BB936975 ( RCC09995 )

[UP]


[1][TOP]
>UniRef100_Q9C668 Putative uncharacterized protein F28B23.10 n=1 Tax=Arabidopsis
           thaliana RepID=Q9C668_ARATH
          Length = 478

 Score =  172 bits (436), Expect = 1e-41
 Identities = 76/109 (69%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 63  PPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP 122

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVYNSPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 123 PPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 171

 Score =  171 bits (434), Expect = 2e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPY+Y SPPPP       PPPPY+YKSPPP
Sbjct: 73  PPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPP 132

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVYNSPPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 133 PPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 181

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 83  PPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPP 142

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 143 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 191

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 143 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 202

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 203 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 251

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 153 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 212

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 213 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 261

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 163 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 222

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 223 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 271

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 173 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 232

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 233 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 281

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 183 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 242

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 243 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 291

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 193 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 252

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 253 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 301

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 203 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 262

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 263 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 311

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 213 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 272

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 273 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 321

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 223 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 282

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 283 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 331

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 233 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 292

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 293 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPP 341

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 243 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 302

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 303 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPP 351

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 253 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 312

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 313 PPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPP 361

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 80/109 (73%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P+     +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 353 PPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 412

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVYKSP PPPYVYKSPP
Sbjct: 413 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPP 461

 Score =  170 bits (430), Expect = 5e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 93  PPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPP 152

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 153 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 201

 Score =  170 bits (430), Expect = 5e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 103 PPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPP 162

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 163 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 211

 Score =  170 bits (430), Expect = 5e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 113 PPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 172

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 173 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 221

 Score =  170 bits (430), Expect = 5e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 123 PPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 182

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 183 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 231

 Score =  170 bits (430), Expect = 5e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 133 PPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 192

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 193 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 241

 Score =  169 bits (428), Expect = 9e-41
 Identities = 75/109 (68%), Positives = 78/109 (71%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 263 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 322

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVYNSPPPPPYVYKSPPPPPYVY SPPP PYVYKSPP
Sbjct: 323 PPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPP 371

 Score =  169 bits (428), Expect = 9e-41
 Identities = 75/109 (68%), Positives = 78/109 (71%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 273 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 332

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVYNSPPPPPYVY SPPPPPYVY SPPP PYVYKSPPPPPYVY SPP
Sbjct: 333 PPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPP 381

 Score =  167 bits (422), Expect = 4e-40
 Identities = 74/109 (67%), Positives = 78/109 (71%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPP        PPPPY+Y SPPP
Sbjct: 323 PPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPP 382

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 383 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 431

 Score =  167 bits (422), Expect = 4e-40
 Identities = 74/109 (67%), Positives = 78/109 (71%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPP PYVY SPPPP       PPPPY+YKSPPP
Sbjct: 333 PPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 392

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 393 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 441

 Score =  165 bits (417), Expect = 2e-39
 Identities = 68/83 (81%), Positives = 72/83 (86%), Gaps = 6/83 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP----S--PPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPPPYVY SPPPP       PPPPY+Y SPPPPPY+Y SPPPPPYVY+SPPPPPY+YK
Sbjct: 49  SPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYK 108

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPPYVY SPPPPPYVYKSPP
Sbjct: 109 SPPPPPYVYSSPPPPPYVYKSPP 131

 Score =  160 bits (405), Expect = 4e-38
 Identities = 68/91 (74%), Positives = 73/91 (80%), Gaps = 11/91 (12%)
 Frame = +1

Query: 70  SPFSPP-----PPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSP 216
           SP SPP     PP ++Y SPPPP       PPPPYIYKSPPPPPYVY+SPPPPPY+Y SP
Sbjct: 31  SPPSPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSP 90

Query: 217 PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPPPYVY SPPPPPY+YKSPPPPPYVY SPP
Sbjct: 91  PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPP 121

 Score =  160 bits (405), Expect = 4e-38
 Identities = 76/108 (70%), Positives = 78/108 (72%), Gaps = 6/108 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPPYI-YKSPPP 162
           PP   V SSP  S  +  S        PPPPPYVY SPPPP     SPPPP   Y SPPP
Sbjct: 351 PPPPYVYSSPPPSPYVYKS--------PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 402

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
           PPYVY SPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSP
Sbjct: 403 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 450

 Score =  159 bits (402), Expect = 9e-38
 Identities = 76/109 (69%), Positives = 79/109 (72%), Gaps = 14/109 (12%)
 Frame = +1

Query: 25  SPNSSTKITPSGIGVSP-------FSPPPPPY-VYPSPPPP------SPPPPYIYKSPPP 162
           SP S     P+ I  SP        SPPPPPY  Y SPPPP       PPPPYIYKSPPP
Sbjct: 34  SPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYI-YKSPPPPPYVYSSPPPPPYIYKSPPP 92

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPY+Y SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 93  PPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPP 141

 Score =  159 bits (402), Expect = 9e-38
 Identities = 73/111 (65%), Positives = 77/111 (69%), Gaps = 8/111 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPP--------PPSPPPPYIYKSP 156
           PP+   S  P      +P        SPPPPPYVY SPP        P  PPPPY+Y SP
Sbjct: 283 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVYNSP 340

Query: 157 PPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPPPYVY SPPPPPYVY+SPPP PYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 341 PPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPP 391

 Score =  159 bits (401), Expect = 1e-37
 Identities = 68/86 (79%), Positives = 70/86 (81%), Gaps = 9/86 (10%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPS------PPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPPPYVY SPPPP       PPPPY+Y SPPPPPYVY SPPPPPYVY+SPPPPPYVYK
Sbjct: 389 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYK 448

Query: 241 SPPPPPYVYKSPPPPP---YVYKSPP 309
           SP PPPYVYKSPPPPP   Y Y SPP
Sbjct: 449 SPSPPPYVYKSPPPPPSYSYSYSSPP 474

 Score =  140 bits (354), Expect = 3e-32
 Identities = 57/74 (77%), Positives = 61/74 (82%), Gaps = 3/74 (4%)
 Frame = +1

Query: 97  YVYPSPPPPS---PPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVY 267
           Y Y  P PPS    PP +IY SPPPPPYVY+SPPPPPY+Y SPPPPPYVY SPPPPPY+Y
Sbjct: 28  YTYSPPSPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIY 87

Query: 268 KSPPPPPYVYKSPP 309
           KSPPPPPYVY SPP
Sbjct: 88  KSPPPPPYVYSSPP 101

 Score =  137 bits (346), Expect = 3e-31
 Identities = 64/106 (60%), Positives = 69/106 (65%), Gaps = 7/106 (6%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 373 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 432

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPP-PYVYKSPPPPPYVY 297
           PPYVY+SPPPPPYVY SP PPPYVYKSPPPP  Y Y    PPP +Y
Sbjct: 433 PPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPPPPIY 478

[2][TOP]
>UniRef100_Q9C669 Putative uncharacterized protein F28B23.9 n=1 Tax=Arabidopsis
           thaliana RepID=Q9C669_ARATH
          Length = 443

 Score =  171 bits (434), Expect = 2e-41
 Identities = 79/116 (68%), Positives = 82/116 (70%), Gaps = 13/116 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP-------FSPPPPPYVYPSPPPPS------PPPPY 141
           PP+   S SP       P  I  SP        SPPPPPYVY SPPPP       PPPPY
Sbjct: 46  PPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPY 105

Query: 142 IYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           +YKSPPPPPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVY SPPPPPYVYKSPP
Sbjct: 106 VYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPP 161

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 173 PPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 232

