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNP-PPCPDPPLEPPP 90
            P P+PPP P P P P P P P P P P P P P   P+P PTP P P PP    P  P P
Sbjct: 1859 PSPSPPPTPSPTPSPTPSPTPSPTPSPTPSPTPTPTPSPTPTPTPTPTPPTESSPTPPAP 1918

Query: 89   PPPVYKYKSPPPPAKKP 39
                Y    P  P + P
Sbjct: 1919 DSATYFTLQPGVPVQIP 1935

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 36/76 (47%), Positives = 41/76 (53%), Gaps = 17/76 (22%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP---PCPEPPPAPP--------PPPPP---PPPPPPPTPPAPPPTPP 135
           P  +P+P P P+PP   P P PPP PP        PP PP   P P PPP PP   P+PP
Sbjct: 723 PVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPP 782

Query: 134 PNPP---PCPDPPLEP 96
           P PP   P P PP+ P
Sbjct: 783 PPPPVAVPSPSPPILP 798

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 39/94 (41%), Positives = 40/94 (42%), Gaps = 7/94 (7%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAP-PPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP---- 108
            P P PTP P P P P P P P P P P P P P P PTP   PPT     PP PD     
Sbjct: 1865 PTPSPTPSPTPSPTPSPTPSPTPSPTPTPTPSPTPTPTPTPTPPTESSPTPPAPDSATYF 1924

Query: 107  PLEP--PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             L+P  P   P       P     P   PS P P
Sbjct: 1925 TLQPGVPVQIPASTITVIPGAQLPPGAPPSTPTP 1958

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 26/40 (65%), Positives = 27/40 (67%)
 Frame = -2

Query: 260  PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPT 141
            P PPP P PPP   PPP+PPP PPPPPPP PP P    PT
Sbjct: 934  PPPPPVPSPPPPSPPPPSPPPLPPPPPPPSPPPPVDECPT 973

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 28/48 (58%), Positives = 30/48 (62%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPN 129
            P P+P+PPP P PPP P PPP PPPPPPP PPPP    P       PN
Sbjct: 936  PPPVPSPPP-PSPPP-PSPPPLPPPPPPPSPPPPVDECPTLRLVGGPN 981

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 27/55 (49%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP---PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPC 117
           P  +P+P P P+PP   P P PPP PP   P PPPPPP   P+P    PP  P C
Sbjct: 749 PVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPPPPPPVAVPSP---SPPILPTC 800

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 31/88 (35%), Positives = 33/88 (37%), Gaps = 8/88 (9%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPP--------TPPAPPPTPPPNPPPC 117
            P P P+P P P P P P P P P PP    P PP P         P  P   P       
Sbjct: 1883 PSPTPSPTPTPTPSPTPTPTPTPTPPTESSPTPPAPDSATYFTLQPGVPVQIPASTITVI 1942

Query: 116  PDPPLEPPPPPPVYKYKSPPPPAKKPYE 33
            P   L P  PP      S P PA  P +
Sbjct: 1943 PGAQLPPGAPP------STPTPAPIPVD 1964

[83][TOP]
>UniRef100_UPI00019856A2 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019856A2
          Length = 249

 Score =  115 bits (287), Expect = 2e-24
 Identities = 57/87 (65%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GG G G   GF  GGGG L    GGGGGG   G G G GFGGG GGG GG GGGG GGGG
Sbjct: 123 GGAGGGGGGGFGGGGGGGL---GGGGGGGGGLGGGGGAGFGGGAGGGLGGSGGGGFGGGG 179

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGGSG GGG G+G G G+G G
Sbjct: 180 GGGGGLGGGSGFGGGAGSGFGGGAGLG 206

 Score =  111 bits (278), Expect = 2e-23
 Identities = 58/95 (61%), Positives = 62/95 (65%), Gaps = 10/95 (10%)
 Frame = +1

Query: 13  GGGGDGYSYGF---LAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG-------G 162
           GGGG G+  G    L G GG  +   GGGGGG  GGSG GGG G G GGGAG       G
Sbjct: 153 GGGGAGFGGGAGGGLGGSGGGGFGGGGGGGGGLGGGSGFGGGAGSGFGGGAGLGGGAGGG 212

Query: 163 VGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSG 267
            GGGGGGGGGGGGGG GGG+G G G GAGGG+G G
Sbjct: 213 FGGGGGGGGGGGGGGLGGGAGGGFGGGAGGGLGGG 247

 Score =  109 bits (272), Expect = 1e-22
 Identities = 57/90 (63%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG---GVGGGGGGG 186
           G G G   G  AGGGG      GGGGGG  GGSG GGG G G GGG G   G GGGGGGG
Sbjct: 76  GAGGGLGGGGGAGGGGGF---GGGGGGGLGGGSGFGGGAGAGFGGGTGVGGGAGGGGGGG 132

Query: 187 -GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGGGGG GGG G GGG G GGG G G G
Sbjct: 133 FGGGGGGGLGGGGGGGGGLGGGGGAGFGGG 162

 Score =  109 bits (272), Expect = 1e-22
 Identities = 57/90 (63%), Positives = 60/90 (66%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGG---GSNGGSGHGGGFGGGVGGGAGGVGGGGGG 183
           GGGG G   GF  GGGG L   +G GGG   G  GG+G GGG GGG GGG GG GGGG G
Sbjct: 83  GGGGAGGGGGFGGGGGGGLGGGSGFGGGAGAGFGGGTGVGGGAGGGGGGGFGGGGGGGLG 142

Query: 184 GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGGG GGG G G G GAGGG+G   G
Sbjct: 143 GGGGGGGGLGGGGGAGFGGGAGGGLGGSGG 172

 Score =  105 bits (262), Expect = 2e-21
 Identities = 54/84 (64%), Positives = 57/84 (67%), Gaps = 2/84 (2%)
 Frame = +1

Query: 28  GYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG--GGGG 201
           GY  G   GGGG      GGGGGG +GG+G GGG G G GGG GG GG GGGGG  GGGG
Sbjct: 42  GYDGGLGGGGGGGF---GGGGGGGLDGGAGFGGGSGFGAGGGLGGGGGAGGGGGFGGGGG 98

Query: 202 GGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGGSG GGG GAG G G+G G
Sbjct: 99  GGLGGGSGFGGGAGAGFGGGTGVG 122

 Score =  103 bits (256), Expect = 8e-21
 Identities = 54/88 (61%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGG--GGGG 189
           GGG G   G   GGGG      GGGGGG  GG G GGG GGG G G GG  GGG  G GG
Sbjct: 116 GGGTGVGGGAGGGGGGGF---GGGGGGGLGGGGGGGGGLGGGGGAGFGGGAGGGLGGSGG 172

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGG GGG G GGG G GGG GSG G
Sbjct: 173 GGFGGGGGGGGGLGGGSGFGGGAGSGFG 200

 Score =  102 bits (255), Expect = 1e-20
 Identities = 58/90 (64%), Positives = 60/90 (66%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGG---GGG 183
           GGGG G   G L GGGG  +   GGG GG  GGSG GGGFGGG GGG GG+GGG   GGG
Sbjct: 143 GGGGGG---GGLGGGGGAGF---GGGAGGGLGGSG-GGGFGGG-GGGGGGLGGGSGFGGG 194

Query: 184 GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            G G GGGAG G G GGGFG GGG G G G
Sbjct: 195 AGSGFGGGAGLGGGAGGGFGGGGGGGGGGG 224

 Score =  101 bits (252), Expect = 2e-20
 Identities = 53/90 (58%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNG-GSGHGGGFGGGVGGGAGGVGGGGG---G 183
           GGG G+  G  AG GG   +  G GGGG  G G G GGG GGG GGG GG+GGGGG   G
Sbjct: 102 GGGSGFGGGAGAGFGGGTGVGGGAGGGGGGGFGGGGGGGLGGG-GGGGGGLGGGGGAGFG 160

Query: 184 GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGG G  GG G GGG G GGG+G G+G
Sbjct: 161 GGAGGGLGGSGGGGFGGGGGGGGGLGGGSG 190

 Score =  101 bits (251), Expect = 3e-20
 Identities = 54/91 (59%), Positives = 56/91 (61%), Gaps = 5/91 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGG---GSNGGSGHGGGFGGGVGGG-AGGVGGGGGG 183
           GGG G+  G   GGGG      GGGGG   G  GG G G GFGGG G G  GG G GGG 
Sbjct: 70  GGGSGFGAGGGLGGGGG----AGGGGGFGGGGGGGLGGGSGFGGGAGAGFGGGTGVGGGA 125

Query: 184 GGGGGGG-GAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGG G GGG G GGG G GGG+G G G
Sbjct: 126 GGGGGGGFGGGGGGGLGGGGGGGGGLGGGGG 156

 Score =  100 bits (248), Expect = 7e-20
 Identities = 54/87 (62%), Positives = 55/87 (63%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   GF  GGGG L      GG G  GGSG G G G G GGGAGG GG GGGGGG
Sbjct: 48  GGGGGG---GFGGGGGGGL-----DGGAGFGGGSGFGAGGGLGGGGGAGGGGGFGGGGGG 99

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGG+G G G G GFG G GVG G G
Sbjct: 100 GLGGGSGFGGGAGAGFGGGTGVGGGAG 126

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 53/90 (58%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GG G G   GF AGGG        GGGGG+ GG G GGG GGG+GGG+G  GGG G G G
Sbjct: 65  GGAGFGGGSGFGAGGGL-------GGGGGAGGGGGFGGGGGGGLGGGSG-FGGGAGAGFG 116

Query: 193 GG---GGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG   GGGAGGG G G G G GGG+G G G
Sbjct: 117 GGTGVGGGAGGGGGGGFGGGGGGGLGGGGG 146

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 55/92 (59%), Positives = 55/92 (59%), Gaps = 5/92 (5%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGG--VGGGAG-GVGGGGGG 183
           GG G G   GF  G GG L    G GGGG  GG G GGG GGG   GGGAG G GGG G 
Sbjct: 149 GGLGGGGGAGFGGGAGGGL---GGSGGGGFGGGGGGGGGLGGGSGFGGGAGSGFGGGAGL 205

Query: 184 GGGGGG--GGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GG  GG GGG G GGG G GGG G G G
Sbjct: 206 GGGAGGGFGGGGGGGGGGGGGGLGGGAGGGFG 237

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 31/48 (64%), Positives = 32/48 (66%)
 Frame = +1

Query: 130 FGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           F  G  GG GG GGGG GGGGGGG   G G G G GFGAGGG+G G G
Sbjct: 39  FDPGYDGGLGGGGGGGFGGGGGGGLDGGAGFGGGSGFGAGGGLGGGGG 86

[84][TOP]
>UniRef100_Q9M3Y2 Glycine-rich protein n=1 Tax=Triticum aestivum RepID=Q9M3Y2_WHEAT
          Length = 390

 Score =  115 bits (287), Expect = 2e-24
 Identities = 58/92 (63%), Positives = 60/92 (65%), Gaps = 6/92 (6%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGG------VGGGG 177
           G G G   G  AGGGG       GGGGG  GG+GHGGGFG G G GAGG        GGG
Sbjct: 190 GAGGGAGGGLGAGGGGGF---GSGGGGGLGGGAGHGGGFGAGGGAGAGGGAGGGFGAGGG 246

Query: 178 GGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGGGGGG GGG+GHGGGFGAGGG G G G
Sbjct: 247 GGFGGGGGGGLGGGAGHGGGFGAGGGGGFGGG 278

 Score =  111 bits (278), Expect = 2e-23
 Identities = 56/90 (62%), Positives = 60/90 (66%), Gaps = 4/90 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           G G G   GF AGGGG      GGGGGG  GG+GHGGGFG G GGG GG GG GGG GGG
Sbjct: 232 GAGGGAGGGFGAGGGGGF---GGGGGGGLGGGAGHGGGFGAGGGGGFGGGGGAGGGLGGG 288

Query: 196 GGGGAGGGS----GHGGGFGAGGGVGSGNG 273
            GGG GGG+    G GGG G GGG+G G+G
Sbjct: 289 HGGGFGGGAGVGGGAGGGLGGGGGLGGGSG 318

 Score =  107 bits (267), Expect = 4e-22
 Identities = 57/93 (61%), Positives = 60/93 (64%), Gaps = 7/93 (7%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGG---SNGGSGHGGGFGGGVGGGAG---GVGGGG 177
           GGG G+  GF AGGG       GGG GG   + GG G GGG GGG+GGGAG   G G GG
Sbjct: 216 GGGAGHGGGFGAGGGAG----AGGGAGGGFGAGGGGGFGGGGGGGLGGGAGHGGGFGAGG 271

Query: 178 GGGGGGGGGGAGG-GSGHGGGFGAGGGVGSGNG 273
           GGG GGGGG  GG G GHGGGFG G GVG G G
Sbjct: 272 GGGFGGGGGAGGGLGGGHGGGFGGGAGVGGGAG 304

 Score =  107 bits (267), Expect = 4e-22
 Identities = 57/88 (64%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGG--VGGGAGGVGGGGGGGG 189
           GGG G+  GF AGGGG      GGGG G   G GHGGGFGGG  VGGGAGG  GGGGG G
Sbjct: 258 GGGAGHGGGFGAGGGGGF---GGGGGAGGGLGGGHGGGFGGGAGVGGGAGGGLGGGGGLG 314

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGG G G G G G GAGGG G G G
Sbjct: 315 GGSGGGLGSGRGGGLGGGAGGGGGGGLG 342

 Score =  105 bits (262), Expect = 2e-21
 Identities = 57/99 (57%), Positives = 61/99 (61%), Gaps = 12/99 (12%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GG G G   GF AGGG    L  GG GGG  GG+G GGG GGG+GGG GG  GG GGGG 
Sbjct: 85  GGAGGGAGGGFGAGGGAGGGL-GGGHGGGFGGGAGAGGGAGGGLGGGGGGGFGGSGGGGL 143

Query: 193 GG------------GGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG            GGGAGGG G GGG GAGGG+G G+G
Sbjct: 144 GGGAGAGQGGGFGAGGGAGGGGGFGGGAGAGGGLGGGHG 182

 Score =  104 bits (259), Expect = 3e-21
 Identities = 57/92 (61%), Positives = 58/92 (63%), Gaps = 6/92 (6%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGG---VGGGGGGG 186
           GGG G  +G  AG GG      GGGGGG  GGSG GGG GGG G G GG    GGG GGG
Sbjct: 106 GGGHGGGFGGGAGAGGGAGGGLGGGGGGGFGGSG-GGGLGGGAGAGQGGGFGAGGGAGGG 164

Query: 187 GG-GGGGGAGG--GSGHGGGFGAGGGVGSGNG 273
           GG GGG GAGG  G GHGGGFG G G G G G
Sbjct: 165 GGFGGGAGAGGGLGGGHGGGFGGGAGAGGGAG 196

 Score =  104 bits (259), Expect = 3e-21
 Identities = 57/97 (58%), Positives = 60/97 (61%), Gaps = 10/97 (10%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVG-GGAGGVGGGGGGGG 189
           GG G G  +G  AG GG L    GG GGG  GG+G GGG GGG+G GG GG G GGGGG 
Sbjct: 159 GGAGGGGGFGGGAGAGGGL---GGGHGGGFGGGAGAGGGAGGGLGAGGGGGFGSGGGGGL 215

Query: 190 GGG---------GGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG         GGGAG G G GGGFGAGGG G G G
Sbjct: 216 GGGAGHGGGFGAGGGAGAGGGAGGGFGAGGGGGFGGG 252

 Score =  103 bits (257), Expect = 6e-21
 Identities = 54/95 (56%), Positives = 59/95 (62%), Gaps = 8/95 (8%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGF--------GGGVGGGAGGVG 168
           G G  G + G L GGGG  +  +GGGG G   G+G GGGF        GGG GGGAG  G
Sbjct: 116 GAGAGGGAGGGLGGGGGGGFGGSGGGGLGGGAGAGQGGGFGAGGGAGGGGGFGGGAGAGG 175

Query: 169 GGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGG GGG GGGAG G G GGG GAGGG G G+G
Sbjct: 176 GLGGGHGGGFGGGAGAGGGAGGGLGAGGGGGFGSG 210

 Score =  103 bits (257), Expect = 6e-21
 Identities = 56/94 (59%), Positives = 61/94 (64%), Gaps = 7/94 (7%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGG-GSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GG G G   GF +GGGG L    G GGG G+ GG+G GGG GGG G G GG  GGGGGGG
Sbjct: 197 GGLGAGGGGGFGSGGGGGLGGGAGHGGGFGAGGGAGAGGGAGGGFGAGGGGGFGGGGGGG 256

Query: 190 GGGGG------GAGGGSGHGGGFGAGGGVGSGNG 273
            GGG       GAGGG G GGG GAGGG+G G+G
Sbjct: 257 LGGGAGHGGGFGAGGGGGFGGGGGAGGGLGGGHG 290

 Score =  103 bits (256), Expect = 8e-21
 Identities = 57/105 (54%), Positives = 62/105 (59%), Gaps = 18/105 (17%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGG------------- 153
           GGGG     G L GG G  +   GG GGG+ GG G GGG GGG+GGG             
Sbjct: 62  GGGGGLGGGGGLGGGHGGGFGAGGGAGGGAGGGFGAGGGAGGGLGGGHGGGFGGGAGAGG 121

Query: 154 --AGGVGGGGGGG-GGGGGGGAGG--GSGHGGGFGAGGGVGSGNG 273
              GG+GGGGGGG GG GGGG GG  G+G GGGFGAGGG G G G
Sbjct: 122 GAGGGLGGGGGGGFGGSGGGGLGGGAGAGQGGGFGAGGGAGGGGG 166

 Score =  102 bits (255), Expect = 1e-20
 Identities = 56/95 (58%), Positives = 59/95 (62%), Gaps = 8/95 (8%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNG-GSGHGGGFGGGVGGGAG---GVGGGGG 180
           GG G G   GF AGGG       GGG G   G G GHGGGFGGG G G G   G+G GGG
Sbjct: 145 GGAGAGQGGGFGAGGGAGGGGGFGGGAGAGGGLGGGHGGGFGGGAGAGGGAGGGLGAGGG 204

Query: 181 G----GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G       GGGGG GGG+GHGGGFGAGGG G+G G
Sbjct: 205 GGFGS---GGGGGLGGGAGHGGGFGAGGGAGAGGG 236

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 56/90 (62%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGG---VGGGGGGG 186
           GGG G   GF  GGGG L     GGGGG  GG G G G GGG GGGAGG    GGG GGG
Sbjct: 50  GGGLGGGGGFGGGGGGGL-----GGGGGLGGGHGGGFGAGGGAGGGAGGGFGAGGGAGGG 104

Query: 187 -GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG GGG GGG+G GG  GAGGG+G G G
Sbjct: 105 LGGGHGGGFGGGAGAGG--GAGGGLGGGGG 132

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 56/94 (59%), Positives = 59/94 (62%), Gaps = 7/94 (7%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGG--SGHGGGFGGGV-GGGAGGVGGG-- 174
           GG G G+  G   GGG    L  GGG GGGS GG  SG GGG GGG  GGG GG+GGG  
Sbjct: 287 GGHGGGFGGGAGVGGGAGGGLGGGGGLGGGSGGGLGSGRGGGLGGGAGGGGGGGLGGGHD 346

Query: 175 -GGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            G GGG G GGGAGGG G GGG G G G G+G G
Sbjct: 347 SGLGGGIGAGGGAGGGFGGGGGGGHGSGAGAGGG 380

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 54/90 (60%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGG-GSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG G  +G  AG GG      GGGGG G   G G G G GGG+GGGAGG GGGGG GGG
Sbjct: 286 GGGHGGGFGGGAGVGGGAGGGLGGGGGLGGGSGGGLGSGRGGGLGGGAGG-GGGGGLGGG 344

Query: 193 ---GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
              G GGG G G G GGGFG GGG G G+G
Sbjct: 345 HDSGLGGGIGAGGGAGGGFGGGGGGGHGSG 374

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 49/81 (60%), Positives = 53/81 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GG G G   G  +G GG L    GGGGGG  GG GH  G GGG+G  AGG  GGG GGGG
Sbjct: 311 GGLGGGSGGGLGSGRGGGLGGGAGGGGGGGLGG-GHDSGLGGGIG--AGGGAGGGFGGGG 367

Query: 193 GGGGGAGGGSGHGGGFGAGGG 255
           GGG G+G G+G GGGF AGGG
Sbjct: 368 GGGHGSGAGAGGGGGFDAGGG 388

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/92 (56%), Positives = 55/92 (59%), Gaps = 5/92 (5%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGS---GHGGGFGGGVGGG-AGGVGGG-G 177
           GG G G   G   GGGG L   +GGG G   GG    G GGG GGG+GGG   G+GGG G
Sbjct: 295 GGAGVGGGAGGGLGGGGGLGGGSGGGLGSGRGGGLGGGAGGGGGGGLGGGHDSGLGGGIG 354

Query: 178 GGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG GGG G GGG GHG G GAGGG G   G
Sbjct: 355 AGGGAGGGFGGGGGGGHGSGAGAGGGGGFDAG 386

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 35/55 (63%), Positives = 37/55 (67%)
 Frame = +1

Query: 109 GSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G   GGG GGG G G GG GG GGGGG GGG G G G+G G G GAGGG G+G G
Sbjct: 46  GRCRGGGLGGGGGFGGGGGGGLGGGGGLGGGHGGGFGAGGGAGGGAGGGFGAGGG 100

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 31/54 (57%), Positives = 31/54 (57%), Gaps = 8/54 (14%)
 Frame = +1

Query: 136 GGVGGGAGGVGGGGGGGGGGGGGGAGG--------GSGHGGGFGAGGGVGSGNG 273
           G V    G   GGG GGGGG GGG GG        G GHGGGFGAGGG G G G
Sbjct: 39  GVVAAANGRCRGGGLGGGGGFGGGGGGGLGGGGGLGGGHGGGFGAGGGAGGGAG 92

[85][TOP]
>UniRef100_UPI00019859A1 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019859A1
          Length = 377

 Score =  115 bits (287), Expect = 2e-24
 Identities = 62/122 (50%), Positives = 64/122 (52%), Gaps = 37/122 (30%)
 Frame = -2

Query: 260 PTPPPA------PKPPPCPEPPPAPP-----PPPPPP--------------PPPPPP--T 162
           P PPP       P PPP   PP  PP     PPPPPP              PPPPPP  +
Sbjct: 81  PPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYS 140

Query: 161 PPAPPP---TPPPNPPPCPDPP-------LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP  PP     PP PPP   PP         PPPPPPVYKYKSPPPP KKPY+Y SPPPP
Sbjct: 141 PPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPP 200

Query: 11  VY 6
            Y
Sbjct: 201 PY 202

 Score =  111 bits (277), Expect = 3e-23
 Identities = 60/125 (48%), Positives = 66/125 (52%), Gaps = 35/125 (28%)
 Frame = -2

Query: 272 PFPLPTPPPAP-----KPPPCPEPPP----APPPPP----------------PPP----- 183
           P+   +PPP P     K PP P   P    +PPPPP                PPP     
Sbjct: 166 PYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKS 225

Query: 182 PPPPPP-----TPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPP 18
           PPPPPP     +PP PPP   P PPP P     PPPPPPVYKYKSPPPP+  PY+Y SPP
Sbjct: 226 PPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPS-PPYKYKSPP 284

Query: 17  PPVYK 3
           PP YK
Sbjct: 285 PPPYK 289

 Score =  107 bits (268), Expect = 3e-22
 Identities = 63/134 (47%), Positives = 67/134 (50%), Gaps = 44/134 (32%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPP--PPPPPPPP----PPPPTPPA------PPPTPP-- 135
           P+   +PPP P       PPP PP   PPPPPPP     PPP PP       PPP+PP  
Sbjct: 220 PYKYKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYK 279

Query: 134 ---PNPPPC-----PDPPLE-------------PPPPPPVYKYKSPPPPAKK-------P 39
              P PPP      P PPL+             PPPPPPVYKYKSPPPP  K       P
Sbjct: 280 YKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPP 339

Query: 38  YEY--PSPPPPVYK 3
           Y Y  P PPPPVYK
Sbjct: 340 YMYKSPPPPPPVYK 353

 Score =  107 bits (267), Expect = 4e-22
 Identities = 61/121 (50%), Positives = 67/121 (55%), Gaps = 34/121 (28%)
 Frame = -2

Query: 272 PFPLPTPPPAP-----KPPPCPEPP---PAPPPPP------PPPP-----PPPPP----T 162
           P+   +PPP P     K PP P PP    +PPPPP      PPPP     PPPPP    +
Sbjct: 253 PYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKS 312

Query: 161 PPAPPP-----TPPP------NPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
           PP PPP     +PPP      +PPP P     PPPPPPVYKYKSPPPP  K Y Y SPPP
Sbjct: 313 PPPPPPVYKYKSPPPPVYKYKSPPPPPYMYKSPPPPPPVYKYKSPPPPPPK-YYYSSPPP 371

Query: 14  P 12
           P
Sbjct: 372 P 372

 Score =  103 bits (256), Expect = 8e-21
 Identities = 57/122 (46%), Positives = 63/122 (51%), Gaps = 32/122 (26%)
 Frame = -2

Query: 272 PFPLPTPPPAP---------------KPPP----CPEPPP------APPPPPP---PPPP 177
           P+   +PPP P                PPP     P PPP      +PPPPPP   PPPP
Sbjct: 191 PYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPPPPPPVYKYKSPPPPPPVHSPPPP 250

Query: 176 PPP---PTPPAPPPTPPPNPPPCPDPPLE-PPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
           PPP    +PP PPP      PP P PP +   PPPP YKYKSPPPP   P +Y SPPPP 
Sbjct: 251 PPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPP---PLQYKSPPPPP 307

Query: 8   YK 3
           YK
Sbjct: 308 YK 309

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 50/101 (49%), Positives = 55/101 (54%), Gaps = 25/101 (24%)
 Frame = -2

Query: 233 PPCPEPPPAPPPPPP------PPPPPPPPTPPAPPP----TPPPNPP------PCPDPPL 102
           PP P    +PPPPPP      PPPPPP  +PP  PP    +PPP PP      P P PP+
Sbjct: 39  PPPPYYYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPV 98

Query: 101 EPPPPPPVYKYKSPPPPAK-------KPYEY--PSPPPPVY 6
             PP  P YKYKSPPPP          PY+Y  P PPPPVY
Sbjct: 99  YSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVY 139

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 47/96 (48%), Positives = 51/96 (53%), Gaps = 10/96 (10%)
 Frame = -2

Query: 263 LPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPT-PPPNPPPCPDPPLEPPPP 87
           LP+   A      P PP     PPPPPP     +PP PPP   PP+ PP       PPPP
Sbjct: 26  LPSETSANYHYSSPPPPYYYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYK--SPPPP 83

Query: 86  PPVYKYKSPPPPA-------KKPYEY--PSPPPPVY 6
           PPVYKYKSPPPP          PY+Y  P PPPPVY
Sbjct: 84  PPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVY 119

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 40/91 (43%), Positives = 42/91 (46%), Gaps = 16/91 (17%)
 Frame = -2

Query: 260 PTPPP----APKPPPC-----PEPPPA----PPPPPP---PPPPPPPPTPPAPPPTPPPN 129
           P PPP    +P PPP      P PPP      PPPP      PPPPP    +PPP PP  
Sbjct: 293 PPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPYMYKSPPPPPPVY 352

Query: 128 PPPCPDPPLEPPPPPPVYKYKSPPPPAKKPY 36
                     PPPPPP Y Y SPPPP    Y
Sbjct: 353 KYK------SPPPPPPKYYYSSPPPPPPHHY 377

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 30/50 (60%), Positives = 31/50 (62%), Gaps = 9/50 (18%)
 Frame = -2

Query: 125 PPCPDPPLEPPPPPPVYKYKSPPPPAK-------KPYEY--PSPPPPVYK 3
           PP P     PPPPPPVYKYKSPPPP          PY+Y  P PPPPVYK
Sbjct: 39  PPPPYYYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYK 88

[86][TOP]
>UniRef100_Q8H776 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana
           RepID=Q8H776_ARATH
          Length = 163

 Score =  114 bits (286), Expect = 3e-24
 Identities = 59/82 (71%), Positives = 59/82 (71%), Gaps = 5/82 (6%)
 Frame = +1

Query: 43  FLAGGGGDLYL*TGGG---GGGSNGGSGHGGGFG--GGVGGGAGGVGGGGGGGGGGGGGG 207
           F  GGGG      GGG   GGG  GG G GGGFG  GGVGGGAGG  GGGGG GGGGGGG
Sbjct: 52  FGRGGGGGF----GGGRGSGGGIGGGGGQGGGFGAGGGVGGGAGGGLGGGGGAGGGGGGG 107

Query: 208 AGGGSGHGGGFGAGGGVGSGNG 273
            GGGSGHGGGFGAGGGVG G G
Sbjct: 108 IGGGSGHGGGFGAGGGVGGGAG 129

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 51/82 (62%), Positives = 53/82 (64%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGG G   GF AGGG       GG GGG  GG G GGG GGG+GGG+G   GGG G GGG
Sbjct: 71  GGGGGQGGGFGAGGGVG-----GGAGGGLGGGGGAGGGGGGGIGGGSG--HGGGFGAGGG 123

Query: 196 GGGGAGGGSGHGGGFGAGGGVG 261
            GGGAGGG G GGG G GGG G
Sbjct: 124 VGGGAGGGIGGGGGAGGGGGGG 145

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 50/85 (58%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG G   G   GGG       GGG GGG+ GG G GGG GGG GGG GG  G GGG G 
Sbjct: 61  GGGRGSGGGIGGGGGQGGGFGAGGGVGGGAGGGLGGGGGAGGGGGGGIGGGSGHGGGFGA 120

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSG 267
           GGG G G G G GGG GAGGG G G
Sbjct: 121 GGGVGGGAGGGIGGGGGAGGGGGGG 145

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 45/71 (63%), Positives = 46/71 (64%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG  G + G L GGGG      GGGGGG  GGSGHGGGFG G     GGVGGG GGG G
Sbjct: 83  GGGVGGGAGGGLGGGGGA----GGGGGGGIGGGSGHGGGFGAG-----GGVGGGAGGGIG 133

Query: 193 GGGGGAGGGSG 225
           GGGG  GGG G
Sbjct: 134 GGGGAGGGGGG 144

[87][TOP]
>UniRef100_B7Q768 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7Q768_IXOSC
          Length = 230

 Score =  114 bits (286), Expect = 3e-24
 Identities = 57/88 (64%), Positives = 57/88 (64%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           T GGG G       GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGG
Sbjct: 156 TNGGGGG-------GGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 202

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGG GGG G GGG G GGG G G G
Sbjct: 203 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 230

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 40/64 (62%), Positives = 41/64 (64%)
 Frame = +1

Query: 82  GGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVG 261
           G GGGG  GG   GGGFGGG      G GGG GGG GGGG G G G GHGGGFG GG  G
Sbjct: 1   GHGGGGFGGGGFGGGGFGGG------GFGGGHGGGYGGGGFGGGFGGGHGGGFGGGGYGG 54

Query: 262 SGNG 273
            G+G
Sbjct: 55  GGHG 58

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/61 (65%), Positives = 40/61 (65%)
 Frame = +1

Query: 52  GGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHG 231
           GGGG      GG GGG  GG G GGG GGG GGG  G G GGG GGG GGGG GGG GHG
Sbjct: 3   GGGG---FGGGGFGGGGFGGGGFGGGHGGGYGGGGFGGGFGGGHGGGFGGGGYGGG-GHG 58

Query: 232 G 234
           G
Sbjct: 59  G 59

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 40/63 (63%), Positives = 40/63 (63%)
 Frame = +1

Query: 55  GGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGG 234
           GGG      G GGGG  GG   GGGFGGG GGG GG GG GGG GGG GGG GGG   GG
Sbjct: 3   GGG------GFGGGGFGGGGFGGGGFGGGHGGGYGG-GGFGGGFGGGHGGGFGGGGYGGG 55

Query: 235 GFG 243
           G G
Sbjct: 56  GHG 58

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 40/69 (57%), Positives = 42/69 (60%), Gaps = 1/69 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGG-VGGGAGGVGGGGGGGG 189
           G GG G+      GGGG      GGG GG   G GHGGG+GGG  GGG GG  GGG GGG
Sbjct: 1   GHGGGGF------GGGGF----GGGGFGGGGFGGGHGGGYGGGGFGGGFGGGHGGGFGGG 50

Query: 190 GGGGGGAGG 216
           G GGGG GG
Sbjct: 51  GYGGGGHGG 59

[88][TOP]
>UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra
           magnipapillata RepID=UPI0001924514
          Length = 490

 Score =  114 bits (286), Expect = 3e-24
 Identities = 47/70 (67%), Positives = 47/70 (67%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
           P PP A    PCP PPP PPPPPPPPPPPPPP  P PPP PPP PPP P PP  PPPPPP
Sbjct: 346 PPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 80  VYKYKSPPPP 51
                 PPPP
Sbjct: 406 ------PPPP 409

 Score =  108 bits (271), Expect = 1e-22
 Identities = 45/71 (63%), Positives = 45/71 (63%)
 Frame = -2

Query: 251 PPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYK 72
           PP P   PC   PP PPPPPPPPPPPPPP PP  PP PPP PPP P PP  PPPPPP   
Sbjct: 346 PPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP--- 402

Query: 71  YKSPPPPAKKP 39
              PPPP   P
Sbjct: 403 --PPPPPPPCP 411

 Score =  105 bits (261), Expect = 2e-21
 Identities = 40/54 (74%), Positives = 40/54 (74%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
           P P PPP P PPP P PPP PPP PPPPPPPPPP PP PPP PPP PPP P PP
Sbjct: 356 PCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

 Score =  105 bits (261), Expect = 2e-21
 Identities = 40/53 (75%), Positives = 40/53 (75%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCP 114
           P P P PPP P PPP P PP  PPPPPPPPPPPPPP PP PPP PPP PPPCP
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCP 411

 Score =  103 bits (258), Expect = 5e-21
 Identities = 42/58 (72%), Positives = 42/58 (72%)
 Frame = -2

Query: 254 PPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
           P P P PPP P PPP PPPPPPP PPPPPP PP PPP PPP PPP P PP  PPPP P
Sbjct: 356 PCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP--PPPPCP 411

 Score =  103 bits (257), Expect = 6e-21
 Identities = 49/80 (61%), Positives = 50/80 (62%)
 Frame = -2

Query: 251 PPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYK 72
           P A  PPP P   P  P PPPPPPPPPPP PP PPP PPP+PPP P PP  PPPPPP   
Sbjct: 341 PNACCPPP-PSANPCQPCPPPPPPPPPPP-PPPPPPPPPPSPPPPPPPPPPPPPPPP--- 395

Query: 71  YKSPPPPAKKPYEYPSPPPP 12
              PPPP   P   P PPPP
Sbjct: 396 ---PPPPPPPP---PPPPPP 409

 Score =  103 bits (256), Expect = 8e-21
 Identities = 46/82 (56%), Positives = 47/82 (57%)
 Frame = -2

Query: 257 TPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPV 78
           +P     PPP   P    PPPPPPPPPPPPP PP PPP  PP PPP P PP  PPPPPP 
Sbjct: 340 SPNACCPPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP- 398

Query: 77  YKYKSPPPPAKKPYEYPSPPPP 12
                PPPP       P PPPP
Sbjct: 399 -----PPPP-------PPPPPP 408

 Score =  103 bits (256), Expect = 8e-21
 Identities = 41/61 (67%), Positives = 41/61 (67%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP P PPPPPPPPPPPP PP PPP PPP PPP P  P    
Sbjct: 356 PCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASCS 415

Query: 92  P 90
           P
Sbjct: 416 P 416

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 45/120 (37%), Positives = 48/120 (40%), Gaps = 46/120 (38%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNP----------- 126
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PP     +P           
Sbjct: 368 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASCSPTSCGFGCHYRD 427

Query: 125 -----------------------------------PPCPDPPLEPPPPPPVYKYKSPPPP 51
                                              PP P  P+ PPP PP+     P PP
Sbjct: 428 RLLPTLTYPCDTCTLICLPGCEQSCCKTKNQQTIFPPAPTMPVLPPPDPPMVLPFKPQPP 487

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 38/79 (48%), Positives = 38/79 (48%)
 Frame = -2

Query: 248 PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKY 69
           P    P      P    PPPP   P  P PP PPP PPP PPP P PP   PPPPP    
Sbjct: 329 PTEAKPEMQTGSPNACCPPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 388

Query: 68  KSPPPPAKKPYEYPSPPPP 12
             PPPP   P   P PPPP
Sbjct: 389 PPPPPPPPPPPPPPPPPPP 407

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 38/120 (31%), Positives = 39/120 (32%), Gaps = 33/120 (27%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP----------------------PPPPPPPPTP 159
           P   P PP     PP   P  AP P P                       PP      TP
Sbjct: 270 PAEAPQPPSEAPQPPAEAPQAAPQPSPEDGNLIKANAAVETLLKATGGSSPPTEAKLDTP 329

Query: 158 PAPPPT-----------PPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
               P            PPP+  PC   P  PPPPPP      PPPP   P   P PPPP
Sbjct: 330 TEAKPEMQTGSPNACCPPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 389

[89][TOP]
>UniRef100_Q6Z498 Os07g0511100 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q6Z498_ORYSJ
          Length = 359

 Score =  114 bits (285), Expect = 3e-24
 Identities = 61/105 (58%), Positives = 64/105 (60%), Gaps = 18/105 (17%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGG------------------ 138
           GGGG G   G L GG G  +   GG GGG++GG G GGGFGG                  
Sbjct: 62  GGGGLGGGGGGLGGGHGGGFGGGGGLGGGASGGVGGGGGFGGGGGGGLGGGQGGGFGGGA 121

Query: 139 GVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGGAGG  GGGGG GGGGGGG GGG GHGGGFGAGGGVG G G
Sbjct: 122 GAGGGAGGGLGGGGGFGGGGGGGLGGGGGHGGGFGAGGGVGGGAG 166

 Score =  112 bits (281), Expect = 1e-23
 Identities = 59/89 (66%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGGAGGVGGGGGGG 186
           G G  G + G L GGGG      GGGGGG  GG GHGGGFG  GGVGGGAGG  G GGGG
Sbjct: 120 GAGAGGGAGGGLGGGGGF----GGGGGGGLGGGGGHGGGFGAGGGVGGGAGG--GVGGGG 173

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGGGG G G GHGGGFG G GVG G G
Sbjct: 174 GFGGGGGGGLGGGHGGGFGGGAGVGGGAG 202

 Score =  110 bits (274), Expect = 6e-23
 Identities = 56/87 (64%), Positives = 59/87 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG  G + G + GGGG      GGGGGG  GG GHGGGFGGG G G G  GG GGGGG 
Sbjct: 158 GGGVGGGAGGGVGGGGG-----FGGGGGGGLGG-GHGGGFGGGAGVGGGAGGGVGGGGGF 211

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG+G G G GGGFGAGGG G G G
Sbjct: 212 GGGGGSGLGGGQGGGFGAGGGAGGGIG 238

 Score =  109 bits (273), Expect = 8e-23
 Identities = 60/89 (67%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGG--VGGGAGGVGGGGGGG 186
           GG G G   G   GGGG      GGGGGG  GG GHG GFGGG  VGGGAGG  GGGGG 
Sbjct: 261 GGAGVGSGAGGGVGGGGGF----GGGGGGGLGG-GHGSGFGGGAGVGGGAGGGVGGGGGF 315

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGG GG  GHGGGFGAG GVG G G
Sbjct: 316 GGGGGGGLGG--GHGGGFGAGAGVGGGAG 342

 Score =  108 bits (271), Expect = 1e-22
 Identities = 56/87 (64%), Positives = 57/87 (65%), Gaps = 1/87 (1%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGG-GSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG G  +G  AG GG      GGGGG G  GGSG GGG GGG G G G  GG GGGGG 
Sbjct: 184 GGGHGGGFGGGAGVGGGAGGGVGGGGGFGGGGGSGLGGGQGGGFGAGGGAGGGIGGGGGF 243

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG G G GHGGGFG G GVGSG G
Sbjct: 244 GGGGGGGLGGGHGGGFGGGAGVGSGAG 270

 Score =  107 bits (267), Expect = 4e-22
 Identities = 57/95 (60%), Positives = 59/95 (62%), Gaps = 9/95 (9%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDL---------YL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVG 168
           GGG G   GF  GGGG L         +   GG GGG+ GG G GGGFGGG GGG GG  
Sbjct: 128 GGGLGGGGGFGGGGGGGLGGGGGHGGGFGAGGGVGGGAGGGVGGGGGFGGGGGGGLGGGH 187

Query: 169 GGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGG G GGGAGGG G GGGFG GGG G G G
Sbjct: 188 GGGFGGGAGVGGGAGGGVGGGGGFGGGGGSGLGGG 222

 Score =  106 bits (265), Expect = 7e-22
 Identities = 59/92 (64%), Positives = 60/92 (65%), Gaps = 6/92 (6%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGG---GGG 186
           GGG G   GF  GGGG L    GG GGG  GG+G GGG GGGVGGG G  GGGG   GGG
Sbjct: 166 GGGVGGGGGFGGGGGGGL---GGGHGGGFGGGAGVGGGAGGGVGGGGGFGGGGGSGLGGG 222

Query: 187 GGGG---GGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG   GGGAGGG G GGGFG GGG G G G
Sbjct: 223 QGGGFGAGGGAGGGIGGGGGFGGGGGGGLGGG 254

 Score =  106 bits (264), Expect = 9e-22
 Identities = 56/91 (61%), Positives = 58/91 (63%), Gaps = 5/91 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNG-GSGHGGGFGGGVG---GGAGGVGGGGGG 183
           GGG G  +G   G GG +    G GGGG  G G GHGGGFGGG G   G  GGVGGGGG 
Sbjct: 220 GGGQGGGFGAGGGAGGGIGGGGGFGGGGGGGLGGGHGGGFGGGAGVGSGAGGGVGGGGGF 279

Query: 184 GGGGGGG-GAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGG G G GSG GGG G GGG G G G
Sbjct: 280 GGGGGGGLGGGHGSGFGGGAGVGGGAGGGVG 310

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/94 (61%), Positives = 59/94 (62%), Gaps = 9/94 (9%)
 Frame = +1

Query: 19  GGDGYSYGFLAGGGGDLYL*TGGG-------GGGSNGGSGHGGGFGGGVGGGAGGVGGGG 177
           GG G   GF  GGGG L    GGG       GGG+ GG G GGGFGGG GGG GG GG G
Sbjct: 93  GGVGGGGGFGGGGGGGLGGGQGGGFGGGAGAGGGAGGGLGGGGGFGGGGGGGLGGGGGHG 152

Query: 178 G--GGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G  G GGG GGGAGGG G GGGFG GGG G G G
Sbjct: 153 GGFGAGGGVGGGAGGGVGGGGGFGGGGGGGLGGG 186

 Score =  105 bits (262), Expect = 2e-21
 Identities = 59/97 (60%), Positives = 60/97 (61%), Gaps = 11/97 (11%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGG G   GF  GGGG L    GG GGG  GG+G G G GGGVGGG GG GGGGGGG GG
Sbjct: 234 GGGIGGGGGFGGGGGGGL---GGGHGGGFGGGAGVGSGAGGGVGGG-GGFGGGGGGGLGG 289

Query: 196 G-----------GGGAGGGSGHGGGFGAGGGVGSGNG 273
           G           GGGAGGG G GGGFG GGG G G G
Sbjct: 290 GHGSGFGGGAGVGGGAGGGVGGGGGFGGGGGGGLGGG 326

 Score =  102 bits (255), Expect = 1e-20
 Identities = 55/86 (63%), Positives = 57/86 (66%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGG G   GF  GGGG L    GG G G  GG+G GGG GGGVGGG G  GGGGGG GGG
Sbjct: 270 GGGVGGGGGFGGGGGGGL---GGGHGSGFGGGAGVGGGAGGGVGGGGGFGGGGGGGLGGG 326

Query: 196 GGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG G G+G GG  GAGGGVG G G
Sbjct: 327 HGGGFGAGAGVGG--GAGGGVGGGGG 350

 Score =  101 bits (252), Expect = 2e-20
 Identities = 58/105 (55%), Positives = 59/105 (56%), Gaps = 19/105 (18%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGG---GGGSNGGSGHGGGFGGGVGGG-----AGGVGG 171
           GGG G   GF  GGG  L    GGG   GGG+ GG G GGGFGGG GGG      GG GG
Sbjct: 202 GGGVGGGGGFGGGGGSGLGGGQGGGFGAGGGAGGGIGGGGGFGGGGGGGLGGGHGGGFGG 261

Query: 172 G-----------GGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G           GGGGG GGGGG G G GHG GFG G GVG G G
Sbjct: 262 GAGVGSGAGGGVGGGGGFGGGGGGGLGGGHGSGFGGGAGVGGGAG 306

 Score =  101 bits (251), Expect = 3e-20
 Identities = 56/94 (59%), Positives = 57/94 (60%), Gaps = 8/94 (8%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGG-------AGGVGGG 174
           GGG G   GF  GGG       GGGGG   GG G GGG GGG GGG       +GGVGGG
Sbjct: 43  GGGFGEGEGFGGGGGFG----GGGGGGLGGGGGGLGGGHGGGFGGGGGLGGGASGGVGGG 98

Query: 175 GGGGGGGGGG-GAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGGGGGG G G G G GGG GAGGG G G G
Sbjct: 99  GGFGGGGGGGLGGGQGGGFGGGAGAGGGAGGGLG 132

 Score =  100 bits (250), Expect = 4e-20
 Identities = 56/91 (61%), Positives = 56/91 (61%), Gaps = 4/91 (4%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGGAGGVGGGGGGG 186
           GG G G   G   GGGG       GGGGGS  G G GGGFG  GG GGG GG GG GGGG
Sbjct: 193 GGAGVGGGAGGGVGGGGGF-----GGGGGSGLGGGQGGGFGAGGGAGGGIGGGGGFGGGG 247

Query: 187 GGGGGGGAGGGSGHGGGF--GAGGGVGSGNG 273
           GGG GGG GGG G G G   GAGGGVG G G
Sbjct: 248 GGGLGGGHGGGFGGGAGVGSGAGGGVGGGGG 278

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 51/83 (61%), Positives = 53/83 (63%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G  +G   GGG  +    GGG GG  GG   GGGFGGG GGG GG  GGG G G 
Sbjct: 283 GGGGLGGGHGSGFGGGAGV----GGGAGGGVGG---GGGFGGGGGGGLGGGHGGGFGAGA 335

Query: 193 GGGGGAGGGSGHGGGFGAGGGVG 261
           G GGGAGGG G GGGFG GGG G
Sbjct: 336 GVGGGAGGGVGGGGGFGGGGGGG 358

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 50/92 (54%), Positives = 53/92 (57%), Gaps = 5/92 (5%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGG-----G 177
           G  G G  +G   GGG        G G G  GG G GGG GGG+GGG GG+GGG     G
Sbjct: 30  GPFGHGCKFGRCHGGGF-------GEGEGFGGGGGFGGGGGGGLGGGGGGLGGGHGGGFG 82

Query: 178 GGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG  GG GGGA GG G GGGFG GGG G G G
Sbjct: 83  GG--GGLGGGASGGVGGGGGFGGGGGGGLGGG 112

[90][TOP]
>UniRef100_Q6Z495 Os07g0511300 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q6Z495_ORYSJ
          Length = 296

 Score =  114 bits (285), Expect = 3e-24
 Identities = 60/92 (65%), Positives = 62/92 (67%), Gaps = 6/92 (6%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGGAG---GVGGGGG 180
           GGG G   G   GGGG      GG GGG  GG G GGGFG  GGVGGG+G   G+GGGGG
Sbjct: 110 GGGSGAGGGLGGGGGGGF---GGGSGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGGG 166

Query: 181 GG-GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGGGGGG GGG G GGGFGAGGGVG   G
Sbjct: 167 GGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAG 198

 Score =  110 bits (274), Expect = 6e-23
 Identities = 60/97 (61%), Positives = 62/97 (63%), Gaps = 10/97 (10%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TG---GGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGG 183
           GGGG G   GF  GGGG L    G   GGGGG  GG   GGGFGGGVGGG+G    GGG 
Sbjct: 63  GGGGFGGGGGFRGGGGGGLGGGGGFGGGGGGGLGGGGCEGGGFGGGVGGGSGA---GGGL 119

Query: 184 GGGGG-------GGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG       GGG GGG G GGGFGAGGGVG G+G
Sbjct: 120 GGGGGGGFGGGSGGGVGGGGGQGGGFGAGGGVGGGSG 156

 Score =  107 bits (267), Expect = 4e-22
 Identities = 56/90 (62%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLY---L*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGG 183
           GGGG G   GF  GGGG L       GG GGG  GGSG GGG GGG GGG GG  GGG G
Sbjct: 77  GGGGLGGGGGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGGGGGGGFGGGSGGGVG 136

Query: 184 GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGG GGG G G G GGG G GGG+G G G
Sbjct: 137 GGGGQGGGFGAGGGVGGGSGTGGGLGGGGG 166

 Score =  106 bits (265), Expect = 7e-22
 Identities = 57/93 (61%), Positives = 60/93 (64%), Gaps = 6/93 (6%)
 Frame = +1

Query: 13  GGGGDGY---SYGFLAGGGGDLYL*TGGG---GGGSNGGSGHGGGFGGGVGGGAGGVGGG 174
           GGGG G+   S G + GGGG      GGG   GGG  GGSG GGG GGG GGG GG GGG
Sbjct: 121 GGGGGGFGGGSGGGVGGGGGQ-----GGGFGAGGGVGGGSGTGGGLGGGGGGGFGGGGGG 175

Query: 175 GGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGGGG GGG G G G GG  G GGG+GSG G
Sbjct: 176 GIGGGGGKGGGFGAGGGVGGAAGGGGGMGSGGG 208

 Score =  103 bits (256), Expect = 8e-21
 Identities = 57/94 (60%), Positives = 58/94 (61%), Gaps = 8/94 (8%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGGAGGVGGGGGGGG 189
           GGG G   G   GGGG      GGGGGG  GG G GGGFG  GGVGG AGG GG G GGG
Sbjct: 152 GGGSGTGGGLGGGGGGGF---GGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGSGGG 208

Query: 190 G--GGGGGAGGGSG----HGGGFGAGGGVGSGNG 273
           G  GGGGG GGG G     GGG G GGG+G G G
Sbjct: 209 GGFGGGGGKGGGFGAGGVMGGGAGGGGGLGGGGG 242

 Score =  102 bits (255), Expect = 1e-20
 Identities = 54/95 (56%), Positives = 56/95 (58%), Gaps = 8/95 (8%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGG--------GVGGGAGGVG 168
           GG G G+  G   GGG       GGGGGG  GG G GGG GG        G GGG GG  
Sbjct: 139 GGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFGGGG-GGGIGGGGGKGGGFGAGGGVGGAA 197

Query: 169 GGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG G GGGGG GGG G GGGFGAGG +G G G
Sbjct: 198 GGGGGMGSGGGGGFGGGGGKGGGFGAGGVMGGGAG 232

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 56/89 (62%), Positives = 57/89 (64%), Gaps = 3/89 (3%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGG---GGGG 186
           GGG G   GF AGGG      TGGG GG  GG G GGG GGG+GGG GG GGG   GGG 
Sbjct: 136 GGGGGQGGGFGAGGGVGGGSGTGGGLGGGGGG-GFGGGGGGGIGGG-GGKGGGFGAGGGV 193

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG  GGG G GSG GGGFG GGG G G G
Sbjct: 194 GGAAGGGGGMGSGGGGGFGGGGGKGGGFG 222

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 46/70 (65%), Positives = 47/70 (67%), Gaps = 7/70 (10%)
 Frame = +1

Query: 85  GGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGG-------GGGGGGGAGGGSGHGGGFG 243
           GGGGG  GG G  GG GGG+GGG GG GGGGGGG       GGG GGG GGGSG GGG G
Sbjct: 62  GGGGGFGGGGGFRGGGGGGLGGG-GGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLG 120

Query: 244 AGGGVGSGNG 273
            GGG G G G
Sbjct: 121 GGGGGGFGGG 130

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 52/95 (54%), Positives = 54/95 (56%), Gaps = 11/95 (11%)
 Frame = +1

Query: 10  TGGG-GDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGG----------GVGGGA 156
           TGGG G G   GF  GGGG +     GGGGG  GG G GGG GG          G GGG 
Sbjct: 157 TGGGLGGGGGGGFGGGGGGGI-----GGGGGKGGGFGAGGGVGGAAGGGGGMGSGGGGGF 211

Query: 157 GGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVG 261
           G  GGGG GGG G GG  GGG+G GGG G GGG G
Sbjct: 212 G--GGGGKGGGFGAGGVMGGGAGGGGGLGGGGGGG 244

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 49/90 (54%), Positives = 51/90 (56%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYS---YGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGG 183
           G GG G+    +G   G G D       GGGG  GG   GGGF GG GGG GG    GGG
Sbjct: 34  GPGGFGHGPKGFGRGPGFGHDCRFGRCHGGGGGFGG---GGGFRGGGGGGLGG----GGG 86

Query: 184 GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGGGGG GGG   GGGFG G G GSG G
Sbjct: 87  FGGGGGGGLGGGGCEGGGFGGGVGGGSGAG 116

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 50/98 (51%), Positives = 52/98 (53%), Gaps = 20/98 (20%)
 Frame = +1

Query: 40  GFLAGGGGDLYL*TGGGGGGSNGGSGH----------GGGFGGGVG---GGAGGVGGGGG 180
           GF  GG G      G  G G   G GH          GGGFGGG G   GG GG+GGGGG
Sbjct: 32  GFGPGGFGH-----GPKGFGRGPGFGHDCRFGRCHGGGGGFGGGGGFRGGGGGGLGGGGG 86

Query: 181 GGGGGGGG-------GAGGGSGHGGGFGAGGGVGSGNG 273
            GGGGGGG       G G G G GGG GAGGG+G G G
Sbjct: 87  FGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGGGGG 124

[91][TOP]
>UniRef100_Q6GUG3 Serine/proline-rich repeat protein n=2 Tax=Lupinus angustifolius
           RepID=Q6GUG3_LUPAN
          Length = 198

 Score =  114 bits (285), Expect = 3e-24
 Identities = 57/116 (49%), Positives = 61/116 (52%), Gaps = 27/116 (23%)
 Frame = -2

Query: 272 PFPLPTPPPA----PKPPPCPEPPP-----APPPPPPPPPPP-----PPPTPPAPPPTPP 135
           P P P+PPP       PPP P PPP     +PPPP   PPPP     PPP  P+PPP  P
Sbjct: 83  PPPSPSPPPPYLYKSPPPPSPSPPPPYVNKSPPPPSSSPPPPYIYKSPPPPSPSPPPPSP 142

Query: 134 PNPPPCPDPPLEPPPPPPVYKYKSPPPPAKK-------------PYEYPSPPPPVY 6
             PPP P PP   P PPP Y YKSPPPP+               PY Y SPPPPVY
Sbjct: 143 SPPPPSPSPPPPSPSPPPPYVYKSPPPPSPSPPPPSPSPPPPYHPYLYSSPPPPVY 198

 Score =  102 bits (254), Expect = 1e-20
 Identities = 52/101 (51%), Positives = 58/101 (57%), Gaps = 16/101 (15%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPP-----PPPPPPTPPAP-----PPTPPPNPPP- 120
           P P+P P+P PP   + PP P P PPPP     PPPP P+PP P     PP P P+PPP 
Sbjct: 49  PPPSPSPSPPPPYVYKSPPPPSPSPPPPYAYKSPPPPSPSPPPPYLYKSPPPPSPSPPPP 108

Query: 119 ----CPDPPLEPPPPPPVYKYKSPPPPA-KKPYEYPSPPPP 12
                P PP   PPPP  Y YKSPPPP+   P   PSPPPP
Sbjct: 109 YVNKSPPPPSSSPPPP--YIYKSPPPPSPSPPPPSPSPPPP 147

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 43/90 (47%), Positives = 48/90 (53%), Gaps = 9/90 (10%)
 Frame = -2

Query: 254 PPPAPKPPPCPEPPP----APPPPPPPPPPPPPPTPPAPPPTPPPNPPPCP--DPPLEPP 93
           P  A +P    +PP     +PPPP P P PPPP    +PPP  P  PPP     PP   P
Sbjct: 28  PYNAGQPYYYYQPPSYYYQSPPPPSPSPSPPPPYVYKSPPPPSPSPPPPYAYKSPPPPSP 87

Query: 92  PPPPVYKYKSPPPPAKK---PYEYPSPPPP 12
            PPP Y YKSPPPP+     PY   SPPPP
Sbjct: 88  SPPPPYLYKSPPPPSPSPPPPYVNKSPPPP 117

[92][TOP]
>UniRef100_C4IYP5 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C4IYP5_MAIZE
          Length = 441

 Score =  114 bits (285), Expect = 3e-24
 Identities = 56/97 (57%), Positives = 63/97 (64%), Gaps = 9/97 (9%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPP--PPPPPPPPPPTPPAPPPTPPPNPPPCPDPPL- 102
           P  LP+PPP+P PPP P PPP+PPPP   PPPP PPPP+PP PP  PPP  P  P PPL 
Sbjct: 249 PPRLPSPPPSP-PPPSP-PPPSPPPPLMSPPPPSPPPPSPPPPPLLPPPPQPHSPPPPLS 306

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYP------SPPPPV 9
            PPPPPP+ +  SPPPP   P   P      SPPPP+
Sbjct: 307 SPPPPPPLPQPHSPPPPLSSPPPPPPLPQPHSPPPPL 343

 Score =  107 bits (266), Expect = 5e-22
 Identities = 54/104 (51%), Positives = 58/104 (55%), Gaps = 18/104 (17%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPP-----PPP---PPPPPPTP----PAPPPTPPPN 129
           P PL +PPP   PPP P PPP  PPPP     PPP   PPPPPP P    P PP + PP 
Sbjct: 270 PPPLMSPPPPSPPPPSPPPPPLLPPPPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPP 329

Query: 128 PPPCPDP-----PLEPPPPPPVYKYKSPPP-PAKKPYEYPSPPP 15
           PPP P P     PL  PPPPP   +  PPP PA  P  +P PPP
Sbjct: 330 PPPLPQPHSPPPPLSSPPPPPPLPHSPPPPSPAPAPVYHPPPPP 373

 Score =  106 bits (264), Expect = 9e-22
 Identities = 53/96 (55%), Positives = 57/96 (59%), Gaps = 9/96 (9%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP---PPTPPPNPPP-CPDPP 105
           P P   PPP   PPP   PPP+PPPPP  PPPP P +PP P   PP PPP P P  P PP
Sbjct: 264 PPPPSPPPPLMSPPPPSPPPPSPPPPPLLPPPPQPHSPPPPLSSPPPPPPLPQPHSPPPP 323

Query: 104 L-EPPPPPPVYKYKSPPPPAKKPYEYP----SPPPP 12
           L  PPPPPP+ +  SPPPP   P   P    SPPPP
Sbjct: 324 LSSPPPPPPLPQPHSPPPPLSSPPPPPPLPHSPPPP 359

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 45/91 (49%), Positives = 47/91 (51%), Gaps = 2/91 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTP--PPNPPPCPDPPLE 99
           P P P P P   PPP   PPP PP P P  PPPP  +PP PPP P  PP P P P P   
Sbjct: 309 PPPPPLPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPHSPPPPSPAPAPVYH 368

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
           PPPPP        PPP      +P PPPP Y
Sbjct: 369 PPPPPQCPPCPVLPPPLPCTPTHPWPPPPPY 399

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 56/118 (47%), Positives = 62/118 (52%), Gaps = 31/118 (26%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPP---APPPPPPPPPPPPPPTP-PAP--PPTPPPNPPPCP- 114
           P PL +PPP P  P    PPP   +PPPPPP P  PPPP+P PAP   P PPP  PPCP 
Sbjct: 321 PPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPHSPPPPSPAPAPVYHPPPPPQCPPCPV 380

Query: 113 -DPPLEP------PPPPPVY----------KYKSPPPPAKK-------PYEYPSPPPP 12
             PPL        PPPPP Y          +Y SPPPP +        P +Y SPPPP
Sbjct: 381 LPPPLPCTPTHPWPPPPPYYPGPFPPTDPVRYASPPPPQQHHPWPPVYPVQYGSPPPP 438

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 46/89 (51%), Positives = 49/89 (55%), Gaps = 12/89 (13%)
 Frame = -2

Query: 242 PKPPPCPEPPPAPPPPPPPPPPPPPPTPPAP---PPTPPPNPPPCPDPPLEPPP-----P 87
           P  PP P P    PPP PPPP PPPP+PP P   PP P P PP  P PPL PPP     P
Sbjct: 242 PFVPPMPPPRLPSPPPSPPPPSPPPPSPPPPLMSPPPPSPPPPSPPPPPLLPPPPQPHSP 301

Query: 86  PPVYKYKSPPPPAKKPYEYP----SPPPP 12
           PP      PPPP  +P+  P    SPPPP
Sbjct: 302 PPPLSSPPPPPPLPQPHSPPPPLSSPPPP 330

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 44/83 (53%), Positives = 47/83 (56%), Gaps = 11/83 (13%)
 Frame = -2

Query: 224 PEPPPAPPPP-PPPPPPPPPPTPPAPPPTPP--PNPPPCPDPPLEPPPP--PPVYKYKSP 60
           P  PP PPP  P PPP PPPP+PP P P PP    PPP P PP  PPPP  PP  +  SP
Sbjct: 242 PFVPPMPPPRLPSPPPSPPPPSPPPPSPPPPLMSPPPPSPPPPSPPPPPLLPPPPQPHSP 301

Query: 59  PPPAKKPYEYP------SPPPPV 9
           PPP   P   P      SPPPP+
Sbjct: 302 PPPLSSPPPPPPLPQPHSPPPPL 324

[93][TOP]
>UniRef100_Q41187 Glycine-rich protein (Fragment) n=1 Tax=Arabidopsis thaliana
           RepID=Q41187_ARATH
          Length = 210

 Score =  114 bits (284), Expect = 4e-24
 Identities = 56/87 (64%), Positives = 58/87 (66%), Gaps = 1/87 (1%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG G   GF  G GG      GGG GGG+ GG GHGGG GGG GGG GG GG GGG GG
Sbjct: 39  GGGGGAGGGFGGGAGGGHGGGAGGGFGGGAGGGGGHGGGAGGGFGGGVGGGGGHGGGAGG 98

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGGAGGG GHGGG G G G G+G G
Sbjct: 99  GFGGGAGGGGGHGGGAGGGFGGGAGGG 125

 Score =  113 bits (282), Expect = 8e-24
 Identities = 57/87 (65%), Positives = 59/87 (67%), Gaps = 1/87 (1%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG G  +G   GGGG      GGG GGG+ GG GHGGG GGG GGGAGG GG GGG GG
Sbjct: 75  GGGAGGGFGGGVGGGGGHGGGAGGGFGGGAGGGGGHGGGAGGGFGGGAGGGGGQGGGAGG 134

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGGAGGG G G G GAGGG G G G
Sbjct: 135 GFGGGAGGGFGGGAGGGAGGGFGGGAG 161

 Score =  108 bits (270), Expect = 2e-22
 Identities = 55/87 (63%), Positives = 58/87 (66%), Gaps = 1/87 (1%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG G  +G  AG GG L    GGG GGG+ GG G GGGFGGG GGG GG  GGG GGG 
Sbjct: 9   GGGAGGGHGGGAGAGGGLGGGAGGGFGGGAGGGGGAGGGFGGGAGGGHGGGAGGGFGGGA 68

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG+G G G G GGG G G G
Sbjct: 69  GGGGGHGGGAGGGFGGGVGGGGGHGGG 95

 Score =  108 bits (270), Expect = 2e-22
 Identities = 58/93 (62%), Positives = 60/93 (64%), Gaps = 7/93 (7%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG G  +G  AGGGG      GGG GGG  GG GHGGG GGG GGGAGG GG GGG GG
Sbjct: 57  GGGAGGGFGGGAGGGGGHGGGAGGGFGGGVGGGGGHGGGAGGGFGGGAGGGGGHGGGAGG 116

Query: 193 G------GGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G      GGGG GGG+G G G GAGGG G G G
Sbjct: 117 GFGGGAGGGGGQGGGAGGGFGGGAGGGFGGGAG 149

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/98 (57%), Positives = 60/98 (61%), Gaps = 11/98 (11%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGG-----GDLYL*TGGGGGGSNG------GSGHGGGFGGGVGGGAG 159
           GG G G+  G  AGGG     G  +    GGGGG+ G      G GHGGG GGG GGGAG
Sbjct: 10  GGAGGGHGGGAGAGGGLGGGAGGGFGGGAGGGGGAGGGFGGGAGGGHGGGAGGGFGGGAG 69

Query: 160 GVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GG GGG GGG GGG GGG GHGGG G G G G+G G
Sbjct: 70  GGGGHGGGAGGGFGGGVGGGGGHGGGAGGGFGGGAGGG 107

 Score =  107 bits (266), Expect = 5e-22
 Identities = 55/89 (61%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGG--VGGGGGGG 186
           GGG  G   G   GGGG      GG GGG+ GG G GGG GGG GGGAGG   GG GGG 
Sbjct: 93  GGGAGGGFGGGAGGGGGHGGGAGGGFGGGAGGGGGQGGGAGGGFGGGAGGGFGGGAGGGA 152

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGGAGGG GHGGG G G G G G G
Sbjct: 153 GGGFGGGAGGGGGHGGGAGGGAGGGFGGG 181

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/93 (60%), Positives = 59/93 (63%), Gaps = 7/93 (7%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGG------SGHGGGFGGGVGGGAGGVGGG 174
           GGG G  +G  AGGGG      GGG GGG+ GG       G GGGFGGG GGG G  GG 
Sbjct: 111 GGGAGGGFGGGAGGGGGQGGGAGGGFGGGAGGGFGGGAGGGAGGGFGGGAGGGGGHGGGA 170

Query: 175 GGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGG GGGAGGG GHGGG G G G G+G G
Sbjct: 171 GGGAGGGFGGGAGGGGGHGGGAGGGFGGGAGGG 203

 Score =  105 bits (262), Expect = 2e-21
 Identities = 56/90 (62%), Positives = 58/90 (64%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNG---GSGHGGGFGGGVGGGAGGVGGGGGG 183
           GG G G  +G  AGGG       GGG GG  G   G G GGGFGGG GGGAGG  GGG G
Sbjct: 102 GGAGGGGGHGGGAGGGFGGGAGGGGGQGGGAGGGFGGGAGGGFGGGAGGGAGGGFGGGAG 161

Query: 184 GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGG GGGAGGG+G G G GAGGG G G G
Sbjct: 162 GGGGHGGGAGGGAGGGFGGGAGGGGGHGGG 191

 Score =  103 bits (256), Expect = 8e-21
 Identities = 56/95 (58%), Positives = 59/95 (62%), Gaps = 9/95 (9%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGG-----VGGGG 177
           GGG G  +G  AGGGG      GGG GGG+ GG G GGG GGG GGGAGG      GGG 
Sbjct: 93  GGGAGGGFGGGAGGGGGHGGGAGGGFGGGAGGGGGQGGGAGGGFGGGAGGGFGGGAGGGA 152

Query: 178 GG---GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG   GG GGGGG GGG+G G G G GGG G G G
Sbjct: 153 GGGFGGGAGGGGGHGGGAGGGAGGGFGGGAGGGGG 187

 Score =  101 bits (251), Expect = 3e-20
 Identities = 52/85 (61%), Positives = 54/85 (63%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GG G G   GF  G GG      GG GGG+ GG G G G GGG GGGAGG  GGG GGG 
Sbjct: 126 GGQGGGAGGGFGGGAGGGF---GGGAGGGAGGGFGGGAGGGGGHGGGAGGGAGGGFGGGA 182

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSG 267
           GGGGG GGG+G G G GAGGG G G
Sbjct: 183 GGGGGHGGGAGGGFGGGAGGGGGHG 207

 Score =  100 bits (249), Expect = 5e-20
 Identities = 48/75 (64%), Positives = 49/75 (65%)
 Frame = +1

Query: 49  AGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGH 228
           AG GG      GG GGG  GG+G GGG GGG GGG GG  GGGGG GGG GGGAGGG G 
Sbjct: 2   AGAGGGF---GGGAGGGHGGGAGAGGGLGGGAGGGFGGGAGGGGGAGGGFGGGAGGGHGG 58

Query: 229 GGGFGAGGGVGSGNG 273
           G G G GGG G G G
Sbjct: 59  GAGGGFGGGAGGGGG 73

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 50/79 (63%), Positives = 52/79 (65%), Gaps = 4/79 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGG----AGGVGGGGGG 183
           GGG G  +G  AGGG       GG GGG+ GG GHGGG GGG GGG    AGG GG GGG
Sbjct: 137 GGGAGGGFGGGAGGGAG-----GGFGGGAGGGGGHGGGAGGGAGGGFGGGAGGGGGHGGG 191

Query: 184 GGGGGGGGAGGGSGHGGGF 240
            GGG GGGAGGG GHGG F
Sbjct: 192 AGGGFGGGAGGGGGHGGRF 210

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 55/96 (57%), Positives = 56/96 (58%), Gaps = 10/96 (10%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGG--AGGVGGGGGGGG 189
           G G G  +G  AGGG       GG G G   G G GGGFGGG GGG  AGG  GGG GGG
Sbjct: 1   GAGAGGGFGGGAGGGHG-----GGAGAGGGLGGGAGGGFGGGAGGGGGAGGGFGGGAGGG 55

Query: 190 GGG------GGGAGGGSGHGGGFGA--GGGVGSGNG 273
            GG      GGGAGGG GHGGG G   GGGVG G G
Sbjct: 56  HGGGAGGGFGGGAGGGGGHGGGAGGGFGGGVGGGGG 91

[94][TOP]
>UniRef100_B9SVA0 GRP3S, putative n=1 Tax=Ricinus communis RepID=B9SVA0_RICCO
          Length = 165

 Score =  114 bits (284), Expect = 4e-24
 Identities = 58/89 (65%), Positives = 61/89 (68%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   GF  GGGG L     GGGGG+ GG+G GGG GGG GGG GG  GGGGG GG
Sbjct: 47  GGGGGG---GFGGGGGGGL-----GGGGGAGGGAGFGGGAGGGAGGGLGGGAGGGGGFGG 98

Query: 193 GGGGGAGGGSGHGGGFGA--GGGVGSGNG 273
           GGGGG GGGSG GGG G   GGG G+G G
Sbjct: 99  GGGGGLGGGSGFGGGAGGGFGGGAGAGGG 127

 Score =  112 bits (281), Expect = 1e-23
 Identities = 59/88 (67%), Positives = 61/88 (69%), Gaps = 4/88 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGA---GGVGGGGGGG 186
           GGG G   G  AGGGG      GGGGGG  GGSG GGG GGG GGGA   GG+GGG GGG
Sbjct: 79  GGGAGGGLGGGAGGGGGF---GGGGGGGLGGGSGFGGGAGGGFGGGAGAGGGLGGGAGGG 135

Query: 187 GGGGGGGAGG-GSGHGGGFGAGGGVGSG 267
           GG GGGG GG G G GGGFGAGGG+G G
Sbjct: 136 GGFGGGGGGGLGGGAGGGFGAGGGLGGG 163

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/88 (62%), Positives = 56/88 (63%), Gaps = 1/88 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GGGG G   G  AGGG       GGG GGG  GG+G GGGFGGG GGG GG  G GGG G
Sbjct: 56  GGGGGGLGGGGGAGGGAGFGGGAGGGAGGGLGGGAGGGGGFGGGGGGGLGGGSGFGGGAG 115

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGGAG G G GGG G GGG G G G
Sbjct: 116 GGFGGGAGAGGGLGGGAGGGGGFGGGGG 143

 Score =  106 bits (264), Expect = 9e-22
 Identities = 54/89 (60%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGG--G 186
           GGGG G   GF  G GG      GG GGG+ GG G GGG GGG+GGG+G  GG GGG  G
Sbjct: 64  GGGGAGGGAGFGGGAGGGA---GGGLGGGAGGGGGFGGGGGGGLGGGSGFGGGAGGGFGG 120

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G G GGG GGG+G GGGFG GGG G G G
Sbjct: 121 GAGAGGGLGGGAGGGGGFGGGGGGGLGGG 149

 Score =  103 bits (258), Expect = 5e-21
 Identities = 51/80 (63%), Positives = 53/80 (66%)
 Frame = +1

Query: 34  SYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAG 213
           S G L GGGG  +   GGGG G  GG+G G GFGGG GGGAGG  GGG GGGGG GGG G
Sbjct: 42  SGGGLGGGGGGGFGGGGGGGLGGGGGAGGGAGFGGGAGGGAGGGLGGGAGGGGGFGGGGG 101

Query: 214 GGSGHGGGFGAGGGVGSGNG 273
           GG G G GFG G G G G G
Sbjct: 102 GGLGGGSGFGGGAGGGFGGG 121

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/68 (60%), Positives = 42/68 (61%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG---GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGG 183
           GGGG G   GF  G GG      GGG   GGG  GG+G GGGFGGG GGG GG  GGG G
Sbjct: 100 GGGGLGGGSGFGGGAGGGF----GGGAGAGGGLGGGAGGGGGFGGGGGGGLGGGAGGGFG 155

Query: 184 GGGGGGGG 207
            GGG GGG
Sbjct: 156 AGGGLGGG 163

[95][TOP]
>UniRef100_Q8I519 Erythrocyte membrane protein 1, PfEMP1 n=1 Tax=Plasmodium
           falciparum 3D7 RepID=Q8I519_PLAF7
          Length = 2359

 Score =  114 bits (284), Expect = 4e-24
 Identities = 55/88 (62%), Positives = 59/88 (67%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +GGGG     G   GGGG       GGGGGS GG G GGG G G GGG+GG GG GGGGG
Sbjct: 596 SGGGGGSGGGGGSGGGGGS------GGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGG 649

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGGG+GGG G GGG G+GGG GSG G
Sbjct: 650 SGGGGGSGGGGGSGGGGGSGGGGGSGGG 677

 Score =  114 bits (284), Expect = 4e-24
 Identities = 55/88 (62%), Positives = 59/88 (67%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +GGGG     G   GGGG       GGGGGS GG G GGG G G GGG+GG GG GGGGG
Sbjct: 602 SGGGGGSGGGGGSGGGGGS------GGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGG 655

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGGG+GGG G GGG G+GGG GSG G
Sbjct: 656 SGGGGGSGGGGGSGGGGGSGGGGGSGGG 683

 Score =  114 bits (284), Expect = 4e-24
 Identities = 55/88 (62%), Positives = 59/88 (67%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +GGGG     G   GGGG       GGGGGS GG G GGG G G GGG+GG GG GGGGG
Sbjct: 608 SGGGGGSGGGGGSGGGGGS------GGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGG 661

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGGG+GGG G GGG G+GGG GSG G
Sbjct: 662 SGGGGGSGGGGGSGGGGGSGGGGGSGGG 689

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/87 (62%), Positives = 59/87 (67%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +GGGG     G   GGGG       GGGGGS GG G GGG G G GGG+GG GG GGGGG
Sbjct: 614 SGGGGGSGGGGGSGGGGGS------GGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGG 667

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGN 270
            GGGGG+GGG G GGG G+GGG GSG+
Sbjct: 668 SGGGGGSGGGGGSGGGGGSGGGGGSGS 694

 Score =  111 bits (277), Expect = 3e-23
 Identities = 55/86 (63%), Positives = 59/86 (68%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGG G   G  +GGGG       GGGGGS GG G GGG G G GGG+GG GG GGGGG G
Sbjct: 593 GGGSGGGGG--SGGGGG-----SGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSG 645

Query: 196 GGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGG+GGG G GGG G+GGG GSG G
Sbjct: 646 GGGGSGGGGGSGGGGGSGGGGGSGGG 671

 Score =  105 bits (261), Expect = 2e-21
 Identities = 52/88 (59%), Positives = 56/88 (63%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           T    DG S   + GG G        GGGGS GG G GGG G G GGG+GG GG GGGGG
Sbjct: 580 TQNRSDGSSSVHVGGGSG--------GGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGG 631

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGGG+GGG G GGG G+GGG GSG G
Sbjct: 632 SGGGGGSGGGGGSGGGGGSGGGGGSGGG 659

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 42/71 (59%), Positives = 45/71 (63%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +GGGG     G   GGGG       GGGGGS GG G GGG G G GGG+GG GG GGGGG
Sbjct: 632 SGGGGGSGGGGGSGGGGGS------GGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGG 685

Query: 190 GGGGGGAGGGS 222
            GGGGG+G  S
Sbjct: 686 SGGGGGSGSKS 696

[96][TOP]
>UniRef100_B7PYQ7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PYQ7_IXOSC
          Length = 209

 Score =  114 bits (284), Expect = 4e-24
 Identities = 55/82 (67%), Positives = 55/82 (67%)
 Frame = +1

Query: 28  GYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGG 207
           G S G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG
Sbjct: 130 GSSRGKAGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 183

Query: 208 AGGGSGHGGGFGAGGGVGSGNG 273
            GGG G GGG G GGG G G G
Sbjct: 184 GGGGGGGGGGGGGGGGGGGGGG 205

 Score =  113 bits (282), Expect = 8e-24
 Identities = 56/85 (65%), Positives = 56/85 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G       GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 137 GGGGGG------GGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 184

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSG 267
           GGGGG GGG G GGG G GGG G G
Sbjct: 185 GGGGGGGGGGGGGGGGGGGGGGGGG 209

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGG G       GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGG
Sbjct: 137 GGGGG-------GGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 183

Query: 196 GGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGG GGG G GGG G GGG G G G
Sbjct: 184 GGGGGGGGGGGGGGGGGGGGGGGGGG 209

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 32/40 (80%), Positives = 32/40 (80%)
 Frame = +1

Query: 82  GGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGG 201
           GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 32/40 (80%), Positives = 32/40 (80%)
 Frame = +1

Query: 85  GGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGG 204
           GGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 32/40 (80%), Positives = 32/40 (80%)
 Frame = +1

Query: 88  GGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGG 207
           GGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 32/40 (80%), Positives = 32/40 (80%)
 Frame = +1

Query: 106 GGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSG 225
           GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 32/40 (80%), Positives = 32/40 (80%)
 Frame = +1

Query: 133 GGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGG 252
           GGG GGG GG GGGGGGGGGGGGGG GGG G GGG G GG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 32/40 (80%), Positives = 32/40 (80%)
 Frame = +1

Query: 136 GGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGG 255
           GG GGG GG GGGGGGGGGGGGGG GGG G GGG G GGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 32/39 (82%), Positives = 32/39 (82%)
 Frame = +1

Query: 121 GGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGG 237
           GGG GGG GGG GG GGGGGGGGGGGGGG GGG G GGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 39

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 32/39 (82%), Positives = 32/39 (82%)
 Frame = +1

Query: 121 GGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGG 237
           GGG GGG GGG GG GGGGGGGGGGGGGG GGG G GGG
Sbjct: 2   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 32/40 (80%), Positives = 32/40 (80%)
 Frame = +1

Query: 115 GHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGG 234
           G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G GG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 32/40 (80%), Positives = 32/40 (80%)
 Frame = +1

Query: 124 GGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFG 243
           GG GGG GGG GG GGGGGGGGGGGGGG GGG G GGG G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 31/40 (77%), Positives = 31/40 (77%)
 Frame = +1

Query: 94  GGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAG 213
           GG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 31/40 (77%), Positives = 31/40 (77%)
 Frame = +1

Query: 148 GGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSG 267
           GG GG GGGGGGGGGGGGGG GGG G GGG G GGG G G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 31/39 (79%), Positives = 31/39 (79%)
 Frame = +1

Query: 145 GGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVG 261
           GGG GG GGGGGGGGGGGGGG GGG G GGG G GGG G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 39

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 31/39 (79%), Positives = 31/39 (79%)
 Frame = +1

Query: 145 GGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVG 261
           GGG GG GGGGGGGGGGGGGG GGG G GGG G GGG G
Sbjct: 2   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 30/44 (68%), Positives = 31/44 (70%)
 Frame = +1

Query: 142 VGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           +G   G  GGGGGGGGGGGGGG GGG G GGG G GGG G G G
Sbjct: 129 LGSSRGKAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 172

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 30/39 (76%), Positives = 30/39 (76%)
 Frame = +1

Query: 157 GGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGGGGGGGGGGGGG GGG G GGG G GGG G G G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 39

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 30/39 (76%), Positives = 30/39 (76%)
 Frame = +1

Query: 157 GGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGGGGGGGGGGGGG GGG G GGG G GGG G G G
Sbjct: 2   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

[97][TOP]
>UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera
           RepID=UPI0000DB6CCB
          Length = 394

 Score =  114 bits (284), Expect = 4e-24
 Identities = 49/80 (61%), Positives = 50/80 (62%)
 Frame = -2

Query: 263 LPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPP 84
           LPT    P P     PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PPL PPPPP
Sbjct: 219 LPTAVVVPPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278

Query: 83  PVYKYKSPPPPAKKPYEYPS 24
           P      PPPP   P   P+
Sbjct: 279 PP---PLPPPPPSLPLPLPT 295

 Score =  113 bits (282), Expect = 8e-24
 Identities = 46/81 (56%), Positives = 49/81 (60%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
           P PPP P PPP P PPP PPPPPPPPPPPPPP PP P P PPP PPP P PP   P P P
Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLP 294

Query: 80  VYKYKSPPPPAKKPYEYPSPP 18
                  PP   +P +  + P
Sbjct: 295 TTSATVAPPSTSQPTQLSTTP 315

 Score =  102 bits (254), Expect = 1e-20
 Identities = 48/83 (57%), Positives = 50/83 (60%)
 Frame = -2

Query: 257 TPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPV 78
           T P A   PP P+    PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PP PPP 
Sbjct: 218 TLPTAVVVPP-PQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP- 275

Query: 77  YKYKSPPPPAKKPYEYPSPPPPV 9
                PPPP   P   PS P P+
Sbjct: 276 -----PPPPPPLPPPPPSLPLPL 293

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 38/62 (61%), Positives = 38/62 (61%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PPPPPPPP PPPPP PP  PP PP  P P P       
Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLPTTSATVA 301

Query: 92  PP 87
           PP
Sbjct: 302 PP 303

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 34/61 (55%), Positives = 34/61 (55%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P PPP PP PPPPPPPPP P PP   P P P       PP    
Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLPTTSATVAPPSTSQ 307

Query: 92  P 90
           P
Sbjct: 308 P 308

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 32/63 (50%), Positives = 33/63 (52%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PPP P PPP P P P PPPPPPP PPPPP  P   P T     PP    P +  
Sbjct: 253 PPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLPTTSATVAPPSTSQPTQLS 312

Query: 92  PPP 84
             P
Sbjct: 313 TTP 315

[98][TOP]
>UniRef100_A9TWI4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9TWI4_PHYPA
          Length = 818

 Score =  114 bits (284), Expect = 4e-24
 Identities = 53/87 (60%), Positives = 58/87 (66%), Gaps = 7/87 (8%)
 Frame = -2

Query: 251 PPAPK----PPPC--PEPPPAPPPP-PPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           PP P     PP C  P PPP+PPPP PPPPP PPPP+PP PPP+PPP PPP P PP  PP
Sbjct: 465 PPPPLCDWVPPECTLPPPPPSPPPPSPPPPPSPPPPSPPPPPPSPPP-PPPSPPPPSPPP 523

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP P     SPPPPA +P +   PPPP
Sbjct: 524 PPSP-----SPPPPAPRPVKIFRPPPP 545

 Score =  113 bits (283), Expect = 6e-24
 Identities = 49/84 (58%), Positives = 54/84 (64%)
 Frame = -2

Query: 263 LPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPP 84
           LP PPP+P PPP P PPP+PPPP PPPPPP PP PP  PP P P PPP P PP  PP P 
Sbjct: 479 LPPPPPSP-PPPSPPPPPSPPPPSPPPPPPSPPPPPPSPPPPSPPPPPSPSPP--PPAPR 535

Query: 83  PVYKYKSPPPPAKKPYEYPSPPPP 12
           PV  ++ PPP         +PPPP
Sbjct: 536 PVKIFRPPPPDFISNSAPKAPPPP 559

 Score =  110 bits (276), Expect = 4e-23
 Identities = 49/92 (53%), Positives = 56/92 (60%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE-- 99
           P P   PPP+P PPP P PP  PPPPP PPPPPP P PP+PPP P P+PPP    P++  
Sbjct: 481 PPPPSPPPPSPPPPPSPPPPSPPPPPPSPPPPPPSPPPPSPPPPPSPSPPPPAPRPVKIF 540

Query: 98  -PPPPPPVYKY--KSPPPPAKKPYEYPSPPPP 12
            PPPP  +     K+PPPP       P PPPP
Sbjct: 541 RPPPPDFISNSAPKAPPPPPACDCSCPLPPPP 572

 Score =  104 bits (260), Expect = 3e-21
 Identities = 46/86 (53%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = -2

Query: 263 LPTPPPAPKPPPCPEPPPAPPPPPPPP--PPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
           +P     P PPP P PP  PPPP PPP  PPPPPP+PP PPP+PPP  PP P  P  PPP
Sbjct: 473 VPPECTLPPPPPSPPPPSPPPPPSPPPPSPPPPPPSPPPPPPSPPPPSPPPPPSPSPPPP 532

Query: 89  PPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P   K   PPPP       P  PPP
Sbjct: 533 APRPVKIFRPPPPDFISNSAPKAPPP 558