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 233 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 281

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 79/109 (72%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 183 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 242

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 243 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 291

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 80/109 (73%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 223 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 282

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY+SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 283 PPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPP 331

 Score =  170 bits (431), Expect = 4e-41
 Identities = 75/109 (68%), Positives = 80/109 (73%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 233 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 292

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 293 PPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPP 341

 Score =  169 bits (428), Expect = 9e-41
 Identities = 74/109 (67%), Positives = 80/109 (73%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 73  PPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 132

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY+SPPPPPYVYKSPPPPPYVY  PPPPPYVY+SPP
Sbjct: 133 PPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPP 181

 Score =  168 bits (426), Expect = 1e-40
 Identities = 74/109 (67%), Positives = 78/109 (71%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY  PPPP       PPPPY+Y SPPP
Sbjct: 133 PPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPP 192

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 193 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 241

 Score =  168 bits (426), Expect = 1e-40
 Identities = 74/109 (67%), Positives = 78/109 (71%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P         PPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 143 PPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPP 202

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 203 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 251

 Score =  164 bits (416), Expect = 2e-39
 Identities = 72/109 (66%), Positives = 77/109 (70%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 83  PPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 142

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY+SPPPPPYVY SPPPPPYVY  PPPPPYVY+SPPPPPYVY SPP
Sbjct: 143 PPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPP 191

 Score =  162 bits (410), Expect = 1e-38
 Identities = 72/109 (66%), Positives = 78/109 (71%), Gaps = 17/109 (15%)
 Frame = +1

Query: 34  SSTKITPSGIGVSPFSP----PPPPYVYPSPPPPS-------------PPPPYIYKSPPP 162
           +S + +P+    SP  P     PPPYVY SP PP              PPPPY+Y SPPP
Sbjct: 23  TSAQYSPTPTPYSPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPP 82

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVYNSPPPPPYVY+SPPPPPYVYKSPPPPPYVY SPPPPPYVYKSPP
Sbjct: 83  PPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 131

 Score =  161 bits (408), Expect = 2e-38
 Identities = 73/112 (65%), Positives = 78/112 (69%), Gaps = 8/112 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 243 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPP 302

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYV--YKSPPS 312
           PPYVY+SPPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYV  Y  PP+
Sbjct: 303 PPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPA 354

 Score =  160 bits (405), Expect = 4e-38
 Identities = 74/119 (62%), Positives = 78/119 (65%), Gaps = 16/119 (13%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPP--------PP--------SPP 132
           PP+   S  P      +P        SPPPPPYVY SPP        PP         PP
Sbjct: 93  PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPP 152

Query: 133 PPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPY+YKSPPPPPYVY+ PPPPPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYVY SPP
Sbjct: 153 PPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 211

 Score =  156 bits (395), Expect = 6e-37
 Identities = 72/110 (65%), Positives = 75/110 (68%), Gaps = 7/110 (6%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+Y SPPP
Sbjct: 253 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPP 312

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYK-SPPPPPYVYKSPP 309
           PPYVY SPPPPPYVY SPPPPPYVYKSPPPPPYV   SPPP PYVYK PP
Sbjct: 313 PPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPP 362

 Score =  146 bits (368), Expect = 8e-34
 Identities = 70/110 (63%), Positives = 73/110 (66%), Gaps = 7/110 (6%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
           PP+   S  P      +P        SPPPPPYVY SPPPP       PPPPY+YKSPPP
Sbjct: 263 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPP 322

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYK-SPPPPPYVYKSPPPPPYVYKSPP 309
           PPYVY SPPPPPYVY SPPPPPYV   SPPP PYVYK   PPPYVYK PP
Sbjct: 323 PPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYK---PPPYVYKPPP 369

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 50/96 (52%), Positives = 53/96 (55%), Gaps = 9/96 (9%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPP----PPPYVYPSPPPPSP----PPPYIYK-S 153
           PP   V   P    K  P     SP   P    PPPYVY   PPP+P    PPPY+Y  S
Sbjct: 352 PPAPYVYKPPPYVYKPPPYVYNYSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSYS 411

Query: 154 PPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPY 261
           PPP PYVY    PPPYVY+SP PPPY Y SP PP Y
Sbjct: 412 PPPAPYVYK---PPPYVYSSPSPPPY-YSSPSPPLY 443

[3][TOP]
>UniRef100_O65375 F12F1.9 protein n=1 Tax=Arabidopsis thaliana RepID=O65375_ARATH
          Length = 744

 Score =  150 bits (379), Expect = 4e-35
 Identities = 74/113 (65%), Positives = 81/113 (71%), Gaps = 10/113 (8%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPY--------VYPSPPPPSP--PPPYIYK 150
           P   A S  P  S+K++PS   V  +SPPPPPY         YP PPPPSP  PPPY+Y 
Sbjct: 417 PTVRAYSPPPPPSSKMSPS---VRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYS 473

Query: 151 SPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP YVY+SPPPPPYVY+SPPPPPYVY S PPPPYVY S PPPPYVY SPP
Sbjct: 474 SPPPP-YVYSSPPPPPYVYSSPPPPPYVYSS-PPPPYVYSS-PPPPYVYSSPP 523

 Score =  127 bits (320), Expect = 3e-28
 Identities = 66/116 (56%), Positives = 74/116 (63%), Gaps = 14/116 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPP----PPPYVYPSPPPP-----SPPPPYIYKS 153
           P   A S  P   +K++PS     P  PP    PPPYVY SPPPP      PPPPY+Y S
Sbjct: 434 PSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSS 493

Query: 154 PPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPP-----PPPYVYKSPPPPPYVYKSP 306
           PPPPPYVY+S PPPPYVY+S PPPPYVY SPP     PPP   +S PPPP VY +P
Sbjct: 494 PPPPPYVYSS-PPPPYVYSS-PPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAP 547

 Score =  119 bits (298), Expect = 1e-25
 Identities = 62/109 (56%), Positives = 63/109 (57%), Gaps = 34/109 (31%)
 Frame = +1

Query: 85  PPPPYVYPSPPPP------------SPPPPYIYK--------SPPPPPYVYNSP------ 186
           PPP YVY SPPPP            SPPPP   K        SPPPPPY   SP      
Sbjct: 398 PPPIYVYSSPPPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYP 457

Query: 187 --------PPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
                   PPPPYVY+S PPPPYVY SPPPPPYVY SPPPPPYVY SPP
Sbjct: 458 PPPPPSPSPPPPYVYSS-PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPP 505

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 61/129 (47%), Positives = 64/129 (49%), Gaps = 26/129 (20%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-SPPPPYIYKSPPPPPYVY 177
           PP   V SSP     +  S      +S PPPPYVY SPPPP   PPP   +S PPPP VY
Sbjct: 485 PPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVY 544

Query: 178 -----NSPPPPPYVY-----NSPPPPPYVY-----KSPPPPPYVY-----KSPPPP---- 285
                 SPPPP  VY      SPPPP  VY      SPPPP  VY      SPPPP    
Sbjct: 545 YAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVY 604

Query: 286 -PYVYKSPP 309
            P V  SPP
Sbjct: 605 YPQVTPSPP 613

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 59/136 (43%), Positives = 65/136 (47%), Gaps = 33/136 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFS---PPPPPYVYP----SPPPPSPP--PPYIYKS 153
           PP   V  +P + +   PS +   P +   PPP P  YP    SPPPPSP   PP  Y  
Sbjct: 538 PPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSP 597