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 43/77 (55%), Positives = 45/77 (58%), Gaps = 5/77 (6%)
 Frame = -2

Query: 227 CPEPPP-----APPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKS 63
           C  PPP      PP    PPPPP PP PP+PPP P P PP  P PP  PPPPPP     S
Sbjct: 462 CSAPPPPLCDWVPPECTLPPPPPSPP-PPSPPPPPSPPPPSPPPPPPSPPPPPP-----S 515

Query: 62  PPPPAKKPYEYPSPPPP 12
           PPPP+  P   PSPPPP
Sbjct: 516 PPPPSPPPPPSPSPPPP 532

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 46/101 (45%), Positives = 49/101 (48%), Gaps = 15/101 (14%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPP---------PPPPPTPPAPPPTPPPNPPP 120
           P P P PPP+P PP  P PPP+PPPPPP PP         P PP  PPAP P     PPP
Sbjct: 487 PPPSPPPPPSPPPPSPPPPPPSPPPPPPSPPPPSPPPPPSPSPP--PPAPRPVKIFRPPP 544

Query: 119 CPD------PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            PD      P   PPPP        PPPP+  P  Y    P
Sbjct: 545 -PDFISNSAPKAPPPPPACDCSCPLPPPPSHHPPGYVEGDP 584

[99][TOP]
>UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative
           (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC
          Length = 91

 Score =  114 bits (284), Expect = 4e-24
 Identities = 44/62 (70%), Positives = 47/62 (75%)
 Frame = -2

Query: 254 PPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVY 75
           PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPP  +
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--PPPPPQSF 58

Query: 74  KY 69
           ++
Sbjct: 59  RF 60

 Score =  111 bits (277), Expect = 3e-23
 Identities = 42/59 (71%), Positives = 44/59 (74%)
 Frame = -2

Query: 242 PKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYK 66
           P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP   ++
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQSFR 59

 Score =  110 bits (274), Expect = 6e-23
 Identities = 44/62 (70%), Positives = 44/62 (70%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP       PPPP
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP-------PPPP 53

Query: 86  PP 81
           PP
Sbjct: 54  PP 55

 Score =  107 bits (267), Expect = 4e-22
 Identities = 45/72 (62%), Positives = 47/72 (65%)
 Frame = -2

Query: 218 PPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKP 39
           PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP      PPPP    
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP------PPPP---- 50

Query: 38  YEYPSPPPPVYK 3
              P PPP  ++
Sbjct: 51  ---PPPPPQSFR 59

 Score =  103 bits (257), Expect = 6e-21
 Identities = 40/53 (75%), Positives = 40/53 (75%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCP 114
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55

[100][TOP]
>UniRef100_UPI0000DA2377 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA2377
          Length = 132

 Score =  113 bits (283), Expect = 6e-24
 Identities = 56/87 (64%), Positives = 58/87 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGGDG      +GGGGD     GGGGGG +GG G GGG GGG G G GG GGG GGGGG
Sbjct: 11  GGGGDGGG----SGGGGD-----GGGGGGGDGGGGGGGGGGGGGGDGGGGDGGGDGGGGG 61

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GG  G GGG G G G
Sbjct: 62  GGGGGGGGGGGDGGDDGGGGGGGGGGG 88

 Score =  109 bits (273), Expect = 8e-23
 Identities = 55/86 (63%), Positives = 57/86 (66%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +GGGGDG   G   GGGG      GGGGGG +GG G GGG GGG GGG GG GGGGG GG
Sbjct: 19  SGGGGDGGGGGGGDGGGGGG---GGGGGGGGDGGGGDGGGDGGGGGGGGGGGGGGGGDGG 75

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSG 267
             GGGG GGG G GGG G  GG GSG
Sbjct: 76  DDGGGGGGGGGGGGGGDGGSGGDGSG 101

 Score =  101 bits (251), Expect = 3e-20
 Identities = 52/81 (64%), Positives = 53/81 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGGDG   G   GGGG      GGG GG +GG G GGG GGG GGG GG  GGGGGGGG
Sbjct: 28  GGGGDGGGGGGGGGGGGGGD--GGGGDGGGDGGGGGGGGGGGGGGGGDGGDDGGGGGGGG 85

Query: 193 GGGGGAGGGSGHGGGFGAGGG 255
           GGGGG  GGSG  G  G GGG
Sbjct: 86  GGGGGGDGGSGGDGSGGDGGG 106

 Score =  100 bits (248), Expect = 7e-20
 Identities = 50/74 (67%), Positives = 50/74 (67%)
 Frame = +1

Query: 52  GGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHG 231
           GGGGD       GGGG  GGSG GGG GGG GGG GG GGGGGGGGGGG GG G G G G
Sbjct: 6   GGGGD-------GGGGDGGGSG-GGGDGGGGGGGDGGGGGGGGGGGGGGDGGGGDGGGDG 57

Query: 232 GGFGAGGGVGSGNG 273
           GG G GGG G G G
Sbjct: 58  GGGGGGGGGGGGGG 71

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 44/65 (67%), Positives = 44/65 (67%)
 Frame = +1

Query: 79  TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGV 258
           T GGGGG  GG   GG  GGG GGG GG  GGGGGGGGGGGGG  GG G GGG G GGG 
Sbjct: 3   TQGGGGGDGGGGDGGGSGGGGDGGGGGGGDGGGGGGGGGGGGGGDGGGGDGGGDGGGGGG 62

Query: 259 GSGNG 273
           G G G
Sbjct: 63  GGGGG 67

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 49/87 (56%), Positives = 50/87 (57%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G    GGGD     GGGGGG  GG G GGG GG  GGG GG GGGGGGG G
Sbjct: 39  GGGGGGGGDGGGGDGGGD-----GGGGGGGGGGGGGGGGDGGDDGGGGGGGGGGGGGGDG 93

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GG   GG G G      GG G G+G
Sbjct: 94  GSGGDGSGGDGGGRDDDGSGGDGGGSG 120

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 51/90 (56%), Positives = 52/90 (57%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGGDG       GGGG      GGGGGG  GG G GG  GGG GGG GG GGG GG GG
Sbjct: 48  GGGGDGGG----DGGGG------GGGGGGGGGGGGDGGDDGGGGGGGGGGGGGGDGGSGG 97

Query: 193 GGGGGAGGG---SGHGGGFGAGGGVGSGNG 273
            G GG GGG    G GG  G  GG G G+G
Sbjct: 98  DGSGGDGGGRDDDGSGGDGGGSGGDGGGSG 127

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 48/84 (57%), Positives = 50/84 (59%), Gaps = 4/84 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVG-GGAGGVGGGGGGGG- 189
           GGGDG   G   GGGG      GGG GG +GG G GGG GGG G GG+GG G GG GGG 
Sbjct: 53  GGGDGGGGGGGGGGGGG-----GGGDGGDDGGGGGGGGGGGGGGDGGSGGDGSGGDGGGR 107

Query: 190 --GGGGGGAGGGSGHGGGFGAGGG 255
              G GG  GG  G GGG G GGG
Sbjct: 108 DDDGSGGDGGGSGGDGGGSGGGGG 131

[101][TOP]
>UniRef100_B7Q8C0 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7Q8C0_IXOSC
          Length = 92

 Score =  113 bits (283), Expect = 6e-24
 Identities = 57/88 (64%), Positives = 57/88 (64%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           T GGG G       GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGG
Sbjct: 18  TMGGGGG-------GGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGG GGG G GGG G GGG G G G
Sbjct: 65  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 92

 Score =  112 bits (280), Expect = 1e-23
 Identities = 53/77 (68%), Positives = 53/77 (68%)
 Frame = +1

Query: 43  FLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGS 222
           F  GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG 
Sbjct: 17  FTMGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70

Query: 223 GHGGGFGAGGGVGSGNG 273
           G GGG G GGG G G G
Sbjct: 71  GGGGGGGGGGGGGGGGG 87

 Score =  110 bits (275), Expect = 5e-23
 Identities = 52/80 (65%), Positives = 54/80 (67%)
 Frame = +1

Query: 34  SYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAG 213
           ++ F   GGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG G
Sbjct: 13  NFRFFTMGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66

Query: 214 GGSGHGGGFGAGGGVGSGNG 273
           GG G GGG G GGG G G G
Sbjct: 67  GGGGGGGGGGGGGGGGGGGG 86

[102][TOP]
>UniRef100_Q0CQD0 Predicted protein n=1 Tax=Aspergillus terreus NIH2624
           RepID=Q0CQD0_ASPTN
          Length = 313

 Score =  113 bits (283), Expect = 6e-24
 Identities = 55/97 (56%), Positives = 56/97 (57%), Gaps = 10/97 (10%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPP---PPPPPTPPAPPPTPPPNPPPCPDPPL 102
           P  LP PP  P PPP P PPP PPPPPPPPP   PPPPP PP P P PP  PPP   PP+
Sbjct: 129 PPVLPGPPVGPPPPP-PPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPV 187

Query: 101 EPPPPPPVYKYKSPP-----PPAKKPYEYPSPP--PP 12
            PP PPP      PP     PPA  P E P PP  PP
Sbjct: 188 PPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPPKGPP 224

 Score =  110 bits (274), Expect = 6e-23
 Identities = 52/89 (58%), Positives = 54/89 (60%), Gaps = 2/89 (2%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTP-PPNPPPCPDPPLEP 96
           P P P PPP P PPP P PP A PPPPP PPPP PP P  PPP   PP PPP P PP EP
Sbjct: 139 PPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHP-PPAEP 197

Query: 95  -PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPPP  +    PPP + P     PPPP
Sbjct: 198 APPPPPAPQGPPAPPPVEGPPPPKGPPPP 226

 Score =  105 bits (263), Expect = 1e-21
 Identities = 54/100 (54%), Positives = 56/100 (56%), Gaps = 14/100 (14%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPC--PEPPPAPPPPPPPPPPPPPPT--PPAPPPTPP-----PNPPP 120
           P P P PPP P PPP   P PPP PPPP PPPP  PPP   PP PPP PP     P PPP
Sbjct: 144 PPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPPP 203

Query: 119 CPD-----PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            P      PP+E PPPP     K PPPP   P+  P PPP
Sbjct: 204 APQGPPAPPPVEGPPPP-----KGPPPP---PHSPPGPPP 235

 Score =  105 bits (261), Expect = 2e-21
 Identities = 50/83 (60%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query: 254 PPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP--PPP 81
           PPP   P P   PPP PPPPPPPPPPPPPP P A PP PP  PPP P PP  PPP   PP
Sbjct: 127 PPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPP 186

Query: 80  VYKYKSPPPPAKKPYEYPSPPPP 12
           V      PPP   P E P+PPPP
Sbjct: 187 V------PPPHPPPAE-PAPPPP 202

 Score =  103 bits (257), Expect = 6e-21
 Identities = 57/126 (45%), Positives = 59/126 (46%), Gaps = 39/126 (30%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPP---PPPPPPPPPPTPPAP--------PPTPPPNP 126
           P P   PPP P PPP P PPP PPPP   PPPPP PPPP PP P        PP PPP+P
Sbjct: 133 PGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHP 192

Query: 125 PPC---------------------PDPPLEPPP----PPPVYKYKSPPPPAKKPYEYP-- 27
           PP                      P PP  PPP    PP     + PPPPAK P   P  
Sbjct: 193 PPAEPAPPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPPPAPPV 252

Query: 26  -SPPPP 12
             PPPP
Sbjct: 253 EGPPPP 258

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 48/89 (53%), Positives = 50/89 (56%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPP--PPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P PPPAP+ PP P P   PPPP  PPPPP  PP  PPA  P PP   PP P PP+E P
Sbjct: 197 PAPPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPP-PAPPVEGP 255

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPP--PP 12
           PPP       PPP    P E P PP  PP
Sbjct: 256 PPPHSPPPHGPPPHFPPPAEGPPPPHGPP 284

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 46/88 (52%), Positives = 47/88 (53%), Gaps = 5/88 (5%)
 Frame = -2

Query: 260 PTPPPAPKPP-PCPEPPPAPPPPPPPPPP--PPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
           P PPP P P  P P PPPAP  PP PPP   PPPP  P PPP  PP PPP   PP     
Sbjct: 186 PVPPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKV 245

Query: 89  PPPVYKYKSPPPPAKKPYEYPSP--PPP 12
           PPP    + PPPP   P   P P  PPP
Sbjct: 246 PPPAPPVEGPPPPHSPPPHGPPPHFPPP 273

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 57/114 (50%), Positives = 59/114 (51%), Gaps = 27/114 (23%)
 Frame = -2

Query: 272 PFPLPTPPPA---PKPPPCPEPPPAPPP---PPPP--PPPPP--PPTPP----------A 153
           P P P PPPA   P PPP P+ PPAPPP   PPPP  PPPPP  PP PP           
Sbjct: 186 PVPPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKV 245

Query: 152 PPPTPPPN--PPPCPDPPLEPPP--PPPVYKYKSPPPPAKKPYEYPSP---PPP 12
           PPP PP    PPP   PP  PPP  PPP    + PPPP   P   P P   PPP
Sbjct: 246 PPPAPPVEGPPPPHSPPPHGPPPHFPPPA---EGPPPPHGPPPHSPPPSEGPPP 296

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/92 (50%), Positives = 50/92 (54%), Gaps = 7/92 (7%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPP---PPPPPPPPPPPTP---PAPPPTPPPN-PPPCP 114
           P P+  PPP   PPP P  PP PPP   PPPP   PPP  P   P PP +PPP+ PPP  
Sbjct: 211 PPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPPHSPPPHGPPPHF 270

Query: 113 DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPP 18
            PP E PPPP       PPP +  P E P PP
Sbjct: 271 PPPAEGPPPP-----HGPPPHSPPPSEGPPPP 297

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 33/59 (55%), Positives = 35/59 (59%), Gaps = 3/59 (5%)
 Frame = -2

Query: 176 PPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSP---PPPV 9
           PPPP  P PP  PPP PPP P PP  PPPPPP+     PPPP   P  +P P   PPPV
Sbjct: 127 PPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPM---AGPPPPPGPPPPHPPPPAGPPPV 182

[103][TOP]
>UniRef100_Q07PB7 Peptidase C14, caspase catalytic subunit p20 n=1 Tax=Rhodopseudomonas
            palustris BisA53 RepID=Q07PB7_RHOP5
          Length = 1067

 Score =  113 bits (282), Expect = 8e-24
 Identities = 57/105 (54%), Positives = 61/105 (58%), Gaps = 17/105 (16%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPP---PAPPPP------PPPP-----PPPPPPTPPAPPPTPPPN 129
            P P PPP  +PPP P PP   PAPPPP      PPPP     PPPPP   PAPPP PP  
Sbjct: 931  PAPPPPPVVRPPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARPAPPPPPPVV 990

Query: 128  PPPCPDPPL---EPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
             PP P PP     PPPPPPV +   PPPPA +P   P PPPPV +
Sbjct: 991  RPPPPPPPAARPAPPPPPPVVRPPPPPPPAARP--APPPPPPVVR 1033

 Score =  108 bits (270), Expect = 2e-22
 Identities = 51/91 (56%), Positives = 54/91 (59%), Gaps = 8/91 (8%)
 Frame = -2

Query: 266  PLPTPPPAPK--PPPCPEPPPAPPPPPP---PPPPPPPPTPPAPPPTPPPNPPPCPDPPL 102
            P P PPP  +  PPP P   PAPPPPPP   PPPPPPP   PAPPP PP   PP P PP 
Sbjct: 961  PAPPPPPVVRQAPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPA 1020

Query: 101  ---EPPPPPPVYKYKSPPPPAKKPYEYPSPP 18
                PPPPPPV +   PPPP   P   P+PP
Sbjct: 1021 ARPAPPPPPPVVRPPPPPPPPPPPAARPAPP 1051

 Score =  105 bits (261), Expect = 2e-21
 Identities = 50/92 (54%), Positives = 53/92 (57%), Gaps = 4/92 (4%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTP----PPNPPPCPDPPLE 99
            P P   PAP PPP   PPP PPPP   P PPPP   PAPPP P     P PPP   P   
Sbjct: 925  PPPAARPAPPPPPVVRPPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARP--A 982

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
            PPPPPPV +   PPPPA +P   P PPPPV +
Sbjct: 983  PPPPPPVVRPPPPPPPAARP--APPPPPPVVR 1012

 Score =  100 bits (250), Expect = 4e-20
 Identities = 50/94 (53%), Positives = 53/94 (56%), Gaps = 12/94 (12%)
 Frame = -2

Query: 260  PTPPPAPKPPPCPEPP----PAPPPP-----PPPPPP---PPPPTPPAPPPTPPPNPPPC 117
            P PPPA +P P P PP    P PPPP     PPPPPP   PPPP PPA  P PPP PP  
Sbjct: 973  PPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVV 1032

Query: 116  PDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
              PP  PPPPPP  +   P PPA KP   P+  P
Sbjct: 1033 RPPPPPPPPPPPAAR---PAPPAAKPCTLPNGQP 1063

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 50/110 (45%), Positives = 54/110 (49%), Gaps = 22/110 (20%)
 Frame = -2

Query: 266  PLPTPPPA-----PKPPPCPEPPPAP---------------PPPPPPPPPPPPPTPPAPP 147
            P P PPPA     P PP    P PAP               PPP   P PPPPP    PP
Sbjct: 884  PPPPPPPAAAREAPPPPAAERPKPAPAAERQTPPAVTRPAAPPPAARPAPPPPPVVRPPP 943

Query: 146  PTPPPNPPPCPDPPL--EPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
            P PPP   P P PP+    PPPPPV +   PPPPA +P   P PPPPV +
Sbjct: 944  PPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARP--APPPPPPVVR 991

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 40/79 (50%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPP-----PPPPPPTPPAPPPTPPPNPPPCPDPPL 102
            P P PPPA +P P P PP   PPPPPPP     PPPPPP    PPP PPP PPP   P  
Sbjct: 992  PPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPP-PPPAARP-- 1048

Query: 101  EPPPPPPVYKYKSPPPPAK 45
             PP   P       P PA+
Sbjct: 1049 APPAAKPCTLPNGQPCPAR 1067

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 45/111 (40%), Positives = 49/111 (44%), Gaps = 21/111 (18%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPA-----PPPT---PPPNP--- 126
            P P     P P  P  P  P AP   P P  PPPPP P A     PPP    P P P   
Sbjct: 853  PLPGANGQPLPPVPASPPSPAAPAKSPSPTAPPPPPPPAAAREAPPPPAAERPKPAPAAE 912

Query: 125  ---------PPCPDPPLEP-PPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
                     P  P P   P PPPPPV +   PPPP   P  +P+PPPPV +
Sbjct: 913  RQTPPAVTRPAAPPPAARPAPPPPPVVR---PPPPPPPPAAHPAPPPPVVR 960

[104][TOP]
>UniRef100_Q39864 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39864_SOYBN
          Length = 199

 Score =  113 bits (282), Expect = 8e-24
 Identities = 63/122 (51%), Positives = 68/122 (55%), Gaps = 32/122 (26%)
 Frame = -2

Query: 272 PFPLPTPPPAP---KPPPCPEPPPAPPPPP-----PPPP------PPPP------PTPPA 153
           P+  P+PPP     K PP P   P+PPPPP     PPPP      PPPP      P PP 
Sbjct: 5   PYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPY 64

Query: 152 PPPTPPPNPPPCPDPPLEPP------PPPPVYKYKSPPPPAK------KPYEYPSPPPPV 9
             P+PPP P   P PP  PP      PPPPVYKYKSPPPP K       PY+YPSPPPPV
Sbjct: 65  KYPSPPPPPYKYPSPP--PPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPV 122

Query: 8   YK 3
           YK
Sbjct: 123 YK 124

 Score =  113 bits (282), Expect = 8e-24
 Identities = 62/130 (47%), Positives = 68/130 (52%), Gaps = 40/130 (30%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP----PAPPPP------PPPP-----PPPPPPTPPAPPPT- 141
           P+  P+PPP P   P P PP     +PPPP      PPPP     PPPPP   P+PPP  
Sbjct: 63  PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPV 122

Query: 140 ----------------PPPNPPPCPDPP--LEPPPPPPVYKYKSPPPPAK------KPYE 33
                           PPP+  P P PP    P PPPPVYKYKSPPPP K       PY+
Sbjct: 123 YKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYK 182

Query: 32  YPSPPPPVYK 3
           YPSPPPPVYK
Sbjct: 183 YPSPPPPVYK 192

 Score =  109 bits (273), Expect = 8e-23
 Identities = 64/140 (45%), Positives = 72/140 (51%), Gaps = 50/140 (35%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP----PAPPPP------PPPP-----PPPPPPTPPAPPP-- 144
           P+  P+PPP P   P P PP     +PPPP      PPPP     PPPPP   P+PPP  
Sbjct: 24  PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPV 83

Query: 143 ----TPPP------NPPPC------PDPPLE-PPPPPPVYKYKSPPPPAKK--------- 42
               +PPP      +PPP       P PP + P PPPPVYKYKSPPPP  K         
Sbjct: 84  YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPHK 143

Query: 41  -------PYEYPSPPPPVYK 3
                  PY+YPSPPPPVYK
Sbjct: 144 YPSPPPPPYKYPSPPPPVYK 163

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 57/114 (50%), Positives = 63/114 (55%), Gaps = 36/114 (31%)
 Frame = -2

Query: 236 PPPCPEPPPAPPPP------PPPP--PPPPPPTP---PAPPP------TPPP------NP 126
           PP  P   P+PPPP      PPPP   P PPP P   P+PPP      +PPP      +P
Sbjct: 1   PPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSP 60

Query: 125 PP------CPDPPLE-PPPPPPVYKYKSPPPPAKK------PYEYPSPPPPVYK 3
           PP       P PP + P PPPPVYKYKSPPPP  K      PY+YPSPPPP YK
Sbjct: 61  PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYK 114

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 50/101 (49%), Positives = 56/101 (55%), Gaps = 14/101 (13%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP----PAPPPP----PPPPPPPPPPTPPAPPPTPPPNPPPC 117
           P+  P+PPP P   P P PP     +PPPP      PPPP   P+PP PP   P  PPP 
Sbjct: 102 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKYPSPPPPV 161

Query: 116 -----PDPPLE-PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
                P PP + P PPPP YKY SPPPP    Y+Y SPPPP
Sbjct: 162 YKYKSPPPPYKYPSPPPPPYKYPSPPPPV---YKYKSPPPP 199

[105][TOP]
>UniRef100_Q39835 Extensin n=1 Tax=Glycine max RepID=Q39835_SOYBN
          Length = 432

 Score =  113 bits (282), Expect = 8e-24
 Identities = 63/122 (51%), Positives = 68/122 (55%), Gaps = 32/122 (26%)
 Frame = -2

Query: 272 PFPLPTPPPAP---KPPPCPEPPPAPPPPP-----PPPP------PPPP------PTPPA 153
           P+  P+PPP     K PP P   P+PPPPP     PPPP      PPPP      P PP 
Sbjct: 218 PYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPY 277

Query: 152 PPPTPPPNPPPCPDPPLEPP------PPPPVYKYKSPPPPAK------KPYEYPSPPPPV 9
             P+PPP P   P PP  PP      PPPPVYKYKSPPPP K       PY+YPSPPPPV
Sbjct: 278 KYPSPPPPPYKYPSPP--PPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPV 335

Query: 8   YK 3
           YK
Sbjct: 336 YK 337

 Score =  112 bits (279), Expect = 2e-23
 Identities = 61/117 (52%), Positives = 67/117 (57%), Gaps = 27/117 (23%)
 Frame = -2

Query: 272 PFPLPTPPP-----APKPPPCPEPPP----APPPP---PPPP-----PPPPPPTPPAP-- 150
           P P  +PPP     +P PP    PPP    +PPPP   PPPP     PPPP  +PP P  
Sbjct: 116 PPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYY 175

Query: 149 ---PPTPPPNPPP-----CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
              PP P  +PPP      P PP   PPPP  Y YKSPPPP KKPY+YPSPPPPVYK
Sbjct: 176 YHSPPPPKHSPPPPYYYHSPPPPKHSPPPP--YYYKSPPPPPKKPYKYPSPPPPVYK 230

 Score =  111 bits (278), Expect = 2e-23
 Identities = 61/119 (51%), Positives = 68/119 (57%), Gaps = 29/119 (24%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCP-----EPPPAPPPPPP-----PPPP---PPPP----TPPAPPP 144
           P+   +PPP    PP P      PPP   PPPP     PPPP   PPPP    +PP P  
Sbjct: 141 PYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKH 200

Query: 143 TPPP-----NPPPCPDPPLE-PPPPPPVYKYKSPPPPAK------KPYEYPSPPPPVYK 3
           +PPP     +PPP P  P + P PPPPVYKYKSPPPP K       PY+YPSPPPPVYK
Sbjct: 201 SPPPPYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYK 259

 Score =  110 bits (276), Expect = 4e-23
 Identities = 65/132 (49%), Positives = 71/132 (53%), Gaps = 42/132 (31%)
 Frame = -2

Query: 272 PFPLPTPPP------APKPP----PCPEPP---PAPPPPP-----PPPP------PPPP- 168
           P+  P+PPP      +P PP      P PP   P+PPPPP     PPPP      PPPP 
Sbjct: 247 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 306

Query: 167 -----PTPPAPPPTPPPNPPPCPDPPLEPP------PPPPVYKYKSPPPPAK------KP 39
                P PP   P+PPP P   P PP  PP      PPPPVYKYKSPPPP K       P
Sbjct: 307 YKYKSPPPPYKYPSPPPPPYKYPSPP--PPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPP 364

Query: 38  YEYPSPPPPVYK 3
           Y+YPSPPPPVYK
Sbjct: 365 YKYPSPPPPVYK 376

 Score =  108 bits (271), Expect = 1e-22
 Identities = 63/125 (50%), Positives = 68/125 (54%), Gaps = 35/125 (28%)
 Frame = -2

Query: 272 PFPLPTPPP-----APKPPPCPEPPP----APPPP---PPPP-----PPPPPPTP---PA 153
           P P  +PPP     +P PP    PPP    +PPPP   PPPP     PPPPP  P   P+
Sbjct: 164 PPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYKSPPPPPKKPYKYPS 223

Query: 152 PPPT-------PPPNPPPCPDPP--LEPPPPPPVYKYKSPPPPAKK------PYEYPSPP 18
           PPP        PPP   P P PP    P PPPPVYKYKSPPPP  K      PY+YPSPP
Sbjct: 224 PPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPP 283

Query: 17  PPVYK 3
           PP YK
Sbjct: 284 PPPYK 288

 Score =  106 bits (264), Expect = 9e-22
 Identities = 58/120 (48%), Positives = 66/120 (55%), Gaps = 30/120 (25%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP----PAPPPP----PPPPPPPPPPTPPAPP---PTPPP-- 132
           P+  P+PPP P   P P PP     +PPPP      PPPP   P+PP PP   P+PPP  
Sbjct: 276 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPV 335

Query: 131 ----NPPP------CPDPPLE-PPPPPPVYKYKSPPPPAKK------PYEYPSPPPPVYK 3
               +PPP       P PP + P PPPP YKY SPPPP  K      PY+YPSPPPP YK
Sbjct: 336 YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYK 395

 Score =  105 bits (261), Expect = 2e-21
 Identities = 57/117 (48%), Positives = 62/117 (52%), Gaps = 28/117 (23%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP----PAPPPP------PPPP-----PPPPPPTPPAPPPT- 141
           P+  P+PPP P   P P PP     +PPPP      PPPP     PPPPP   P+PPP  
Sbjct: 315 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPV 374

Query: 140 ------PPPNPPPCPDPP--LEPPPPPPVYKYKSPPPPAKKP----YEYPSPPPPVY 6
                 PPP   P P PP    P PPPPVYKYKSPPPP   P    Y Y SPPPP +
Sbjct: 375 YKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVHSPPPPHYIYASPPPPYH 431

 Score =  103 bits (257), Expect = 6e-21
 Identities = 59/122 (48%), Positives = 64/122 (52%), Gaps = 32/122 (26%)
 Frame = -2

Query: 272 PFPLPTPPP-----APKPPPCPEPPP----APPPPP------PPPPPP------PPPTPP 156
           P P  +PPP     +P PP    PPP    +PPPPP      P PPPP      PPP   
Sbjct: 180 PPPKHSPPPPYYYHSPPPPKHSPPPPYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYK 239

Query: 155 APPPTPPPNPPPCPDPPL----EPPPP-------PPVYKYKSPPPPAKKPYEYPSPPPPV 9
            P P PPP   P P PP+     PPPP       PP YKY SPPPP   PY+YPSPPPPV
Sbjct: 240 YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP---PYKYPSPPPPV 296

Query: 8   YK 3
           YK
Sbjct: 297 YK 298

 Score =  102 bits (255), Expect = 1e-20
 Identities = 60/123 (48%), Positives = 67/123 (54%), Gaps = 33/123 (26%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP-PCPEPPPA-----PPPPPPP--PPPPPPPTPPAPPP------TPP 135
           P+   +PPP PK P   P PPP       PPPP     PPPPP   P+PPP      +PP
Sbjct: 205 PYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 264

Query: 134 P------NPPP------CPDPPLE-PPPPPPVYKYKSPPPPAKK------PYEYPSPPPP 12
           P      +PPP       P PP + P PPPPVYKYKSPPPP  K      PY+YPSPPPP
Sbjct: 265 PPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP 324

Query: 11  VYK 3
            YK
Sbjct: 325 PYK 327

 Score =  102 bits (254), Expect = 1e-20
 Identities = 60/123 (48%), Positives = 67/123 (54%), Gaps = 33/123 (26%)
 Frame = -2

Query: 272 PFPLPTPPP------APKPP----PCPEPP---PAPPPPP-----PPPP------PPPP- 168
           P+  P+PPP      +P PP      P PP   P+PPPPP     PPPP      PPPP 
Sbjct: 286 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 345

Query: 167 -----PTPPA--PPPTPPPNPPPCPDPPL-EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
                P PP   P P PPP   P P PP+ +   PPP YKY SPPPP   PY+YPSPPPP
Sbjct: 346 YKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPP---PYKYPSPPPP 402

Query: 11  VYK 3
           VYK
Sbjct: 403 VYK 405

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 55/122 (45%), Positives = 60/122 (49%), Gaps = 35/122 (28%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCP-----EPPPAPPPPPP-----PPPP---PPPP----TPPAPPP 144
           P+   +PPP    PP P      PPP   PPPP     PPPP   PPPP    +PP P  
Sbjct: 45  PYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKH 104

Query: 143 TPPP-----NPPP---CPDPPL---EPPP----PPPVYKYKSPPPPAKK---PYEYPSPP 18
           +PPP     +PPP    P PP     PPP    PPP Y Y SPPPP      PY Y SPP
Sbjct: 105 SPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPP 164

Query: 17  PP 12
           PP
Sbjct: 165 PP 166

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 54/115 (46%), Positives = 57/115 (49%), Gaps = 34/115 (29%)
 Frame = -2

Query: 254 PPPAPKPPP-----CPEPPPAPPPPP-----PPPP--PPPPP----TPPAPPPTPPP--- 132
           PPP   PPP      P PP   PPPP     PPPP   PPPP    +PP P  +PPP   
Sbjct: 36  PPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYY 95

Query: 131 --NPPP---CPDPPL---EPPP----PPPVYKYKSPPPPAKK---PYEYPSPPPP 12
             +PPP    P PP     PPP    PPP Y Y SPPPP      PY Y SPPPP
Sbjct: 96  YHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP 150

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 47/100 (47%), Positives = 48/100 (48%), Gaps = 17/100 (17%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPP-----PPPPPTPPAPP-----PTPPPNPPPCPD 111
           P PP    PPP     P PP   PPPP     PPPP   P PP     P PP + PP P 
Sbjct: 35  PPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPY 94

Query: 110 PPLEPPP----PPPVYKYKSPPPPAKK---PYEYPSPPPP 12
               PPP    PPP Y Y SPPPP      PY Y SPPPP
Sbjct: 95  YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP 134

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 28/55 (50%), Positives = 29/55 (52%), Gaps = 7/55 (12%)
 Frame = -2

Query: 155 APPPTPPPNPPP----CPDPPLEPPPPPPVYKYKSPPPPAKK---PYEYPSPPPP 12
           +PPP     PPP     P PP   PPPP  Y Y SPPPP      PY Y SPPPP
Sbjct: 34  SPPPPKHSPPPPYYYHSPPPPKHSPPPP--YYYHSPPPPKHSPPPPYYYHSPPPP 86

[106][TOP]
>UniRef100_A1KR25 Cell wall glycoprotein GP2 (Fragment) n=2 Tax=Chlamydomonas
            reinhardtii RepID=A1KR25_CHLRE
          Length = 1226

 Score =  113 bits (282), Expect = 8e-24
 Identities = 50/84 (59%), Positives = 55/84 (65%)
 Frame = -2

Query: 260  PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
            P+PPP   PPP   PPP+PPPP PPPP PPPP+P  PPP PPP  PP P PP  PP PPP
Sbjct: 960  PSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSP--PPPVPPPPSPPPPSPP--PPSPPP 1015

Query: 80   VYKYKSPPPPAKKPYEYPSPPPPV 9
                 + PPP+  P   PSPPPPV
Sbjct: 1016 A---AASPPPSPPPPPPPSPPPPV 1036

 Score =  105 bits (262), Expect = 2e-21
 Identities = 54/93 (58%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPP-PTPPAPPP--TPPPNPPP-CPDPP 105
            P P   PPP   PPP P PP  PPP PPPP PPPP P PP+PPP   PPP+PPP    PP
Sbjct: 962  PPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPP 1021

Query: 104  LEPPPPPPVYKYKSPPPP-AKKPYEYPSPPPPV 9
              PPPPPP     SPPPP A+ P   P PP PV
Sbjct: 1022 PSPPPPPP----PSPPPPVARLP---PWPPLPV 1047

 Score =  105 bits (261), Expect = 2e-21
 Identities = 46/81 (56%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -2

Query: 248  PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP--PPPPVY 75
            P P  PP P PP  PPP PPPP   PPP+PP P P PP  PPP P PP+ PP  PPPP  
Sbjct: 949  PLPPSPPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSP 1008

Query: 74   KYKSPPPPAKKPYEYPSPPPP 12
               SPPP A  P   P PPPP
Sbjct: 1009 PPPSPPPAAASPPPSPPPPPP 1029

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 44/91 (48%), Positives = 52/91 (57%), Gaps = 9/91 (9%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPP--------APPPTPPPNPPPCPD 111
            P P+PPP   PPP P PP  PPP PPPP PPPP  PP        +PPP+PPP PPP P 
Sbjct: 974  PPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPP 1033

Query: 110  PPLEPPPP-PPVYKYKSPPPPAKKPYEYPSP 21
            PP+   PP PP+     PP P  +   + +P
Sbjct: 1034 PPVARLPPWPPLPVNNVPPAPTARNTTWTAP 1064

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 40/92 (43%), Positives = 47/92 (51%), Gaps = 8/92 (8%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPPPPP-----PPPPPPTPPAPPPTPPPNPPPCPDP 108
            P P P  PP P PPP   PPP+PPPP PPP     PP PPP PP  PP P    PP P  
Sbjct: 986  PAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPPPPVARLPPWPPL 1045

Query: 107  PLEPPPPPPVYK---YKSPPPPAKKPYEYPSP 21
            P+   PP P  +   + +P     + YE  +P
Sbjct: 1046 PVNNVPPAPTARNTTWTAPAGTTVRTYEIFAP 1077

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 31/54 (57%), Positives = 36/54 (66%)
 Frame = -2

Query: 227 CPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYK 66
           CP PPPAP PPP PP P PPP PP P P P    PP P+P   PPPPPP ++++
Sbjct: 776 CPPPPPAPSPPPKPPTPSPPPLPPQPNPPP---APPSPNP--SPPPPPPGFRFQ 824

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 30/49 (61%), Positives = 33/49 (67%)
 Frame = -2

Query: 269 FPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPP 123
           +  P PPPAP PPP    PP P PPP PP P PPP PP+P P+PPP PP
Sbjct: 774 YTCPPPPPAPSPPP---KPPTPSPPPLPPQPNPPPAPPSPNPSPPPPPP 819

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 34/61 (55%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = -2

Query: 257 TPPPAPKPPP-CP-EPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPP 84
           TPP   +P   CP  PPP+P PPP PP PP PP  P  PP+PPP+ PP P  P  PPP P
Sbjct: 564 TPPDLMQPSTSCPLSPPPSPSPPPSPPQPPSPPPVPPSPPSPPPS-PPSPANPSPPPPAP 622

Query: 83  P 81
           P
Sbjct: 623 P 623

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 33/68 (48%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = -2

Query: 269 FPLPTPPPAPKPPPCPEPPPAPPPPPPPP-PPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           F LP        PP P  PP+PPP PP P PP P P PP+PPP+P P  P  P PP   P
Sbjct: 276 FFLPPSCKTTSRPPSPPLPPSPPPQPPSPLPPSPAPLPPSPPPSPLPPSPKPPTPPSPLP 335

Query: 92  PPPPVYKY 69
           P PP  ++
Sbjct: 336 PAPPTQQF 343

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 27/45 (60%), Positives = 29/45 (64%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP 132
           P P+P P P PP  P PPP PP PP PPP PP P  P+PPP  PP
Sbjct: 579 PPPSPSPPPSPPQPPSPPPVPPSPPSPPPSPPSPANPSPPPPAPP 623

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 31/54 (57%), Positives = 36/54 (66%)
 Frame = -2

Query: 236 PPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVY 75
           PPP P PPP+PP PP PPP PP  +PP+PPP+PP   P  P PP  PP PP  +
Sbjct: 579 PPPSPSPPPSPPQPPSPPPVPP--SPPSPPPSPP--SPANPSPP--PPAPPAAF 626

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 35/77 (45%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = -2

Query: 236 PPPCPEP--PPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKS 63
           PP C     PP+PP PP PPP PP P PP+P P               PP PPP     S
Sbjct: 279 PPSCKTTSRPPSPPLPPSPPPQPPSPLPPSPAPL--------------PPSPPP-----S 319

Query: 62  PPPPAKKPYEYPSPPPP 12
           P PP+ KP   PSP PP
Sbjct: 320 PLPPSPKPPTPPSPLPP 336

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 31/62 (50%), Positives = 33/62 (53%)
 Frame = -2

Query: 233 PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPP 54
           PP    P    P  PPP P PPP+PP P     P+PPP P  P  PPP PP     SPPP
Sbjct: 565 PPDLMQPSTSCPLSPPPSPSPPPSPPQP-----PSPPPVPPSPPSPPPSPPSPANPSPPP 619

Query: 53  PA 48
           PA
Sbjct: 620 PA 621

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 26/42 (61%), Positives = 28/42 (66%), Gaps = 2/42 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPP--PPPPPPTPPA 153
           P P P+PP  P PPP P  PP+PPP PP P  P PPPP PPA
Sbjct: 583 PSPPPSPPQPPSPPPVPPSPPSPPPSPPSPANPSPPPPAPPA 624

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 26/46 (56%), Positives = 28/46 (60%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPP 135
           P P P+PPP+P  PP P P P  PP PPP  PP P  P  PPP PP
Sbjct: 579 PPPSPSPPPSPPQPPSPPPVPPSPPSPPP-SPPSPANPSPPPPAPP 623

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 28/46 (60%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = -2

Query: 185 PPPPPPPTPPAPPPTPPPNP-PPCPDPPLEPPPPPPVYKYKSPPPP 51
           PPPPP P+PP  PPTP P P PP P+PP  PP P P     SPPPP
Sbjct: 777 PPPPPAPSPPPKPPTPSPPPLPPQPNPPPAPPSPNP-----SPPPP 817

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 30/49 (61%), Positives = 32/49 (65%), Gaps = 3/49 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPP-PPPPP-PPPPPPPTPPAP-PPTPP 135
           P P P+PPP P  P  P P P PP PPP P PP P PPTPP+P PP PP
Sbjct: 292 PLP-PSPPPQPPSPLPPSPAPLPPSPPPSPLPPSPKPPTPPSPLPPAPP 339

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 24/43 (55%), Positives = 25/43 (58%)
 Frame = -2

Query: 179 PPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPP 51
           PPPPP P  PP  P P+PPP P  P  PPP PP      PPPP
Sbjct: 777 PPPPPAPSPPPKPPTPSPPPLPPQP-NPPPAPPSPNPSPPPPP 818

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 4/39 (10%)
 Frame = -2

Query: 272 PFPLPTP-PPAPKPPPCP---EPPPAPPPPPPPPPPPPP 168
           P P P P PP P PPP P    PPPAPP P P PPPPPP
Sbjct: 781 PAPSPPPKPPTPSPPPLPPQPNPPPAPPSPNPSPPPPPP 819

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 27/63 (42%), Positives = 31/63 (49%)
 Frame = -2

Query: 200 PPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSP 21
           PP    P    P  P P P+PPP+PP       +PP PPPV      PPP+      PSP
Sbjct: 565 PPDLMQPSTSCPLSPPPSPSPPPSPP-------QPPSPPPVPPSPPSPPPSPPSPANPSP 617

Query: 20  PPP 12
           PPP
Sbjct: 618 PPP 620

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 25/52 (48%), Positives = 27/52 (51%)
 Frame = -2

Query: 167 PTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P+   PPP P P+PPP P  P  PP PP       P PP   P   PSPPPP
Sbjct: 772 PSYTCPPPPPAPSPPPKPPTPSPPPLPP------QPNPPPAPPSPNPSPPPP 817

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 25/53 (47%), Positives = 29/53 (54%)
 Frame = -2

Query: 161 PPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
           PP P P+PPP PP    PPL P P PP      P PP+  P   P PPPP ++
Sbjct: 778 PPPPAPSPPPKPPTPSPPPLPPQPNPP------PAPPSPNP--SPPPPPPGFR 822

[107][TOP]
>UniRef100_B9HFC9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HFC9_POPTR
          Length = 241

 Score =  112 bits (281), Expect = 1e-23
 Identities = 57/90 (63%), Positives = 59/90 (65%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG---GGVGGGAGGVGGGGGG 183
           GGG  G S G   GGGG      GGGGGG  GG+G G GFG   GG GGG GG GGGGGG
Sbjct: 131 GGGRGGASSGGGGGGGGG-----GGGGGGGGGGNGKGFGFGHGGGGGGGGGGGGGGGGGG 185

Query: 184 GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGGG GGG G GGG+G GGG G G G
Sbjct: 186 GGGSGGGGGGGGGGQGGGWGWGGGGGGGGG 215

 Score =  108 bits (270), Expect = 2e-22
 Identities = 57/90 (63%), Positives = 59/90 (65%), Gaps = 3/90 (3%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNG---GSGHGGGFGGGVGGGAGGVGGGGG 180
           +GGGG G       GGGG      GGGGGG NG   G GHGGG GGG GGG GG GGGGG
Sbjct: 139 SGGGGGG------GGGGGG-----GGGGGGGNGKGFGFGHGGG-GGGGGGGGGGGGGGGG 186

Query: 181 GGGGGGGGGAGGGSGHGGGFGAGGGVGSGN 270
           GG GGGGGG GGG G G G+G GGG G GN
Sbjct: 187 GGSGGGGGGGGGGQGGGWGWGGGGGGGGGN 216

 Score =  103 bits (258), Expect = 5e-21
 Identities = 53/87 (60%), Positives = 55/87 (63%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           G GG+G   G  + GGG      GGGGGG  GG G GGG G G G G GG GGGGGGGGG
Sbjct: 126 GSGGNGGGRGGASSGGG------GGGGGGGGGGGGGGGGNGKGFGFGHGG-GGGGGGGGG 178

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG   GGG G GGG G G G
Sbjct: 179 GGGGGGGGGGSGGGGGGGGGGQGGGWG 205

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/91 (57%), Positives = 54/91 (59%), Gaps = 6/91 (6%)
 Frame = +1

Query: 19  GGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGG------VGGGGG 180
           GG   S G  +GG G      GG GG S+GG G GGG GGG GGG GG       G GGG
Sbjct: 117 GGKPSSGGRGSGGNG------GGRGGASSGGGGGGGGGGGGGGGGGGGNGKGFGFGHGGG 170

Query: 181 GGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGGGG GGG G GG  G GGG G G G
Sbjct: 171 GGGGGGGGGGGGGGGGGGSGGGGGGGGGGQG 201

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 46/80 (57%), Positives = 49/80 (61%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG+G  +GF  GGGG       GGGGG  GG G GGG G G GGG GG G GGG G G
Sbjct: 155 GGGGNGKGFGFGHGGGG-------GGGGGGGGGGGGGGGGGSGGGGGGGGGGQGGGWGWG 207

Query: 193 GGGGGAGGGSGHGGGFGAGG 252
           GGGGG GG  G    +G GG
Sbjct: 208 GGGGGGGGNQGDCLPWGCGG 227

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 50/103 (48%), Positives = 52/103 (50%), Gaps = 25/103 (24%)
 Frame = +1

Query: 40  GFLAGGGGDLYL*TGGGGGGSNGG-----SGHG----------GGFGGGVGGGAGGVGGG 174
           G   GG G+     GGGGGGS  G     SGHG          GG     G G+GG GGG
Sbjct: 79  GGRGGGNGN-----GGGGGGSGVGKGGDHSGHGKEIGKPHQRKGGKPSSGGRGSGGNGGG 133

Query: 175 GGG---GGGGGGGGAGGGSGHGG-------GFGAGGGVGSGNG 273
            GG   GGGGGGGG GGG G GG       GFG GGG G G G
Sbjct: 134 RGGASSGGGGGGGGGGGGGGGGGGGNGKGFGFGHGGGGGGGGG 176

[108][TOP]
>UniRef100_Q41645 Extensin (Fragment) n=1 Tax=Volvox carteri RepID=Q41645_VOLCA
          Length = 464

 Score =  112 bits (281), Expect = 1e-23
 Identities = 49/90 (54%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPP---PCPDPPL 102
           P P+ +PPP P P P P PPP    P PPPP PPPP+PP P P+P P PP   P P PP+
Sbjct: 304 PQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPV 363

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPPP  +   PPPPA  P   P PPPP
Sbjct: 364 VSPPPPPP-RASPPPPPASSPPPPPRPPPP 392

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/98 (55%), Positives = 57/98 (58%), Gaps = 10/98 (10%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPP---PPPPPPTP-PAPPPTPPPNPPPCPDPP 105
           P P  +PPP P+ PP P PP A PPPPPPP   P PPPP P  +PPP PPP P P P PP
Sbjct: 266 PLPKTSPPPPPRVPPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPP 325

Query: 104 -LEPPPPPPVYKYKSPPPPAKK-----PYEYPSPPPPV 9
              P PPPP     SPPPP        P   PSPPPPV
Sbjct: 326 RSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPV 363

 Score =  105 bits (261), Expect = 2e-21
 Identities = 49/93 (52%), Positives = 53/93 (56%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPP---CPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPP---PCPD 111
           P P P P P+P PPP    P PPP  PPPP PPPP P P+PP P  +P P PP   P P 
Sbjct: 310 PPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPP 369

Query: 110 PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP   PPPPP     SPPPP + P   P P PP
Sbjct: 370 PPRASPPPPPA---SSPPPPPRPPPPSPPPSPP 399

 Score =  102 bits (254), Expect = 1e-20
 Identities = 48/87 (55%), Positives = 52/87 (59%), Gaps = 3/87 (3%)
 Frame = -2

Query: 263 LPTPPPAPK--PPPCPEPPPAPPPP-PPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           L   PP PK  PPP P  PP+PPPP   PPPPPPP   P+PPP  P + PP P PP   P
Sbjct: 261 LTASPPLPKTSPPPPPRVPPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSP 320

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPP     SPPPP+  P   PSPPPP
Sbjct: 321 SPPPPRSSPSPPPPSPPP---PSPPPP 344

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 48/90 (53%), Positives = 51/90 (56%), Gaps = 4/90 (4%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP-PAPPPPPP---PPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
           P   P+PPP   PPP P PP P+P PPPP   P PPPP  +PP PPP   P PPP   PP
Sbjct: 325 PRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPP 384

Query: 104 LEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
             PP PPP     SPPPPA      PSP P
Sbjct: 385 -PPPRPPPPSPPPSPPPPATAAANPPSPAP 413

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 51/104 (49%), Positives = 53/104 (50%), Gaps = 17/104 (16%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPP-----PPP----PPPPPPPTPPAPPPTPPPNPPP 120
           P P P  PP P PPP P P P+PPPP     PPP    PPPPPP   P PPP   P PPP
Sbjct: 329 PSPPPPSPPPPSPPP-PRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPP 387

Query: 119 CPDPPLEPP-PPPPVYKYKSPPPPAKK-------PYEYPSPPPP 12
            P PP  PP PPPP     +PP PA         P     PPPP
Sbjct: 388 RPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPLGTRPPPPP 431

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 55/114 (48%), Positives = 62/114 (54%), Gaps = 24/114 (21%)
 Frame = -2

Query: 272 PFPLPTPPP---APKPPPC----PEPPPAPPPPPPP---PPPPPPPTPPAPPPTPPP--- 132
           P P P+PPP   +P PPP     P PPP   PPPPP   PPPPP P PP+PPP+PPP   
Sbjct: 344 PRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPAT 403

Query: 131 ---NPP-PCPD------PPLEPPPPPPVYKYKSPPPPAK-KPYEYPSPPPPVYK 3
              NPP P P       PPL   PPPP  +  +PPP     P +  SPPPP  K
Sbjct: 404 AAANPPSPAPSRSRAGGPPLGTRPPPPPPEDDAPPPDYYFPPPQDMSPPPPKKK 457

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 49/99 (49%), Positives = 52/99 (52%), Gaps = 17/99 (17%)
 Frame = -2

Query: 257 TPPPAPKPPP-----CPEP-----PPAP---PPPPPPPPPPPPPTPPAPPPTPPPNPPPC 117
           +PPPA + PP      P P     PP P   PPPPP  PP PPP   +PPP PPP   P 
Sbjct: 241 SPPPATRSPPPRRITSPSPVLTASPPLPKTSPPPPPRVPPSPPPPVASPPPPPPPRVSPS 300

Query: 116 PDPP---LEPPPPPPVYKYKSPPPPAKKPY-EYPSPPPP 12
           P PP     PPPPPP     SPPPP   P    PSPPPP
Sbjct: 301 PPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPP 339

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 41/98 (41%), Positives = 44/98 (44%), Gaps = 21/98 (21%)
 Frame = -2

Query: 242 PKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPP--------------------PTPPPNPP 123
           P PPP P    +PPPP      PPP T   PP                    P PPP  P
Sbjct: 220 PSPPPPPRVSTSPPPPARVSSSPPPATRSPPPRRITSPSPVLTASPPLPKTSPPPPPRVP 279

Query: 122 PCPDPPL-EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P P PP+  PPPPPP     SPPPP  +P   P PPPP
Sbjct: 280 PSPPPPVASPPPPPPPRVSPSPPPP--QPVSSPPPPPP 315

[109][TOP]
>UniRef100_Q00X46 Chromosome 13 contig 1, DNA sequence n=1 Tax=Ostreococcus tauri
            RepID=Q00X46_OSTTA
          Length = 1990

 Score =  112 bits (281), Expect = 1e-23
 Identities = 49/82 (59%), Positives = 56/82 (68%)
 Frame = -2

Query: 257  TPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPV 78
            +PPP+P PPP P P P+PPPP PPPP P PP PP P P PPP+P P P PP  PPP PP 
Sbjct: 780  SPPPSP-PPPNPPPLPSPPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPPP 838

Query: 77   YKYKSPPPPAKKPYEYPSPPPP 12
                SPPPP+  P+  P+PPPP
Sbjct: 839  ---PSPPPPS--PFPPPAPPPP 855

 Score =  103 bits (258), Expect = 5e-21
 Identities = 48/84 (57%), Positives = 50/84 (59%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
            P P PPP P PPP   PPP+P PP PPPP P PP  P+P P PP  PPP P PP  PPPP
Sbjct: 786  PPPNPPPLPSPPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPPPP-SPPPP 844

Query: 86   PPVYKYKSPPPPAKKPYEYPSPPP 15
             P       PPPA  P   PSPPP
Sbjct: 845  SPF------PPPAPPP---PSPPP 859

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 45/82 (54%), Positives = 49/82 (59%), Gaps = 4/82 (4%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPP----PAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
            P PLP+PPP   PPP P PP    P+P PPP P P PPPP+PP P P PP  PPP P PP
Sbjct: 790  PPPLPSPPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPPPPSPPPPSPFPP 849

Query: 104  LEPPPPPPVYKYKSPPPPAKKP 39
              PPPP       SPPP  + P
Sbjct: 850  PAPPPP-------SPPPADECP 864

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 43/74 (58%), Positives = 45/74 (60%), Gaps = 2/74 (2%)
 Frame = -2

Query: 227 CPEPPPAPPPPPPPP--PPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPP 54
           C   PP  PPPP PP  P PPPP+PP P PTPP  PPP P PP  P P PP     SPPP
Sbjct: 777 CVSSPPPSPPPPNPPPLPSPPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPP---PSPPP 833

Query: 53  PAKKPYEYPSPPPP 12
           P+  P   PSPPPP
Sbjct: 834 PSPPP---PSPPPP 844

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 32/54 (59%), Positives = 34/54 (62%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPD 111
           P P P PPP+P P P P  PP P PPPP PPPP P  PPAPPP  PP    CP+
Sbjct: 812 PPPSPFPPPSPSPSPPPPSPPPPSPPPPSPPPPSPFPPPAPPPPSPPPADECPN 865

[110][TOP]
>UniRef100_A0CZ14 Chromosome undetermined scaffold_31, whole genome shotgun sequence
           n=1 Tax=Paramecium tetraurelia RepID=A0CZ14_PARTE
          Length = 417

 Score =  112 bits (281), Expect = 1e-23
 Identities = 54/99 (54%), Positives = 56/99 (56%), Gaps = 16/99 (16%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPE-------PPPAPPPPPPPPP----PPPPPTPPAPPPTP-PPNPPPC 117
           P PPP P PPP P        PPP PPPPPPP P    PPPPP PP PPP P   NPPP 
Sbjct: 288 PPPPPPPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPP 347

Query: 116 PDPPL----EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           P PPL     PPPPPP+     PPPP   P+    PPPP
Sbjct: 348 PPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPPP 386

 Score =  112 bits (280), Expect = 1e-23
 Identities = 49/91 (53%), Positives = 52/91 (57%), Gaps = 8/91 (8%)
 Frame = -2

Query: 260 PTPPPAPKPPPCP--EPPPAPPPPPPPPP------PPPPPTPPAPPPTPPPNPPPCPDPP 105
           P PPP P PPP P  + PP PPPPPPPPP      PPPPP PP P    PP PPP P   
Sbjct: 309 PPPPPPPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGA 368

Query: 104 LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPPPP +    PPPP     + P PPPP
Sbjct: 369 RPPPPPPPPFGNAPPPPPPPPGSKIPGPPPP 399

 Score =  103 bits (256), Expect = 8e-21
 Identities = 55/104 (52%), Positives = 55/104 (52%), Gaps = 17/104 (16%)
 Frame = -2

Query: 272 PFPLPTPPP-----APKPPPCPEPPPA------PPPPPPPP------PPPPPPTPPAPPP 144
           P P P PPP     AP PPP P PPP       PPPPPPPP      PPPPPP P    P
Sbjct: 311 PPPPPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARP 370

Query: 143 TPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPP PP    PP  PPPPPP  K   PPPP   P   P PPPP
Sbjct: 371 PPPPPPPFGNAPP--PPPPPPGSKIPGPPPPPGGP-RPPGPPPP 411

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 42/82 (51%), Positives = 48/82 (58%), Gaps = 12/82 (14%)
 Frame = -2

Query: 218 PPPAPPPPPPPPPPPPPPTP----PAPPPTPPPNPPPCPD-----PPLEPPPPPPVYKYK 66
           P    PPPPPPPPPPP P       APPP PPP PPP P+     PP  PPPPPP+   +
Sbjct: 283 PQQQSPPPPPPPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPPPPPIPGQQ 342

Query: 65  SPPPPAKKP---YEYPSPPPPV 9
           +PPPP   P    + P PPPP+
Sbjct: 343 NPPPPPPPPLPGQQAPPPPPPL 364

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 48/92 (52%), Gaps = 21/92 (22%)
 Frame = -2

Query: 224 PEPPPAPPPPPPPPPPPP--------PPTPPAPPP-------TPPPNPPPCPDPPL---- 102
           P+    PPPPPPPPPP P        PP PP PPP        PPP PPP P PP+    
Sbjct: 283 PQQQSPPPPPPPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPPPPPIPGQQ 342

Query: 101 --EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PPPPPP+   ++PPPP   P     PPPP
Sbjct: 343 NPPPPPPPPLPGQQAPPPPPPLPGGARPPPPP 374

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 38/68 (55%), Positives = 38/68 (55%), Gaps = 8/68 (11%)
 Frame = -2

Query: 266 PLPTPPPAP----KPPPCPEPPPAPPPPPPPPP----PPPPPTPPAPPPTPPPNPPPCPD 111
           P P PPP P     PPP P P  A PPPPPPPP    PPPPP PP      PP PP  P 
Sbjct: 345 PPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPR 404

Query: 110 PPLEPPPP 87
           PP  PPPP
Sbjct: 405 PPGPPPPP 412

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 27/50 (54%), Positives = 27/50 (54%), Gaps = 5/50 (10%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPP-----PPPPPPPPPPTPPAPPPTP 138
           P P    PP P PPP    PP PPPP     P PPPPP  P PP PPP P
Sbjct: 363 PLPGGARPPPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRPPGPPPPP 412

[111][TOP]
>UniRef100_Q69XV3 Os06g0622400 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q69XV3_ORYSJ
          Length = 321

 Score =  112 bits (280), Expect = 1e-23
 Identities = 53/79 (67%), Positives = 55/79 (69%)
 Frame = +1

Query: 37  YGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGG 216
           +G  +GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGG GGGGGG GG
Sbjct: 77  WGVWSGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 130

Query: 217 GSGHGGGFGAGGGVGSGNG 273
           G G GGG G GGG G GNG
Sbjct: 131 GGGGGGGGGGGGGGGGGNG 149

 Score =  107 bits (267), Expect = 4e-22
 Identities = 54/88 (61%), Positives = 56/88 (63%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +GGGG         GGGG      GGGGGG  GG G GGG GGG GGG GG GGG GGGG
Sbjct: 81  SGGGG---------GGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGG 125

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGG GGG G GGG G GGG G  +G
Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGGNGGDDG 153

 Score =  101 bits (251), Expect = 3e-20
 Identities = 56/112 (50%), Positives = 57/112 (50%), Gaps = 25/112 (22%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG G G GGG GG GGGGGGGGG
Sbjct: 86  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139

Query: 193 GGGGGAGG-------------------------GSGHGGGFGAGGGVGSGNG 273
           GGGGG GG                         G G G G G G G+G GNG
Sbjct: 140 GGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGGKGRGRGRGRGMGSGIGRGNG 191

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 45/63 (71%), Positives = 45/63 (71%)
 Frame = +1

Query: 85  GGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGS 264
           G G  S GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G GGG G GGG G 
Sbjct: 76  GWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 135

Query: 265 GNG 273
           G G
Sbjct: 136 GGG 138

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 43/64 (67%), Positives = 43/64 (67%)
 Frame = +1

Query: 82  GGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVG 261
           G G     GG G GGG GGG GGG GG GGGGGGGGGGGGGG GG  G GGG G GGG G
Sbjct: 76  GWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 135

Query: 262 SGNG 273
            G G
Sbjct: 136 GGGG 139

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 56/151 (37%), Positives = 58/151 (38%), Gaps = 64/151 (42%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 84  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137

Query: 193 GGGGGAGGGS---------------------------GHGGGFGAGGGV----------- 258
           GGGGG GGG                            G G G G G G+           
Sbjct: 138 GGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGGKGRGRGRGRGMGSGIGRGNGQNGDRG 197

Query: 259 --------------------------GSGNG 273
                                     G G+G
Sbjct: 198 INSGGRGKIKGSNGGSRNVIGGGNKGGGGDG 228

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 53/151 (35%), Positives = 56/151 (37%), Gaps = 64/151 (42%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 92  GGGGGGGGGGGGGGGGG------GGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145

Query: 193 GGG------------------GGAGG---------------------------------- 216
           GG                   GG GG                                  
Sbjct: 146 GGNGGDDGDNGDDGEDGDGDAGGRGGKGRGRGRGRGMGSGIGRGNGQNGDRGINSGGRGK 205

Query: 217 ------------GSGHGGGFGAGGGVGSGNG 273
                       G G+ GG G GG   + +G
Sbjct: 206 IKGSNGGSRNVIGGGNKGGGGDGGSDNAQSG 236

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 41/88 (46%), Positives = 45/88 (51%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGG--GSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           G G G   G   G  GD  + +GG G   GSNGGS +  G G   GGG GG      G G
Sbjct: 179 GRGMGSGIGRGNGQNGDRGINSGGRGKIKGSNGGSRNVIGGGNKGGGGDGGSDNAQSGDG 238

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG   +GGG G G   GAGGG G G G
Sbjct: 239 GGGWESSGGGGGRGDVSGAGGGGGGGGG 266

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 37/83 (44%), Positives = 40/83 (48%), Gaps = 4/83 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGG----GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGG 183
           G G     G  +GG G +    GG     GGG+ GG G GG      G G GG    GGG
Sbjct: 189 GNGQNGDRGINSGGRGKIKGSNGGSRNVIGGGNKGGGGDGGSDNAQSGDGGGGWESSGGG 248

Query: 184 GGGGGGGGAGGGSGHGGGFGAGG 252
           GG G   GAGGG G GGG  A G
Sbjct: 249 GGRGDVSGAGGGGGGGGGDDANG 271

[112][TOP]
>UniRef100_A2YLR2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2YLR2_ORYSI
          Length = 342

 Score =  112 bits (280), Expect = 1e-23
 Identities = 60/105 (57%), Positives = 62/105 (59%), Gaps = 18/105 (17%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVG-------- 168
           GGGG G   G L GG G  +   GG GGG+ GG G GGGFGGG GGG GG G        
Sbjct: 62  GGGGLGGGGGGLGGGHGGGFGEGGGLGGGAGGGVGGGGGFGGGGGGGLGGGGGGGFGGGA 121

Query: 169 ----------GGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
                     GGGGG GGGGGGG GG  GHGGGFGAGGGVG G G
Sbjct: 122 GAGGGAGGGLGGGGGFGGGGGGGLGGSGGHGGGFGAGGGVGGGAG 166

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/86 (63%), Positives = 56/86 (65%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           G G G   G   GGGG      GGGGGG+ GG GHG GFGGG G G G  GG GGGGG G
Sbjct: 245 GAGVGSGAGGGVGGGGGF----GGGGGGALGG-GHGSGFGGGAGVGGGAGGGVGGGGGFG 299

Query: 196 GGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGG G G GHGGGFGAG GVG G G
Sbjct: 300 GGGGGGLGGGHGGGFGAGAGVGGGAG 325

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/93 (60%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = +1

Query: 13  GGGGDGYSYG----FLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGG 180
           GG G+G  +G    F  GGGG L    GG GGG  GG G GGG GGG GGG GG GG GG
Sbjct: 44  GGFGEGEGFGGGGGFGGGGGGGLGGGGGGLGGGHGGGFGEGGGLGGGAGGGVGGGGGFGG 103

Query: 181 GGGG--GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGG  GGGGG G G G G G GAGGG+G G G
Sbjct: 104 GGGGGLGGGGGGGFGGGAGAGGGAGGGLGGGGG 136

 Score =  104 bits (260), Expect = 3e-21
 Identities = 55/89 (61%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGG--GG 186
           GGG  G   G L GGGG  +    G GGG+ GG G GGGFGGG GGG GG GG GG  G 
Sbjct: 98  GGGFGGGGGGGLGGGGGGGFGGGAGAGGGAGGGLGGGGGFGGGGGGGLGGSGGHGGGFGA 157

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGGAGGG G GGGFG GGG  S  G
Sbjct: 158 GGGVGGGAGGGVGGGGGFGGGGGGASVAG 186

 Score =  102 bits (254), Expect = 1e-20
 Identities = 55/86 (63%), Positives = 57/86 (66%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGG G   GF  GGGG L    GG G G  GG+G GGG GGGVGGG G  GGGGGG GGG
Sbjct: 253 GGGVGGGGGFGGGGGGAL---GGGHGSGFGGGAGVGGGAGGGVGGGGGFGGGGGGGLGGG 309

Query: 196 GGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG G G+G GG  GAGGGVG G G
Sbjct: 310 HGGGFGAGAGVGG--GAGGGVGGGGG 333

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 52/86 (60%), Positives = 54/86 (62%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGGDG   G L GG G  +    G G G+ GG G GGGFGGG GG  GG  G G GGG G
Sbjct: 227 GGGDG---GGLGGGHGGGFGAGAGVGSGAGGGVGGGGGFGGGGGGALGGGHGSGFGGGAG 283

Query: 196 GGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGAGGG G GGGFG GGG G G G
Sbjct: 284 VGGGAGGGVGGGGGFGGGGGGGLGGG 309

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 52/88 (59%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGG--GG 189
           GGG G   GF  GGG       GGGGG   GG G GGG GGG G G G  GG GGG  GG
Sbjct: 43  GGGFGEGEGFGGGGGFG----GGGGGGLGGGGGGLGGGHGGGFGEGGGLGGGAGGGVGGG 98

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGG GGG G GGG G GGG G+G G
Sbjct: 99  GGFGGGGGGGLGGGGGGGFGGGAGAGGG 126

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 63/143 (44%), Positives = 64/143 (44%), Gaps = 56/143 (39%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG-----GGGSNGGSGHGGGFG--GGVGGGAGG--- 162
           GGGG G+  G  AGGG    L  GGG     GGG  G  GHGGGFG  GGVGGGAGG   
Sbjct: 111 GGGGGGFGGGAGAGGGAGGGLGGGGGFGGGGGGGLGGSGGHGGGFGAGGGVGGGAGGGVG 170

Query: 163 ------VGGGG-----------------------------GGGGG-----------GGGG 204
                  GGGG                             G GGG           GGG 
Sbjct: 171 GGGGFGGGGGGASVAGMAAALAVVLVAEAAGLVVAKGGGFGAGGGAAAGIAGGVGFGGGD 230

Query: 205 GAGGGSGHGGGFGAGGGVGSGNG 273
           G G G GHGGGFGAG GVGSG G
Sbjct: 231 GGGLGGGHGGGFGAGAGVGSGAG 253

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 48/82 (58%), Positives = 50/82 (60%), Gaps = 4/82 (4%)
 Frame = +1

Query: 40  GFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGG- 216
           GF AGGG    +  G G GG +GG G GGG GGG G GAG   G GGG GGGGG G GG 
Sbjct: 209 GFGAGGGAAAGIAGGVGFGGGDGG-GLGGGHGGGFGAGAGVGSGAGGGVGGGGGFGGGGG 267

Query: 217 ---GSGHGGGFGAGGGVGSGNG 273
              G GHG GFG G GVG G G
Sbjct: 268 GALGGGHGSGFGGGAGVGGGAG 289

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/92 (54%), Positives = 53/92 (57%), Gaps = 5/92 (5%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           G  G G  +G   GGG        G G G  GG G GGG GGG+GGG GG+GGG GGG G
Sbjct: 30  GPFGHGCKFGRCHGGGF-------GEGEGFGGGGGFGGGGGGGLGGGGGGLGGGHGGGFG 82

Query: 193 -----GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
                GG  GAGGG G GGGFG GGG G G G
Sbjct: 83  EGGGLGG--GAGGGVGGGGGFGGGGGGGLGGG 112

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 52/108 (48%), Positives = 54/108 (50%), Gaps = 22/108 (20%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGG-------------------DLYL*TGGG---GGGSNGGSGHGGG 129
           GGG G   GF  GGGG                    L +  GGG   GGG+  G   G G
Sbjct: 166 GGGVGGGGGFGGGGGGASVAGMAAALAVVLVAEAAGLVVAKGGGFGAGGGAAAGIAGGVG 225

Query: 130 FGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           FGGG GGG GG  GGG G G G G GAGGG G GGGFG GGG   G G
Sbjct: 226 FGGGDGGGLGGGHGGGFGAGAGVGSGAGGGVGGGGGFGGGGGGALGGG 273

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 47/76 (61%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGG-GSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG G  +G  AG GG      GGGGG G  GG G GGG GGG G GAG VGGG GGG G
Sbjct: 271 GGGHGSGFGGGAGVGGGAGGGVGGGGGFGGGGGGGLGGGHGGGFGAGAG-VGGGAGGGVG 329

Query: 193 GGGGGAGGGSGHGGGF 240
           GGGG  GGG   GGGF
Sbjct: 330 GGGGFGGGG---GGGF 342

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 58/140 (41%), Positives = 60/140 (42%), Gaps = 54/140 (38%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDL---------YL*TGGGGGGSNGGSGHGGGFGGGVGG------ 150
           GGG G   GF  GGGG L         +   GG GGG+ GG G GGGFGGG GG      
Sbjct: 128 GGGLGGGGGFGGGGGGGLGGSGGHGGGFGAGGGVGGGAGGGVGGGGGFGGGGGGASVAGM 187

Query: 151 -----------------------GAGG-----------VGGGGGGG-----GGGGGGGAG 213
                                  GAGG            GGG GGG     GGG G GAG
Sbjct: 188 AAALAVVLVAEAAGLVVAKGGGFGAGGGAAAGIAGGVGFGGGDGGGLGGGHGGGFGAGAG 247

Query: 214 GGSGHGGGFGAGGGVGSGNG 273
            GSG GGG G GGG G G G
Sbjct: 248 VGSGAGGGVGGGGGFGGGGG 267

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 44/67 (65%), Positives = 44/67 (65%), Gaps = 5/67 (7%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGG--VGGGAGG-VGGGGG- 180
           GG G G   G   GGGG      GGGGGG  GG GHGGGFG G  VGGGAGG VGGGGG 
Sbjct: 280 GGAGVGGGAGGGVGGGGGF----GGGGGGGLGG-GHGGGFGAGAGVGGGAGGGVGGGGGF 334

Query: 181 -GGGGGG 198
            GGGGGG
Sbjct: 335 GGGGGGG 341

[113][TOP]
>UniRef100_B7QMH8 H/ACA ribonucleoprotein complex protein, putative (Fragment) n=1
           Tax=Ixodes scapularis RepID=B7QMH8_IXOSC
          Length = 121

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/87 (64%), Positives = 56/87 (64%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG         GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 50  GGGG---------GGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GGG G GGG G G G
Sbjct: 95  GGGGGGGGGGGGGGGGGGGGGGGGGGG 121

 Score =  111 bits (277), Expect = 3e-23
 Identities = 52/76 (68%), Positives = 53/76 (69%)
 Frame = +1

Query: 46  LAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSG 225
           + GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G
Sbjct: 48  MPGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101

Query: 226 HGGGFGAGGGVGSGNG 273
            GGG G GGG G G G
Sbjct: 102 GGGGGGGGGGGGGGGG 117

[114][TOP]
>UniRef100_Q4A2S6 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S6_EHV86
          Length = 430

 Score =  112 bits (280), Expect = 1e-23
 Identities = 50/89 (56%), Positives = 53/89 (59%), Gaps = 3/89 (3%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPP-PPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
           P P PPP   PPP P PPP PPPP  P P PPPPP+P  PPP+PPP+PP  P PP  P  
Sbjct: 148 PPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPPSQ 207

Query: 89  PPPVYKYKSPPP--PAKKPYEYPSPPPPV 9
           PPP     SPPP  P   P   P  PPPV
Sbjct: 208 PPPFSPPPSPPPFSPPPSPPSQPPQPPPV 236

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/101 (54%), Positives = 62/101 (61%), Gaps = 14/101 (13%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPP----PCPEPPPAP--PPPPPPPPP---PPPPTPPAPPP--TPPPNP 126
           P P P+PPP P PP    P P PPP+P  PPP PPP P   PPPP PP+ PP  +PPP+P
Sbjct: 158 PPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPSP 217

Query: 125 PPC---PDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP    P PP +PP PPPV    S PPP+  P   PS PPP
Sbjct: 218 PPFSPPPSPPSQPPQPPPVLP-PSSPPPSPVPSAPPSAPPP 257

 Score =  105 bits (261), Expect = 2e-21
 Identities = 47/95 (49%), Positives = 56/95 (58%), Gaps = 8/95 (8%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPP------PNPPPCPDPP 105
           P P+P P+P PPP P  P   PPPP PPPP PPP  P+PPP PP      P+PPP P P 
Sbjct: 126 PSPSPVPSPPPPPSPFAPEPSPPPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPY 185

Query: 104 LEPPPPPPVYKYKSPP--PPAKKPYEYPSPPPPVY 6
           + PP PPP    + PP  PP++ P   P P PP +
Sbjct: 186 MPPPSPPPHPPNQPPPPYPPSQPPPFSPPPSPPPF 220

 Score =  104 bits (259), Expect = 3e-21
 Identities = 47/89 (52%), Positives = 50/89 (56%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAP----PPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
           P   PP  P P P P PPP P    P P PPPP PPPPTPP P P+PPP PPP   P   
Sbjct: 118 PPNVPPSIPSPSPVPSPPPPPSPFAPEPSPPPPMPPPPTPPPPSPSPPPLPPPPWSPDPS 177

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPPP  Y     PPP+  P+    PPPP
Sbjct: 178 PPPPPSPYM----PPPSPPPHPPNQPPPP 202

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 49/104 (47%), Positives = 52/104 (50%), Gaps = 17/104 (16%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPP----------PPPPPPPTP-PAPPPTPPPNP 126
           P P   PPP   PP  P PPP+PPPP PP          P PPPP TP P+PPP  PP  
Sbjct: 34  PPPSNPPPPLSPPPSLPPPPPSPPPPSPPSLPPWWPNVSPSPPPPTTPSPSPPPPMPPRS 93

Query: 125 PPCPDPPLEPPPP------PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP P PP   PPP      PP     + PP    P   PSPPPP
Sbjct: 94  PPSPSPPSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVPSPPPP 137

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 49/91 (53%), Positives = 53/91 (58%), Gaps = 6/91 (6%)
 Frame = -2

Query: 266 PLPTPPPAPKP-PPCPEPPPAPPPPPPPPPPPPPPTPPA-PPPTPPPN-PPPCPDP---P 105
           P P PP  P P PP P PP +PP P PP P PPP  PP+ PPP+ PPN PP  P P   P
Sbjct: 73  PSPPPPTTPSPSPPPPMPPRSPPSPSPPSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVP 132

Query: 104 LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPPP P     SPPPP   P   P+PPPP
Sbjct: 133 SPPPPPSPFAPEPSPPPPMPPP---PTPPPP 160

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 52/124 (41%), Positives = 56/124 (45%), Gaps = 37/124 (29%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP-PAPPP-------------------------PPPPPPP-- 177
           P P P PP  P+ PP P PP P+PPP                         P PPPPP  
Sbjct: 81  PSPSPPPPMPPRSPPSPSPPSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVPSPPPPPSP 140

Query: 176 ------PPPPTPPAP-PPTPPPNPPPCPDPPL--EPPPPPPVYKYKSPPPPAKKPYEYPS 24
                 PPPP PP P PP P P+PPP P PP   +P PPPP   Y  PP P   P   P 
Sbjct: 141 FAPEPSPPPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPP 200

Query: 23  PPPP 12
           PP P
Sbjct: 201 PPYP 204

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 46/90 (51%), Positives = 48/90 (53%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PF-PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           PF P P+PPP   PP  P  PP PPP  PP  PPP P P APP  PPP  PP    P  P
Sbjct: 210 PFSPPPSPPPFSPPPSPPSQPPQPPPVLPPSSPPPSPVPSAPPSAPPPTQPPPSPVPSTP 269

Query: 95  PPPPPVYKYKSPPPPAKKP--YEYPSPPPP 12
           P P PV    SP PP + P    YP  PPP
Sbjct: 270 PSPQPVSPPPSPEPPLQPPPNVPYPYAPPP 299

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 48/99 (48%), Positives = 55/99 (55%), Gaps = 12/99 (12%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPP------PPPPTPP-----APPPTPPPNP 126
           P P  TP P+P PP  P  PP+P PP P PPP      PPP  PP      P P+P P+P
Sbjct: 75  PPPPTTPSPSPPPPMPPRSPPSPSPPSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVPSP 134

Query: 125 PPCPDP-PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP P P   EP PPPP+    +PPPP+  P   P PPPP
Sbjct: 135 PPPPSPFAPEPSPPPPMPPPPTPPPPSPSP--PPLPPPP 171

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 48/112 (42%), Positives = 53/112 (47%), Gaps = 24/112 (21%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP-------------PAPPPPPPPPPPPPPPTPPAPPPTP-- 138
           P PL  PP  P PPP P PP             P+PPPP  P P PPPP PP  PP+P  
Sbjct: 40  PPPLSPPPSLPPPPPSPPPPSPPSLPPWWPNVSPSPPPPTTPSPSPPPPMPPRSPPSPSP 99

Query: 137 ---------PPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
                    PP+ PP  +PP  PP  P      SPPPP       PSPPPP+
Sbjct: 100 PSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVPSPPPPPSPFAPEPSPPPPM 151

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 44/88 (50%), Positives = 49/88 (55%), Gaps = 4/88 (4%)
 Frame = -2

Query: 266 PLPTPPP-APKPPPCPEPPPAPPPPPPPPPPP---PPPTPPAPPPTPPPNPPPCPDPPLE 99
           P P+PPP  P  PP P PP  PPP  PPP PP   PPP+PP+ PP PPP  PP   PP  
Sbjct: 187 PPPSPPPHPPNQPPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPPQPPPVLPPSSPPPSP 246

Query: 98  PPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            P  PP     + PPP+  P   PSP P
Sbjct: 247 VPSAPPSAPPPTQPPPSPVPSTPPSPQP 274

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 47/100 (47%), Positives = 52/100 (52%), Gaps = 13/100 (13%)
 Frame = -2

Query: 272 PFPLPTPPP-----APKPPPCPEPPPAPPP--PPPPPPPPPPPTPPAPP------PTPPP 132
           P   P+ PP     +P PP  P PP +PPP  PPPPP PPPP  P  PP      P+PPP
Sbjct: 18  PSSPPSHPPIWPHQSPPPPSNPPPPLSPPPSLPPPPPSPPPPSPPSLPPWWPNVSPSPPP 77

Query: 131 NPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              P P PP  PP PP      SPP P+  P   PS PPP
Sbjct: 78  PTTPSPSPP--PPMPPRSPPSPSPPSPSPPPSFPPSVPPP 115

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 46/95 (48%), Positives = 51/95 (53%), Gaps = 12/95 (12%)
 Frame = -2

Query: 272 PF-PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPP--PPPTPPAPPPTP-------PPNPP 123
           PF P P+PP  P  PP   PP +PPP P P  PP  PPPT P P P P       P +PP
Sbjct: 219 PFSPPPSPPSQPPQPPPVLPPSSPPPSPVPSAPPSAPPPTQPPPSPVPSTPPSPQPVSPP 278

Query: 122 PCPDPPLEPPPPPPVYKYKSPP--PPAKKPYEYPS 24
           P P+PPL+PPP  P Y Y  PP  PP     E  S
Sbjct: 279 PSPEPPLQPPPNVP-YPYAPPPGSPPTSPSVEEDS 312

[115][TOP]
>UniRef100_Q5VR46 Os01g0180000 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5VR46_ORYSJ
          Length = 520

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/100 (54%), Positives = 58/100 (58%), Gaps = 11/100 (11%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPT-------PPAPPPTPPPNP-PPC 117
           P P   PPP+P PP    PPP+PPPP PPPP PPPP        PP PPP P P P PPC
Sbjct: 389 PPPPSPPPPSPPPPSTSPPPPSPPPPSPPPPSPPPPAPIFHPPQPPPPPPPPAPQPHPPC 448

Query: 116 PDPPLEPPPPPP---VYKYKSPPPPAKKPYEYPSPPPPVY 6
           P+ P  PPPPPP        SPPPP   P  YP P PPV+
Sbjct: 449 PELPPPPPPPPPCGGATPALSPPPP---PPYYPGPWPPVH 485

 Score =  107 bits (267), Expect = 4e-22
 Identities = 50/90 (55%), Positives = 52/90 (57%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPP---PPPPPPTPPAPPPTPPPNPPPCPDPPL 102
           PF    PPP+P PPP P PP  PPP PPPP   PPPP P PP+PPP  PP P P   PP 
Sbjct: 374 PFVPALPPPSP-PPPSPPPPSPPPPSPPPPSTSPPPPSPPPPSPPPPSPPPPAPIFHPPQ 432

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPPPP      PP P   P   P PPPP
Sbjct: 433 PPPPPPPPAPQPHPPCPELPP---PPPPPP 459

 Score =  103 bits (257), Expect = 6e-21
 Identities = 53/111 (47%), Positives = 56/111 (50%), Gaps = 26/111 (23%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPP------PAPPPPPPPPPPPP-PPTPPAPPPTPPPNPPPCPDP 108
           P P+PPP   PPP P PP      P PPPPPPPP P P PP P  PPP PPP P     P
Sbjct: 407 PPPSPPPPSPPPPSPPPPAPIFHPPQPPPPPPPPAPQPHPPCPELPPPPPPPPPCGGATP 466

Query: 107 PLEPPPPPPVY----------KYKSPPPPAKKPYE---------YPSPPPP 12
            L PPPPPP Y           Y SPPPP  + +          Y SPPPP
Sbjct: 467 ALSPPPPPPYYPGPWPPVHGVPYGSPPPPPLQHHSSWPPIHSVPYGSPPPP 517

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 55/120 (45%), Positives = 58/120 (48%), Gaps = 34/120 (28%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP------PPPPPPPPTP-PAPP----PTPPPNP 126
           P P  T PP P PPP   PPP+PPPP P      PPPPPPPP P P PP    P PPP P
Sbjct: 399 PPPPSTSPPPPSPPPPSPPPPSPPPPAPIFHPPQPPPPPPPPAPQPHPPCPELPPPPPPP 458

Query: 125 PPC--PDPPLEPPPPPPVY--------------------KYKSPPPPAKK-PYEYPSPPP 15
           PPC    P L PPPPPP Y                    ++ S  PP    PY  P PPP
Sbjct: 459 PPCGGATPALSPPPPPPYYPGPWPPVHGVPYGSPPPPPLQHHSSWPPIHSVPYGSPPPPP 518

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 40/78 (51%), Positives = 44/78 (56%), Gaps = 6/78 (7%)
 Frame = -2

Query: 227 CPEPPPAPPPPPPPPPPPPPPTPPAPPP------TPPPNPPPCPDPPLEPPPPPPVYKYK 66
           C    PA PPP PPPP PPPP+PP P P       PPP+PPP   PP  PPPP P++   
Sbjct: 372 CKPFVPALPPPSPPPPSPPPPSPPPPSPPPPSTSPPPPSPPPPSPPPPSPPPPAPIFHPP 431

Query: 65  SPPPPAKKPYEYPSPPPP 12
            PPPP   P   P PP P
Sbjct: 432 QPPPPPPPPAPQPHPPCP 449

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 29/69 (42%), Positives = 33/69 (47%), Gaps = 9/69 (13%)
 Frame = -2

Query: 254 PPPAPKPPPC--------PEPPPAPPPPP-PPPPPPPPPTPPAPPPTPPPNPPPCPDPPL 102
           PPP P PPPC        P PPP   P P PP    P  +PP PP     + PP    P 
Sbjct: 452 PPPPPPPPPCGGATPALSPPPPPPYYPGPWPPVHGVPYGSPPPPPLQHHSSWPPIHSVPY 511

Query: 101 EPPPPPPVY 75
             PPPPP++
Sbjct: 512 GSPPPPPLH 520

[116][TOP]
>UniRef100_B9S5R2 Actin binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9S5R2_RICCO
          Length = 210

 Score =  112 bits (280), Expect = 1e-23
 Identities = 51/87 (58%), Positives = 54/87 (62%), Gaps = 7/87 (8%)
 Frame = -2

Query: 251 PPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPN-----PPPCPDPPL--EPP 93
           PP P PPP P PP  PPP PPPPPPPPPP+P  PPPT PP+     PPP P PP     P
Sbjct: 42  PPPPPPPPSPPPPSPPPPSPPPPPPPPPPSPSPPPPTSPPSSLLSPPPPSPPPPASSSSP 101

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PPPP      PPPP+  P   PSPPPP
Sbjct: 102 PPPP------PPPPSSPP---PSPPPP 119

 Score =  100 bits (250), Expect = 4e-20
 Identities = 45/87 (51%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP-PPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
           P P P+PPP   PPP P PPP PPPP P PPPP  PP+    PP P P PP     P  P
Sbjct: 45  PPPPPSPPPPSPPPPSPPPPPPPPPPSPSPPPPTSPPSSLLSPPPPSPPPPASSSSPPPP 104

Query: 95  PPPPPVYKYKSPPPPAKKPYEYPSPPP 15
           PPPPP     SPPPP    Y   + PP
Sbjct: 105 PPPPPSSPPPSPPPPPTPSYTSNTSPP 131

 Score =  100 bits (248), Expect = 7e-20
 Identities = 45/77 (58%), Positives = 48/77 (62%), Gaps = 7/77 (9%)
 Frame = -2