Query: 154 PPPPPYVYN----SPPPP-----PYVYNSPPPPPYVY-----KSPPPPPYVY-----KSP 276
           PPP P  Y     SPPPP     P V  SPPPP  VY      SPPPP  VY      SP
Sbjct: 598 PPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSP 657

Query: 277 PPPPYVY-----KSPP 309
           PPP  VY     +SPP
Sbjct: 658 PPPSPVYYPSETQSPP 673

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 56/122 (45%), Positives = 63/122 (51%), Gaps = 20/122 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP--FSPPPP-----PYVYPSPPPPSP---PPPYIYK 150
           PP S V   P +++   PS +   P  +SPPPP     P V PSPPPPSP   PP  +  
Sbjct: 568 PPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPP--VTP 625

Query: 151 SPPPPPYVYNSPPPPPYVYNSPPPPPYVY-----KSPPPPPYVY-----KSPPPPPYVYK 300
           SPPPP  VY  P  P     SPPPP  VY      SPPPP  VY     +SPPPP   Y 
Sbjct: 626 SPPPPSPVYYPPVTP-----SPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYY 680

Query: 301 SP 306
           SP
Sbjct: 681 SP 682

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/117 (41%), Positives = 54/117 (46%), Gaps = 18/117 (15%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGI---GVSPFSPPPPPYVYPS----PPPP---------SPP 132
           PP S V   P + +   PS +    V+P  PPP P  YPS    PPPP         SPP
Sbjct: 628 PPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPP 687

Query: 133 PPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVY--KSPPPPPYVY 297
           P    K   PP    +  PPP Y Y+S PPPP      PP P V    SPPPPP  Y
Sbjct: 688 PTKACKEGHPPQATPSYEPPPEYSYSSSPPPPSPTSYFPPMPSVSYDASPPPPPSYY 744

[4][TOP]
>UniRef100_Q43682 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q43682_VIGUN
          Length = 280

 Score =  146 bits (369), Expect = 6e-34
 Identities = 80/133 (60%), Positives = 82/133 (61%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSP--- 156
           PP     S P  S    P  +  SP  P   PPPPYVY SPPPPSP  PPPY+YKSP   
Sbjct: 7   PPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 66

Query: 157 ---PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKS 273
              PPPPYVY SP      PPPPYVY SP      PPPPYVYKSP      PPPPYVYKS
Sbjct: 67  SPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKS 126

Query: 274 -PPPPPYVYKSPP 309
            PPPPPYVYKSPP
Sbjct: 127 PPPPPPYVYKSPP 139

 Score =  146 bits (368), Expect = 8e-34
 Identities = 79/133 (59%), Positives = 82/133 (61%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP--PSPPPPYIYKSP--- 156
           PP     S P  S    P  +  SP  P   PPPPYVY SPPP  PSPPPPY+YKSP   
Sbjct: 55  PPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 114

Query: 157 ---PPPPYVYNS-PPPPPYVYNSP------PPPPYVYKSP------PPPPYVYKSP---- 276
              PPPPYVY S PPPPPYVY SP      PPPPYVYKSP      PPPPYVYKSP    
Sbjct: 115 SPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS 174

Query: 277 --PPPPYVYKSPP 309
             PPPPY+YKSPP
Sbjct: 175 PSPPPPYIYKSPP 187

 Score =  145 bits (365), Expect = 2e-33
 Identities = 81/138 (58%), Positives = 82/138 (59%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSP--- 156
           PP     S P  S    P  +  SP  P   PPPPYVY SPPPPSP  PPPYIYKSP   
Sbjct: 130 PPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPP 189

Query: 157 ---PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKS 273
              PPPPYVY SP      PPPPYVY SP      PPPPYVYKSP      PPPPYVYKS
Sbjct: 190 SPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKS 249

Query: 274 P------PPPPYVYKSPP 309
           P      PPPPYVYKSPP
Sbjct: 250 PPPPSPSPPPPYVYKSPP 267

 Score =  140 bits (354), Expect = 3e-32
 Identities = 72/111 (64%), Positives = 73/111 (65%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPYVY SPPP  PSPPPPY+YKSP      PPPPYVY SP      PPPPYVY 
Sbjct: 2   PSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYK 61

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPYVYKSP      PPPPYVYKSP      PPPPYVYKSPP
Sbjct: 62  SPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPP 112

 Score =  134 bits (338), Expect = 2e-30
 Identities = 77/135 (57%), Positives = 79/135 (58%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P  +  SP  P   PPPPYVY SPPPPSP  PPPY+YKSPPPP
Sbjct: 23  PPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 82

Query: 166 ------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPPP-YVY------- 267
                 PYVY SPPPP      PYVY SPPPP      PYVYKSPPPPP YVY       
Sbjct: 83  SPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPS 142

Query: 268 -KSPPPPPYVYKSPP 309
               PPPPYVYKSPP
Sbjct: 143 PS--PPPPYVYKSPP 155

 Score =  134 bits (338), Expect = 2e-30
 Identities = 77/135 (57%), Positives = 79/135 (58%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P  +  SP  P   PPPPYVY SPPPPSP  PPPY+YKSPPPP
Sbjct: 39  PPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 98

Query: 166 ------PYVYNSPPPP------PYVYNSPPPPP-YVYKSPPPP------PYVY------- 267
                 PYVY SPPPP      PYVY SPPPPP YVYKSPPPP      PYVY       
Sbjct: 99  SPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS 158

Query: 268 -KSPPPPPYVYKSPP 309
               PPPPYVYKSPP
Sbjct: 159 PS--PPPPYVYKSPP 171

 Score =  134 bits (338), Expect = 2e-30
 Identities = 76/137 (55%), Positives = 79/137 (57%), Gaps = 34/137 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP--PPPYIYKSPPPP--- 165
           PP     S P  S    P  +  SP  PPPPPYVY SPPPPSP  PPPY+YKSPPPP   
Sbjct: 103 PPPYVYKSPPPPSPSPPPPYVYKSP--PPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPS 160

Query: 166 ---PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP------PYVY----- 267
              PYVY SPPPP      PY+Y SPPPP      PYVYKSPPPP      PYVY     
Sbjct: 161 PPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPP 220

Query: 268 ---KSPPPPPYVYKSPP 309
                 PPPPYVYKSPP
Sbjct: 221 PSPS--PPPPYVYKSPP 235

 Score =  134 bits (337), Expect = 3e-30
 Identities = 76/135 (56%), Positives = 79/135 (58%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P  +  SP  P   PPPPYVY SPPPPSP  PPPY+YKSPPPP
Sbjct: 71  PPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 130

Query: 166 P-YVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP------PYVY------- 267
           P YVY SPPPP      PYVY SPPPP      PYVYKSPPPP      PY+Y       
Sbjct: 131 PPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPS 190

Query: 268 -KSPPPPPYVYKSPP 309
               PPPPYVYKSPP
Sbjct: 191 PS--PPPPYVYKSPP 203

 Score =  130 bits (327), Expect = 4e-29
 Identities = 73/132 (55%), Positives = 76/132 (57%), Gaps = 29/132 (21%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P  +  SP  P   PPPPY+Y SPPPPSP  PPPY+YKSPPPP
Sbjct: 146 PPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPP 205

Query: 166 ------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP------PYVYKS 273
                 PYVY SPPPP      PYVY SPPPP      PYVYKSPPPP      PYVYKS
Sbjct: 206 SPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKS 265