Query: 221 EPPPAPPPPPPPPPPPPPPTPPAPPPTPP--PNPPPCPDPP---LEPPP--PPPVYKYKS 63
           +PPP PPPP PPPP PPPP+PP PPP PP  P+PPP   PP   L PPP  PPP     S
Sbjct: 41  QPPPPPPPPSPPPPSPPPPSPPPPPPPPPPSPSPPPPTSPPSSLLSPPPPSPPPPASSSS 100

Query: 62  PPPPAKKPYEYPSPPPP 12
           PPPP   P   P P PP
Sbjct: 101 PPPPPPPPPSSPPPSPP 117

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 39/73 (53%), Positives = 42/73 (57%), Gaps = 14/73 (19%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPP-----PAPPPPPPP-----PPPPPPPTPPAPPPTPPPNPP 123
           P P P PPP+P PPP   PP     P PP PPPP     PPPPPPP P +PPP+PPP P 
Sbjct: 62  PPPPPPPPPSPSPPPPTSPPSSLLSPPPPSPPPPASSSSPPPPPPPPPSSPPPSPPPPPT 121

Query: 122 PC----PDPPLEP 96
           P       PPL P
Sbjct: 122 PSYTSNTSPPLRP 134

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 24/52 (46%), Positives = 29/52 (55%), Gaps = 4/52 (7%)
 Frame = -2

Query: 266 PLPTPPP----APKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPP 123
           P P+PPP    +  PPP P PP +PPP PPPPP P   +  +PP  P    P
Sbjct: 88  PPPSPPPPASSSSPPPPPPPPPSSPPPSPPPPPTPSYTSNTSPPLRPSLRGP 139

[117][TOP]
>UniRef100_B8ADK4 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8ADK4_ORYSI
          Length = 520

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/100 (54%), Positives = 58/100 (58%), Gaps = 11/100 (11%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPT-------PPAPPPTPPPNP-PPC 117
           P P   PPP+P PP    PPP+PPPP PPPP PPPP        PP PPP P P P PPC
Sbjct: 389 PPPPSPPPPSPPPPSTSPPPPSPPPPSPPPPSPPPPAPIFHPPQPPPPPPPPAPQPHPPC 448

Query: 116 PDPPLEPPPPPP---VYKYKSPPPPAKKPYEYPSPPPPVY 6
           P+ P  PPPPPP        SPPPP   P  YP P PPV+
Sbjct: 449 PELPPPPPPPPPCGGATPALSPPPP---PPYYPGPWPPVH 485

 Score =  107 bits (267), Expect = 4e-22
 Identities = 50/90 (55%), Positives = 52/90 (57%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPP---PPPPPPTPPAPPPTPPPNPPPCPDPPL 102
           PF    PPP+P PPP P PP  PPP PPPP   PPPP P PP+PPP  PP P P   PP 
Sbjct: 374 PFVPALPPPSP-PPPSPPPPSPPPPSPPPPSTSPPPPSPPPPSPPPPSPPPPAPIFHPPQ 432

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPPPP      PP P   P   P PPPP
Sbjct: 433 PPPPPPPPAPQPHPPCPELPP---PPPPPP 459

 Score =  103 bits (257), Expect = 6e-21
 Identities = 53/111 (47%), Positives = 56/111 (50%), Gaps = 26/111 (23%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPP------PAPPPPPPPPPPPP-PPTPPAPPPTPPPNPPPCPDP 108
           P P+PPP   PPP P PP      P PPPPPPPP P P PP P  PPP PPP P     P
Sbjct: 407 PPPSPPPPSPPPPSPPPPAPIFHPPQPPPPPPPPAPQPHPPCPELPPPPPPPPPCGGATP 466

Query: 107 PLEPPPPPPVY----------KYKSPPPPAKKPYE---------YPSPPPP 12
            L PPPPPP Y           Y SPPPP  + +          Y SPPPP
Sbjct: 467 ALSPPPPPPYYPGPWPPVHGVPYGSPPPPPLQHHSSWPPIHSVPYGSPPPP 517

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 55/120 (45%), Positives = 58/120 (48%), Gaps = 34/120 (28%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPP------PPPPPPPPTP-PAPP----PTPPPNP 126
           P P  T PP P PPP   PPP+PPPP P      PPPPPPPP P P PP    P PPP P
Sbjct: 399 PPPPSTSPPPPSPPPPSPPPPSPPPPAPIFHPPQPPPPPPPPAPQPHPPCPELPPPPPPP 458

Query: 125 PPC--PDPPLEPPPPPPVY--------------------KYKSPPPPAKK-PYEYPSPPP 15
           PPC    P L PPPPPP Y                    ++ S  PP    PY  P PPP
Sbjct: 459 PPCGGATPALSPPPPPPYYPGPWPPVHGVPYGSPPPPPLQHHSSWPPIHSVPYGSPPPPP 518

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 40/78 (51%), Positives = 44/78 (56%), Gaps = 6/78 (7%)
 Frame = -2

Query: 227 CPEPPPAPPPPPPPPPPPPPPTPPAPPP------TPPPNPPPCPDPPLEPPPPPPVYKYK 66
           C    PA PPP PPPP PPPP+PP P P       PPP+PPP   PP  PPPP P++   
Sbjct: 372 CKPFVPALPPPSPPPPSPPPPSPPPPSPPPPSTSPPPPSPPPPSPPPPSPPPPAPIFHPP 431

Query: 65  SPPPPAKKPYEYPSPPPP 12
            PPPP   P   P PP P
Sbjct: 432 QPPPPPPPPAPQPHPPCP 449

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 29/69 (42%), Positives = 33/69 (47%), Gaps = 9/69 (13%)
 Frame = -2

Query: 254 PPPAPKPPPC--------PEPPPAPPPPP-PPPPPPPPPTPPAPPPTPPPNPPPCPDPPL 102
           PPP P PPPC        P PPP   P P PP    P  +PP PP     + PP    P 
Sbjct: 452 PPPPPPPPPCGGATPALSPPPPPPYYPGPWPPVHGVPYGSPPPPPLQHHSSWPPIHSVPY 511

Query: 101 EPPPPPPVY 75
             PPPPP++
Sbjct: 512 GSPPPPPLH 520

[118][TOP]
>UniRef100_A3AH89 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A3AH89_ORYSJ
          Length = 590

 Score =  112 bits (279), Expect = 2e-23
 Identities = 58/93 (62%), Positives = 63/93 (67%), Gaps = 5/93 (5%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGG---GSNGGSGHGGGFGGGVGGGAGGVGGGGG 180
           +GG G G   G  AGGGG L   TGGGGG   G+ GG G GGG GGG+GGGAG  GG GG
Sbjct: 265 SGGAGGGLGGGAGAGGGGGLGGGTGGGGGLGGGTGGGGGLGGGAGGGLGGGAGSCGGLGG 324

Query: 181 GGGGGGGGGAGGGSGHGGGF--GAGGGVGSGNG 273
           G G GGGGG GGG+G GGG   GAGGG+G G G
Sbjct: 325 GAGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAG 357

 Score =  110 bits (275), Expect = 5e-23
 Identities = 58/90 (64%), Positives = 62/90 (68%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GGGG G   G  AGGGG L    GGG GGG+ GG G  GG GGG+GGGAG  GGGG GGG
Sbjct: 228 GGGGAGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGLSGGAGGGLGGGAGAGGGGGLGGG 287

Query: 190 GGGGGGAGGGSGHGGGF--GAGGGVGSGNG 273
            GGGGG GGG+G GGG   GAGGG+G G G
Sbjct: 288 TGGGGGLGGGTGGGGGLGGGAGGGLGGGAG 317

 Score =  107 bits (268), Expect = 3e-22
 Identities = 58/92 (63%), Positives = 62/92 (67%), Gaps = 6/92 (6%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG-----GVGGGGG 180
           GGG G   G  AGGGG L    GG GGG  GG+G GGG GGG+GGGAG     G GGGGG
Sbjct: 147 GGGAGGGLGGGAGGGGGL---GGGAGGGLGGGAGGGGGVGGGLGGGAGGGLGSGAGGGGG 203

Query: 181 -GGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG GGGGG GGG+G G G GAGGG G+G G
Sbjct: 204 LGGGAGGGGGLGGGAGGGLGGGAGGGGGAGGG 235

 Score =  107 bits (267), Expect = 4e-22
 Identities = 57/90 (63%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           T GGG G+  G   GGGG L    GG GGG  GG GHGGG GGG GGG GG  GGGGG G
Sbjct: 35  TLGGGGGFGGGGGFGGGGGLGG-GGGAGGGFGGGLGHGGGLGGGFGGGKGGGLGGGGGLG 93

Query: 190 GGG--GGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG  GGG GGG GHGGG G G G G G G
Sbjct: 94  GGGGAGGGFGGGLGHGGGLGGGFGGGKGGG 123

 Score =  107 bits (267), Expect = 4e-22
 Identities = 56/90 (62%), Positives = 59/90 (65%), Gaps = 4/90 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVG-GGAGGVGGGGGGGGG 192
           GGG G   G  AGGGG L    GG GGG  GG+G GGG GGG G GG GG+GGG GGGGG
Sbjct: 369 GGGGGLGGG--AGGGGGL---GGGAGGGLGGGAGAGGGLGGGAGAGGGGGLGGGAGGGGG 423

Query: 193 ---GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
              G GGG GGG+G GGGFG G G G G G
Sbjct: 424 LGGGAGGGLGGGAGAGGGFGGGAGAGGGGG 453

 Score =  107 bits (266), Expect = 5e-22
 Identities = 54/86 (62%), Positives = 57/86 (66%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGG G   G  AGGGG L    GG GGG  GG+G GGGFGGG G G GG  GGG GGGGG
Sbjct: 409 GGGGGLGGG--AGGGGGL---GGGAGGGLGGGAGAGGGFGGGAGAGGGGGLGGGAGGGGG 463

Query: 196 GGGGAGGGSGHGGGFGAGGGVGSGNG 273
             GGAGGG+  GGGFG G G G+G G
Sbjct: 464 LDGGAGGGAEAGGGFGGGAGAGTGGG 489

 Score =  107 bits (266), Expect = 5e-22
 Identities = 54/89 (60%), Positives = 57/89 (64%), Gaps = 3/89 (3%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGG---GSNGGSGHGGGFGGGVGGGAGGVGGGGGGG 186
           G G G+  G  AGGGG L    GGGGG   G+ GG+  GGGFGGG G G GG GG GGG 
Sbjct: 437 GAGGGFGGGAGAGGGGGLGGGAGGGGGLDGGAGGGAEAGGGFGGGAGAGTGGGGGLGGGA 496

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG G G G G GGG GAGGG G G G
Sbjct: 497 GGGGGLGGGAGGGLGGGAGAGGGFGGGKG 525

 Score =  106 bits (264), Expect = 9e-22
 Identities = 56/88 (63%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TG-GGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GGGG G   G  AGGG    L +G GGGGG  GG+G GGG GGG GGG GG  GGGGG G
Sbjct: 178 GGGGVGGGLGGGAGGG----LGSGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGAG 233

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGGAGGG G GGG G G G G+G G
Sbjct: 234 GGLGGGAGGGGGLGGGAGGGLGGGAGGG 261

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/88 (65%), Positives = 61/88 (69%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGG G   G   GGGG L    GGGGG  +GG G GGG GGG+GGGAGG GG GGG GGG
Sbjct: 113 GGGFGGGKGGGLGGGGGLGGGAGGGGGLGSGG-GLGGGAGGGLGGGAGGGGGLGGGAGGG 171

Query: 196 GGGGAGGGSGHGGGF--GAGGGVGSGNG 273
            GGGAGGG G GGG   GAGGG+GSG G
Sbjct: 172 LGGGAGGGGGVGGGLGGGAGGGLGSGAG 199

 Score =  105 bits (262), Expect = 2e-21
 Identities = 56/91 (61%), Positives = 59/91 (64%), Gaps = 5/91 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGG---GSNGGSGHGGGFGGGVGGGAGGVGGGGGGG 186
           GGG G   G  AGGGG L    GGGGG   G+ GG G G G GGG GGG GG  GGGGG 
Sbjct: 187 GGGAGGGLGSGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGAGGGLGGGAGGGGGL 246

Query: 187 GGGGGGGAGGGSGHGGGF--GAGGGVGSGNG 273
           GGG GGG GGG+G GGG   GAGGG+G G G
Sbjct: 247 GGGAGGGLGGGAGGGGGLSGGAGGGLGGGAG 277

 Score =  105 bits (262), Expect = 2e-21
 Identities = 52/86 (60%), Positives = 54/86 (62%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGG G   G  AGGGG       G GGG  GG+G GGG GGG GGG GG  GGGGG  GG
Sbjct: 215 GGGAGGGLGGGAGGGG-------GAGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGLSGG 267

Query: 196 GGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG GGG+G GGG G GGG G G G
Sbjct: 268 AGGGLGGGAGAGGGGGLGGGTGGGGG 293

 Score =  105 bits (261), Expect = 2e-21
 Identities = 55/90 (61%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVG-GGAGGVGGGGGGGGG 192
           GGG G   G  AGGGG L    GG GGG  GG+G GGG GGG G GG GG+GGG GGGGG
Sbjct: 329 GGGGGLGGG--AGGGGGL---GGGAGGGLGGGAGAGGGLGGGAGAGGGGGLGGGAGGGGG 383

Query: 193 ---GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
              G GGG GGG+G GGG G G G G G G
Sbjct: 384 LGGGAGGGLGGGAGAGGGLGGGAGAGGGGG 413

 Score =  104 bits (260), Expect = 3e-21
 Identities = 57/88 (64%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GGG  G   G L GGGG   L  GGG GGG  GG GHGGG GGG GGG GG  GGGGG G
Sbjct: 75  GGGFGGGKGGGLGGGGG---LGGGGGAGGGFGGGLGHGGGLGGGFGGGKGGGLGGGGGLG 131

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGG G GSG G G GAGGG+G G G
Sbjct: 132 GGAGGGGGLGSGGGLGGGAGGGLGGGAG 159

 Score =  104 bits (259), Expect = 3e-21
 Identities = 56/90 (62%), Positives = 60/90 (66%), Gaps = 2/90 (2%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +G GG G   G  AGGGG L    GG GGG  GG+G GGG GGG+GGGAGG GG GGG G
Sbjct: 196 SGAGGGG-GLGGGAGGGGGL---GGGAGGGLGGGAGGGGGAGGGLGGGAGGGGGLGGGAG 251

Query: 190 GGGGGGAGGGSGHGGGFGA--GGGVGSGNG 273
           GG GGGAGGG G  GG G   GGG G+G G
Sbjct: 252 GGLGGGAGGGGGLSGGAGGGLGGGAGAGGG 281

 Score =  103 bits (258), Expect = 5e-21
 Identities = 57/91 (62%), Positives = 60/91 (65%), Gaps = 4/91 (4%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGG---VGGGGGG 183
           GGGG   S G L GG G      GG GGG+ GG G GGG GGG+GGGAGG   VGGG GG
Sbjct: 135 GGGGGLGSGGGLGGGAG------GGLGGGAGGGGGLGGGAGGGLGGGAGGGGGVGGGLGG 188

Query: 184 GGGGG-GGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGG G GAGGG G GGG G GGG+G G G
Sbjct: 189 GAGGGLGSGAGGGGGLGGGAGGGGGLGGGAG 219

 Score =  103 bits (258), Expect = 5e-21
 Identities = 55/91 (60%), Positives = 58/91 (63%), Gaps = 5/91 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGG---GSNGGSGHGGGFGGGVGGGAGGVGGGGG-- 180
           GGG G   G   G GG L    GGGGG   G+ GG G GGG GGG+GGGAGG GG GG  
Sbjct: 177 GGGGGVGGGLGGGAGGGLGSGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGAGGGL 236

Query: 181 GGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGGGG GGG+G G G GAGGG G   G
Sbjct: 237 GGGAGGGGGLGGGAGGGLGGGAGGGGGLSGG 267

 Score =  103 bits (258), Expect = 5e-21
 Identities = 54/89 (60%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GG G G   G  AG GG      GG GGG+ GG G GGG GGG+GGGAG  GG GGG G 
Sbjct: 354 GGAGAGGGLGGGAGAGGG-----GGLGGGAGGGGGLGGGAGGGLGGGAGAGGGLGGGAGA 408

Query: 193 GGGGGAGGGSGHGGGF--GAGGGVGSGNG 273
           GGGGG GGG+G GGG   GAGGG+G G G
Sbjct: 409 GGGGGLGGGAGGGGGLGGGAGGGLGGGAG 437

 Score =  103 bits (256), Expect = 8e-21
 Identities = 56/88 (63%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GG G G   G  AGGGG L   +GGG GGG+ GG G G G GGG+GGGAGG  GGG GGG
Sbjct: 122 GGLGGGGGLGGGAGGGGGLG--SGGGLGGGAGGGLGGGAGGGGGLGGGAGGGLGGGAGGG 179

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGG GGG+G G G GAGGG G G G
Sbjct: 180 GGVGGGLGGGAGGGLGSGAGGGGGLGGG 207

 Score =  103 bits (256), Expect = 8e-21
 Identities = 57/94 (60%), Positives = 61/94 (64%), Gaps = 7/94 (7%)
 Frame = +1

Query: 13  GGGGD--GYSYGFLAGGGGDLYL*TGGGGG---GSNGGSGHGGGFGGGVGGGAGGVGGGG 177
           GG G   G   G  AGGGG L    GGGGG   G+ GG G G G GGG+GGGAG  GGGG
Sbjct: 314 GGAGSCGGLGGGAGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGGLGGGAGAGGGGG 373

Query: 178 GGGGGGGGGGAGGGSGH--GGGFGAGGGVGSGNG 273
            GGG GGGGG GGG+G   GGG GAGGG+G G G
Sbjct: 374 LGGGAGGGGGLGGGAGGGLGGGAGAGGGLGGGAG 407

 Score =  102 bits (254), Expect = 1e-20
 Identities = 54/89 (60%), Positives = 58/89 (65%), Gaps = 3/89 (3%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG G   G   G GG      GGG GGG+ GG G GGG GGG+GGGAG  GG GGG G 
Sbjct: 309 GGGLGGGAGSCGGLGGGAGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGGLGGGAGA 368

Query: 193 GGGGGAGGGSGHGGGF--GAGGGVGSGNG 273
           GGGGG GGG+G GGG   GAGGG+G G G
Sbjct: 369 GGGGGLGGGAGGGGGLGGGAGGGLGGGAG 397

 Score =  102 bits (254), Expect = 1e-20
 Identities = 54/88 (61%), Positives = 57/88 (64%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           TGGGG     G  AGGGG L    GG GGG  GG+G GGGFGGG GGG GG  GG  G G
Sbjct: 486 TGGGG---GLGGGAGGGGGL---GGGAGGGLGGGAGAGGGFGGGKGGGFGGGLGGSSGSG 539

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG GAGGG+G G G G GGG G+G G
Sbjct: 540 FGGGFGAGGGAGGGAGAGFGGGAGAGGG 567

 Score =  102 bits (253), Expect = 2e-20
 Identities = 54/88 (61%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG-GVGGGGGGGGG 192
           G G G   GF  G GG L     GGGGG  GG G GGGFGGG+G G G G G GGG GGG
Sbjct: 69  GHGGGLGGGFGGGKGGGL-----GGGGGLGGGGGAGGGFGGGLGHGGGLGGGFGGGKGGG 123

Query: 193 -GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGGG GGG+G GGG G+GGG+G G G
Sbjct: 124 LGGGGGLGGGAGGGGGLGSGGGLGGGAG 151

 Score =  102 bits (253), Expect = 2e-20
 Identities = 54/88 (61%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGG-G 189
           GGG G   G  AGGGG +    GGG GGG   G+G GGG GGG GGG GG+GGG GGG G
Sbjct: 165 GGGAGGGLGGGAGGGGGVGGGLGGGAGGGLGSGAGGGGGLGGGAGGG-GGLGGGAGGGLG 223

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGG G G G GGG G GGG+G G G
Sbjct: 224 GGAGGGGGAGGGLGGGAGGGGGLGGGAG 251

 Score =  101 bits (252), Expect = 2e-20
 Identities = 55/92 (59%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = +1

Query: 10  TGGGGD--GYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGA-GGVGGGGG 180
           TGGGG   G + G L GG G      GG G G  GG G G G GGG+GGGA GG+GGG G
Sbjct: 298 TGGGGGLGGGAGGGLGGGAGSCGGLGGGAGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAG 357

Query: 181 GGGG-GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG GGG GAGGG G GGG G GGG+G G G
Sbjct: 358 AGGGLGGGAGAGGGGGLGGGAGGGGGLGGGAG 389

 Score =  101 bits (251), Expect = 3e-20
 Identities = 54/88 (61%), Positives = 57/88 (64%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGG-VGGGGGGGGG 192
           GGG G   G  AG GG L    GG G G  GG G G G GGG+GGGAGG +GGG G GGG
Sbjct: 345 GGGAGGGLGGGAGAGGGL---GGGAGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGG 401

Query: 193 -GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG GAGGG G GGG G GGG+G G G
Sbjct: 402 LGGGAGAGGGGGLGGGAGGGGGLGGGAG 429

 Score =  100 bits (250), Expect = 4e-20
 Identities = 54/90 (60%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TG-GGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG G   G   G GG L    G GGGGG  GG+G GGG GGG GGG GG+GGG GGG G
Sbjct: 255 GGGAGGGGGLSGGAGGGLGGGAGAGGGGGLGGGTGGGGGLGGGTGGG-GGLGGGAGGGLG 313

Query: 193 GGG---GGAGGGSGHGGGFGAGGGVGSGNG 273
           GG    GG GGG+G GGG G GGG G G G
Sbjct: 314 GGAGSCGGLGGGAGAGGGGGLGGGAGGGGG 343

 Score =  100 bits (249), Expect = 5e-20
 Identities = 55/89 (61%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG-GVGGGGGGGG 189
           GGGG G  +G   G GG L    GG GGG  GG G GGG GGG GGG G G GGG GGG 
Sbjct: 94  GGGGAGGGFGGGLGHGGGL---GGGFGGGKGGGLGGGGGLGGGAGGGGGLGSGGGLGGGA 150

Query: 190 GGG-GGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGGAGGG G GGG G G G G+G G
Sbjct: 151 GGGLGGGAGGGGGLGGGAGGGLGGGAGGG 179

 Score =  100 bits (249), Expect = 5e-20
 Identities = 57/91 (62%), Positives = 59/91 (64%), Gaps = 4/91 (4%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GG G G   G   GGG       GGG GGG+ GG G GGG GGG+GGGAG  GGG GGG 
Sbjct: 466 GGAGGGAEAGGGFGGGAGAGTGGGGGLGGGAGGGGGLGGGAGGGLGGGAGA-GGGFGGGK 524

Query: 190 GGG-GGGAGG--GSGHGGGFGAGGGVGSGNG 273
           GGG GGG GG  GSG GGGFGAGGG G G G
Sbjct: 525 GGGFGGGLGGSSGSGFGGGFGAGGGAGGGAG 555

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 54/91 (59%), Positives = 58/91 (63%), Gaps = 5/91 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGG--FGGGVGGGAGGVGGGGGGG- 186
           GGG G   G  AGGGG L   +GG GGG  GG+G GGG   GGG GGG GG+GGG GGG 
Sbjct: 247 GGGAGGGLGGGAGGGGGL---SGGAGGGLGGGAGAGGGGGLGGGTGGG-GGLGGGTGGGG 302

Query: 187 --GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
             GGG GGG GGG+G  GG G G G G G G
Sbjct: 303 GLGGGAGGGLGGGAGSCGGLGGGAGAGGGGG 333

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 53/88 (60%), Positives = 56/88 (63%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGA-GGVGGGGGGGGG 192
           GGG G   G  AG GG L    GG G G  GG G G G GGG+GGGA GG+GGG G GGG
Sbjct: 385 GGGAGGGLGGGAGAGGGL---GGGAGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGG 441

Query: 193 -GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG GAGGG G GGG G GGG+  G G
Sbjct: 442 FGGGAGAGGGGGLGGGAGGGGGLDGGAG 469

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 56/91 (61%), Positives = 59/91 (64%), Gaps = 5/91 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVG--GGGGGG 186
           GGG G   G  AGGG    L  GGG GGG  GG G G G GGG+GGGAGG G  G GGG 
Sbjct: 87  GGGGGLGGGGGAGGGFGGGLGHGGGLGGGFGGGKGGGLGGGGGLGGGAGGGGGLGSGGGL 146

Query: 187 GGGGGGGAGGGSGHGGGF--GAGGGVGSGNG 273
           GGG GGG GGG+G GGG   GAGGG+G G G
Sbjct: 147 GGGAGGGLGGGAGGGGGLGGGAGGGLGGGAG 177

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 55/95 (57%), Positives = 57/95 (60%), Gaps = 9/95 (9%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TG-GGGGGSNGGSGHGGGFGGGVGGGA---GGVGGGGGG 183
           GGG G   G  AG GG      G GGGGG  GG+G GGG  GG GGGA   GG GGG G 
Sbjct: 425 GGGAGGGLGGGAGAGGGFGGGAGAGGGGGLGGGAGGGGGLDGGAGGGAEAGGGFGGGAGA 484

Query: 184 GGGGG---GGGAGGGSGHGGGFGA--GGGVGSGNG 273
           G GGG   GGGAGGG G GGG G   GGG G+G G
Sbjct: 485 GTGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGG 519

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/84 (61%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGGAGGVGGGGGGGG 189
           GGG G   GF  G GG       GGG G + GSG GGGFG  GG GGGAG   GGG G G
Sbjct: 511 GGGAGAGGGFGGGKGGGF-----GGGLGGSSGSGFGGGFGAGGGAGGGAGAGFGGGAGAG 565

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVG 261
           GGGG GAGGG   GGGFG GGGVG
Sbjct: 566 GGGGLGAGGGG--GGGFGGGGGVG 587

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 42/71 (59%), Positives = 43/71 (60%), Gaps = 3/71 (4%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVG-GGAGGVGGGGGGG 186
           GG G G   GF  G GG      GGG G G   G G G GFGGG G GG GG+G GGGGG
Sbjct: 518 GGFGGGKGGGFGGGLGGSSGSGFGGGFGAGGGAGGGAGAGFGGGAGAGGGGGLGAGGGGG 577

Query: 187 GG-GGGGGAGG 216
           GG GGGGG GG
Sbjct: 578 GGFGGGGGVGG 588

[119][TOP]
>UniRef100_B4NYZ4 GE18300 n=1 Tax=Drosophila yakuba RepID=B4NYZ4_DROYA
          Length = 688

 Score =  112 bits (279), Expect = 2e-23
 Identities = 44/65 (67%), Positives = 46/65 (70%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P PTPPP P P P P+PPP PPP P PPPPPPPP PPAP P+PP  PP  P PP  PP
Sbjct: 208 PAPAPTPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPPAPKPSPPTPPPTTPPPPTAPP 267

Query: 92  PPPPV 78
           PPP V
Sbjct: 268 PPPSV 272

 Score =  110 bits (274), Expect = 6e-23
 Identities = 49/87 (56%), Positives = 50/87 (57%)
 Frame = -2

Query: 269 FPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
           FP   PPP P P P P PPP PPP P P PPPPPP  P PPP PPP PPP P P   PP 
Sbjct: 197 FPFVPPPPPPPPAPAPTPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPPAPKP--SPPT 254

Query: 89  PPPVYKYKSPPPPAKKPYEYPSPPPPV 9
           PPP     +PPPP       P PPP V
Sbjct: 255 PPPT----TPPPPTA-----PPPPPSV 272

 Score =  105 bits (263), Expect = 1e-21
 Identities = 45/76 (59%), Positives = 46/76 (60%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P P PPPAP P P P PPPAP P PPPPPPP P  PP PPP PPP P P P  P    PP
Sbjct: 202 PPPPPPPAPAPTPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPPAPKPSPPTPPPTTPP 261

Query: 86  PPVYKYKSPPPPAKKP 39
           PP     +PPPP   P
Sbjct: 262 PPT----APPPPPSVP 273

 Score =  102 bits (255), Expect = 1e-20
 Identities = 52/97 (53%), Positives = 54/97 (55%), Gaps = 11/97 (11%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPP---PTPPAPPPTPPPNPPPCPDPPL 102
           P P P PPPAPKP P P PPP P PPPPPPPPPPP   P+PP PPPT PP PP  P PP 
Sbjct: 212 PTPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPPAPKPSPPTPPPTTPP-PPTAPPPPP 270

Query: 101 EPPPP--------PPVYKYKSPPPPAKKPYEYPSPPP 15
             P P        PP   + SPP     P  YP   P
Sbjct: 271 SVPIPSGQDSGIRPPQLGW-SPPYGPSNPGGYPPSLP 306

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 41/73 (56%), Positives = 41/73 (56%)
 Frame = -2

Query: 230 PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPP 51
           PC      P    P  PPPPPP PPAP PTPPP PPP P P   PPPPPP  K   PPPP
Sbjct: 185 PCDRCDGVPFEHFPFVPPPPPP-PPAPAPTPPPPPPPAPKPK-PPPPPPPKPKPPPPPPP 242

Query: 50  AKKPYEYPSPPPP 12
              P   PSPP P
Sbjct: 243 PPPPAPKPSPPTP 255

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 41/108 (37%), Positives = 45/108 (41%), Gaps = 34/108 (31%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPP------CPEPPPAPPPPPPPPPP--------PP-----PPTPPAP 150
           P P P PPPAPKP P       P PP APPPPP  P P        PP     PP  P+ 
Sbjct: 238 PPPPPPPPPAPKPSPPTPPPTTPPPPTAPPPPPSVPIPSGQDSGIRPPQLGWSPPYGPSN 297

Query: 149 PPTPPPN----------PPPCPDPPLEPPPP-----PPVYKYKSPPPP 51
           P   PP+          P P   PP    PP     PP+  +  PP P
Sbjct: 298 PGGYPPSLPGWITLPVAPNPGGHPPNSQMPPSSGLNPPLPGWILPPAP 345

[120][TOP]
>UniRef100_UPI0000DA36CE PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA36CE
          Length = 136

 Score =  111 bits (278), Expect = 2e-23
 Identities = 55/85 (64%), Positives = 56/85 (65%)
 Frame = +1

Query: 19  GGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGG 198
           GGD     +  GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGG
Sbjct: 5   GGD-----WCCGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 53

Query: 199 GGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGG G GGG G GGG G G G
Sbjct: 54  GGGGGGGGGGGGGGGGGGGGGGGGG 78

 Score =  110 bits (276), Expect = 4e-23
 Identities = 54/82 (65%), Positives = 55/82 (67%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G       GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 12  GGGGGG------GGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 59

Query: 193 GGGGGAGGGSGHGGGFGAGGGV 258
           GGGGG GGG G GGG G GGG+
Sbjct: 60  GGGGGGGGGGGGGGGGGGGGGI 81

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/83 (66%), Positives = 55/83 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G       GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 11  GGGGGG-------GGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 57

Query: 193 GGGGGAGGGSGHGGGFGAGGGVG 261
           GGGGG GGG G GGG G GGG G
Sbjct: 58  GGGGGGGGGGGGGGGGGGGGGGG 80

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 30/44 (68%), Positives = 31/44 (70%)
 Frame = +1

Query: 142 VGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           + GG    GGGGGGGGGGGGGG GGG G GGG G GGG G G G
Sbjct: 3   IKGGDWCCGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 46

[121][TOP]
>UniRef100_B1JXE0 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia
           MC0-3 RepID=B1JXE0_BURCC
          Length = 505

 Score =  111 bits (278), Expect = 2e-23
 Identities = 55/87 (63%), Positives = 55/87 (63%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   G GG      GGGGGG  GG G GGG GG  G G GG GGGGGGGGG
Sbjct: 329 GGGGGGGGGGGGNGNGG------GGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGG 382

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G  GG G GGG G GNG
Sbjct: 383 GGGGGGGGGGGGNGGNGGGGGGGHGNG 409

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/90 (61%), Positives = 58/90 (64%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLY---L*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGG 183
           GGGG G   G   GGGG         GGGG G+ GG G+GGG GGG GGG  G GGGGGG
Sbjct: 290 GGGGHGSGGGHGDGGGGHGNGGGHGNGGGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGG 349

Query: 184 GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGGG GGG+G  GG G GGG G G G
Sbjct: 350 GGGGGGGGGGGGAGGNGGNGGGGGGGGGGG 379

 Score =  108 bits (271), Expect = 1e-22
 Identities = 54/87 (62%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GG G+G   G   GGGG+     GGGGGG  GG G GGG G G  GG GG GGGGGGGGG
Sbjct: 324 GGPGNGGGGGGGGGGGGNG---NGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGG 380

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG GGG G GG  G GGG G G+G
Sbjct: 381 GGGGGGGGGGGGGGNGGNGGGGGGGHG 407

 Score =  108 bits (270), Expect = 2e-22
 Identities = 55/87 (63%), Positives = 57/87 (65%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG+     G GGG  NGG G GGG GGG G G GG GGGGGG GG
Sbjct: 303 GGGGHGNGGGHGNGGGGN-----GNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGGGG-GG 356

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGAGG  G+GGG G GGG G G G
Sbjct: 357 GGGGGAGGNGGNGGGGGGGGGGGGGGG 383

 Score =  105 bits (262), Expect = 2e-21
 Identities = 55/92 (59%), Positives = 56/92 (60%), Gaps = 7/92 (7%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGG--- 183
           GGGG G   G   GGGG      GGGG G NGG+G GGG GGG GGG GG GGGGGG   
Sbjct: 335 GGGGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGGGGGG 394

Query: 184 ----GGGGGGGGAGGGSGHGGGFGAGGGVGSG 267
               GGGGGGG   GG GHG G G G G GSG
Sbjct: 395 NGGNGGGGGGGHGNGGGGHGNGGGNGNGNGSG 426

 Score =  103 bits (258), Expect = 5e-21
 Identities = 53/88 (60%), Positives = 55/88 (62%), Gaps = 1/88 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      G GGGG  GG G GGG GGG GGG GG  GG GGGGG
Sbjct: 344 GGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGGGGGGNGGNGGGGG 403

Query: 193 GGGGGAGGGSGHGGGFGAGGGV-GSGNG 273
           GG G  GGG G+GGG G G G  G+GNG
Sbjct: 404 GGHGNGGGGHGNGGGNGNGNGSGGAGNG 431

 Score =  103 bits (258), Expect = 5e-21
 Identities = 54/94 (57%), Positives = 57/94 (60%), Gaps = 7/94 (7%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   G GG      GGGGGG  GG G GGG GGG GGG GG GGGGGGG G
Sbjct: 354 GGGGGGGGAGGNGGNGG------GGGGGGGGGGGGGGGGGGGGGGGGNGGNGGGGGGGHG 407

Query: 193 GGGGGAGGGSGHGGGFGAGG-------GVGSGNG 273
            GGGG G G G+G G G+GG       GVG+G G
Sbjct: 408 NGGGGHGNGGGNGNGNGSGGAGNGGANGVGNGRG 441

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 51/90 (56%), Positives = 52/90 (57%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGG---GGG 183
           G GG G   G   GGGG      G GGG  +GG GHG G G G GGG  G GGG   GGG
Sbjct: 277 GSGGHGSGGGHGDGGGGH-----GSGGGHGDGGGGHGNGGGHGNGGGGNGNGGGPGNGGG 331

Query: 184 GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGGG  G  G GGG G GGG G G G
Sbjct: 332 GGGGGGGGGNGNGGGGGGGGGGGGGGGGGG 361

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 53/88 (60%), Positives = 55/88 (62%), Gaps = 1/88 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGG-GAGGVGGGGGGGG 189
           GG GDG       GG GD     GGGG G+ GG G+GGG  G  GG G GG GGGGGGGG
Sbjct: 285 GGHGDGGGGHGSGGGHGD-----GGGGHGNGGGHGNGGGGNGNGGGPGNGGGGGGGGGGG 339

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G G GG GGG G GGG G GGG G GNG
Sbjct: 340 GNGNGGGGGGGGGGGGGGGGGGAG-GNG 366

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 48/86 (55%), Positives = 50/86 (58%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG  G  G+GGG GGG G G GG G GGG G G
Sbjct: 369 GGGGGGGGGGGGGGGGG------GGGGGGGGGNGGNGGGGGGGHGNGGGGHGNGGGNGNG 422

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGN 270
            G GGAG G  +G G G G G  SGN
Sbjct: 423 NGSGGAGNGGANGVGNGRGNGGNSGN 448

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 53/100 (53%), Positives = 56/100 (56%), Gaps = 13/100 (13%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGG---GGG 183
           GG GDG       GG GD     G GGG  +GG GHG G G G GGG  G GGG   GGG
Sbjct: 259 GGHGDGSGGHGNGGGHGDGSGGHGSGGGHGDGGGGHGSGGGHGDGGGGHGNGGGHGNGGG 318

Query: 184 G----------GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G          GGGGGGG GGG+G+GGG G GGG G G G
Sbjct: 319 GNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGGGGGGGG 358

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 48/87 (55%), Positives = 51/87 (58%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGGG      GGGGGG NGG+G GGG G G GGG  G GGG G G G
Sbjct: 371 GGGGGGGGGGGGGGGGG------GGGGGGGNGGNGGGGGGGHGNGGGGHGNGGGNGNGNG 424

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GG G GG +G G G G GG  G+  G
Sbjct: 425 SGGAGNGGANGVGNGRGNGGNSGNAGG 451

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 51/105 (48%), Positives = 56/105 (53%), Gaps = 18/105 (17%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVG-------- 168
           GGGG G   G   GGGG  +   GGGG G+ GG+G+G G GG   GGA GVG        
Sbjct: 387 GGGGGGGGNGGNGGGGGGGHG-NGGGGHGNGGGNGNGNGSGGAGNGGANGVGNGRGNGGN 445

Query: 169 ----------GGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
                     GGGG G GGG GGA G  GHG G G G G G+GNG
Sbjct: 446 SGNAGGSNGNGGGGAGNGGGSGGANGTGGHGNGGGNGNGHGTGNG 490

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 51/93 (54%), Positives = 54/93 (58%), Gaps = 5/93 (5%)
 Frame = +1

Query: 10  TGGG--GDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGG 183
           +GGG  G G S G  +GGGG      GGGG G  GG G+GGG G G GG   G G G G 
Sbjct: 224 SGGGTSGGGTSGGGTSGGGGH-----GGGGDGDGGGHGNGGGHGDGSGGHGNGGGHGDGS 278

Query: 184 GGGGGGGG---AGGGSGHGGGFGAGGGVGSGNG 273
           GG G GGG    GGG G GGG G GGG G GNG
Sbjct: 279 GGHGSGGGHGDGGGGHGSGGGHGDGGG-GHGNG 310

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 49/93 (52%), Positives = 52/93 (55%), Gaps = 5/93 (5%)
 Frame = +1

Query: 10  TGGG--GDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGG 183
           +GGG  G G S G  +GGG      T GGGG   GG G GGG G G G G G  G G GG
Sbjct: 219 SGGGTSGGGTSGGGTSGGG------TSGGGGHGGGGDGDGGGHGNGGGHGDGSGGHGNGG 272

Query: 184 GGGGGGGGAGGGSGH---GGGFGAGGGVGSGNG 273
           G G G GG G G GH   GGG G+GGG G G G
Sbjct: 273 GHGDGSGGHGSGGGHGDGGGGHGSGGGHGDGGG 305

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 52/98 (53%), Positives = 53/98 (54%), Gaps = 11/98 (11%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGG-GDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGG----- 174
           GGGGDG   G   GGG GD     G GGG  +G  GHG G G G GGG  G GGG     
Sbjct: 245 GGGGDGDGGGHGNGGGHGDGSGGHGNGGGHGDGSGGHGSGGGHGDGGGGHGSGGGHGDGG 304

Query: 175 ----GGGGGGGGGGGAGGGSGHG-GGFGAGGGVGSGNG 273
                GGG G GGGG G G G G GG G GGG G GNG
Sbjct: 305 GGHGNGGGHGNGGGGNGNGGGPGNGGGGGGGGGGGGNG 342

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 52/94 (55%), Positives = 57/94 (60%), Gaps = 6/94 (6%)
 Frame = +1

Query: 10  TGGG--GDGYSYGFLAGGGGDLYL*TGGG--GGGSNGGSGHGGGFGGG--VGGGAGGVGG 171
           TGGG  G G S G  +GGG      +GGG  GGG++GG   GGG  GG   GGG  G G 
Sbjct: 179 TGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGT 238

Query: 172 GGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGG GGGG G GGG G+GGG G G G G GNG
Sbjct: 239 SGGGGHGGGGDGDGGGHGNGGGHGDGSG-GHGNG 271

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 50/94 (53%), Positives = 55/94 (58%), Gaps = 6/94 (6%)
 Frame = +1

Query: 10  TGGG--GDGYSYGFLAGGGGDLYL*TGGG---GGGSNGGSGHGGGFGGGVGGGAGGVGGG 174
           +GGG  G G S G  +GGG      +GGG   GG S GG+  GGG GGG  G  GG G G
Sbjct: 199 SGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHGNG 258

Query: 175 GGGGGGGGGGGAGGGSGHG-GGFGAGGGVGSGNG 273
           GG G G GG G GGG G G GG G+GGG G G G
Sbjct: 259 GGHGDGSGGHGNGGGHGDGSGGHGSGGGHGDGGG 292

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 52/98 (53%), Positives = 58/98 (59%), Gaps = 10/98 (10%)
 Frame = +1

Query: 10  TGGG--GDGYSYGFLAGGGGDLYL*TGGG--GGGSNGGSGHGGGFGGG--VGGGAGGVGG 171
           +GGG  G G S G  +GGG      +GGG  GGG++GG   GGG  GG   GGG  G G 
Sbjct: 174 SGGGTTGGGTSGGGTSGGGT-----SGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGT 228

Query: 172 GGGG--GGG--GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG  GGG  GGGG  GGG G GGG G GGG G G+G
Sbjct: 229 SGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGGHGDGSG 266

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 52/96 (54%), Positives = 58/96 (60%), Gaps = 8/96 (8%)
 Frame = +1

Query: 10  TGGG--GDGYSYGFLAGGGGDLYL*TGGG--GGGSNGGSGHGGGFGGG--VGGGAGGVGG 171
           +GGG  G G S G  +GGG      +GGG  GGG++GG   GGG  GG   GGG  G GG
Sbjct: 184 SGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGG 243

Query: 172 GGGGGGGGGGG-GAGGGSGHG-GGFGAGGGVGSGNG 273
            GGGG G GGG G GGG G G GG G GGG G G+G
Sbjct: 244 HGGGGDGDGGGHGNGGGHGDGSGGHGNGGGHGDGSG 279

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 52/98 (53%), Positives = 58/98 (59%), Gaps = 10/98 (10%)
 Frame = +1

Query: 10  TGGG--GDGYSYGFLAGGGGDLYL*TGGG--GGGSNGGSGHGGGFGGGVGGGAGGVGGGG 177
           +GGG  G G S G  +GGG      +GGG  GGG++GG   GGG  GG   G GG GGGG
Sbjct: 189 SGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGGG 248