Query: 274 PPPPPYVYKSPP 309
           PPPP      PP
Sbjct: 266 PPPPS-PSPPPP 276

 Score =  129 bits (324), Expect = 1e-28
 Identities = 71/122 (58%), Positives = 73/122 (59%), Gaps = 23/122 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP--PSPPPPYIYKSP--- 156
           PP     S P  S    P  I  SP  P   PPPPYVY SPPP  PSPPPPY+YKSP   
Sbjct: 162 PPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 221

Query: 157 ---PPPPYVYNSPPPPPYVYNSPPPPPYVYKSP------PPPPYVYKSP------PPPPY 291
              PPPPYVY SPPPP    +  PPPPYVYKSP      PPPPYVYKSP      PPPPY
Sbjct: 222 SPSPPPPYVYKSPPPP----SPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPY 277

Query: 292 VY 297
           VY
Sbjct: 278 VY 279

 Score =  122 bits (307), Expect = 9e-27
 Identities = 62/96 (64%), Positives = 63/96 (65%), Gaps = 30/96 (31%)
 Frame = +1

Query: 112 PPPPSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP------PPPPYVY 237
           PP PSPPPPY+YKSP      PPPPYVY SP      PPPPYVY SP      PPPPYVY
Sbjct: 1   PPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVY 60

Query: 238 KSP------PPPPYVYKSP------PPPPYVYKSPP 309
           KSP      PPPPYVYKSP      PPPPYVYKSPP
Sbjct: 61  KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPP 96

[5][TOP]
>UniRef100_Q9STN1 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STN1_ARATH
          Length = 350

 Score =  145 bits (366), Expect = 1e-33
 Identities = 72/116 (62%), Positives = 77/116 (66%), Gaps = 13/116 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF---SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPY 171
           PP   V S P  S  +  S    SP+   SPPPPPYVY SPPPP   PPYIY SPP PPY
Sbjct: 36  PPQPYVYSPPLPSPYVYKSP-PPSPYLYSSPPPPPYVYNSPPPP---PPYIYNSPPRPPY 91

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYK----------SPPPPPYVYKSPP 309
           VY SPPPPP+VY+SPPPP Y+Y SPPPPPYVYK          SPPPPPYVY S P
Sbjct: 92  VYKSPPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYNSAP 147

 Score =  144 bits (364), Expect = 2e-33
 Identities = 64/81 (79%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +1

Query: 70  SPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNS-PPPPPYVYKSP 246
           SP SPPP PYVY SPP PSP   Y+YKSPPP PY+Y+SPPPPPYVYNS PPPPPY+Y SP
Sbjct: 31  SPQSPPPQPYVY-SPPLPSP---YVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSP 86

Query: 247 PPPPYVYKSPPPPPYVYKSPP 309
           P PPYVYKSPPPPP+VY SPP
Sbjct: 87  PRPPYVYKSPPPPPFVYSSPP 107

 Score =  137 bits (345), Expect = 4e-31
 Identities = 76/142 (53%), Positives = 81/142 (57%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF---SPPPPPYVYPSPPPP-----SPPPP-YIYKS 153
           PP   + SSP     +  S     P+   SPP PPYVY SPPPP     SPPPP YIY S
Sbjct: 56  PPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNS 115

Query: 154 PPPPPYVY----------NSPPPPPYVYN----------SPPPPPYV----------YKS 243
           PPPPPYVY          +SPPPPPYVYN          SPPPPPYV          Y S
Sbjct: 116 PPPPPYVYKSVPRITFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVLFIYSS 175

Query: 244 PPPPPYVYKSPPPPPYVYKSPP 309
           PPPPPYVY SPPPPPYVY+S P
Sbjct: 176 PPPPPYVYNSPPPPPYVYESVP 197

 Score =  130 bits (328), Expect = 3e-29
 Identities = 60/103 (58%), Positives = 66/103 (64%), Gaps = 26/103 (25%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP---------------SPPPP-----------YIYKSPPPPPYVYN 180
           SPPPPPYVY SPPPP               SPPPP           +IY SPPPPPYVYN
Sbjct: 175 SPPPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYN 234

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           S P  P++Y+SPPPPPYVYKS P  P++Y SPPPPPYVY S P
Sbjct: 235 SAPRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPPPYVYNSAP 277

 Score =  128 bits (322), Expect = 2e-28
 Identities = 61/112 (54%), Positives = 71/112 (63%), Gaps = 9/112 (8%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF---SPPPPPYVYPSPP------PPSPPPPYIYKS 153
           P  + + SSP     +  S   + PF   SPPPPPYVY S P         PPPPY+Y S
Sbjct: 127 PRITFIYSSPPPPPYVYNSAPRI-PFIYSSPPPPPYVYNSAPRVLFIYSSPPPPPYVYNS 185

Query: 154 PPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPPPPYVY S P  P++Y+SPPPPPYVY S P  P++Y SPPPPPYVY S P
Sbjct: 186 PPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAP 237

 Score =  121 bits (304), Expect = 2e-26
 Identities = 55/93 (59%), Positives = 61/93 (65%), Gaps = 16/93 (17%)
 Frame = +1

Query: 79  SPPPPPYVYPSPP------PPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSP-------- 216
           SPPPPPYVY S P         PPPPY+YKS P  P++Y+SPPPPPYVYNS         
Sbjct: 225 SPPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPPPYVYNSAPRIPFIYS 284

Query: 217 --PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             PPPPYVY S P  P++Y SPPPPPYVY S P
Sbjct: 285 SLPPPPYVYNSAPRVPFIYSSPPPPPYVYNSAP 317

 Score =  105 bits (261), Expect = 2e-21
 Identities = 48/84 (57%), Positives = 54/84 (64%), Gaps = 16/84 (19%)
 Frame = +1

Query: 79  SPPPPPYVYPSPP-------PPSPPP---------PYIYKSPPPPPYVYNSPPPPPYVYN 210
           SPPPPPYVY S P        P PPP         P+IY S PPPPYVYNS P  P++Y+
Sbjct: 245 SPPPPPYVYKSVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSLPPPPYVYNSAPRVPFIYS 304

Query: 211 SPPPPPYVYKSPPPPPYVYKSPPP 282
           SPPPPPYVY S P  P++Y SPPP
Sbjct: 305 SPPPPPYVYNSAPRIPFIYSSPPP 328

 Score =  103 bits (256), Expect = 8e-21
 Identities = 44/65 (67%), Positives = 48/65 (73%), Gaps = 1/65 (1%)
 Frame = +1

Query: 118 PPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKS-PPPPPYV 294
           P S    Y  +SPPP PYVY+ P P PYVY SPPP PY+Y SPPPPPYVY S PPPPPY+
Sbjct: 23  PTSAQCKYSPQSPPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYI 82

Query: 295 YKSPP 309
           Y SPP
Sbjct: 83  YNSPP 87

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = +1

Query: 79  SPPPPPYVYPSPP------PPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPPPYVY S P         PPPPY+Y S P  P++Y+SPPPPPYVYNS P  P++Y 
Sbjct: 265 SPPPPPYVYNSAPRIPFIYSSLPPPPYVYNSAPRVPFIYSSPPPPPYVYNSAPRIPFIYS 324

Query: 241 SPPPPPYVYKS 273
           SPPP  +++ S
Sbjct: 325 SPPPH-HMFTS 334

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 35/59 (59%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = +1

Query: 139 YIYKSPPPPPYVYNSPPPPPYVY-NSPP-PPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           Y+   P      Y+   PPP  Y  SPP P PYVYKSPPP PY+Y SPPPPPYVY SPP
Sbjct: 18  YVVVVPTSAQCKYSPQSPPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPP 76

[6][TOP]
>UniRef100_Q8H9E1 Extensin (Fragment) n=1 Tax=Solanum tuberosum RepID=Q8H9E1_SOLTU
          Length = 152

 Score =  144 bits (362), Expect = 4e-33
 Identities = 71/110 (64%), Positives = 71/110 (64%), Gaps = 7/110 (6%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP  PPPY YKSPPPP
Sbjct: 12  PPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 71

Query: 166 PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPP--YVYKSPPPPPYVYKSPP 309
           P VY SPPPP Y Y SPPPP Y YKSPPPPP  Y YKSPPPP Y YKSPP
Sbjct: 72  PPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPP 121

 Score =  136 bits (342), Expect = 8e-31
 Identities = 66/97 (68%), Positives = 66/97 (68%), Gaps = 20/97 (20%)
 Frame = +1

Query: 79  SPPPP------PYVYPSPPPPSP--PPPYIYKSP------PPPPYVYNSP------PPPP 198
           SPPPP      PYVY SPPPPSP  PPPY YKSP      PPPPY Y SP      PPPP
Sbjct: 3   SPPPPSPSLPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 62

Query: 199 YVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           Y Y SPPPPP VYKSPPPP Y YKSPPPP Y YKSPP
Sbjct: 63  YYYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPP 99

 Score =  130 bits (328), Expect = 3e-29
 Identities = 68/111 (61%), Positives = 70/111 (63%), Gaps = 15/111 (13%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP----PSPPPPYIYKSP------PP 162
           S P  S  + P  +  SP  P   PPPPY Y SP      PSPPPPY YKSP      PP
Sbjct: 3   SPPPPSPSLPPPYVYKSPPPPSPSPPPPYYYKSP--PPPSPSPPPPYYYKSPPPPSPSPP 60

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPP--YVYKSPP 309
           PPY Y SPPPPP VY SPPPP Y YKSPPPP Y YKSPPPPP  Y YKSPP
Sbjct: 61  PPYYYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPP 111

 Score =  129 bits (325), Expect = 8e-29
 Identities = 70/120 (58%), Positives = 70/120 (58%), Gaps = 17/120 (14%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPP-----SPPPP-YIYKS 153
           PP     S P  S    P     SP  P   PPPPY Y SPPPP     SPPPP Y YKS
Sbjct: 28  PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPPPVYKSPPPPVYKYKS 87

Query: 154 PPPPPYVYNSPPPPP--YVYNSPPPPPYVYKSPPPPPYVYKSPPPP------PYVYKSPP 309
           PPPP Y Y SPPPPP  Y Y SPPPP Y YKSPPPP Y YKSPPPP      PY Y SPP
Sbjct: 88  PPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSPAPYYYTSPP 147

 Score =  122 bits (306), Expect = 1e-26
 Identities = 59/89 (66%), Positives = 60/89 (67%), Gaps = 20/89 (22%)
 Frame = +1

Query: 103 YPSPPPPSP--PPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP------PP 222
           Y SPPPPSP  PPPY+YKSP      PPPPY Y SP      PPPPY Y SP      PP
Sbjct: 1   YKSPPPPSPSLPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP 60

Query: 223 PPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPY YKSPPPPP VYKSPPPP Y YKSPP
Sbjct: 61  PPYYYKSPPPPPPVYKSPPPPVYKYKSPP 89

 Score =  117 bits (293), Expect = 4e-25
 Identities = 63/111 (56%), Positives = 66/111 (59%), Gaps = 14/111 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPP-YIYKSPPP 162
           PP+   S  P S +   P        SPPPPP VY SPPPP     SPPPP Y YKSPPP
Sbjct: 45  PPYYYKSPPPPSPSPPPPYYYK----SPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPP 100

Query: 163 PP--YVYNSPPPPPYVYNSPPPPPYVYKSPPPP------PYVYKSPPPPPY 291
           PP  Y Y SPPPP Y Y SPPPP Y YKSPPPP      PY Y SPPPP +
Sbjct: 101 PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSPAPYYYTSPPPPSH 151

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 45/92 (48%), Positives = 47/92 (51%), Gaps = 15/92 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-------SPPPP-YIYKSP 156
           PP+   S  P      +P        SPPPP Y Y SPPPP       SPPPP Y YKSP
Sbjct: 61  PPYYYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSP 120

Query: 157 PPPPYVYNSPPPP------PYVYNSP-PPPPY 231
           PPP Y Y SPPPP      PY Y SP PP  Y
Sbjct: 121 PPPVYKYKSPPPPVHKSPAPYYYTSPPPPSHY 152

[7][TOP]
>UniRef100_UPI00019859A1 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019859A1
          Length = 377

 Score =  141 bits (356), Expect = 2e-32
 Identities = 72/128 (56%), Positives = 74/128 (57%), Gaps = 25/128 (19%)
 Frame = +1

Query: 1   PPFSAVSSSPNSST---KITPSGIGVSPFSPPPPPYVYPSPPPP-------SPPPP---Y 141
           PP+   S  P       K  P    V    PPPPPY Y SPPPP       SPPPP   Y
Sbjct: 219 PPYKYKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPY 278

Query: 142 IYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPP------------YVYKSPPPP 285
            YKSPPPPPY Y SPPPPP  Y SPPPPPY YKSPPPPP            Y YKSPPPP
Sbjct: 279 KYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPP 338

Query: 286 PYVYKSPP 309
           PY+YKSPP
Sbjct: 339 PYMYKSPP 346

 Score =  139 bits (349), Expect = 1e-31
 Identities = 71/116 (61%), Positives = 74/116 (63%), Gaps = 13/116 (11%)
 Frame = +1

Query: 1   PPFSAVS--SSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP-------PPPYIYKS 153
           PP++  S  S+     K  P     SP  PPPP Y Y SPPPP P       PPPY YKS
Sbjct: 200 PPYNLPSGTSADEYEYKSPPPYKYKSP-PPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKS 258

Query: 154 PPPPP--YVYNSPPP--PPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPPPP  Y Y SPPP  PPY Y SPPPPPY YKSPPPPP  YKSPPPPPY YKSPP
Sbjct: 259 PPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPP 314

 Score =  138 bits (347), Expect = 2e-31
 Identities = 64/89 (71%), Positives = 65/89 (73%), Gaps = 12/89 (13%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPS------PPPPYIYKSPPPPP--YVYNSPPPPPYVYNSPPPPPYV 234
           SPPPPPY Y SPPPP       PPPPY YKSPPPPP  Y Y SPPPP Y Y SPPPPPY+
Sbjct: 282 SPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPYM 341

Query: 235 YKSPPPPP--YVYKSPPPPP--YVYKSPP 309
           YKSPPPPP  Y YKSPPPPP  Y Y SPP
Sbjct: 342 YKSPPPPPPVYKYKSPPPPPPKYYYSSPP 370

 Score =  137 bits (345), Expect = 4e-31
 Identities = 64/98 (65%), Positives = 65/98 (66%), Gaps = 22/98 (22%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPSPP--------PPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPP--- 228
           PPPP Y Y SPPPPSPP        PPY YKSPPPPP  Y SPPPPPY Y SPPPPP   
Sbjct: 261 PPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVY 320

Query: 229 ---------YVYKSPPPPPYVYKSPPPPP--YVYKSPP 309
                    Y YKSPPPPPY+YKSPPPPP  Y YKSPP
Sbjct: 321 KYKSPPPPVYKYKSPPPPPYMYKSPPPPPPVYKYKSPP 358