Query: 178 GGGGG--GGGGGAG---GGSGHGGGFGAG-GGVGSGNG 273
            G GG  G GGG G   GG G+GGG G G GG GSG G
Sbjct: 249 DGDGGGHGNGGGHGDGSGGHGNGGGHGDGSGGHGSGGG 286

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 50/125 (40%), Positives = 53/125 (42%), Gaps = 38/125 (30%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVG-------- 168
           GGGG G   G   GGGG+     GGGGG  NGG GHG G G G G G+GG G        
Sbjct: 378 GGGGGGGGGGGGGGGGGNGGNGGGGGGGHGNGGGGHGNGGGNGNGNGSGGAGNGGANGVG 437

Query: 169 ------------------GGGGGGGGGGGGGA------------GGGSGHGGGFGAGGGV 258
                             GGGG G GGG GGA            G G G G G G G G 
Sbjct: 438 NGRGNGGNSGNAGGSNGNGGGGAGNGGGSGGANGTGGHGNGGGNGNGHGTGNGNGGGHGN 497

Query: 259 GSGNG 273
           G  +G
Sbjct: 498 GGSSG 502

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 52/106 (49%), Positives = 56/106 (52%), Gaps = 18/106 (16%)
 Frame = +1

Query: 10  TGGG--GDGYSYGFLAGGGGDLYL*TGGG--GGGSNGGSGHGGGFGGG--VGGGAGGVGG 171
           +GGG  G G S G  +GGG      TGGG  GGG++GG   GGG  GG   GGG  G G 
Sbjct: 154 SGGGTSGGGTSGGGTSGGGTSGGGTTGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGT 213

Query: 172 GGGG------------GGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG            GGG  GGG  GG GHGGG G G G G GNG
Sbjct: 214 SGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGG-GDGDGGGHGNG 258

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 44/90 (48%), Positives = 52/90 (57%), Gaps = 4/90 (4%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNG---GSGHGGGFGGGVGGGAGGVGG-GGG 180
           GG G+G   G  AG GG   +  G G GG++G   GS   GG G G GGG+GG  G GG 
Sbjct: 417 GGNGNGNGSGG-AGNGGANGVGNGRGNGGNSGNAGGSNGNGGGGAGNGGGSGGANGTGGH 475

Query: 181 GGGGGGGGGAGGGSGHGGGFGAGGGVGSGN 270
           G GGG G G G G+G+GGG G GG  G  +
Sbjct: 476 GNGGGNGNGHGTGNGNGGGHGNGGSSGGNH 505

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 42/89 (47%), Positives = 48/89 (53%), Gaps = 3/89 (3%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGG-GDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GG  G + G  +G G G      GG GGG++GG   GGG  GG   G G  GGG  GGG 
Sbjct: 124 GGATGGTSGSTSGTGRGGNASGNGGSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTTGGGT 183

Query: 193 GGGGGAGGGSGHGG--GFGAGGGVGSGNG 273
            GGG +GGG+  GG  G G  GG  SG G
Sbjct: 184 SGGGTSGGGTSGGGTSGGGTSGGGTSGGG 212

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 43/92 (46%), Positives = 48/92 (52%), Gaps = 4/92 (4%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGG--GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGG 183
           T G   G   G  A G G     +GGG  GGG++GG   GGG  GG   G G  GGG  G
Sbjct: 130 TSGSTSGTGRGGNASGNGG----SGGGTSGGGTSGGGTSGGGTSGGGTSGGGTTGGGTSG 185

Query: 184 GGGGGGGGAGGGSGHGG--GFGAGGGVGSGNG 273
           GG  GGG +GGG+  GG  G G  GG  SG G
Sbjct: 186 GGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGG 217

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 44/92 (47%), Positives = 50/92 (54%), Gaps = 4/92 (4%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGG--GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGG 183
           TG GG+    G    GGG     +GGG  GGG++GG   GGG  GG   G G  GGG  G
Sbjct: 137 TGRGGNASGNG--GSGGGT----SGGGTSGGGTSGGGTSGGGTSGGGTTGGGTSGGGTSG 190

Query: 184 GGGGGGGGAGGGSGHGG--GFGAGGGVGSGNG 273
           GG  GGG +GGG+  GG  G G  GG  SG G
Sbjct: 191 GGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGG 222

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 43/94 (45%), Positives = 48/94 (51%), Gaps = 7/94 (7%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGG-GSNGGSGHG----GGFGGGVGGGAGGVGGGG 177
           G GG G   G   GGG      TGGG G GS G +G+G     G GG  GG +G   G G
Sbjct: 85  GAGGSGNGNGNGNGGG------TGGGNGNGSGGNNGNGAVGPAGVGGATGGTSGSTSGTG 138

Query: 178 GGGGGGGGGGAGGGSGHGG--GFGAGGGVGSGNG 273
            GG   G GG+GGG+  GG  G G  GG  SG G
Sbjct: 139 RGGNASGNGGSGGGTSGGGTSGGGTSGGGTSGGG 172

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 37/74 (50%), Positives = 41/74 (55%)
 Frame = +1

Query: 52  GGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHG 231
           G GG      G GG G+  G+G+GGG GGG G G+GG  G G  G  G GG  GG SG  
Sbjct: 80  GNGG-----AGAGGSGNGNGNGNGGGTGGGNGNGSGGNNGNGAVGPAGVGGATGGTSGST 134

Query: 232 GGFGAGGGVGSGNG 273
            G G GG   SGNG
Sbjct: 135 SGTGRGGN-ASGNG 147

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 41/91 (45%), Positives = 45/91 (49%), Gaps = 7/91 (7%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNG---GSGHGGGFGG--GVGGGA--GGVGGG 174
           GGG+G   G   G G       GG  GG++G   G+G GG   G  G GGG   GG  GG
Sbjct: 102 GGGNGNGSGGNNGNGAVGPAGVGGATGGTSGSTSGTGRGGNASGNGGSGGGTSGGGTSGG 161

Query: 175 GGGGGGGGGGGAGGGSGHGGGFGAGGGVGSG 267
           G  GGG  GGG  GG   GGG   GG  G G
Sbjct: 162 GTSGGGTSGGGTSGGGTTGGGTSGGGTSGGG 192

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 32/63 (50%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +1

Query: 88  GGGGSNGGSGHGG-GFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGS 264
           G G  NGG+G GG G G G G G G  GG G G GG  G GA G +G GG  G   G  S
Sbjct: 76  GRGVGNGGAGAGGSGNGNGNGNGGGTGGGNGNGSGGNNGNGAVGPAGVGGATGGTSGSTS 135

Query: 265 GNG 273
           G G
Sbjct: 136 GTG 138

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 25/54 (46%), Positives = 28/54 (51%)
 Frame = +1

Query: 112 SGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           +G G G GG   GG+G   G G GGG GGG G G G  +G G     GVG   G
Sbjct: 75  AGRGVGNGGAGAGGSGNGNGNGNGGGTGGGNGNGSGGNNGNGAVGPAGVGGATG 128

[122][TOP]
>UniRef100_Q39337 Glycine-rich_protein_(Aa1-291) n=1 Tax=Brassica napus
           RepID=Q39337_BRANA
          Length = 291

 Score =  111 bits (278), Expect = 2e-23
 Identities = 57/97 (58%), Positives = 60/97 (61%), Gaps = 10/97 (10%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGV---------GGGAGGV 165
           GGG  G   G   GGGG      GG GGG  GG  HGGG+GGG          GGGAGG 
Sbjct: 153 GGGYGGGGAGGHGGGGG------GGNGGGGGGGGAHGGGYGGGEGAGAGGGYGGGGAGGH 206

Query: 166 GGGGGGG-GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGG GGGGGGG+G G  HGGG+GAGGG G G G
Sbjct: 207 GGGGGGGKGGGGGGGSGAGGAHGGGYGAGGGAGEGYG 243

 Score =  107 bits (267), Expect = 4e-22
 Identities = 54/96 (56%), Positives = 59/96 (61%), Gaps = 9/96 (9%)
 Frame = +1

Query: 13  GGGGDGYSYGFLA-------GGGGDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGGAGGV 165
           GGGG+G   G+         GGGG      GGGGGG  GGSG+GGG G  GG G G GG 
Sbjct: 60  GGGGEGGGAGYGGAEGIGGGGGGGHGGGAGGGGGGGPGGGSGYGGGSGEGGGAGYGGGGA 119

Query: 166 GGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGGGG GGGGG G G  HGGG+G G G G+G G
Sbjct: 120 GGHGGGGGSGGGGGGGAGGAHGGGYGGGEGAGAGGG 155

 Score =  100 bits (248), Expect = 7e-20
 Identities = 53/96 (55%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSG--HGGGFGGGVGGGAGGVGGGGGGGG 189
           GGG GY  G   G GG      GG GGG  GG+G  HGGG+GGG G GAGG  G GGGG 
Sbjct: 109 GGGAGYGGGGAGGHGGG-----GGSGGGGGGGAGGAHGGGYGGGEGAGAGG--GYGGGGA 161

Query: 190 GGGGGGAGGGSG--------HGGGFGAGGGVGSGNG 273
           GG GGG GGG+G        HGGG+G G G G+G G
Sbjct: 162 GGHGGGGGGGNGGGGGGGGAHGGGYGGGEGAGAGGG 197

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 50/88 (56%), Positives = 55/88 (62%), Gaps = 1/88 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TG-GGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GGGG G+  G   GGGG     +G GGG G  GG+G+GGG  GG GGG G  GGGGGG G
Sbjct: 78  GGGGGGHGGGAGGGGGGGPGGGSGYGGGSGEGGGAGYGGGGAGGHGGGGGSGGGGGGGAG 137

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G  GGG GGG G G G G GGG   G+G
Sbjct: 138 GAHGGGYGGGEGAGAGGGYGGGGAGGHG 165

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 48/87 (55%), Positives = 51/87 (58%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GG G+G   G+  GG G      GGGG G  GG G GG  GGG GGG G   GGG GGGG
Sbjct: 104 GGSGEGGGAGYGGGGAGGH---GGGGGSGGGGGGGAGGAHGGGYGGGEGAGAGGGYGGGG 160

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GG G GGG G+GGG G GG  G G G
Sbjct: 161 AGGHGGGGGGGNGGGGGGGGAHGGGYG 187

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 55/95 (57%), Positives = 58/95 (61%), Gaps = 8/95 (8%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGGAGGVGGGGGGG 186
           GG G G + G   GGGG      GGGGGGS  G  HGGG+G  GG G G GG GG GG G
Sbjct: 196 GGYGGGGAGGHGGGGGGGK---GGGGGGGSGAGGAHGGGYGAGGGAGEGYGGGGGEGGHG 252

Query: 187 GG-GGGGGAGGGSGHGGGF-----GAGGGVGSGNG 273
           GG GGGGGAGGG G GGG+     G GGG G G G
Sbjct: 253 GGGGGGGGAGGGGGGGGGYAAAGSGHGGGAGRGEG 287

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 49/87 (56%), Positives = 53/87 (60%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G + G   GGGG  +    GGG G+  G G+GGG  GG GGG GG  GGGGGGG 
Sbjct: 165 GGGGGGGNGG--GGGGGGAHGGGYGGGEGAGAGGGYGGGGAGGHGGGGGGGKGGGGGGGS 222

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GG  GGG G GGG G G G G G G
Sbjct: 223 GAGGAHGGGYGAGGGAGEGYGGGGGEG 249

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 48/87 (55%), Positives = 52/87 (59%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           G GG G S G   GG G  +    GGG G+  G G+GGG  GG GGG GG  GGGGGGGG
Sbjct: 121 GHGGGGGSGGGGGGGAGGAHGGGYGGGEGAGAGGGYGGGGAGGHGGGGGGGNGGGGGGGG 180

Query: 193 GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
             GGG GGG G G G G GGG   G+G
Sbjct: 181 AHGGGYGGGEGAGAGGGYGGGGAGGHG 207

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 52/90 (57%), Positives = 52/90 (57%), Gaps = 4/90 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGG-GGG-- 186
           GGG GY  G   GGG        G GGG  GG G GGG GGG GGGAGG  GGG GGG  
Sbjct: 97  GGGSGYGGGSGEGGGA-------GYGGGGAGGHGGGGGSGGGGGGGAGGAHGGGYGGGEG 149

Query: 187 -GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            G GGG G GG  GHGGG G G G G G G
Sbjct: 150 AGAGGGYGGGGAGGHGGGGGGGNGGGGGGG 179

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 49/93 (52%), Positives = 52/93 (55%), Gaps = 6/93 (6%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGG------G 174
           GGGG G ++G   GGG       G GGGG+ G  G GGG  GG GGG  G GG      G
Sbjct: 174 GGGGGGGAHGGGYGGGEGAGAGGGYGGGGAGGHGGGGGGGKGGGGGGGSGAGGAHGGGYG 233

Query: 175 GGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG G G GG GG  GHGGG G GGG G G G
Sbjct: 234 AGGGAGEGYGGGGGEGGHGGGGGGGGGAGGGGG 266

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/82 (58%), Positives = 51/82 (62%)
 Frame = +1

Query: 28  GYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGG 207
           GY  G  AG G        GGGGG  GG+G+GG  G G GGG    GG GGG GGGGGGG
Sbjct: 47  GYGIGVDAGVGV-------GGGGGEGGGAGYGGAEGIGGGGG----GGHGGGAGGGGGGG 95

Query: 208 AGGGSGHGGGFGAGGGVGSGNG 273
            GGGSG+GGG G GGG G G G
Sbjct: 96  PGGGSGYGGGSGEGGGAGYGGG 117

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/95 (54%), Positives = 53/95 (55%), Gaps = 9/95 (9%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGG-------GSNGGSGHGGGFGGGVGGGAGGVGG- 171
           G G G   G   GGGG      GGG G       G  GG GHGGG GGG GGG GG  G 
Sbjct: 47  GYGIGVDAGVGVGGGGG----EGGGAGYGGAEGIGGGGGGGHGGGAGGGGGGGPGGGSGY 102

Query: 172 GGGGGGGGGGG-GAGGGSGHGGGFGAGGGVGSGNG 273
           GGG G GGG G G GG  GHGGG G+GGG G G G
Sbjct: 103 GGGSGEGGGAGYGGGGAGGHGGGGGSGGGGGGGAG 137

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/98 (54%), Positives = 55/98 (56%), Gaps = 12/98 (12%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGG------GAGGVGGGG 177
           GGG+G   G   GGGG      GG GGG  GG G GGG G G GG      GAGG  G G
Sbjct: 187 GGGEGAGAGGGYGGGG-----AGGHGGGGGGGKGGGGGGGSGAGGAHGGGYGAGGGAGEG 241

Query: 178 GGGGGGG---GGGAGGGSGHGGGFGAGGG---VGSGNG 273
            GGGGG    GGG GGG G GGG G GGG    GSG+G
Sbjct: 242 YGGGGGEGGHGGGGGGGGGAGGGGGGGGGYAAAGSGHG 279

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 46/83 (55%), Positives = 46/83 (55%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G   G   GGG   Y   GG G G  GG G GG  GGG GGG  G      GGGG
Sbjct: 216 GGGGGGSGAGGAHGGG---YGAGGGAGEGYGGGGGEGGHGGGGGGGGGAG------GGGG 266

Query: 193 GGGGGAGGGSGHGGGFGAGGGVG 261
           GGGG A  GSGHGGG G G G G
Sbjct: 267 GGGGYAAAGSGHGGGAGRGEGGG 289

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 43/78 (55%), Positives = 45/78 (57%), Gaps = 4/78 (5%)
 Frame = +1

Query: 13  GGGGDG----YSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGG 180
           GGGG G    +  G+ AGGG       G GGGG  GG G GGG GGG GGG GG GGG  
Sbjct: 218 GGGGSGAGGAHGGGYGAGGGAG----EGYGGGGGEGGHGGGGGGGGGAGGGGGG-GGGYA 272

Query: 181 GGGGGGGGGAGGGSGHGG 234
             G G GGGAG G G GG
Sbjct: 273 AAGSGHGGGAGRGEGGGG 290

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 35/63 (55%), Positives = 38/63 (60%)
 Frame = +1

Query: 85  GGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGS 264
           G G  S+  +G+G G   GVG G GG  GGG G GG  G G GGG GHGGG G GGG G 
Sbjct: 37  GYGEKSSLHAGYGIGVDAGVGVGGGGGEGGGAGYGGAEGIGGGGGGGHGGGAGGGGGGGP 96

Query: 265 GNG 273
           G G
Sbjct: 97  GGG 99

[123][TOP]
>UniRef100_B7Q972 Secreted salivary gland peptide, putative (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q972_IXOSC
          Length = 117

 Score =  111 bits (278), Expect = 2e-23
 Identities = 55/82 (67%), Positives = 55/82 (67%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           TGGGG G       GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGG
Sbjct: 48  TGGGGGG------GGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95

Query: 190 GGGGGGAGGGSGHGGGFGAGGG 255
           GGGGGG GGG G GGG G GGG
Sbjct: 96  GGGGGGGGGGGGGGGGGGGGGG 117

 Score =  110 bits (276), Expect = 4e-23
 Identities = 51/69 (73%), Positives = 51/69 (73%)
 Frame = +1

Query: 67  LYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGA 246
           L L TGGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G GGG G 
Sbjct: 44  LKLATGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 247 GGGVGSGNG 273
           GGG G G G
Sbjct: 104 GGGGGGGGG 112

 Score =  110 bits (276), Expect = 4e-23
 Identities = 53/76 (69%), Positives = 53/76 (69%)
 Frame = +1

Query: 46  LAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSG 225
           LA GGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G
Sbjct: 46  LATGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99

Query: 226 HGGGFGAGGGVGSGNG 273
            GGG G GGG G G G
Sbjct: 100 GGGGGGGGGGGGGGGG 115

 Score =  110 bits (276), Expect = 4e-23
 Identities = 52/74 (70%), Positives = 52/74 (70%)
 Frame = +1

Query: 52  GGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHG 231
           GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G G
Sbjct: 49  GGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102

Query: 232 GGFGAGGGVGSGNG 273
           GG G GGG G G G
Sbjct: 103 GGGGGGGGGGGGGG 116

 Score =  110 bits (276), Expect = 4e-23
 Identities = 52/74 (70%), Positives = 52/74 (70%)
 Frame = +1

Query: 52  GGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHG 231
           GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G G
Sbjct: 50  GGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 232 GGFGAGGGVGSGNG 273
           GG G GGG G G G
Sbjct: 104 GGGGGGGGGGGGGG 117

[124][TOP]
>UniRef100_Q2L049 Filamentous hemagglutinin/adhesin n=1 Tax=Bordetella avium 197N
            RepID=Q2L049_BORA1
          Length = 2621

 Score =  111 bits (278), Expect = 2e-23
 Identities = 57/115 (49%), Positives = 62/115 (53%), Gaps = 30/115 (26%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCP-------EPPPAPPPP------PPPPPPPPPP-----TPPAPPPT 141
            P P PPP P PPP P       +PPP PPPP      PPPPPPPPPP      PP PPP 
Sbjct: 2319 PSPPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPP 2378

Query: 140  PPP-----NPPPCPDPP-------LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPP     +PPP P PP       ++PPPPPP      PPPP  K  + P PPPP
Sbjct: 2379 PPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPP------PPPPKVKKVDPPPPPPP 2427

 Score =  110 bits (276), Expect = 4e-23
 Identities = 60/119 (50%), Positives = 61/119 (51%), Gaps = 32/119 (26%)
 Frame = -2

Query: 272  PFPLPTPPPAPK-----PPPCPEPP------PAPPPPPPPP------PPPPPPTPPA--- 153
            P P P PPP PK     PPP P PP      P PPPPPPPP      PPPPPP PP    
Sbjct: 2325 PPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVK 2384

Query: 152  ---PPPTPPPNPPP---CPDPPLEPPPPPPVYKYKSPPPPAKKP------YEYPSPPPP 12
               PPP PPP PPP     DPP  PPPPPP  K   PPPP   P       + P PPPP
Sbjct: 2385 KVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPP 2443

 Score =  108 bits (270), Expect = 2e-22
 Identities = 59/119 (49%), Positives = 60/119 (50%), Gaps = 34/119 (28%)
 Frame = -2

Query: 266  PLPTPPPAPK-------PPPCPEPP------PAPPPPPPPPP------PPPPPTPPAP-- 150
            P P PPP PK       PPP P PP      P PPPPPPPPP      PPPPP PP P  
Sbjct: 2357 PPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKV 2416

Query: 149  ----PPTPPPNPPP-----CPDPPLEPPPPPPVYKYKSPPPPAKKPYEY----PSPPPP 12
                PP PPP PPP      P PP  PPPPP V K   PPPP   P +     P PPPP
Sbjct: 2417 KKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPP 2475

 Score =  108 bits (270), Expect = 2e-22
 Identities = 60/118 (50%), Positives = 60/118 (50%), Gaps = 28/118 (23%)
 Frame = -2

Query: 272  PFPLPTPPPAPK-------PPPCPEPP------PAPPPPPPPP------PPPPPPTPPAP 150
            P P P PPP PK       PPP P PP      P PPPPPPPP      PPPPPP PP P
Sbjct: 2388 PPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPP 2447

Query: 149  ------PPTPPPNPPP---CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
                  PP PPP PPP     DPP  PPPPPP  K   PPPP       P PPP V K
Sbjct: 2448 KVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP-------PPPPPKVKK 2498

 Score =  108 bits (269), Expect = 2e-22
 Identities = 58/118 (49%), Positives = 60/118 (50%), Gaps = 31/118 (26%)
 Frame = -2

Query: 272  PFPLPTP------PPAPKPPPCP-----EPPPAPPPPPP------PPPPPPPPTPPA--- 153
            P P P P      PP P PPP P     +PPP PPPPPP      PPPPPPPP PP    
Sbjct: 2343 PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKK 2402

Query: 152  --PPPTPPPNPPPCP--DPPLEPPPPPPVYKYKSPPPPAKKP-------YEYPSPPPP 12
              PPP PPP PP     DPP  PPPPPP  K   PPPP   P        + P PPPP
Sbjct: 2403 VDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPP 2460

 Score =  106 bits (265), Expect = 7e-22
 Identities = 54/110 (49%), Positives = 58/110 (52%), Gaps = 25/110 (22%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPP------PPPPPPPPTP------PAPPPTPPP--- 132
            P P PPP PK      PPP PPPPPP      PPPPPPPP P      P PPP PPP   
Sbjct: 2373 PPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKV 2432

Query: 131  ---NPPPCPDPP-------LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
               +PPP P PP       ++PPPPPP      PPPP  K  + P PPPP
Sbjct: 2433 KKVDPPPPPPPPPPPKVKKVDPPPPPP------PPPPKVKKVDPPPPPPP 2476

 Score =  103 bits (256), Expect = 8e-21
 Identities = 58/119 (48%), Positives = 58/119 (48%), Gaps = 35/119 (29%)
 Frame = -2

Query: 266  PLPTPPPAPK------PPPCPEPPPA------PPPPPPPPPP------PPPPTPPAPPPT 141
            P P PPP PK      PPP P PPP       PPPPPPPPPP      PPPP PP PP  
Sbjct: 2406 PPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKV 2465

Query: 140  ----PPPNPPPCP------DPPLEPPPPPPVYKYKSP-------PPPAKKPYEYPSPPP 15
                PPP PPP P      DPP  PPPPP V K   P       P PA KP   P P P
Sbjct: 2466 KKVDPPPPPPPPPPKVKKVDPPPPPPPPPKVKKVDPPPKDEVDGPKPAPKPKAQPRPSP 2524

 Score =  100 bits (249), Expect = 5e-20
 Identities = 50/96 (52%), Positives = 51/96 (53%), Gaps = 20/96 (20%)
 Frame = -2

Query: 239  KPPPCPEPPPAPPPPPPPPP------PPPPPTPPA-----PPPTPPPNPPPCP--DPPLE 99
            K  P P PPP PPPPPPPPP      PPPPP PP      PPP PPP PP     DPP  
Sbjct: 2316 KIDPSPPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP 2375

Query: 98   PPPPPPVYKYKSPPPPAKKP-------YEYPSPPPP 12
            PPPPPP  K   PPPP   P        + P PPPP
Sbjct: 2376 PPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPP 2411

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 34/76 (44%), Positives = 37/76 (48%), Gaps = 9/76 (11%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPP----PPPPPPPPTPPAPPPTPPP-----NPPPCP 114
            P P PPP PK      PPP PPPPP      PPPPPPP P      PPP      P P P
Sbjct: 2455 PPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPKVKKVDPPPKDEVDGPKPAP 2514

Query: 113  DPPLEPPPPPPVYKYK 66
             P  +P P P   +Y+
Sbjct: 2515 KPKAQPRPSPSTARYE 2530

[125][TOP]
>UniRef100_Q8GD27 Adhesin FhaB n=1 Tax=Bordetella avium RepID=Q8GD27_BORAV
          Length = 2621

 Score =  111 bits (278), Expect = 2e-23
 Identities = 57/115 (49%), Positives = 62/115 (53%), Gaps = 30/115 (26%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCP-------EPPPAPPPP------PPPPPPPPPP-----TPPAPPPT 141
            P P PPP P PPP P       +PPP PPPP      PPPPPPPPPP      PP PPP 
Sbjct: 2319 PSPPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPP 2378

Query: 140  PPP-----NPPPCPDPP-------LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPP     +PPP P PP       ++PPPPPP      PPPP  K  + P PPPP
Sbjct: 2379 PPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPP------PPPPKVKKVDPPPPPPP 2427

 Score =  110 bits (276), Expect = 4e-23
 Identities = 60/119 (50%), Positives = 61/119 (51%), Gaps = 32/119 (26%)
 Frame = -2

Query: 272  PFPLPTPPPAPK-----PPPCPEPP------PAPPPPPPPP------PPPPPPTPPA--- 153
            P P P PPP PK     PPP P PP      P PPPPPPPP      PPPPPP PP    
Sbjct: 2325 PPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVK 2384

Query: 152  ---PPPTPPPNPPP---CPDPPLEPPPPPPVYKYKSPPPPAKKP------YEYPSPPPP 12
               PPP PPP PPP     DPP  PPPPPP  K   PPPP   P       + P PPPP
Sbjct: 2385 KVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPP 2443

 Score =  108 bits (270), Expect = 2e-22
 Identities = 59/119 (49%), Positives = 60/119 (50%), Gaps = 34/119 (28%)
 Frame = -2

Query: 266  PLPTPPPAPK-------PPPCPEPP------PAPPPPPPPPP------PPPPPTPPAP-- 150
            P P PPP PK       PPP P PP      P PPPPPPPPP      PPPPP PP P  
Sbjct: 2357 PPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKV 2416

Query: 149  ----PPTPPPNPPP-----CPDPPLEPPPPPPVYKYKSPPPPAKKPYEY----PSPPPP 12
                PP PPP PPP      P PP  PPPPP V K   PPPP   P +     P PPPP
Sbjct: 2417 KKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPP 2475

 Score =  108 bits (270), Expect = 2e-22
 Identities = 60/118 (50%), Positives = 60/118 (50%), Gaps = 28/118 (23%)
 Frame = -2

Query: 272  PFPLPTPPPAPK-------PPPCPEPP------PAPPPPPPPP------PPPPPPTPPAP 150
            P P P PPP PK       PPP P PP      P PPPPPPPP      PPPPPP PP P
Sbjct: 2388 PPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPP 2447

Query: 149  ------PPTPPPNPPP---CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVYK 3
                  PP PPP PPP     DPP  PPPPPP  K   PPPP       P PPP V K
Sbjct: 2448 KVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP-------PPPPPKVKK 2498

 Score =  108 bits (269), Expect = 2e-22
 Identities = 58/118 (49%), Positives = 60/118 (50%), Gaps = 31/118 (26%)
 Frame = -2

Query: 272  PFPLPTP------PPAPKPPPCP-----EPPPAPPPPPP------PPPPPPPPTPPA--- 153
            P P P P      PP P PPP P     +PPP PPPPPP      PPPPPPPP PP    
Sbjct: 2343 PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKK 2402

Query: 152  --PPPTPPPNPPPCP--DPPLEPPPPPPVYKYKSPPPPAKKP-------YEYPSPPPP 12
              PPP PPP PP     DPP  PPPPPP  K   PPPP   P        + P PPPP
Sbjct: 2403 VDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPP 2460

 Score =  106 bits (265), Expect = 7e-22
 Identities = 54/110 (49%), Positives = 58/110 (52%), Gaps = 25/110 (22%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPP------PPPPPPPPTP------PAPPPTPPP--- 132
            P P PPP PK      PPP PPPPPP      PPPPPPPP P      P PPP PPP   
Sbjct: 2373 PPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKV 2432

Query: 131  ---NPPPCPDPP-------LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
               +PPP P PP       ++PPPPPP      PPPP  K  + P PPPP
Sbjct: 2433 KKVDPPPPPPPPPPPKVKKVDPPPPPP------PPPPKVKKVDPPPPPPP 2476

 Score =  103 bits (256), Expect = 8e-21
 Identities = 58/119 (48%), Positives = 58/119 (48%), Gaps = 35/119 (29%)
 Frame = -2

Query: 266  PLPTPPPAPK------PPPCPEPPPA------PPPPPPPPPP------PPPPTPPAPPPT 141
            P P PPP PK      PPP P PPP       PPPPPPPPPP      PPPP PP PP  
Sbjct: 2406 PPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKV 2465

Query: 140  ----PPPNPPPCP------DPPLEPPPPPPVYKYKSP-------PPPAKKPYEYPSPPP 15
                PPP PPP P      DPP  PPPPP V K   P       P PA KP   P P P
Sbjct: 2466 KKVDPPPPPPPPPPKVKKVDPPPPPPPPPKVKKVDPPPKDEVDGPKPAPKPKAQPRPSP 2524

 Score =  100 bits (249), Expect = 5e-20
 Identities = 50/96 (52%), Positives = 51/96 (53%), Gaps = 20/96 (20%)
 Frame = -2

Query: 239  KPPPCPEPPPAPPPPPPPPP------PPPPPTPPA-----PPPTPPPNPPPCP--DPPLE 99
            K  P P PPP PPPPPPPPP      PPPPP PP      PPP PPP PP     DPP  
Sbjct: 2316 KIDPSPPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP 2375

Query: 98   PPPPPPVYKYKSPPPPAKKP-------YEYPSPPPP 12
            PPPPPP  K   PPPP   P        + P PPPP
Sbjct: 2376 PPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPP 2411

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 34/76 (44%), Positives = 37/76 (48%), Gaps = 9/76 (11%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPP----PPPPPPPPTPPAPPPTPPP-----NPPPCP 114
            P P PPP PK      PPP PPPPP      PPPPPPP P      PPP      P P P
Sbjct: 2455 PPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPKVKKVDPPPKDEVDGPKPAP 2514

Query: 113  DPPLEPPPPPPVYKYK 66
             P  +P P P   +Y+
Sbjct: 2515 KPKAQPRPSPSTARYE 2530

[126][TOP]
>UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q7XRA9_ORYSJ
          Length = 171

 Score =  111 bits (278), Expect = 2e-23
 Identities = 42/54 (77%), Positives = 42/54 (77%)
 Frame = -2

Query: 242 PKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
           P PP CP PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP
Sbjct: 16  PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69

 Score =  105 bits (262), Expect = 2e-21
 Identities = 42/56 (75%), Positives = 42/56 (75%)
 Frame = -2

Query: 251 PPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPP 84
           PP P  PP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPP
Sbjct: 16  PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--PPPPP 69

 Score =  105 bits (262), Expect = 2e-21
 Identities = 42/60 (70%), Positives = 42/60 (70%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
           P PP  P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP       PPPPPP
Sbjct: 16  PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP-------PPPPPP 68

 Score =  105 bits (261), Expect = 2e-21
 Identities = 42/56 (75%), Positives = 42/56 (75%)
 Frame = -2

Query: 254 PPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           PPP   PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPP
Sbjct: 16  PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--PPPP 69

 Score =  100 bits (249), Expect = 5e-20
 Identities = 39/53 (73%), Positives = 39/53 (73%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP 108
           P P  PP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P P
Sbjct: 17  PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69

 Score =  100 bits (248), Expect = 7e-20
 Identities = 39/53 (73%), Positives = 39/53 (73%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCP 114
           P P   PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P
Sbjct: 16  PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68

 Score =  100 bits (248), Expect = 7e-20
 Identities = 39/54 (72%), Positives = 40/54 (74%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPD 111
           P P   PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P+
Sbjct: 17  PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 70

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 43/70 (61%), Positives = 44/70 (62%)
 Frame = -2

Query: 221 EPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKK 42
           +PPP   PPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP      PPPP   
Sbjct: 15  DPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP------PPPP--- 65

Query: 41  PYEYPSPPPP 12
                 PPPP
Sbjct: 66  ------PPPP 69

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 36/48 (75%), Positives = 36/48 (75%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPN 129
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PP N
Sbjct: 24  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNN 71

[127][TOP]
>UniRef100_A9URA4 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9URA4_MONBE
          Length = 1593

 Score =  111 bits (278), Expect = 2e-23
 Identities = 56/105 (53%), Positives = 58/105 (55%), Gaps = 20/105 (19%)
 Frame = -2

Query: 263  LPTPPPAPKPPPCPEPPP-----APPPPPPP----------PPPPPPPTPPAPPPTPPPN 129
            LP+PPPAP PPP P PPP     APPPPPPP          PPPPPP  P APPP PPP 
Sbjct: 996  LPSPPPAPPPPPPPPPPPPGAPGAPPPPPPPLPGIPGAPPPPPPPPPGIPGAPPPLPPPP 1055

Query: 128  PPPCPD-----PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            PPP P      PPL PPPP        PPPP   P   P PPP +
Sbjct: 1056 PPPPPGIPGAPPPLPPPPPGIPGAPPPPPPPPGIPGAPPPPPPGI 1100

 Score =  110 bits (275), Expect = 5e-23
 Identities = 54/102 (52%), Positives = 55/102 (53%), Gaps = 15/102 (14%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPP----CPEPPPAPPPP-------PPPPPPPPPPTPPAPPPTPPPNP 126
            P P P PPP P PPP     P  PP PPPP       PPPPPPPPP  P APPP PPP P
Sbjct: 997  PSPPPAPPPPPPPPPPPPGAPGAPPPPPPPLPGIPGAPPPPPPPPPGIPGAPPPLPPPPP 1056

Query: 125  PPCPD----PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PP P     PP  PPPPP +     PPPP       P PPPP
Sbjct: 1057 PPPPGIPGAPPPLPPPPPGIPGAPPPPPPPPGIPGAPPPPPP 1098

 Score =  102 bits (253), Expect = 2e-20
 Identities = 51/100 (51%), Positives = 52/100 (52%), Gaps = 15/100 (15%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPP------PPPPPPPTP-----PAPPPTPPPN--- 129
            PL + P    P P P PPP PPPPPPP      PPPPPPP P     P PPP PPP    
Sbjct: 987  PLTSTPSEVLPSPPPAPPPPPPPPPPPPGAPGAPPPPPPPLPGIPGAPPPPPPPPPGIPG 1046

Query: 128  -PPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPP P PP  PPP  P      PPPP   P   P PPPP
Sbjct: 1047 APPPLPPPPPPPPPGIPGAPPPLPPPPPGIPGAPPPPPPP 1086

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/80 (55%), Positives = 45/80 (56%), Gaps = 4/80 (5%)
 Frame = -2

Query: 266  PLPTPPPAP----KPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
            P P PPP P     PPP P PPP PPP  P  PPP PP PP  P  PPP PPP P  P  
Sbjct: 1034 PPPPPPPPPGIPGAPPPLPPPPPPPPPGIPGAPPPLPPPPPGIPGAPPPPPPP-PGIPGA 1092

Query: 98   PPPPPPVYKYKSPPPPAKKP 39
            PPPPPP     +PPPP   P
Sbjct: 1093 PPPPPPGIP-GAPPPPLGGP 1111

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 42/79 (53%), Positives = 42/79 (53%), Gaps = 4/79 (5%)
 Frame = -2

Query: 236  PPPCPEPPPAPPPPPPPPPPPPPPTPPAP--PPTPPPNPPPCPDPPLEPPPPPPVYKYKS 63
            PP    P    P PPP PPPPPPP PP P  P  PPP PPP P  P  PPPPPP      
Sbjct: 986  PPLTSTPSEVLPSPPPAPPPPPPPPPPPPGAPGAPPPPPPPLPGIPGAPPPPPP------ 1039

Query: 62   PPP--PAKKPYEYPSPPPP 12
            PPP  P   P   P PPPP
Sbjct: 1040 PPPGIPGAPPPLPPPPPPP 1058

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 43/84 (51%), Positives = 43/84 (51%), Gaps = 7/84 (8%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPPPP----PPPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
            P PLP PPP P P     PPP PPPPP     PPPPPPPP  P  PP PPP  P  P PP
Sbjct: 1048 PPPLPPPPPPPPPGIPGAPPPLPPPPPGIPGAPPPPPPPPGIPGAPPPPPPGIPGAPPPP 1107

Query: 104  LEPP---PPPPVYKYKSPPPPAKK 42
            L  P      PV   K    P KK
Sbjct: 1108 LGGPGGLVAKPVGPRKPVIQPEKK 1131

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 37/83 (44%), Positives = 37/83 (44%), Gaps = 9/83 (10%)
 Frame = -2

Query: 233  PPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPP---------LEPPPPPP 81
            PP    P    P PPP PPPPPP     PP PPP  P  P PP           PPPPPP
Sbjct: 986  PPLTSTPSEVLPSPPPAPPPPPP-----PPPPPPGAPGAPPPPPPPLPGIPGAPPPPPPP 1040

Query: 80   VYKYKSPPPPAKKPYEYPSPPPP 12
                   PPP   P   P PPPP
Sbjct: 1041 PPGIPGAPPPLPPP---PPPPPP 1060

[128][TOP]
>UniRef100_C5JYR8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis SLH14081
            RepID=C5JYR8_AJEDS
          Length = 1704

 Score =  111 bits (278), Expect = 2e-23
 Identities = 55/99 (55%), Positives = 56/99 (56%), Gaps = 14/99 (14%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAP----PPPPPPPPPPP----PPTPPAPPP---TPPPNPPP 120
            P P P   PKPPP P PPPA     PPPPPPPPPPP    PP PP PPP    PPP PPP
Sbjct: 891  PKPEPTTTPKPPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPPP 950

Query: 119  CP---DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             P    PP  PPPPPP     +PPPP   P     PPPP
Sbjct: 951  PPGIGGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPP 989

 Score =  110 bits (276), Expect = 4e-23
 Identities = 56/104 (53%), Positives = 56/104 (53%), Gaps = 17/104 (16%)
 Frame = -2

Query: 272  PFPLPTPPPA-----PKPPPCPEPPPA----PPPPPPPP----PPPPPPTPPA----PPP 144
            P P P PPPA     P PPP P PPP     PPPPPPPP    PPPPPP PP     PPP
Sbjct: 901  PPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPPPPPGIGGPPPP 960

Query: 143  TPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPP PPP    P  PPPPPP      PPPP       P PPPP
Sbjct: 961  PPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPPPPP 1004

 Score =  105 bits (263), Expect = 1e-21
 Identities = 50/89 (56%), Positives = 51/89 (57%), Gaps = 4/89 (4%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPP----PPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
            P P PPP P PP    PPP PPPPP    PPPPPPPPP    PPP PPP PP    PPL 
Sbjct: 957  PPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPPPPPP-PPGMGGPPLP 1015

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPPP +     PPPP   P     PPPP
Sbjct: 1016 PPPPPGM---GGPPPPPPPPGMRGPPPPP 1041

 Score =  103 bits (257), Expect = 6e-21
 Identities = 53/100 (53%), Positives = 53/100 (53%), Gaps = 13/100 (13%)
 Frame = -2

Query: 272  PFPLPTPPP---APKPPPCPEP------PPAPPPPPPP----PPPPPPPTPPAPPPTPPP 132
            P P P PPP   AP PPP P P      PP PPPPPPP    PPPPPPP P A  P PPP
Sbjct: 931  PPPPPPPPPGVGAPPPPPPPPPGIGGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPP 990

Query: 131  NPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPP    P  PPPPPP       PPP       P PPPP
Sbjct: 991  PPPPGVGGPPPPPPPPPGMGGPPLPPPPPPGMGGPPPPPP 1030

 Score =  102 bits (254), Expect = 1e-20
 Identities = 48/88 (54%), Positives = 49/88 (55%), Gaps = 7/88 (7%)
 Frame = -2

Query: 254  PPPAPKPPPC---PEPPPAPPPPPP----PPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
            PPP P PPP    P PPP PPPPPP    PPPPPPPP     PP PPP PP    PP  P
Sbjct: 944  PPPPPPPPPGIGGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPPPP 1003

Query: 95   PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            PPPP +     PPPP       P PPPP
Sbjct: 1004 PPPPGMGGPPLPPPPPPGMGGPPPPPPP 1031

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 47/88 (53%), Positives = 48/88 (54%), Gaps = 13/88 (14%)
 Frame = -2

Query: 272  PFPLPTPPPAP---KPPPCPEPPPA-----PPPPPP-----PPPPPPPPTPPAPPPTPPP 132
            P P P PPP P    PPP P PPP      PPPPPP     PPPPPPPP     PP PPP
Sbjct: 958  PPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPPPPPPPPGMGGPPLPPP 1017

Query: 131  NPPPCPDPPLEPPPPPPVYKYKSPPPPA 48
             PP    PP  PPPPPP  +   PPP A
Sbjct: 1018 PPPGMGGPP--PPPPPPGMRGPPPPPGA 1043

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 38/73 (52%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = -2

Query: 221  EPPPAPPPPPPPPPPPPPPTP---PAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPP 51
            +P P P   P PPPPPPPP     P PPP PPP PPP    P  PPPPPP      PPPP
Sbjct: 890  KPKPEPTTTPKPPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPP 949

Query: 50   AKKPYEYPSPPPP 12
                   P PPPP
Sbjct: 950  PPPGIGGPPPPPP 962

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 35/77 (45%), Positives = 37/77 (48%), Gaps = 7/77 (9%)
 Frame = -2

Query: 221  EPPPAPPPPPPPPPPPPPPTPPAPPPT-------PPPNPPPCPDPPLEPPPPPPVYKYKS 63
            E   +  P P P   P PP PP PPP        PPP PPP P   L PPPPPP     +
Sbjct: 884  EKDESKKPKPEPTTTPKPPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGA 943

Query: 62   PPPPAKKPYEYPSPPPP 12
            PPPP   P     PPPP
Sbjct: 944  PPPPPPPPPGIGGPPPP 960

[129][TOP]
>UniRef100_C5GLX8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis ER-3
            RepID=C5GLX8_AJEDR
          Length = 1750

 Score =  111 bits (278), Expect = 2e-23
 Identities = 55/99 (55%), Positives = 56/99 (56%), Gaps = 14/99 (14%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAP----PPPPPPPPPPP----PPTPPAPPP---TPPPNPPP 120
            P P P   PKPPP P PPPA     PPPPPPPPPPP    PP PP PPP    PPP PPP
Sbjct: 963  PKPEPTTTPKPPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPPP 1022