 Score =  127 bits (320), Expect = 3e-28
 Identities = 61/100 (61%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP+   S  P      +P    +   SPPPPPY Y SPPP  PPP Y YKSPPPP Y Y 
Sbjct: 276 PPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPP--PPPVYKYKSPPPPVYKYK 333

Query: 181 SPPPPPYVYNSPPPPP--YVYKSPPPPP--YVYKSPPPPP 288
           SPPPPPY+Y SPPPPP  Y YKSPPPPP  Y Y SPPPPP
Sbjct: 334 SPPPPPYMYKSPPPPPPVYKYKSPPPPPPKYYYSSPPPPP 373

 Score =  124 bits (310), Expect = 4e-27
 Identities = 56/80 (70%), Positives = 58/80 (72%), Gaps = 2/80 (2%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPP--YVYKSPP 249
           +S PPPPY Y SPPPP  PP Y YKSPPPPP VY+ P  PPY Y SPPPPP  Y YKSPP
Sbjct: 36  YSSPPPPYYYKSPPPP--PPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPP 93

Query: 250 PPPYVYKSPPPPPYVYKSPP 309
           PPP VY  P  PPY YKSPP
Sbjct: 94  PPPPVYSPPHHPPYKYKSPP 113

 Score =  122 bits (306), Expect = 1e-26
 Identities = 58/84 (69%), Positives = 59/84 (70%), Gaps = 8/84 (9%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP----SPP--PPYIYKSPPPPP--YVYNSPPPPPYVYNSPPPPPYVY 237
           PPPP Y Y SPPPP    SPP  PPY YKSPPPPP  Y Y SPPPPP VY+ P  PPY Y
Sbjct: 50  PPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKY 109

Query: 238 KSPPPPPYVYKSPPPPPYVYKSPP 309
           KSPPPPP VY  P  PPY YKSPP
Sbjct: 110 KSPPPPPPVYSPPHHPPYKYKSPP 133

 Score =  121 bits (303), Expect = 3e-26
 Identities = 61/95 (64%), Positives = 62/95 (65%), Gaps = 15/95 (15%)
 Frame = +1

Query: 70  SPFSPPP-------PPYVYPSPPPP----SPP--PPYIYKSPPPPPYVYNSPPPPPYVYN 210
           SP  PPP       PPY Y SPPPP    SPP  PPY YKSPPPPP VY+ P  PPY Y 
Sbjct: 91  SPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYK 150

Query: 211 SPPPPPYVYKSPPPPPYVYKSPPPPP--YVYKSPP 309
           SPPPPP VY  P  PPY YKSPPPPP  Y YKSPP
Sbjct: 151 SPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPP 185

 Score =  119 bits (298), Expect = 1e-25
 Identities = 57/84 (67%), Positives = 58/84 (69%), Gaps = 8/84 (9%)
 Frame = +1

Query: 79  SPPPPP--YVYPSPPPP----SPP--PPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYV 234
           SPPPPP  Y Y SPPPP    SPP  PPY YKSPPPPP VY+ P  PPY Y SPPPPP V
Sbjct: 79  SPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPV 138

Query: 235 YKSPPPPPYVYKSPPPPPYVYKSP 306
           Y  P  PPY YKSPPPPP VY  P
Sbjct: 139 YSPPHHPPYKYKSPPPPPPVYSPP 162

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/92 (63%), Positives = 59/92 (64%), Gaps = 16/92 (17%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP----SPP--PPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPP----- 228
           PPPP Y Y SPPPP    SPP  PPY YKSPPPPP VY+ P  PPY Y SPPPPP     
Sbjct: 82  PPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSP 141

Query: 229 -----YVYKSPPPPPYVYKSPPPPPYVYKSPP 309
                Y YKSPPPPP VY  P  PPY YKSPP
Sbjct: 142 PHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPP 173

 Score =  117 bits (293), Expect = 4e-25
 Identities = 64/109 (58%), Positives = 65/109 (59%), Gaps = 32/109 (29%)
 Frame = +1

Query: 79  SPPPPPYVY------------PSPPPP--SPP--PPYIYKSPPPPPYVYNSPPPPPYVYN 210
           SPPPPP VY            P PPPP  SPP  PPY YKSPPPPP VY+ P  PPY Y 
Sbjct: 111 SPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYK 170

Query: 211 SPPPPP--YVYKSPPPP---PYVYKSPPPPP-----------YVYKSPP 309
           SPPPPP  Y YKSPPPP   PY YKSPPPPP           Y YKSPP
Sbjct: 171 SPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPP 219

 Score =  116 bits (290), Expect = 9e-25
 Identities = 55/86 (63%), Positives = 56/86 (65%), Gaps = 7/86 (8%)
 Frame = +1

Query: 70  SPFSPPP-------PPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPP 228
           SP  PPP       PPY Y SPPP  PPP Y YKSPPPPP VY+ P  PPY Y SPPPPP
Sbjct: 59  SPPPPPPVYSPPHHPPYKYKSPPP--PPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPP 116

Query: 229 YVYKSPPPPPYVYKSPPPPPYVYKSP 306
            VY  P  PPY YKSPPPPP VY  P
Sbjct: 117 PVYSPPHHPPYKYKSPPPPPPVYSPP 142

 Score =  115 bits (287), Expect = 2e-24
 Identities = 68/135 (50%), Positives = 70/135 (51%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVY------------PSPPPP--SPP-- 132
           PP+   S  P       P        SPPPPP VY            P PPPP  SPP  
Sbjct: 105 PPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHH 164

Query: 133 PPYIYKSPPPPP--YVYNSPPPP---PYVYNSPPPPPY---------VYKSPPPPPYVYK 270
           PPY YKSPPPPP  Y Y SPPPP   PY Y SPPPPPY          Y+   PPPY YK
Sbjct: 165 PPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYK 224

Query: 271 SPPPPP--YVYKSPP 309
           SPPPPP  Y YKSPP
Sbjct: 225 SPPPPPPVYKYKSPP 239

 Score =  114 bits (286), Expect = 3e-24
 Identities = 64/126 (50%), Positives = 66/126 (52%), Gaps = 23/126 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPP---------PPSPPPPYIYKS 153
           PP+   S  P       P        SPPPPP VY SPP         PP PPP Y YKS
Sbjct: 125 PPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVY-SPPHHPPYKYKSPPPPPPVYKYKS 183

Query: 154 PPPP---PYVYNSPPPPPY---------VYNSPPPPPYVYKSPPPPP--YVYKSPPPPPY 291
           PPPP   PY Y SPPPPPY          Y    PPPY YKSPPPPP  Y YKSPPPPP 
Sbjct: 184 PPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPPPPPPVYKYKSPPPPPP 243

Query: 292 VYKSPP 309
           V+  PP
Sbjct: 244 VHSPPP 249

 Score =  114 bits (284), Expect = 4e-24
 Identities = 67/130 (51%), Positives = 69/130 (53%), Gaps = 27/130 (20%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPP--YVYPSPPPP--------SPPPP---- 138
           PP+   S  P       P        SPPPPP  Y Y SPPPP        SPPPP    
Sbjct: 145 PPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNL 204

Query: 139 --------YIYKSPPPPPYVYNSPPPPP--YVYNSPPPPPYVYK-SPPPPPYVYKSPPPP 285
                   Y YKSPPP  Y Y SPPPPP  Y Y SPPPPP V+   PPPPPY YKSPPPP
Sbjct: 205 PSGTSADEYEYKSPPP--YKYKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPP 262

Query: 286 P--YVYKSPP 309
           P  Y YKSPP
Sbjct: 263 PPVYKYKSPP 272

 Score =  109 bits (272), Expect = 1e-22
 Identities = 57/97 (58%), Positives = 59/97 (60%), Gaps = 20/97 (20%)
 Frame = +1

Query: 79  SPPPPPYVYPSPP---------PPSPPPPYIYKSPPPPPYVYNSP-----------PPPP 198
           SPPPPP VY SPP         PP PPP Y YKSPPPPP VY+ P           PPPP
Sbjct: 59  SPPPPPPVY-SPPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPP 117

Query: 199 YVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            VY+ P  PPY YKSPPPPP VY  P  PPY YKSPP
Sbjct: 118 -VYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPP 153

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 44/68 (64%), Positives = 44/68 (64%), Gaps = 4/68 (5%)
 Frame = +1

Query: 118 PPSPPPPYIYKSPPPPPYVYNSPPPPP--YVYNSPPPPPYVYKSPPPPPYVYKSPPPPP- 288
           P      Y Y SP PPPY Y SPPPPP  Y Y SPPPPP VY  P  PPY YKSPPPPP 
Sbjct: 27  PSETSANYHYSSP-PPPYYYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPP 85

Query: 289 -YVYKSPP 309
            Y YKSPP
Sbjct: 86  VYKYKSPP 93

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 33/46 (71%), Positives = 36/46 (78%), Gaps = 3/46 (6%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSPPPPP--YVYNSP-PPPPYVY 207
           SPPPPPY+Y SPPPP  PP Y YKSPPPPP  Y Y+SP PPPP+ Y
Sbjct: 334 SPPPPPYMYKSPPPP--PPVYKYKSPPPPPPKYYYSSPPPPPPHHY 377

[8][TOP]
>UniRef100_Q09083 Hydroxyproline-rich glycoprotein n=1 Tax=Phaseolus vulgaris
           RepID=Q09083_PHAVU
          Length = 580

 Score =  136 bits (343), Expect(2) = 2e-32
 Identities = 61/84 (72%), Positives = 62/84 (73%), Gaps = 7/84 (8%)
 Frame = +1

Query: 79  SPPPP--PYVYPSPPPP-----SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVY 237
           SPPPP  PY Y SPPPP     SPPPPY Y SPPPPPY Y+SPPPP Y Y SPPPP Y Y
Sbjct: 270 SPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKY 329

Query: 238 KSPPPPPYVYKSPPPPPYVYKSPP 309
           KSPPPP Y Y SPPPP Y YKSPP
Sbjct: 330 KSPPPPVYKYNSPPPPVYKYKSPP 353

 Score = 26.2 bits (56), Expect(2) = 2e-32
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 11  PPSHLHPTPPQK*HPPALESLHSP 82
           PP + H  PP K  PP     HSP
Sbjct: 216 PPYYYHSPPPPKHSPPPPYYYHSP 239

 Score =  139 bits (349), Expect = 1e-31
 Identities = 64/101 (63%), Positives = 64/101 (63%), Gaps = 24/101 (23%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP---------------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNS 213
           SPPPPPY YPSPPPP               SPPPPY Y SPPPPPY Y SPPPP Y YNS
Sbjct: 370 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNS 429

Query: 214 PPPPPYVYKSP---------PPPPYVYKSPPPPPYVYKSPP 309
           PPPP Y YKSP         PPPPY Y SPPPPPY Y SPP
Sbjct: 430 PPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPP 470

 Score =  133 bits (335), Expect(2) = 2e-31
 Identities = 62/92 (67%), Positives = 63/92 (68%), Gaps = 13/92 (14%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPP--PYVYNSP---------PPPPYVYNS 213
           P   PPPPY Y SPPPP  SPPPPY Y SPPPP  PY Y+SP         PPPPY Y S
Sbjct: 242 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPS 301

Query: 214 PPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPPPPY Y SPPPP Y YKSPPPP Y YKSPP
Sbjct: 302 PPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPP 333

 Score = 26.2 bits (56), Expect(2) = 2e-31
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 11  PPSHLHPTPPQK*HPPALESLHSP 82
           PP + H  PP K  PP     HSP
Sbjct: 184 PPYYYHSPPPPKHSPPPPYYYHSP 207

 Score =  137 bits (345), Expect = 4e-31
 Identities = 63/83 (75%), Positives = 63/83 (75%), Gaps = 6/83 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPPPY YPSPPPP     SPPPP Y YKSPPPP Y Y SPPPP Y Y SPPPPPY Y 
Sbjct: 409 SPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPP-YKYPSPPPPPYKYS 467

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP Y YKSPPPP Y YKSPP
Sbjct: 468 SPPPPVYKYKSPPPPVYKYKSPP 490

 Score =  137 bits (344), Expect = 5e-31
 Identities = 67/109 (61%), Positives = 69/109 (63%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPP-YIYKSPPP 162
           PP    +S P    K       V  +  PPPPY YPSPPPP     SPPPP Y YKSPPP
Sbjct: 422 PPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPP 481

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P Y Y SPPPP Y Y SPPPPPY Y SPPPP Y YKSPPPP Y YKSPP
Sbjct: 482 PVYKYKSPPPP-YKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPP 529

 Score =  136 bits (342), Expect = 8e-31
 Identities = 68/118 (57%), Positives = 71/118 (60%), Gaps = 15/118 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPP-YIYKSPPP 162
           PP    +S P    K       V  ++ PPPPY YPSPPPP     SPPPP Y YKSPPP
Sbjct: 334 PPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 393

Query: 163 ---------PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
                    PPY Y SPPPPPY Y SPPPP Y Y SPPPP Y YKSPPPP Y YKSPP
Sbjct: 394 PVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPP 451

 Score =  130 bits (326), Expect(2) = 2e-30
 Identities = 61/89 (68%), Positives = 63/89 (70%), Gaps = 10/89 (11%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSPPPP--PYVYNSPPP 222
           P   PPPPY Y SPPPP  SPPPPY Y SP      PPPPY Y+SPPPP  PY Y+SPPP
Sbjct: 226 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKNPYKYSSPPP 285

Query: 223 PPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P Y YKS PPPPY Y SPPPPPY Y SPP
Sbjct: 286 PVYKYKS-PPPPYKYPSPPPPPYKYSSPP 313

 Score = 26.2 bits (56), Expect(2) = 2e-30
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 11  PPSHLHPTPPQK*HPPALESLHSP 82
           PP + H  PP K  PP     HSP
Sbjct: 168 PPYYYHSPPPPKHSPPPPYYYHSP 191

 Score =  134 bits (338), Expect = 2e-30
 Identities = 65/109 (59%), Positives = 68/109 (62%), Gaps = 15/109 (13%)
 Frame = +1

Query: 28  PNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPP 189
           P +  K +     V  +  PPPPY YPSPPPP     SPPPP Y YKSPPPP Y Y SPP
Sbjct: 274 PKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPP 333

Query: 190 PPPYVYNSPPPPPYVYKSP---------PPPPYVYKSPPPPPYVYKSPP 309
           PP Y YNSPPPP Y YKSP         PPPPY Y SPPPPPY Y SPP
Sbjct: 334 PPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPP 382

 Score =  134 bits (338), Expect = 2e-30
 Identities = 65/108 (60%), Positives = 67/108 (62%), Gaps = 5/108 (4%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPPYIYKSPPPP 165
           PP     S P      +P        SPPPP Y Y SPPPP     SPPPPY Y SPPPP
Sbjct: 442 PPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP 501