Query: 119  CP---DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             P    PP  PPPPPP     +PPPP   P     PPPP
Sbjct: 1023 PPGIGGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPP 1061

 Score =  110 bits (276), Expect = 4e-23
 Identities = 56/104 (53%), Positives = 56/104 (53%), Gaps = 17/104 (16%)
 Frame = -2

Query: 272  PFPLPTPPPA-----PKPPPCPEPPPA----PPPPPPPP----PPPPPPTPPA----PPP 144
            P P P PPPA     P PPP P PPP     PPPPPPPP    PPPPPP PP     PPP
Sbjct: 973  PPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPPPPPGIGGPPPP 1032

Query: 143  TPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPP PPP    P  PPPPPP      PPPP       P PPPP
Sbjct: 1033 PPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPPPPP 1076

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 47/87 (54%), Positives = 48/87 (55%), Gaps = 11/87 (12%)
 Frame = -2

Query: 266  PLPTPPPAP---KPPPCPEPPPA----PPPPPPPPPPP----PPPTPPAPPPTPPPNPPP 120
            P P PPP P    PPP P PPP     PPPPPPPPPPP    PPP PP PP    P PPP
Sbjct: 1003 PPPPPPPPPGVGAPPPPPPPPPGIGGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPP 1062

Query: 119  CPDPPLEPPPPPPVYKYKSPPPPAKKP 39
             P P +  PPPPP      PPPP   P
Sbjct: 1063 PPPPGVGGPPPPP------PPPPVNDP 1083

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 46/78 (58%), Positives = 46/78 (58%), Gaps = 13/78 (16%)
 Frame = -2

Query: 272  PFPLPTPPP---APKPPPCPEP------PPAPPPPPPP----PPPPPPPTPPAPPPTPPP 132
            P P P PPP   AP PPP P P      PP PPPPPPP    PPPPPPP P A  P PPP
Sbjct: 1003 PPPPPPPPPGVGAPPPPPPPPPGIGGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPP 1062

Query: 131  NPPPCPDPPLEPPPPPPV 78
             PPP    P  PPPPPPV
Sbjct: 1063 PPPPGVGGPPPPPPPPPV 1080

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 38/73 (52%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = -2

Query: 221  EPPPAPPPPPPPPPPPPPPTP---PAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPP 51
            +P P P   P PPPPPPPP     P PPP PPP PPP    P  PPPPPP      PPPP
Sbjct: 962  KPKPEPTTTPKPPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPPP 1021

Query: 50   AKKPYEYPSPPPP 12
                   P PPPP
Sbjct: 1022 PPPGIGGPPPPPP 1034

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 44/91 (48%), Positives = 46/91 (50%), Gaps = 13/91 (14%)
 Frame = -2

Query: 272  PFPLPTPPPA----PKPPPCPEPPP---APPPPPPPPP------PPPPPTPPAPPPTPPP 132
            P P P PPP     P PPP P PPP   APPPPPPPPP      PPPPP P    P PPP
Sbjct: 1016 PPPPPPPPPGIGGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPPPP 1075

Query: 131  NPPPCPDPPLEPPPPPPVYKYKSPPPPAKKP 39
             PPP  DP   P     +  +K    PA  P
Sbjct: 1076 PPPPVNDP--RPGAGSSIGSWKKTYLPADAP 1104

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 35/77 (45%), Positives = 37/77 (48%), Gaps = 7/77 (9%)
 Frame = -2

Query: 221  EPPPAPPPPPPPPPPPPPPTPPAPPPT-------PPPNPPPCPDPPLEPPPPPPVYKYKS 63
            E   +  P P P   P PP PP PPP        PPP PPP P   L PPPPPP     +
Sbjct: 956  EKDESKKPKPEPTTTPKPPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGA 1015

Query: 62   PPPPAKKPYEYPSPPPP 12
            PPPP   P     PPPP
Sbjct: 1016 PPPPPPPPPGIGGPPPP 1032

[130][TOP]
>UniRef100_Q9FIQ2 Genomic DNA, chromosome 5, P1 clone:MZA15 n=1 Tax=Arabidopsis
           thaliana RepID=Q9FIQ2_ARATH
          Length = 268

 Score =  111 bits (277), Expect = 3e-23
 Identities = 55/95 (57%), Positives = 59/95 (62%), Gaps = 8/95 (8%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVG-------- 168
           G G  GY  G   GGGG      GGGGGGS GG+  G G+GGG GGGAGG G        
Sbjct: 154 GAGASGYGGGAYGGGGGH----GGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGY 209

Query: 169 GGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGG GGGG  GGG  HGGG+G+GGG G G G
Sbjct: 210 GGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYG 244

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 51/89 (57%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGG--GFGGGVGGGAGGVGGGGGGG 186
           GGGG G S G   GG G      GG GGG+ GG  HGG  G+GGG GGG+GG G  GGGG
Sbjct: 172 GGGGGGGSAGGAHGGSGY----GGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
             GGG G+GGG G G G GA GG G G+G
Sbjct: 228 AHGGGYGSGGGEGGGYGGGAAGGYGGGHG 256

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 55/111 (49%), Positives = 58/111 (52%), Gaps = 24/111 (21%)
 Frame = +1

Query: 13  GGGGDGYS--------YGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGA---G 159
           GGGG  Y         YG  AG GG     +G GGG   GG GHGGG GGG  GGA    
Sbjct: 129 GGGGSAYGAGGEHASGYGNGAGEGGGAGA-SGYGGGAYGGGGGHGGGGGGGSAGGAHGGS 187

Query: 160 GVGGGGGGG-------------GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGG GGG             GGGGGGG+GGG  +GGG   GGG GSG G
Sbjct: 188 GYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGG 238

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/95 (55%), Positives = 57/95 (60%), Gaps = 9/95 (9%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGG-FGGGVGGGAGGVGG------G 174
           GGG G +YG  AGG        G G GG  G SG+GGG +GGG G G GG GG      G
Sbjct: 128 GGGGGSAYG--AGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHG 185

Query: 175 GGGGGGGGGGGAGGGSGHG--GGFGAGGGVGSGNG 273
           G G GGG GGGAGGG  HG  GG+G GGG GSG G
Sbjct: 186 GSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGG 220

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 53/100 (53%), Positives = 59/100 (59%), Gaps = 13/100 (13%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNG-------GSGHGGGFGGGVGG---GAGG 162
           GGGG G + G  AGGGG     +GGGGG + G       G G+G G GGG G    G G 
Sbjct: 108 GGGGYGGAAGGHAGGGGGG---SGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGA 164

Query: 163 VGGGGGGGGGGGGGGAG---GGSGHGGGFGAGGGVGSGNG 273
            GGGGG GGGGGGG AG   GGSG+GGG G G G G  +G
Sbjct: 165 YGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHG 204

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 45/91 (49%), Positives = 52/91 (57%), Gaps = 5/91 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGG---GGGG 186
           GGG G + G+ +GGG       GGGGGG+    G+  G G G GGG GG  GG   GGGG
Sbjct: 70  GGGYGGAEGYASGGGSG----HGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGG 125

Query: 187 GGGGGGGA--GGGSGHGGGFGAGGGVGSGNG 273
           G GGGGG+  G G  H  G+G G G G G G
Sbjct: 126 GSGGGGGSAYGAGGEHASGYGNGAGEGGGAG 156

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 48/82 (58%), Positives = 50/82 (60%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG-GVGGGGGGG- 186
           GG G G   G  AGGGG  +   GG GGG  GGSG GG +GGG   G G G GGG GGG 
Sbjct: 185 GGSGYGGGEGGGAGGGGS-HGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGY 243

Query: 187 GGGGGGGAGGGSGHGGGFGAGG 252
           GGG  GG GGG G GGG G GG
Sbjct: 244 GGGAAGGYGGGHGGGGGHGGGG 265

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/99 (48%), Positives = 50/99 (50%), Gaps = 12/99 (12%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG----------- 159
           GGGG   S G  A G G+     GGGGG      GH GG GGG GGG G           
Sbjct: 89  GGGGGAASSGGYASGAGE-----GGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHAS 143

Query: 160 GVGGGGGGGGGGGGGGAGGGS-GHGGGFGAGGGVGSGNG 273
           G G G G GGG G  G GGG+ G GGG G GGG GS  G
Sbjct: 144 GYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGG 182

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 58/105 (55%), Positives = 60/105 (57%), Gaps = 18/105 (17%)
 Frame = +1

Query: 13  GGGGDGYS---YGFLAGGG--GDLYL*TGGGGGG-----SNGGSGHGGGFGGGV--GGGA 156
           GGG  G S   YG  +GGG  G      GGG GG     S GGSGHGGG GG    GG A
Sbjct: 42  GGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYA 101

Query: 157 GGVGGGGGGGGGG--GG--GGAGGGSGHGGG--FGAGGGVGSGNG 273
            G G GGGGG GG  GG  GG GGGSG GGG  +GAGG   SG G
Sbjct: 102 SGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYG 146

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 50/99 (50%), Positives = 54/99 (54%), Gaps = 11/99 (11%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVG-GGAGGVGGGGGGG 186
           +GGGG G       GGGG   + +GG GG S GG G G G G G G GGA G   GGG G
Sbjct: 34  SGGGGHG-------GGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSG 86

Query: 187 GGGGGGGA--------GGGSGHGGGFG--AGGGVGSGNG 273
            GGGGGGA        G G G GGG+G  AGG  G G G
Sbjct: 87  HGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGG 125

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/85 (54%), Positives = 51/85 (60%), Gaps = 5/85 (5%)
 Frame = +1

Query: 34  SYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGG-- 207
           +YG  +GGGG       GGGGGS G S   GG+GG  GGG GG  G G GGG GG  G  
Sbjct: 29  NYGQASGGGGH------GGGGGSGGVSS--GGYGGESGGGYGGGSGEGAGGGYGGAEGYA 80

Query: 208 AGGGSGHGGGFG---AGGGVGSGNG 273
           +GGGSGHGGG G   + GG  SG G
Sbjct: 81  SGGGSGHGGGGGGAASSGGYASGAG 105

[131][TOP]
>UniRef100_Q7Y218 Putative uncharacterized protein At5g46730 n=1 Tax=Arabidopsis
           thaliana RepID=Q7Y218_ARATH
          Length = 290

 Score =  111 bits (277), Expect = 3e-23
 Identities = 55/95 (57%), Positives = 59/95 (62%), Gaps = 8/95 (8%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVG-------- 168
           G G  GY  G   GGGG      GGGGGGS GG+  G G+GGG GGGAGG G        
Sbjct: 154 GAGASGYGGGAYGGGGGH----GGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGY 209

Query: 169 GGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGGGG GGGG  GGG  HGGG+G+GGG G G G
Sbjct: 210 GGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYG 244

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 51/89 (57%), Positives = 55/89 (61%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGG--GFGGGVGGGAGGVGGGGGGG 186
           GGGG G S G   GG G      GG GGG+ GG  HGG  G+GGG GGG+GG G  GGGG
Sbjct: 172 GGGGGGGSAGGAHGGSGY----GGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
             GGG G+GGG G G G GA GG G G G
Sbjct: 228 AHGGGYGSGGGEGGGYGGGAAGGYGGGGG 256

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 53/94 (56%), Positives = 57/94 (60%), Gaps = 9/94 (9%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSG-HGGGFG------GGVGGGAGGVGG 171
           GGG  G + G+  GGGG      G GGGG+ GG G HGGG+G      GG GGGA G  G
Sbjct: 199 GGGSHGGAGGYGGGGGG------GSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYG 252

Query: 172 GGGGGGGGGGGGAGG--GSGHGGGFGAGGGVGSG 267
           GGGGGG GGGG  GG  G G GGG G GGG G G
Sbjct: 253 GGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGG 286

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 55/111 (49%), Positives = 58/111 (52%), Gaps = 24/111 (21%)
 Frame = +1

Query: 13  GGGGDGYS--------YGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGA---G 159
           GGGG  Y         YG  AG GG     +G GGG   GG GHGGG GGG  GGA    
Sbjct: 129 GGGGSAYGAGGEHASGYGNGAGEGGGAGA-SGYGGGAYGGGGGHGGGGGGGSAGGAHGGS 187

Query: 160 GVGGGGGGG-------------GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGG GGG             GGGGGGG+GGG  +GGG   GGG GSG G
Sbjct: 188 GYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGG 238

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/95 (55%), Positives = 57/95 (60%), Gaps = 9/95 (9%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGG-FGGGVGGGAGGVGG------G 174
           GGG G +YG  AGG        G G GG  G SG+GGG +GGG G G GG GG      G
Sbjct: 128 GGGGGSAYG--AGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHG 185

Query: 175 GGGGGGGGGGGAGGGSGHG--GGFGAGGGVGSGNG 273
           G G GGG GGGAGGG  HG  GG+G GGG GSG G
Sbjct: 186 GSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGG 220

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 50/90 (55%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSG-HGGGFGGGVGGGAGGVGGGGGGGG 189
           GGG  G ++G    GGG+     G GGGGS+GG+G +GGG GGG GGG    GGG  GGG
Sbjct: 176 GGGSAGGAHGGSGYGGGEG---GGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGG 232

Query: 190 GGGGGGAGGGSGHG--GGFGAGGGVGSGNG 273
            G GGG GGG G G  GG+G GGG G G G
Sbjct: 233 YGSGGGEGGGYGGGAAGGYGGGGGGGEGGG 262

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 53/100 (53%), Positives = 59/100 (59%), Gaps = 13/100 (13%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNG-------GSGHGGGFGGGVGG---GAGG 162
           GGGG G + G  AGGGG     +GGGGG + G       G G+G G GGG G    G G 
Sbjct: 108 GGGGYGGAAGGHAGGGGGG---SGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGA 164

Query: 163 VGGGGGGGGGGGGGGAG---GGSGHGGGFGAGGGVGSGNG 273
            GGGGG GGGGGGG AG   GGSG+GGG G G G G  +G
Sbjct: 165 YGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHG 204

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 45/91 (49%), Positives = 52/91 (57%), Gaps = 5/91 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGG---GGGG 186
           GGG G + G+ +GGG       GGGGGG+    G+  G G G GGG GG  GG   GGGG
Sbjct: 70  GGGYGGAEGYASGGGSG----HGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGG 125

Query: 187 GGGGGGGA--GGGSGHGGGFGAGGGVGSGNG 273
           G GGGGG+  G G  H  G+G G G G G G
Sbjct: 126 GSGGGGGSAYGAGGEHASGYGNGAGEGGGAG 156

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/99 (48%), Positives = 50/99 (50%), Gaps = 12/99 (12%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG----------- 159
           GGGG   S G  A G G+     GGGGG      GH GG GGG GGG G           
Sbjct: 89  GGGGGAASSGGYASGAGE-----GGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHAS 143

Query: 160 GVGGGGGGGGGGGGGGAGGGS-GHGGGFGAGGGVGSGNG 273
           G G G G GGG G  G GGG+ G GGG G GGG GS  G
Sbjct: 144 GYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGG 182

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 58/105 (55%), Positives = 60/105 (57%), Gaps = 18/105 (17%)
 Frame = +1

Query: 13  GGGGDGYS---YGFLAGGG--GDLYL*TGGGGGG-----SNGGSGHGGGFGGGV--GGGA 156
           GGG  G S   YG  +GGG  G      GGG GG     S GGSGHGGG GG    GG A
Sbjct: 42  GGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYA 101

Query: 157 GGVGGGGGGGGGG--GG--GGAGGGSGHGGG--FGAGGGVGSGNG 273
            G G GGGGG GG  GG  GG GGGSG GGG  +GAGG   SG G
Sbjct: 102 SGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYG 146

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 50/99 (50%), Positives = 54/99 (54%), Gaps = 11/99 (11%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVG-GGAGGVGGGGGGG 186
           +GGGG G       GGGG   + +GG GG S GG G G G G G G GGA G   GGG G
Sbjct: 34  SGGGGHG-------GGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSG 86

Query: 187 GGGGGGGA--------GGGSGHGGGFG--AGGGVGSGNG 273
            GGGGGGA        G G G GGG+G  AGG  G G G
Sbjct: 87  HGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGG 125

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/85 (54%), Positives = 51/85 (60%), Gaps = 5/85 (5%)
 Frame = +1

Query: 34  SYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGG-- 207
           +YG  +GGGG       GGGGGS G S   GG+GG  GGG GG  G G GGG GG  G  
Sbjct: 29  NYGQASGGGGH------GGGGGSGGVSS--GGYGGESGGGYGGGSGEGAGGGYGGAEGYA 80

Query: 208 AGGGSGHGGGFG---AGGGVGSGNG 273
           +GGGSGHGGG G   + GG  SG G
Sbjct: 81  SGGGSGHGGGGGGAASSGGYASGAG 105

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 42/77 (54%), Positives = 44/77 (57%), Gaps = 12/77 (15%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDL---YL*TGGGGGGSNGGS--GHGGGFGGGVGGGA------- 156
           GGGG G   G   GGGG     Y   GG GGG  GG+  G+GGG GGG GGG        
Sbjct: 211 GGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHG 270

Query: 157 GGVGGGGGGGGGGGGGG 207
           GG GGG GGGGG GGGG
Sbjct: 271 GGSGGGHGGGGGHGGGG 287

[132][TOP]
>UniRef100_Q10MG8 Retrotransposon protein, putative, Ty3-gypsy subclass, expressed
           n=1 Tax=Oryza sativa Japonica Group RepID=Q10MG8_ORYSJ
          Length = 590

 Score =  111 bits (277), Expect = 3e-23
 Identities = 58/93 (62%), Positives = 63/93 (67%), Gaps = 5/93 (5%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGG---GSNGGSGHGGGFGGGVGGGAGGVGGGGG 180
           +GG G G   G  AGGGG L   TGGGGG   G+ GG G GGG GGG+GGGAG  GG GG
Sbjct: 265 SGGAGGGLGGGAGAGGGGGLGGGTGGGGGLGGGTGGGGGLGGGAGGGLGGGAGAGGGLGG 324

Query: 181 GGGGGGGGGAGGGSGHGGGF--GAGGGVGSGNG 273
           G G GGGGG GGG+G GGG   GAGGG+G G G
Sbjct: 325 GAGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAG 357

 Score =  110 bits (275), Expect = 5e-23
 Identities = 58/90 (64%), Positives = 62/90 (68%), Gaps = 3/90 (3%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GGGG G   G  AGGGG L    GGG GGG+ GG G  GG GGG+GGGAG  GGGG GGG
Sbjct: 228 GGGGAGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGLSGGAGGGLGGGAGAGGGGGLGGG 287

Query: 190 GGGGGGAGGGSGHGGGF--GAGGGVGSGNG 273
            GGGGG GGG+G GGG   GAGGG+G G G
Sbjct: 288 TGGGGGLGGGTGGGGGLGGGAGGGLGGGAG 317

 Score =  107 bits (268), Expect = 3e-22
 Identities = 58/92 (63%), Positives = 62/92 (67%), Gaps = 6/92 (6%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG-----GVGGGGG 180
           GGG G   G  AGGGG L    GG GGG  GG+G GGG GGG+GGGAG     G GGGGG
Sbjct: 147 GGGAGGGLGGGAGGGGGL---GGGAGGGLGGGAGGGGGVGGGLGGGAGGGLGSGAGGGGG 203

Query: 181 -GGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG GGGGG GGG+G G G GAGGG G+G G
Sbjct: 204 LGGGAGGGGGLGGGAGGGLGGGAGGGGGAGGG 235

 Score =  107 bits (267), Expect = 4e-22
 Identities = 57/90 (63%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           T GGG G+  G   GGGG L    GG GGG  GG GHGGG GGG GGG GG  GGGGG G
Sbjct: 35  TLGGGGGFGGGGGFGGGGGLGG-GGGAGGGFGGGLGHGGGLGGGFGGGKGGGLGGGGGLG 93

Query: 190 GGG--GGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG  GGG GGG GHGGG G G G G G G
Sbjct: 94  GGGGAGGGFGGGLGHGGGLGGGFGGGKGGG 123

 Score =  107 bits (267), Expect = 4e-22
 Identities = 56/90 (62%), Positives = 59/90 (65%), Gaps = 4/90 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVG-GGAGGVGGGGGGGGG 192
           GGG G   G  AGGGG L    GG GGG  GG+G GGG GGG G GG GG+GGG GGGGG
Sbjct: 369 GGGGGLGGG--AGGGGGL---GGGAGGGLGGGAGAGGGLGGGAGTGGGGGLGGGAGGGGG 423

Query: 193 ---GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
              G GGG GGG+G GGGFG G G G G G
Sbjct: 424 LGGGAGGGLGGGAGAGGGFGGGAGAGGGGG 453

 Score =  107 bits (267), Expect = 4e-22
 Identities = 55/88 (62%), Positives = 58/88 (65%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           TGGGG     G  AGGGG L    GG GGG  GG+G GGGFGGG G G GG  GGG GGG
Sbjct: 408 TGGGG---GLGGGAGGGGGL---GGGAGGGLGGGAGAGGGFGGGAGAGGGGGLGGGAGGG 461

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG  GGAGGG+  GGGFG G G G+G G
Sbjct: 462 GGLDGGAGGGAEAGGGFGGGAGAGTGGG 489

 Score =  107 bits (266), Expect = 5e-22
 Identities = 54/89 (60%), Positives = 57/89 (64%), Gaps = 3/89 (3%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGG---GSNGGSGHGGGFGGGVGGGAGGVGGGGGGG 186
           G G G+  G  AGGGG L    GGGGG   G+ GG+  GGGFGGG G G GG GG GGG 
Sbjct: 437 GAGGGFGGGAGAGGGGGLGGGAGGGGGLDGGAGGGAEAGGGFGGGAGAGTGGGGGLGGGA 496

Query: 187 GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGGGG G G G G GGG GAGGG G G G
Sbjct: 497 GGGGGLGGGAGGGLGGGAGAGGGFGGGKG 525

 Score =  106 bits (264), Expect = 9e-22
 Identities = 56/88 (63%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TG-GGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GGGG G   G  AGGG    L +G GGGGG  GG+G GGG GGG GGG GG  GGGGG G
Sbjct: 178 GGGGVGGGLGGGAGGG----LGSGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGAG 233

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGGAGGG G GGG G G G G+G G
Sbjct: 234 GGLGGGAGGGGGLGGGAGGGLGGGAGGG 261

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/88 (65%), Positives = 61/88 (69%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGG G   G   GGGG L    GGGGG  +GG G GGG GGG+GGGAGG GG GGG GGG
Sbjct: 113 GGGFGGGKGGGLGGGGGLGGGAGGGGGLGSGG-GLGGGAGGGLGGGAGGGGGLGGGAGGG 171

Query: 196 GGGGAGGGSGHGGGF--GAGGGVGSGNG 273
            GGGAGGG G GGG   GAGGG+GSG G
Sbjct: 172 LGGGAGGGGGVGGGLGGGAGGGLGSGAG 199

 Score =  105 bits (262), Expect = 2e-21
 Identities = 56/91 (61%), Positives = 59/91 (64%), Gaps = 5/91 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGG---GSNGGSGHGGGFGGGVGGGAGGVGGGGGGG 186
           GGG G   G  AGGGG L    GGGGG   G+ GG G G G GGG GGG GG  GGGGG 
Sbjct: 187 GGGAGGGLGSGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGAGGGLGGGAGGGGGL 246

Query: 187 GGGGGGGAGGGSGHGGGF--GAGGGVGSGNG 273
           GGG GGG GGG+G GGG   GAGGG+G G G
Sbjct: 247 GGGAGGGLGGGAGGGGGLSGGAGGGLGGGAG 277

 Score =  105 bits (262), Expect = 2e-21
 Identities = 52/86 (60%), Positives = 54/86 (62%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGG 195
           GGG G   G  AGGGG       G GGG  GG+G GGG GGG GGG GG  GGGGG  GG
Sbjct: 215 GGGAGGGLGGGAGGGG-------GAGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGLSGG 267

Query: 196 GGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG GGG+G GGG G GGG G G G
Sbjct: 268 AGGGLGGGAGAGGGGGLGGGTGGGGG 293

 Score =  105 bits (262), Expect = 2e-21
 Identities = 56/91 (61%), Positives = 60/91 (65%), Gaps = 5/91 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGG---GSNGGSGHGGGFGGGVGGGAGGVGGGGGGG 186
           G G G   G  AGGGG L    GGGGG   G+ GG G G G GGG+GGGAG  GGGG GG
Sbjct: 317 GAGGGLGGGAGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGGLGGGAGAGGGGGLGG 376

Query: 187 GGGGGGGAGGGSGH--GGGFGAGGGVGSGNG 273
           G GGGGG GGG+G   GGG GAGGG+G G G
Sbjct: 377 GAGGGGGLGGGAGGGLGGGAGAGGGLGGGAG 407

 Score =  105 bits (261), Expect = 2e-21
 Identities = 54/91 (59%), Positives = 57/91 (62%), Gaps = 4/91 (4%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVG-GGAGGVGGGGGGGG 189
           GG G G   G   GGGG L    GG GGG  GG+G GGG GGG G GG GG+GGG GGGG
Sbjct: 286 GGTGGGGGLGGGTGGGGGL---GGGAGGGLGGGAGAGGGLGGGAGAGGGGGLGGGAGGGG 342

Query: 190 G---GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           G   G GGG GGG+G GGG G G G G G G
Sbjct: 343 GLGGGAGGGLGGGAGAGGGLGGGAGAGGGGG 373

 Score =  105 bits (261), Expect = 2e-21
 Identities = 55/90 (61%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVG-GGAGGVGGGGGGGGG 192
           GGG G   G  AGGGG L    GG GGG  GG+G GGG GGG G GG GG+GGG GGGGG
Sbjct: 329 GGGGGLGGG--AGGGGGL---GGGAGGGLGGGAGAGGGLGGGAGAGGGGGLGGGAGGGGG 383

Query: 193 ---GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
              G GGG GGG+G GGG G G G G G G
Sbjct: 384 LGGGAGGGLGGGAGAGGGLGGGAGTGGGGG 413

 Score =  104 bits (260), Expect = 3e-21
 Identities = 57/88 (64%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GGG  G   G L GGGG   L  GGG GGG  GG GHGGG GGG GGG GG  GGGGG G
Sbjct: 75  GGGFGGGKGGGLGGGGG---LGGGGGAGGGFGGGLGHGGGLGGGFGGGKGGGLGGGGGLG 131

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGG G GSG G G GAGGG+G G G
Sbjct: 132 GGAGGGGGLGSGGGLGGGAGGGLGGGAG 159

 Score =  104 bits (259), Expect = 3e-21
 Identities = 56/90 (62%), Positives = 60/90 (66%), Gaps = 2/90 (2%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +G GG G   G  AGGGG L    GG GGG  GG+G GGG GGG+GGGAGG GG GGG G
Sbjct: 196 SGAGGGG-GLGGGAGGGGGL---GGGAGGGLGGGAGGGGGAGGGLGGGAGGGGGLGGGAG 251

Query: 190 GGGGGGAGGGSGHGGGFGA--GGGVGSGNG 273
           GG GGGAGGG G  GG G   GGG G+G G
Sbjct: 252 GGLGGGAGGGGGLSGGAGGGLGGGAGAGGG 281

 Score =  103 bits (258), Expect = 5e-21
 Identities = 57/91 (62%), Positives = 60/91 (65%), Gaps = 4/91 (4%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGG---VGGGGGG 183
           GGGG   S G L GG G      GG GGG+ GG G GGG GGG+GGGAGG   VGGG GG
Sbjct: 135 GGGGGLGSGGGLGGGAG------GGLGGGAGGGGGLGGGAGGGLGGGAGGGGGVGGGLGG 188

Query: 184 GGGGG-GGGAGGGSGHGGGFGAGGGVGSGNG 273
           G GGG G GAGGG G GGG G GGG+G G G
Sbjct: 189 GAGGGLGSGAGGGGGLGGGAGGGGGLGGGAG 219

 Score =  103 bits (258), Expect = 5e-21
 Identities = 55/91 (60%), Positives = 58/91 (63%), Gaps = 5/91 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGG---GSNGGSGHGGGFGGGVGGGAGGVGGGGG-- 180
           GGG G   G   G GG L    GGGGG   G+ GG G GGG GGG+GGGAGG GG GG  
Sbjct: 177 GGGGGVGGGLGGGAGGGLGSGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGAGGGL 236

Query: 181 GGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGGGG GGG+G G G GAGGG G   G
Sbjct: 237 GGGAGGGGGLGGGAGGGLGGGAGGGGGLSGG 267

 Score =  103 bits (258), Expect = 5e-21
 Identities = 54/89 (60%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GG G G   G  AG GG      GG GGG+ GG G GGG GGG+GGGAG  GG GGG G 
Sbjct: 314 GGAGAGGGLGGGAGAGGG-----GGLGGGAGGGGGLGGGAGGGLGGGAGAGGGLGGGAGA 368

Query: 193 GGGGGAGGGSGHGGGF--GAGGGVGSGNG 273
           GGGGG GGG+G GGG   GAGGG+G G G
Sbjct: 369 GGGGGLGGGAGGGGGLGGGAGGGLGGGAG 397

 Score =  103 bits (256), Expect = 8e-21
 Identities = 56/88 (63%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GG G G   G  AGGGG L   +GGG GGG+ GG G G G GGG+GGGAGG  GGG GGG
Sbjct: 122 GGLGGGGGLGGGAGGGGGLG--SGGGLGGGAGGGLGGGAGGGGGLGGGAGGGLGGGAGGG 179

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGG GGG+G G G GAGGG G G G
Sbjct: 180 GGVGGGLGGGAGGGLGSGAGGGGGLGGG 207

 Score =  103 bits (256), Expect = 8e-21
 Identities = 55/90 (61%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TG-GGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGG G   G   G GG L    G GGGGG  GG+G GGG GGG GGG GG+GGG GGG G
Sbjct: 255 GGGAGGGGGLSGGAGGGLGGGAGAGGGGGLGGGTGGGGGLGGGTGGG-GGLGGGAGGGLG 313

Query: 193 GG---GGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG   GGG GGG+G GGG G GGG G G G
Sbjct: 314 GGAGAGGGLGGGAGAGGGGGLGGGAGGGGG 343

 Score =  103 bits (256), Expect = 8e-21
 Identities = 54/89 (60%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GG G G   G  AG GG      GG GGG+ GG G GGG GGG+GGGAG  GG GGG G 
Sbjct: 354 GGAGAGGGLGGGAGAGGG-----GGLGGGAGGGGGLGGGAGGGLGGGAGAGGGLGGGAGT 408

Query: 193 GGGGGAGGGSGHGGGF--GAGGGVGSGNG 273
           GGGGG GGG+G GGG   GAGGG+G G G
Sbjct: 409 GGGGGLGGGAGGGGGLGGGAGGGLGGGAG 437

 Score =  102 bits (254), Expect = 1e-20
 Identities = 55/91 (60%), Positives = 59/91 (64%), Gaps = 5/91 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGG--FGGGVGGGAGGVGGGGGGG- 186
           GGG G   G  AGGGG L   +GG GGG  GG+G GGG   GGG GGG GG+GGG GGG 
Sbjct: 247 GGGAGGGLGGGAGGGGGL---SGGAGGGLGGGAGAGGGGGLGGGTGGG-GGLGGGTGGGG 302

Query: 187 --GGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
             GGG GGG GGG+G GGG G G G G G G
Sbjct: 303 GLGGGAGGGLGGGAGAGGGLGGGAGAGGGGG 333

 Score =  102 bits (254), Expect = 1e-20
 Identities = 54/88 (61%), Positives = 57/88 (64%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           TGGGG     G  AGGGG L    GG GGG  GG+G GGGFGGG GGG GG  GG  G G
Sbjct: 486 TGGGG---GLGGGAGGGGGL---GGGAGGGLGGGAGAGGGFGGGKGGGFGGGLGGSSGSG 539

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG GAGGG+G G G G GGG G+G G
Sbjct: 540 FGGGFGAGGGAGGGAGAGFGGGAGAGGG 567

 Score =  102 bits (253), Expect = 2e-20
 Identities = 54/88 (61%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG-GVGGGGGGGGG 192
           G G G   GF  G GG L     GGGGG  GG G GGGFGGG+G G G G G GGG GGG
Sbjct: 69  GHGGGLGGGFGGGKGGGL-----GGGGGLGGGGGAGGGFGGGLGHGGGLGGGFGGGKGGG 123

Query: 193 -GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGGGG GGG+G GGG G+GGG+G G G
Sbjct: 124 LGGGGGLGGGAGGGGGLGSGGGLGGGAG 151

 Score =  102 bits (253), Expect = 2e-20
 Identities = 54/88 (61%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGG-G 189
           GGG G   G  AGGGG +    GGG GGG   G+G GGG GGG GGG GG+GGG GGG G
Sbjct: 165 GGGAGGGLGGGAGGGGGVGGGLGGGAGGGLGSGAGGGGGLGGGAGGG-GGLGGGAGGGLG 223

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           GG GGG G G G GGG G GGG+G G G
Sbjct: 224 GGAGGGGGAGGGLGGGAGGGGGLGGGAG 251

 Score =  101 bits (251), Expect = 3e-20
 Identities = 54/88 (61%), Positives = 57/88 (64%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGG-VGGGGGGGGG 192
           GGG G   G  AG GG L    GG G G  GG G G G GGG+GGGAGG +GGG G GGG
Sbjct: 305 GGGAGGGLGGGAGAGGGL---GGGAGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGG 361

Query: 193 -GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG GAGGG G GGG G GGG+G G G
Sbjct: 362 LGGGAGAGGGGGLGGGAGGGGGLGGGAG 389

 Score =  100 bits (249), Expect = 5e-20
 Identities = 55/89 (61%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAG-GVGGGGGGGG 189
           GGGG G  +G   G GG L    GG GGG  GG G GGG GGG GGG G G GGG GGG 
Sbjct: 94  GGGGAGGGFGGGLGHGGGL---GGGFGGGKGGGLGGGGGLGGGAGGGGGLGSGGGLGGGA 150

Query: 190 GGG-GGGAGGGSGHGGGFGAGGGVGSGNG 273
           GGG GGGAGGG G GGG G G G G+G G
Sbjct: 151 GGGLGGGAGGGGGLGGGAGGGLGGGAGGG 179

 Score =  100 bits (249), Expect = 5e-20
 Identities = 57/91 (62%), Positives = 59/91 (64%), Gaps = 4/91 (4%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           GG G G   G   GGG       GGG GGG+ GG G GGG GGG+GGGAG  GGG GGG 
Sbjct: 466 GGAGGGAEAGGGFGGGAGAGTGGGGGLGGGAGGGGGLGGGAGGGLGGGAGA-GGGFGGGK 524

Query: 190 GGG-GGGAGG--GSGHGGGFGAGGGVGSGNG 273
           GGG GGG GG  GSG GGGFGAGGG G G G
Sbjct: 525 GGGFGGGLGGSSGSGFGGGFGAGGGAGGGAG 555

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 53/88 (60%), Positives = 56/88 (63%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGG-VGGGGGGGGG 192
           GGG G   G  AG GG L    GG G G  GG G G G GGG+GGGAGG +GGG G GGG
Sbjct: 345 GGGAGGGLGGGAGAGGGL---GGGAGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGG 401

Query: 193 -GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG G GGG G GGG G GGG+G G G
Sbjct: 402 LGGGAGTGGGGGLGGGAGGGGGLGGGAG 429

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 53/88 (60%), Positives = 56/88 (63%), Gaps = 2/88 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGA-GGVGGGGGGGGG 192
           GGG G   G  AG GG L    GG G G  GG G G G GGG+GGGA GG+GGG G GGG
Sbjct: 385 GGGAGGGLGGGAGAGGGL---GGGAGTGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGG 441

Query: 193 -GGGGGAGGGSGHGGGFGAGGGVGSGNG 273
            GGG GAGGG G GGG G GGG+  G G
Sbjct: 442 FGGGAGAGGGGGLGGGAGGGGGLDGGAG 469

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 56/91 (61%), Positives = 59/91 (64%), Gaps = 5/91 (5%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVGGGAGGVG--GGGGGG 186
           GGG G   G  AGGG    L  GGG GGG  GG G G G GGG+GGGAGG G  G GGG 
Sbjct: 87  GGGGGLGGGGGAGGGFGGGLGHGGGLGGGFGGGKGGGLGGGGGLGGGAGGGGGLGSGGGL 146

Query: 187 GGGGGGGAGGGSGHGGGF--GAGGGVGSGNG 273
           GGG GGG GGG+G GGG   GAGGG+G G G
Sbjct: 147 GGGAGGGLGGGAGGGGGLGGGAGGGLGGGAG 177

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 55/95 (57%), Positives = 57/95 (60%), Gaps = 9/95 (9%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TG-GGGGGSNGGSGHGGGFGGGVGGGA---GGVGGGGGG 183
           GGG G   G  AG GG      G GGGGG  GG+G GGG  GG GGGA   GG GGG G 
Sbjct: 425 GGGAGGGLGGGAGAGGGFGGGAGAGGGGGLGGGAGGGGGLDGGAGGGAEAGGGFGGGAGA 484

Query: 184 GGGGG---GGGAGGGSGHGGGFGA--GGGVGSGNG 273
           G GGG   GGGAGGG G GGG G   GGG G+G G
Sbjct: 485 GTGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGG 519

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/84 (61%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +1

Query: 16  GGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFG--GGVGGGAGGVGGGGGGGG 189
           GGG G   GF  G GG       GGG G + GSG GGGFG  GG GGGAG   GGG G G
Sbjct: 511 GGGAGAGGGFGGGKGGGF-----GGGLGGSSGSGFGGGFGAGGGAGGGAGAGFGGGAGAG 565

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVG 261
           GGGG GAGGG   GGGFG GGGVG
Sbjct: 566 GGGGLGAGGGG--GGGFGGGGGVG 587

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 42/71 (59%), Positives = 43/71 (60%), Gaps = 3/71 (4%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGG-GGGSNGGSGHGGGFGGGVG-GGAGGVGGGGGGG 186
           GG G G   GF  G GG      GGG G G   G G G GFGGG G GG GG+G GGGGG
Sbjct: 518 GGFGGGKGGGFGGGLGGSSGSGFGGGFGAGGGAGGGAGAGFGGGAGAGGGGGLGAGGGGG 577

Query: 187 GG-GGGGGAGG 216
           GG GGGGG GG
Sbjct: 578 GGFGGGGGVGG 588

[133][TOP]
>UniRef100_B7Q3T8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q3T8_IXOSC
          Length = 247

 Score =  111 bits (277), Expect = 3e-23
 Identities = 52/75 (69%), Positives = 53/75 (70%)
 Frame = +1

Query: 49  AGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGH 228
           +GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G 
Sbjct: 177 SGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 230

Query: 229 GGGFGAGGGVGSGNG 273
           GGG G GGG G G G
Sbjct: 231 GGGGGGGGGGGGGGG 245

 Score =  110 bits (276), Expect = 4e-23
 Identities = 55/84 (65%), Positives = 56/84 (66%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           +GGGG G       GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGG
Sbjct: 177 SGGGGGG-------GGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 223

Query: 190 GGGGGGAGGGSGHGGGFGAGGGVG 261
           GGGGGG GGG G GGG G GGG G
Sbjct: 224 GGGGGGGGGGGGGGGGGGGGGGGG 247

 Score =  110 bits (276), Expect = 4e-23
 Identities = 52/74 (70%), Positives = 52/74 (70%)
 Frame = +1

Query: 52  GGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHG 231
           GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G G
Sbjct: 180 GGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 233

Query: 232 GGFGAGGGVGSGNG 273
           GG G GGG G G G
Sbjct: 234 GGGGGGGGGGGGGG 247

 Score =  108 bits (270), Expect = 2e-22
 Identities = 51/74 (68%), Positives = 51/74 (68%)
 Frame = +1

Query: 52  GGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHG 231
           G GG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G G
Sbjct: 176 GSGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 229

Query: 232 GGFGAGGGVGSGNG 273
           GG G GGG G G G
Sbjct: 230 GGGGGGGGGGGGGG 243

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 41/58 (70%), Positives = 42/58 (72%)
 Frame = +1

Query: 100 SNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVGSGNG 273
           S+   G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G GGG G GGG G G G
Sbjct: 171 SHRPKGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 228

[134][TOP]
>UniRef100_B7P0X5 Collagen-like repeats containing protein, putative (Fragment) n=1
           Tax=Ixodes scapularis RepID=B7P0X5_IXOSC
          Length = 117

 Score =  111 bits (277), Expect = 3e-23
 Identities = 55/82 (67%), Positives = 55/82 (67%)
 Frame = +1

Query: 10  TGGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGG 189
           TGGGG G       GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGG
Sbjct: 49  TGGGGGG-------GGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95

Query: 190 GGGGGGAGGGSGHGGGFGAGGG 255
           GGGGGG GGG G GGG G GGG
Sbjct: 96  GGGGGGGGGGGGGGGGGGGGGG 117

 Score =  110 bits (276), Expect = 4e-23
 Identities = 52/74 (70%), Positives = 52/74 (70%)
 Frame = +1

Query: 52  GGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHG 231
           GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G G
Sbjct: 50  GGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 232 GGFGAGGGVGSGNG 273
           GG G GGG G G G
Sbjct: 104 GGGGGGGGGGGGGG 117

 Score =  110 bits (274), Expect = 6e-23
 Identities = 49/65 (75%), Positives = 49/65 (75%)
 Frame = +1

Query: 79  TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGV 258
           TGGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G GGG G GGG 
Sbjct: 49  TGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

Query: 259 GSGNG 273
           G G G
Sbjct: 109 GGGGG 113

[135][TOP]
>UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus
           purpuratus RepID=UPI0000E498A8
          Length = 58

 Score =  111 bits (277), Expect = 3e-23
 Identities = 44/58 (75%), Positives = 44/58 (75%)
 Frame = -2

Query: 254 PPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPP 81
           PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPP P
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--PPPPRP 58

 Score =  110 bits (274), Expect = 6e-23
 Identities = 44/61 (72%), Positives = 44/61 (72%)
 Frame = -2

Query: 263 LPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPP 84
           LP PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP       PPPPP
Sbjct: 2   LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP-------PPPPP 54

Query: 83  P 81
           P
Sbjct: 55  P 55

 Score =  107 bits (267), Expect = 4e-22
 Identities = 41/54 (75%), Positives = 41/54 (75%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
           P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56

 Score =  106 bits (264), Expect = 9e-22
 Identities = 45/69 (65%), Positives = 45/69 (65%)
 Frame = -2

Query: 218 PPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKP 39
           PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP      PPPP    
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP------PPPP---- 52

Query: 38  YEYPSPPPP 12
                PPPP
Sbjct: 53  -----PPPP 56

 Score =  105 bits (263), Expect = 1e-21
 Identities = 42/60 (70%), Positives = 43/60 (71%)
 Frame = -2

Query: 218 PPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKP 39
           PPP PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP      PPPP  +P
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP-----PPPPPPPRP 58

 Score =  105 bits (262), Expect = 2e-21
 Identities = 41/55 (74%), Positives = 41/55 (74%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP 108
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P P
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58

 Score =  105 bits (261), Expect = 2e-21
 Identities = 41/56 (73%), Positives = 41/56 (73%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
           P P P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P  P
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58

[136][TOP]
>UniRef100_UPI0000E47360 PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus
            RepID=UPI0000E47360
          Length = 1032

 Score =  111 bits (277), Expect = 3e-23
 Identities = 54/104 (51%), Positives = 58/104 (55%), Gaps = 16/104 (15%)
 Frame = -2

Query: 266  PLPTPPPAPKPPP----CPEPPPAPPPPP-----PPPPPPPPPTPPAPPPTPPPNPPPCP 114
            P P PPP P+PPP     P  PPAPPPPP     P PPPPPPP   A PP PPP PPP P
Sbjct: 890  PPPPPPPPPQPPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPPPPQAALPPPPPPGPPPAP 949

Query: 113  D------PPLEPPPPPPV-YKYKSPPPPAKKPYEYPSPPPPVYK 3
            D      PP  PPP PP+ +    PPPP  +    P PPPP  K
Sbjct: 950  DAALPPPPPAPPPPGPPLPFDVAGPPPPPARSNVDPKPPPPPRK 993

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 47/88 (53%), Positives = 47/88 (53%), Gaps = 8/88 (9%)
 Frame = -2

Query: 266  PLPTPPP----APKPPPCPEPPPAP-PPPPPPPPPPPPPTP-PAPPPTPPPNPPPCPDPP 105
            P P PPP    AP PPP P PP A  PPPPPP PPP P    P PPP PPP  PP P   
Sbjct: 912  PAPPPPPLLSEAPLPPPPPPPPQAALPPPPPPGPPPAPDAALPPPPPAPPPPGPPLPFDV 971

Query: 104  LEPPPPPPVYKY--KSPPPPAKKPYEYP 27
              PPPPP       K PPPP K   E P
Sbjct: 972  AGPPPPPARSNVDPKPPPPPRKSIPEDP 999

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 40/80 (50%), Positives = 42/80 (52%), Gaps = 13/80 (16%)
 Frame = -2

Query: 212  PAPPPPPPPPPPPPPPTP-----PAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPP- 51
            P   PPPPPPPPPP P P     P  PP PPP PP   + PL PPPPPP      PPPP 
Sbjct: 885  PDRSPPPPPPPPPPQPPPSSGSAPGAPPAPPP-PPLLSEAPLPPPPPPPPQAALPPPPPP 943

Query: 50   -------AKKPYEYPSPPPP 12
                   A  P   P+PPPP
Sbjct: 944  GPPPAPDAALPPPPPAPPPP 963

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 31/63 (49%), Positives = 35/63 (55%), Gaps = 11/63 (17%)
 Frame = -2

Query: 254  PPPAPKPPPCPE-----PPPAPPPPPPPPP-----PPPPPTPPAPPPTPPPNP-PPCPDP 108
            PPP P PPP P+     PPPAPPPP PP P     PPPPP      P PPP P    P+ 
Sbjct: 939  PPPPPGPPPAPDAALPPPPPAPPPPGPPLPFDVAGPPPPPARSNVDPKPPPPPRKSIPED 998

Query: 107  PLE 99
            P++
Sbjct: 999  PMD 1001

[137][TOP]
>UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium
           extorquens AM1 RepID=C5B4P6_METEA
          Length = 435

 Score =  111 bits (277), Expect = 3e-23
 Identities = 42/57 (73%), Positives = 43/57 (75%)
 Frame = -2

Query: 260 PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPP 90
           P PPP P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP PDPP+   P
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQPDPPVTTAP 377

 Score =  104 bits (259), Expect = 3e-21
 Identities = 39/52 (75%), Positives = 41/52 (78%)
 Frame = -2

Query: 242 PKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P+PP +P PP
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQPDPP 372

 Score =  102 bits (255), Expect = 1e-20
 Identities = 40/58 (68%), Positives = 41/58 (70%)
 Frame = -2

Query: 251 PPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPV 78
           P   +PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP P P   P P PPV
Sbjct: 316 PDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQPDPPV 373

 Score =  100 bits (249), Expect = 5e-20
 Identities = 41/58 (70%), Positives = 41/58 (70%)
 Frame = -2

Query: 257 TPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPP 84
           TP     PPP P PPP PPPPPPPPPPPPPP PP PPP PPP PPP   PP EPPP P
Sbjct: 315 TPDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP---PPPEPPPQP 369

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 42/72 (58%), Positives = 43/72 (59%)
 Frame = -2

Query: 224 PEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAK 45
           P+    PPPPPPPPPPPPPP PP PPP PPP PPP P PP  PPPPPP      PP    
Sbjct: 316 PDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP-----EPP---- 366

Query: 44  KPYEYPSPPPPV 9
                P P PPV
Sbjct: 367 -----PQPDPPV 373

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 31/47 (65%), Positives = 31/47 (65%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPP 132
           P P P PPP P PPP P PPP PPPPPPPPP PPP   P PP T  P
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPP--QPDPPVTTAP 377

[138][TOP]
>UniRef100_Q43682 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q43682_VIGUN
          Length = 280

 Score =  111 bits (277), Expect = 3e-23
 Identities = 56/110 (50%), Positives = 62/110 (56%), Gaps = 23/110 (20%)
 Frame = -2

Query: 272 PFPLPTPPPA----PKPPPCPEPPP-----APPPPPPPPPPP-----PPPTPPAPPP--- 144
           P P P+PPP       PPP P PPP     +PPPP P PPPP     PPP  P+PPP   
Sbjct: 48  PPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYV 107

Query: 143 ---TPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKK---PYEYPSPPPP 12
               PPP+P P P    + PPPPP Y YKSPPPP+     PY Y SPPPP
Sbjct: 108 YKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 157

 Score =  108 bits (271), Expect = 1e-22
 Identities = 60/121 (49%), Positives = 65/121 (53%), Gaps = 31/121 (25%)
 Frame = -2

Query: 272 PFPLPTPPPA----PKPPPCPEPPP-----APPPPPPPPPPP-----PPPTPPAPPP--- 144
           P P P+PPP       PPP P PPP     +PPPP P PPPP     PPP  P+PPP   
Sbjct: 16  PPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYV 75

Query: 143 ---TPPPNPPPCP-----DPPLEPPPPPPVYKYKSPPPPAKK---PYEYPSPPPP---VY 6
               PPP+P P P      PP   P PPP Y YKSPPPP+     PY Y SPPPP   VY
Sbjct: 76  YKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPPPYVY 135

Query: 5   K 3
           K
Sbjct: 136 K 136

 Score =  108 bits (270), Expect = 2e-22
 Identities = 56/108 (51%), Positives = 59/108 (54%), Gaps = 21/108 (19%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPP-----PPPPPP-----PPPPPPTPPAP-----PPTP 138
           P P P PP   K PP P P P PP     PPPPPP     PPPP P+PP P     PP P
Sbjct: 98  PSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 157

Query: 137 PPNPPP---CPDPPLEPPPPPPVYKYKSPPPPAKK---PYEYPSPPPP 12
            P+PPP      PP   P PPP Y YKSPPPP+     PY Y SPPPP
Sbjct: 158 SPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPP 205

 Score =  108 bits (269), Expect = 2e-22
 Identities = 57/115 (49%), Positives = 62/115 (53%), Gaps = 28/115 (24%)
 Frame = -2

Query: 272 PFPLPTPPPA----PKPPPCPEPPP-----APPPPPPPPPPP-----PPPTPPAPPP--- 144
           P P P+PPP       PPP P PPP     +PPPP P PPPP     PPP  P+PPP   
Sbjct: 155 PPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYV 214

Query: 143 ---TPPPNPPPCP-----DPPLEPPPPPPVYKYKSPPPPAKK---PYEYPSPPPP 12
               PPP+P P P      PP   P PPP Y YKSPPPP+     PY Y SPPPP
Sbjct: 215 YKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 269

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/113 (49%), Positives = 61/113 (53%), Gaps = 28/113 (24%)
 Frame = -2

Query: 266 PLPTPPPA----PKPPPCPEPPP-----APPPPPPPPPPP-----PPPTPPAPPP----- 144
           P P+PPP       PPP P PPP     +PPPP P PPPP     PPP  P+PPP     
Sbjct: 2   PSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYK 61

Query: 143 -TPPPNPPPCP-----DPPLEPPPPPPVYKYKSPPPPAKK---PYEYPSPPPP 12
             PPP+P P P      PP   P PPP Y YKSPPPP+     PY Y SPPPP
Sbjct: 62  SPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 114

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/117 (47%), Positives = 62/117 (52%), Gaps = 30/117 (25%)
 Frame = -2

Query: 272 PFPLPTPPPAPK------PPPCPEPPP-----APPPPPPPPPPP-----PPPTPPAPPP- 144
           P+   +PPP P       PPP P PPP     +PPPP P PPPP     PPP  P+PPP 
Sbjct: 121 PYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPP 180

Query: 143 -----TPPPNPPPCP-----DPPLEPPPPPPVYKYKSPPPPAKK---PYEYPSPPPP 12
                 PPP+P P P      PP   P PPP Y YKSPPPP+     PY Y SPPPP
Sbjct: 181 YIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 237

 Score =  105 bits (262), Expect = 2e-21
 Identities = 55/110 (50%), Positives = 60/110 (54%), Gaps = 29/110 (26%)
 Frame = -2

Query: 254 PPPAPKPPP-----CPEPPP-----APPPPPPPPPPP-----PPPTPPAPPP------TP 138
           PPP+P PPP      P PPP     +PPPP P PPPP     PPP  P+PPP       P
Sbjct: 112 PPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPP 171

Query: 137 PPNPPPCP-----DPPLEPPPPPPVYKYKSPPPPAKK---PYEYPSPPPP 12
           PP+P P P      PP   P PPP Y YKSPPPP+     PY Y SPPPP
Sbjct: 172 PPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 221

 Score =  105 bits (261), Expect = 2e-21
 Identities = 55/108 (50%), Positives = 58/108 (53%), Gaps = 21/108 (19%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPP----PPPPPPPPPPPP----TPPAPPP-----TPPP 132
           P P P PP   K PP P P P PP     PPPP P PPPP    +PP PPP      PPP
Sbjct: 82  PSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPP 141

Query: 131 NPPPCP-----DPPLEPPPPPPVYKYKSPPPPAKK---PYEYPSPPPP 12
           +P P P      PP   P PPP Y YKSPPPP+     PY Y SPPPP
Sbjct: 142 SPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPP 189

 Score =  101 bits (252), Expect = 2e-20
 Identities = 51/98 (52%), Positives = 55/98 (56%), Gaps = 18/98 (18%)
 Frame = -2

Query: 251 PPAPKPPP---CPEPPPAPPPPPPP----PPPPPPPTPPAP-----PPTPPPNPPP---C 117
           PP+P PPP      PPP  P PPPP     PPPP P+PP P     PP P P+PPP    
Sbjct: 1   PPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVY 60

Query: 116 PDPPLEPPPPPPVYKYKSPPPPAKK---PYEYPSPPPP 12
             PP   P PPP Y YKSPPPP+     PY Y SPPPP
Sbjct: 61  KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 98

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 48/96 (50%), Positives = 51/96 (53%), Gaps = 9/96 (9%)
 Frame = -2

Query: 272 PFPLPTPPPA----PKPPPCPEPPP-----APPPPPPPPPPPPPPTPPAPPPTPPPNPPP 120
           P P P+PPP       PPP P PPP     +PPPP P PPPP     P PP   PP P  
Sbjct: 187 PPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYV 246

Query: 119 CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              PP   P PPP Y YKSPPPP+      PSPPPP
Sbjct: 247 YKSPPPPSPSPPPPYVYKSPPPPS------PSPPPP 276

[139][TOP]
>UniRef100_Q42421 Chitinase n=1 Tax=Beta vulgaris subsp. vulgaris RepID=Q42421_BETVU
          Length = 439

 Score =  111 bits (277), Expect = 3e-23
 Identities = 54/92 (58%), Positives = 56/92 (60%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPP---PPPPPTP-PAPPPTPPPNPPPCPDPP 105
           P P P PPP   P P P PPP P PPPP PP   PPPPPTP P PPPTP P PPP P  P
Sbjct: 82  PPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRP-PPPSPPTP 140

Query: 104 LEPPPPPPVYKYKSPP-PPAKKPYEYPSPPPP 12
             PPPPPP     SPP PP+ +P   P P PP
Sbjct: 141 RPPPPPPPSPPTPSPPSPPSPEPPTPPEPTPP 172

 Score =  108 bits (269), Expect = 2e-22
 Identities = 46/85 (54%), Positives = 48/85 (56%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
           P P  PP P+PPP   P P PPPP PP P PPPPTP  PPP PP   PP P  P  PPP 
Sbjct: 51  PTPPRPPTPRPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPR 110

Query: 86  PPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP  +   PP P   P   P PPPP
Sbjct: 111 PPTPRPPPPPTPRPPPPPTPRPPPP 135

 Score =  107 bits (268), Expect = 3e-22
 Identities = 52/93 (55%), Positives = 55/93 (59%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTP-PAPPPT--PPPNPPPCPDPPL 102
           P P P  PP P+PPP   P P PPPP P PPPP PPTP P PPPT  PPP  PP P PP 
Sbjct: 59  PRPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPP 118

Query: 101 EP---PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P   PPPPP  +   P PP  +P   P PPPP
Sbjct: 119 PPTPRPPPPPTPRPPPPSPPTPRP---PPPPPP 148

 Score =  107 bits (268), Expect = 3e-22
 Identities = 48/91 (52%), Positives = 49/91 (53%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272 PFPLPTPP----PAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPP 105
           P P P PP    P P PPP P PPP  PP P PPPPP P  PP P P PPP  PP P PP
Sbjct: 84  PTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPP 143

Query: 104 LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PPP PP     SPP P       P+PP P
Sbjct: 144 PPPPPSPPTPSPPSPPSPEPPTPPEPTPPTP 174

 Score =  107 bits (266), Expect = 5e-22
 Identities = 50/93 (53%), Positives = 53/93 (56%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPP-CPEPPPAPPPPPPPPPP----PPPPTPPAPPPTPPPNP-PPCPD 111
           P P P  PP P+PPP  P PPP  PP P PPPP    PPPP PP P P PPP P PP P 
Sbjct: 69  PRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPPPPP 128

Query: 110 PPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P  PPP PP  +   PPPP+      PSPP P
Sbjct: 129 TPRPPPPSPPTPRPPPPPPPSPPTPSPPSPPSP 161

 Score =  105 bits (262), Expect = 2e-21
 Identities = 49/96 (51%), Positives = 54/96 (56%), Gaps = 7/96 (7%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPC------PEPPPAPPPPPPPPPPPPPPTPPAP-PPTPPPNPPPCP 114
           P P P PPP P+PPP       P PPP P PPPPP P PPPP+PP P PP PPP  PP P
Sbjct: 94  PTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPPPSPPTP 153

Query: 113 DPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
            PP  P P PP     +PP P       P+P PP +
Sbjct: 154 SPPSPPSPEPP-----TPPEPTP-----PTPTPPTH 179

 Score =  104 bits (259), Expect = 3e-21
 Identities = 50/92 (54%), Positives = 52/92 (56%), Gaps = 7/92 (7%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPP--PPPPPPPPPPPTPPAPPPTPPPNP-PPCPDPPLEP 96
           P P PPP P+PP    PPP PP   PPPP P PPPP PP P P PPP P PP P PP   
Sbjct: 57  PTPRPPP-PRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPR 115

Query: 95  PPPPPVYKYKSP----PPPAKKPYEYPSPPPP 12
           PPPPP  +   P    PPP   P   P PPPP
Sbjct: 116 PPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPP 147

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 41/78 (52%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = -2

Query: 242 PKPPPCPEPP-PAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYK 66
           P  P  P PP P PPPP PP P PPPP PP P P PP   PP P PP   PPPPP  +  
Sbjct: 48  PSRPTPPRPPTPRPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPP 107

Query: 65  SPPPPAKKPYEYPSPPPP 12
            P PP  +P   P+P PP
Sbjct: 108 PPRPPTPRPPPPPTPRPP 125

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 37/77 (48%), Positives = 40/77 (51%), Gaps = 5/77 (6%)
 Frame = -2

Query: 227 CPEPPPAPPPPPPPPPP-PPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPP 51
           C    P+ P PP PP P PPPP PP P P PP  P P P PP   PPPP     + PPPP
Sbjct: 43  CSVGRPSRPTPPRPPTPRPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPP 102

Query: 50  AKKP----YEYPSPPPP 12
             +P       P PPPP
Sbjct: 103 TPRPPPPRPPTPRPPPP 119

[140][TOP]
>UniRef100_Q5CLM1 Putative uncharacterized protein n=1 Tax=Cryptosporidium hominis
            RepID=Q5CLM1_CRYHO
          Length = 2646

 Score =  111 bits (277), Expect = 3e-23
 Identities = 54/111 (48%), Positives = 58/111 (52%), Gaps = 24/111 (21%)
 Frame = -2

Query: 272  PFPLPTPPP---APKPPPCPEPPPAPPPPPP-----------PPP----PPPPPTPPAPP 147
            P P P PPP   +P PPP P PP +PPPPPP           PPP    PPPPP PP PP
Sbjct: 2151 PPPPPIPPPPSFSPPPPPIPPPPSSPPPPPPVPEYPPLSSAIPPPPSFSPPPPPIPPPPP 2210

Query: 146  PTP------PPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P P      P +P P P PP  PPPPPP  +Y  P  P   P   P PPPP
Sbjct: 2211 PIPSPPSPIPSSPSPIPSPPSSPPPPPPKPEYPPPSSPIPSPPSSPPPPPP 2261

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 44/89 (49%), Positives = 49/89 (55%), Gaps = 4/89 (4%)
 Frame = -2

Query: 260  PTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTP--PPNPPPCPDPPLEPPPP 87
            P PPP P PPP    PP+P P  P P P PP +PP PPP P  PP   P P PP  PPPP
Sbjct: 2200 PPPPPIPPPPPPIPSPPSPIPSSPSPIPSPPSSPPPPPPKPEYPPPSSPIPSPPSSPPPP 2259

Query: 86   PPVYKYKSP--PPPAKKPYEYPSPPPPVY 6
            PP  +Y  P  P P   P   P+PP P +
Sbjct: 2260 PPKPEYPPPSSPIPTLPPSSPPTPPMPAF 2288

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 45/94 (47%), Positives = 50/94 (53%), Gaps = 8/94 (8%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPP--------PCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPC 117
            P P P PPP P PP        P P PP +PPPPPP P  PPP +P   PP+ PP PPP 
Sbjct: 2204 PIP-PPPPPIPSPPSPIPSSPSPIPSPPSSPPPPPPKPEYPPPSSPIPSPPSSPPPPPPK 2262

Query: 116  PDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPP 15
            P+ P  P  P P     SPP P    +  PSPPP
Sbjct: 2263 PEYP-PPSSPIPTLPPSSPPTPPMPAFP-PSPPP 2294

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 42/94 (44%), Positives = 48/94 (51%), Gaps = 5/94 (5%)
 Frame = -2

Query: 272  PFPLPTPP-PAPKPPPCPEPPPAPP--PPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPL 102
            P P+P+ P P P PP  P PPP  P  PPP  P P PP +PP PPP P   PP  P P L
Sbjct: 2216 PSPIPSSPSPIPSPPSSPPPPPPKPEYPPPSSPIPSPPSSPPPPPPKPEYPPPSSPIPTL 2275

Query: 101  EP--PPPPPVYKYKSPPPPAKKPYEYPSPPPPVY 6
             P  PP PP+  +   PPP       P  P P +
Sbjct: 2276 PPSSPPTPPMPAFPPSPPPTT-----PGVPSPTF 2304

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 44/95 (46%), Positives = 49/95 (51%), Gaps = 8/95 (8%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPC-PE--PPPAPPPPPPPPPPPPPPTPPAPP-----PTPPPNPPPC 117
            P P+P+PP +P PPP  PE  PP +P P PP  PPPPPP P  PP     PT PP+ PP 
Sbjct: 2223 PSPIPSPPSSPPPPPPKPEYPPPSSPIPSPPSSPPPPPPKPEYPPPSSPIPTLPPSSPPT 2282

Query: 116  PDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P  P  PP PPP       P P       P P  P
Sbjct: 2283 PPMPAFPPSPPPT--TPGVPSPTFPSQLSPIPEAP 2315

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 47/95 (49%), Positives = 49/95 (51%), Gaps = 22/95 (23%)
 Frame = -2

Query: 230  PCPEPPP--APPPPPPPPP---PPPPPTPPAP--PPTPPP-----------NPPP--CPD 111
            P P PP    PPPP PPPP   PPPPP PP P  PP PPP            PPP   P 
Sbjct: 2142 PIPTPPSFSPPPPPIPPPPSFSPPPPPIPPPPSSPPPPPPVPEYPPLSSAIPPPPSFSPP 2201

Query: 110  PPLEPPPPPPVYKYKSPPPPAKKPYEYP--SPPPP 12
            PP  PPPPPP+    SP P +  P   P  SPPPP
Sbjct: 2202 PPPIPPPPPPIPSPPSPIPSSPSPIPSPPSSPPPP 2236

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 38/89 (42%), Positives = 41/89 (46%), Gaps = 5/89 (5%)
 Frame = -2

Query: 263  LPTPP-PAPKPPPCPEPPPAPPPPPPPPPPPPP-PTPPAPPPTPPPNPPPCP---DPPLE 99
            +PTP  PAP  PP P P  + P  P P  P P  P P  P PT PP P P P    P L 
Sbjct: 2483 IPTPTIPAPTIPPTPTPTISTPTIPTPTIPTPTIPAPTIPAPTIPPTPTPTPTISTPTLP 2542

Query: 98   PPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P   PP        PPA  P   P+P PP
Sbjct: 2543 PQTLPPAL------PPALPPTITPTPTPP 2565

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/100 (36%), Positives = 39/100 (39%), Gaps = 14/100 (14%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPP--------------PTPPAPPPTPPPN 129
            PLP  PP  K P  P  P  PP PP P  P  P              PTP  P PT PP 
Sbjct: 2437 PLPPLPPTSKVPTLPTLPLLPPLPPTPKAPTLPTPTISTPTIPTPTIPTPTIPAPTIPPT 2496

Query: 128  PPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            P P    P  P P  P     +P  PA      P+P P +
Sbjct: 2497 PTPTISTPTIPTPTIPTPTIPAPTIPAPTIPPTPTPTPTI 2536

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 39/105 (37%), Positives = 43/105 (40%), Gaps = 20/105 (19%)
 Frame = -2

Query: 266  PLPTPPPAPKPPP-CPEPPPAPPPPPP---------PPPPPPPPTPPAPP-PTPPPNPPP 120
            P+PT PP P P P  P   P PP PP          P  PP PPTP AP  PTP  + P 
Sbjct: 2418 PIPTVPPTPIPTPKAPTLSPLPPLPPTSKVPTLPTLPLLPPLPPTPKAPTLPTPTISTPT 2477

Query: 119  CPDP---------PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             P P         P  PP P P     + P P       P+P  P
Sbjct: 2478 IPTPTIPTPTIPAPTIPPTPTPTISTPTIPTPTIPTPTIPAPTIP 2522

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 32/77 (41%), Positives = 33/77 (42%), Gaps = 15/77 (19%)
 Frame = -2

Query: 266  PLPTPPPAPKP--------------PPCPEPP-PAPPPPPPPPPPPPPPTPPAPPPTPPP 132
            P PT PP P P              P  P P  PAP  PP P P P   TP  PP T PP
Sbjct: 2489 PAPTIPPTPTPTISTPTIPTPTIPTPTIPAPTIPAPTIPPTPTPTPTISTPTLPPQTLPP 2548

Query: 131  NPPPCPDPPLEPPPPPP 81
              PP   P + P P PP
Sbjct: 2549 ALPPALPPTITPTPTPP 2565

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 40/118 (33%), Positives = 42/118 (35%), Gaps = 35/118 (29%)
 Frame = -2

Query: 254  PPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPA-------------------------- 153
            P   P  P   E P A   P  P     P TP A                          
Sbjct: 2081 PSSVPGSPTASETPIATGSPMTPESLTAPGTPVAAGSPMVTAPSLVSGVASPAEVSSIAG 2140

Query: 152  -PPPTPP---PNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPS-----PPPPVY 6
             P PTPP   P PPP P PP   PPPPP+    S PPP     EYP      PPPP +
Sbjct: 2141 TPIPTPPSFSPPPPPIPPPPSFSPPPPPIPPPPSSPPPPPPVPEYPPLSSAIPPPPSF 2198

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/94 (38%), Positives = 40/94 (42%), Gaps = 9/94 (9%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPP----PAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLE 99
            P PT PPAP  P   + P      P  P P  PP P PTP AP  +P P  PP    P  
Sbjct: 2391 PTPTFPPAPTLPSTSKLPTPTISTPTIPIPTVPPTPIPTPKAPTLSPLPPLPPTSKVPTL 2450

Query: 98   P-----PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P     PP PP  K  + P P       P+P  P
Sbjct: 2451 PTLPLLPPLPPTPKAPTLPTPTISTPTIPTPTIP 2484

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 26/60 (43%), Positives = 26/60 (43%)
 Frame = -2

Query: 266  PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPPPP 87
            P PT P    P P   P P P P    P  PP   PPA PP  PP   P P PP  P  P
Sbjct: 2512 PTPTIPAPTIPAPTIPPTPTPTPTISTPTLPPQTLPPALPPALPPTITPTPTPPTLPQTP 2571

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 32/88 (36%), Positives = 34/88 (38%), Gaps = 4/88 (4%)
 Frame = -2

Query: 263  LPTP----PPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEP 96
            LPTP    P  P P   P P P P  P   P PP PPT   P     P  PP P  P  P
Sbjct: 2407 LPTPTISTPTIPIPTVPPTPIPTPKAPTLSPLPPLPPTSKVPTLPTLPLLPPLPPTPKAP 2466

Query: 95   PPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
              P P     + P P       P+P  P
Sbjct: 2467 TLPTPTISTPTIPTPTIPTPTIPAPTIP 2494

[141][TOP]
>UniRef100_B7PAQ3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PAQ3_IXOSC
          Length = 235

 Score =  110 bits (276), Expect = 4e-23
 Identities = 52/74 (70%), Positives = 52/74 (70%)
 Frame = +1

Query: 52  GGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHG 231
           GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G G
Sbjct: 168 GGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 221

Query: 232 GGFGAGGGVGSGNG 273
           GG G GGG G G G
Sbjct: 222 GGGGGGGGGGGGGG 235

 Score =  109 bits (272), Expect = 1e-22
 Identities = 54/81 (66%), Positives = 54/81 (66%)
 Frame = +1

Query: 13  GGGGDGYSYGFLAGGGGDLYL*TGGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGG 192
           GGGG G       GGGG      GGGGGG  GG G GGG GGG GGG GG GGGGGGGGG
Sbjct: 168 GGGGGG-------GGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 214

Query: 193 GGGGGAGGGSGHGGGFGAGGG 255
           GGGGG GGG G GGG G GGG
Sbjct: 215 GGGGGGGGGGGGGGGGGGGGG 235

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 45/64 (70%), Positives = 45/64 (70%)
 Frame = +1

Query: 82  GGGGGGSNGGSGHGGGFGGGVGGGAGGVGGGGGGGGGGGGGGAGGGSGHGGGFGAGGGVG 261
           G   GG  GG G GGG GGG GGG GG GGGGGGGGGGGGGG GGG G GGG G GGG G
Sbjct: 164 GSERGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 223

Query: 262 SGNG 273
            G G
Sbjct: 224 GGGG 227

[142][TOP]
>UniRef100_Q9M6R7 Extensin n=1 Tax=Pisum sativum RepID=Q9M6R7_PEA
          Length = 327

 Score =  110 bits (276), Expect = 4e-23
 Identities = 62/125 (49%), Positives = 68/125 (54%), Gaps = 35/125 (28%)
 Frame = -2

Query: 272 PFPLPTPPP----APKPPPCPEPPP-----APPPPPP-------PPPP------PPPPTP 159
           P P+ +PPP    +  PPP   PPP     +PPPPP        PPPP      PPPP  
Sbjct: 46  PPPVHSPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPVH 105

Query: 158 PAPPPTPPPNPPPCP-------DPPLEPP------PPPPVYKYKSPPPPAKKPYEYPSPP 18
             PPP    +PPP P        PP  PP      PPPPVYKYKSPPPP KKPY+Y SPP
Sbjct: 106 SPPPPYHYSSPPPPPKKSYKYSSPP--PPVYKYKSPPPPVYKYKSPPPPVKKPYKYSSPP 163

Query: 17  PPVYK 3
           PPVYK
Sbjct: 164 PPVYK 168

 Score =  100 bits (249), Expect = 5e-20
 Identities = 61/141 (43%), Positives = 68/141 (48%), Gaps = 51/141 (36%)
 Frame = -2

Query: 272 PFPLPTPPPAPK------------------PPPCPEPPP-----APPPPP--------PP 186
           P+   +PPP PK                  PPP   PPP     +PPPPP        PP
Sbjct: 71  PYHYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPP 130

Query: 185 PP------PPPP------PTPPAPPPTPPPNPPP------CPDPPLEP--PPPPPVYKYK 66
           PP      PPPP      P PP   P    +PPP       P PP+     PPPPVYKY+
Sbjct: 131 PPVYKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYQ 190

Query: 65  SPPPPAKKPYEYPSPPPPVYK 3
           SPPPP KK Y+YPSPPPPVYK
Sbjct: 191 SPPPP-KKSYKYPSPPPPVYK 210

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/110 (50%), Positives = 59/110 (53%), Gaps = 22/110 (20%)
 Frame = -2

Query: 269 FPLPTPPPAPKPPPCPEPPPAPPPPP-----PPPP-----PPPPPTPPAPPPTP--PPNP 126
           +P P PP    PPP P    +PPPPP     PPPP      PPPP     PPTP  P   
Sbjct: 201 YPSPPPPVYKSPPP-PYKYQSPPPPPYKYSSPPPPVYKYNSPPPPYKHISPPTPGKPFKF 259

Query: 125 PPCPDPPLE---PPP---PPPVYKYKSPPPPAKKP----YEYPSPPPPVY 6
           PP P P  +   PPP   PPPVYKYKSPPPP   P    Y Y SPPPPVY
Sbjct: 260 PPPPTPIYKYKSPPPVYSPPPVYKYKSPPPPVYSPPPPHYVYSSPPPPVY 309

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 50/102 (49%), Positives = 56/102 (54%), Gaps = 18/102 (17%)
 Frame = -2

Query: 257 TPPPAPKPPPCPEPPPAPPPPPPPP-----PPPPPPTPPAPPP------TPPPN----PP 123
           +PPP  K    P PPP     PPPP     PPPPP    +PPP      +PPP      P
Sbjct: 191 SPPPPKKSYKYPSPPPPVYKSPPPPYKYQSPPPPPYKYSSPPPPVYKYNSPPPPYKHISP 250

Query: 122 PCPDPPLE-PPPPPPVYKYKSPPPPAKKP--YEYPSPPPPVY 6
           P P  P + PPPP P+YKYKSPPP    P  Y+Y SPPPPVY
Sbjct: 251 PTPGKPFKFPPPPTPIYKYKSPPPVYSPPPVYKYKSPPPPVY 292

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 52/119 (43%), Positives = 58/119 (48%), Gaps = 35/119 (29%)
 Frame = -2

Query: 254 PPPAPKPPPCPEPPP------APPPP------PPPP------PPPPP-----PTPPAPPP 144
           PPP  KP     PPP      +PPPP      PPPP      PPPP      P+PP P  
Sbjct: 150 PPPVKKPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYQSPPPPKKSYKYPSPPPPVY 209

Query: 143 TPPPNPPPCPDPPLEP----PPPPPVYKYKSPPPPAK--------KPYEYPSPPPPVYK 3
             PP P     PP  P     PPPPVYKY SPPPP K        KP+++P PP P+YK
Sbjct: 210 KSPPPPYKYQSPPPPPYKYSSPPPPVYKYNSPPPPYKHISPPTPGKPFKFPPPPTPIYK 268

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 57/132 (43%), Positives = 64/132 (48%), Gaps = 42/132 (31%)
 Frame = -2

Query: 272 PFPLPTPPPAPK--------PPPC---PEPPP------APPPP---------PPPP---- 183
           P+   +PPP PK        PPP      PPP      +PPPP         PPPP    
Sbjct: 110 PYHYSSPPPPPKKSYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKY 169

Query: 182 --PPPP------PPTP----PAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKP 39
             PPPP      PP P     +PPP       P P PP+   PPPP YKY+SPPPP   P
Sbjct: 170 KSPPPPVYKYKSPPPPVYKYQSPPPPKKSYKYPSPPPPVYKSPPPP-YKYQSPPPP---P 225

Query: 38  YEYPSPPPPVYK 3
           Y+Y SPPPPVYK
Sbjct: 226 YKYSSPPPPVYK 237

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 39/70 (55%), Positives = 43/70 (61%), Gaps = 5/70 (7%)
 Frame = -2

Query: 197 PPPPPPP-----PPPPTPPAPPPTPPPNPPPCPDPPLEPPPPPPVYKYKSPPPPAKKPYE 33
           PPPPP P     PPPP    PPP    +PPP    P+  PPPP  Y Y SPPPP KK Y+
Sbjct: 33  PPPPPKPYYYQSPPPPVHSPPPPYHYSSPPP----PVHSPPPP--YHYSSPPPPPKKSYK 86

Query: 32  YPSPPPPVYK 3
           Y SPPPP+YK
Sbjct: 87  YSSPPPPIYK 96

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 38/86 (44%), Positives = 42/86 (48%), Gaps = 12/86 (13%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAP------PPPPPPPPP------PPPPTPPAPPPTPPPN 129
           P+   +PP   KP   P PPP P      PPP   PPP      PPPP    PPP    +
Sbjct: 244 PYKHISPPTPGKPFKFP-PPPTPIYKYKSPPPVYSPPPVYKYKSPPPPVYSPPPPHYVYS 302

Query: 128 PPPCPDPPLEPPPPPPVYKYKSPPPP 51
            PP   PP+  PPPP  Y Y SPPPP
Sbjct: 303 SPP---PPVYSPPPPH-YIYASPPPP 324

[143][TOP]
>UniRef100_Q6SSE8 Minus agglutinin n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q6SSE8_CHLRE
          Length = 3889

 Score =  110 bits (276), Expect = 4e-23
 Identities = 49/86 (56%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = -2

Query: 266 PLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPP-PTPPPNPPPCPDPPLEPPP 90
           P P PPP P  PP P   P+PPP PPPP  PPPP P  PP P+PPP PPP P PP  PPP
Sbjct: 699 PRPPPPPLPPSPPLPPVTPSPPPRPPPPKSPPPPKPSPPPRPSPPPRPPPRPLPPSPPPP 758

Query: 89  PPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP      SP PP+  P   PS PPP
Sbjct: 759 PPLPPNPPSPAPPSPPPPPSPSIPPP 784

 Score =  107 bits (266), Expect = 5e-22
 Identities = 50/87 (57%), Positives = 54/87 (62%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDPPLEPP 93
           P P P PP +P PPP P PPP P PPP PPP P PP+PP PPP PP   PP P PP  PP
Sbjct: 719 PPPRPPPPKSP-PPPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLPP--NPPSPAPPSPPP 775

Query: 92  PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
           PP P     SP PP+ +P   PSP PP
Sbjct: 776 PPSPSIPPPSPGPPSPEP---PSPAPP 799

 Score =  106 bits (264), Expect = 9e-22
 Identities = 51/90 (56%), Positives = 52/90 (57%), Gaps = 3/90 (3%)
 Frame = -2

Query: 272 PFPLPTPPPAPKPPPCPEPPPAPPPP--PPPPPPPPPPTPPAPPPTPPPNP-PPCPDPPL 102
           P P P PP  P PP  P PPP PPPP  PPPP P PPP  P+PPP PPP P PP P PP 
Sbjct: 701 PPPPPLPPSPPLPPVTPSPPPRPPPPKSPPPPKPSPPPR-PSPPPRPPPRPLPPSPPPPP 759

Query: 101 EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             PP PP     SPPPP       PSP PP
Sbjct: 760 PLPPNPPSPAPPSPPPPPSPSIPPPSPGPP 789

 Score =  105 bits (262), Expect = 2e-21
 Identities = 58/106 (54%), Positives = 62/106 (58%), Gaps = 19/106 (17%)
 Frame = -2

Query: 272  PFPLPTPP-PAPKPPP-CPEPP-PAPPPPPPP--------PPPPPPPTPPAPPPTPPPNP 126
            P P P PP PAP PPP  PEPP PAPP PPPP        PP PPPP+P  P P PP  P
Sbjct: 922  PPPSPEPPSPAPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPLPPPPSPEPPSPAPPSPP 981

Query: 125  PPCPDPPLE---PPPP---PPVYKYKSPPPPAKKPYE--YPSPPPP 12
            PP P+PP     PPPP   PP     SPPPP+ +P     PSPPPP
Sbjct: 982  PPSPEPPSPAPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPP 1027

 Score =  105 bits (261), Expect = 2e-21
 Identities = 55/99 (55%), Positives = 58/99 (58%), Gaps = 12/99 (12%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPPPCPEPPPAPPP----PPPPPPPPPPPTPPAP-PPTPPPN-----PP 123
            P P   PPP P PPP P PPP PPP    P PPPPPP PP PP+P PP+PPP      PP
Sbjct: 724  PPPKSPPPPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLPPNPPSPAPPSPPPPPSPSIPP 783

Query: 122  PCPDPPL-EPP-PPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P P PP  EPP P PP     SP PP+  P   PSP PP
Sbjct: 784  PSPGPPSPEPPSPAPPSAAPPSPMPPSPAP---PSPDPP 819

 Score =  104 bits (260), Expect = 3e-21
 Identities = 52/96 (54%), Positives = 55/96 (57%), Gaps = 9/96 (9%)
 Frame = -2

Query: 272  PFPLPTPP------PAPK--PPPCPEPP-PAPPPPPPPPPPPPPPTPPAPPPTPPPNPPP 120
            P PLP PP      PAP   PPP PEPP PAPP PPPP P PP P PP+PPP  P  P P
Sbjct: 990  PAPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSP 1049

Query: 119  CPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
             P  P  P P PP     SP PP+ +P   PSP PP
Sbjct: 1050 APPSPAPPSPEPPSPAPPSPAPPSPEP---PSPAPP 1082

 Score =  104 bits (259), Expect = 3e-21
 Identities = 51/98 (52%), Positives = 57/98 (58%), Gaps = 10/98 (10%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPP---------PCPEPP-PAPPPPPPPPPPPPPPTPPAPPPTPPPNPP 123
            P P   PPP+P+PP         P PEPP PAPP PPPP P PP P PP+PPP  P  P 
Sbjct: 871  PAPPSPPPPSPEPPSPAPPSPPLPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPS 930

Query: 122  PCPDPPLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPPV 9
            P P PP  P P PP     SPPPP+ +P   PSP PP+
Sbjct: 931  PAPSPP-PPSPEPPSPAPPSPPPPSPEP---PSPAPPL 964

 Score =  103 bits (258), Expect = 5e-21
 Identities = 57/106 (53%), Positives = 61/106 (57%), Gaps = 19/106 (17%)
 Frame = -2

Query: 272  PFPLPTPP-PAPK--PPPCPEPPPAPPPPPPPP--------PPPPPPTP----PAPPPTP 138
            P P P PP PAP   PPP PEPP   PP PPPP        P PPPP+P    PAPP  P
Sbjct: 892  PLPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPAPPSPP 951

Query: 137  PPNP-PPCPDPPLEPP--PPPPVYKYKSPPPPA-KKPYEYPSPPPP 12
            PP+P PP P PPL PP  P PP     SPPPP+ + P   P PPPP
Sbjct: 952  PPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPLPPPP 997

 Score =  103 bits (257), Expect = 6e-21
 Identities = 49/93 (52%), Positives = 54/93 (58%), Gaps = 6/93 (6%)
 Frame = -2

Query: 272  PFPLPTPPPAPKPP-PCPEPPPAPPPPPPPPPP-PPPPTPPAPPPTPPPNPPPCPDPPL- 102
            P P   PPP+P+PP P P PPP  P PP P PP PPPP+P  P P PP  PPP P+PP  
Sbjct: 975  PAPPSPPPPSPEPPSPAPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSP 1034

Query: 101  ---EPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
                PPPP P     +PP PA    E PSP PP
Sbjct: 1035 APPSPPPPSPEPPSPAPPSPAPPSPEPPSPAPP 1067

 Score =  103 bits (256), Expect = 8e-21
 Identities = 49/92 (53%), Positives = 53/92 (57%), Gaps = 5/92 (5%)
 Frame = -2

Query: 272  PFPLPTPPPAPKP-PPCPEPP----PAPPPPPPPPPPPPPPTPPAPPPTPPPNPPPCPDP 108
            P P P  PP P P PP P PP    P+P PP P PP PPPP+P  P P PP  PPP P+P
Sbjct: 869  PSPAPPSPPPPSPEPPSPAPPSPPLPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEP 928

Query: 107  PLEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
            P   P PPP     SP PP+  P   PSPPPP
Sbjct: 929  PSPAPSPPP----PSPEPPSPAP---PSPPPP 953

 Score =  102 bits (254), Expect = 1e-20
 Identities = 53/99 (53%), Positives = 57/99 (57%), Gaps = 12/99 (12%)
 Frame = -2

Query: 272  PFPLPTPPPA------PKPPPCPEPPPAPPPPPPPPPPPPPPTPPAPPPTPPPNP---PP 120
            P P P+PPPA      P PP  P P P PP P PP PPPP P PP+P P  PP P   PP
Sbjct: 841  PVP-PSPPPASPEPTSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPLPSPEPP 899

Query: 119  CPDPPLEPP--PPPPVYKYKSPPPPA-KKPYEYPSPPPP 12
             P PPL PP  P PP     SPPPP+ + P   PSPPPP
Sbjct: 900  SPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPSPPPP 938

 Score =  102 bits (254), Expect = 1e-20
 Identities = 49/91 (53%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = -2

Query: 272  PFPLPTPPPAPKP-PPCPEPPPAPPPPPPPPPP---PPPPTPPAPPPTPPPNPPPCPDPP 105
            P P P  PP P P PP P PP  PPP P PP P   PPPP+P  P P PP  PPP P+PP
Sbjct: 958  PSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPLPPPPSPEPPSPAPPSPPPPSPEPP 1017

Query: 104  LEPPPPPPVYKYKSPPPPAKKPYEYPSPPPP 12
               PP PP     SP