Query: 166 PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PY Y+SPPPP Y Y SPPPP Y YKS PPPPY Y SPPPP Y YKSPP
Sbjct: 502 PYKYSSPPPPVYKYKSPPPPVYKYKS-PPPPYKYPSPPPPVYKYKSPP 548

 Score =  134 bits (337), Expect = 3e-30
 Identities = 67/109 (61%), Positives = 69/109 (63%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPP-YIYKSPPP 162
           PP+   S  P      +P        SPPPP Y Y SPPPP     SPPPP Y YKSPPP
Sbjct: 295 PPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPP 354

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P Y YNSPPPP Y Y SPPPPPY Y SPPPP Y YKSPPPP Y YKSPP
Sbjct: 355 PVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPP 402

 Score =  126 bits (316), Expect = 8e-28
 Identities = 66/116 (56%), Positives = 68/116 (58%), Gaps = 13/116 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPP-YIYKSPPP 162
           PP    SS P    K       V  +  PPPPY YPSPPPP     SPPPP Y YKSPPP
Sbjct: 461 PPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPP 520

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYK-------SPPPPPYVYKSPP 309
           P Y Y SPPPP Y Y SPPPP Y YKSPPPP Y Y        SPPPP Y+Y SPP
Sbjct: 521 PVYKYKSPPPP-YKYPSPPPPVYKYKSPPPPVYKYNSPPPPVHSPPPPHYIYASPP 575

 Score =  120 bits (300), Expect(2) = 2e-27
 Identities = 62/107 (57%), Positives = 64/107 (59%), Gaps = 28/107 (26%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPPP  SPPPPY Y SP      PPPPY Y+SP      PPPPY Y+
Sbjct: 178 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 237

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSPPPP--PYVYKSPP 309
           SP      PPPPY Y SP      PPPPY Y SPPPP  PY Y SPP
Sbjct: 238 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKNPYKYSSPP 284

 Score = 26.2 bits (56), Expect(2) = 2e-27
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 11  PPSHLHPTPPQK*HPPALESLHSP 82
           PP + H  PP K  PP     HSP
Sbjct: 120 PPYYYHSPPPPKHSPPPPYYYHSP 143

 Score =  118 bits (296), Expect(2) = 5e-27
 Identities = 62/111 (55%), Positives = 64/111 (57%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPPP  SPPPPY Y SP      PPPPY Y+SP      PPPPY Y+
Sbjct: 114 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 173

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 174 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPP 224

 Score = 26.2 bits (56), Expect(2) = 5e-27
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 11  PPSHLHPTPPQK*HPPALESLHSP 82
           PP + H  PP K  PP     HSP
Sbjct: 56  PPYYYHSPPPPKHSPPPPYYYHSP 79

 Score =  118 bits (296), Expect = 2e-25
 Identities = 62/111 (55%), Positives = 64/111 (57%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPPP  SPPPPY Y SP      PPPPY Y+SP      PPPPY Y+
Sbjct: 50  PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 109

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 110 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPP 160

 Score =  117 bits (294), Expect = 3e-25
 Identities = 61/108 (56%), Positives = 63/108 (58%), Gaps = 32/108 (29%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP- 216
           PPP PY Y SPPPP  SPPPPY Y SP      PPPPY Y+SP      PPPPY Y+SP 
Sbjct: 37  PPPKPYYYQSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPP 96

Query: 217 -----PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
                PPPPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 97  PPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPP 144

 Score =  110 bits (276), Expect = 4e-23
 Identities = 56/100 (56%), Positives = 59/100 (59%), Gaps = 5/100 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPPYIYKSPPPP 165
           PP     S P      +P        SPPPP Y Y SPPPP     SPPPPY Y SPPPP
Sbjct: 481 PPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP 540

Query: 166 PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
            Y Y SPPPP Y YNSPPPP +   SPPPP Y+Y SPPPP
Sbjct: 541 VYKYKSPPPPVYKYNSPPPPVH---SPPPPHYIYASPPPP 577

 Score =  102 bits (254), Expect = 1e-20
 Identities = 54/101 (53%), Positives = 58/101 (57%), Gaps = 30/101 (29%)
 Frame = +1

Query: 97  YVYPSPPPPSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP------PP 222
           Y+Y SPPPP  P PY Y+SP      PPPPY Y+SP      PPPPY Y+SP      PP
Sbjct: 30  YIYSSPPPP--PKPYYYQSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP 87

Query: 223 PPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           PPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 88  PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPP 128

[9][TOP]
>UniRef100_Q9FSG1 Putative extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG1_NICSY
          Length = 311

 Score =  139 bits (351), Expect = 7e-32
 Identities = 64/83 (77%), Positives = 64/83 (77%), Gaps = 6/83 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPPP VY SPPPP     SPPPP Y YKSPPPPP VY SPPPP Y Y SPPPP Y YK
Sbjct: 84  SPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYK 143

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP VYKSPPPP Y YKSPP
Sbjct: 144 SPPPPPPVYKSPPPPVYKYKSPP 166

 Score =  137 bits (346), Expect = 3e-31
 Identities = 63/83 (75%), Positives = 63/83 (75%), Gaps = 6/83 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPP Y Y SPPPPP VY SPPPP Y YK
Sbjct: 44  SPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYK 103

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP Y YKSPPPPP VYKSPP
Sbjct: 104 SPPPPVYKYKSPPPPPPVYKSPP 126

 Score =  137 bits (346), Expect = 3e-31
 Identities = 63/83 (75%), Positives = 63/83 (75%), Gaps = 6/83 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPP Y Y SPPPPP VY SPPPP Y YK
Sbjct: 74  SPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYK 133

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP Y YKSPPPPP VYKSPP
Sbjct: 134 SPPPPVYKYKSPPPPPPVYKSPP 156

 Score =  137 bits (345), Expect = 4e-31
 Identities = 63/85 (74%), Positives = 64/85 (75%), Gaps = 8/85 (9%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP---YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYV 234
           SPPPPP +Y SPPPP     SPPPP   Y YKSPPPP Y Y SPPPPP VY SPPPP Y 
Sbjct: 194 SPPPPPPMYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYK 253

Query: 235 YKSPPPPPYVYKSPPPPPYVYKSPP 309
           YKSPPPPP VYKSPPPP Y YKSPP
Sbjct: 254 YKSPPPPPPVYKSPPPPVYKYKSPP 278

 Score =  136 bits (343), Expect = 6e-31
 Identities = 60/83 (72%), Positives = 61/83 (73%), Gaps = 6/83 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP       PPPP +YKSPPPP Y Y SPPPP Y Y SPPPPP VYK
Sbjct: 64  SPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYK 123

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP Y YKSPPPP Y YKSPP
Sbjct: 124 SPPPPVYKYKSPPPPVYKYKSPP 146

 Score =  136 bits (343), Expect = 6e-31
 Identities = 60/83 (72%), Positives = 62/83 (74%), Gaps = 6/83 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP       PPPP +YKSPPPP Y Y SPPPP Y Y SPPPPP VYK
Sbjct: 94  SPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYK 153

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP Y YKSPPPPP V+KSPP
Sbjct: 154 SPPPPVYKYKSPPPPPPVHKSPP 176

 Score =  136 bits (343), Expect = 6e-31
 Identities = 63/85 (74%), Positives = 64/85 (75%), Gaps = 8/85 (9%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-------SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYV 234
           SPPPP Y + SPPPP       SPPPP Y YKSPPPPP VY SPPPP Y Y SPPPPP V
Sbjct: 204 SPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPV 263

Query: 235 YKSPPPPPYVYKSPPPPPYVYKSPP 309
           YKSPPPP Y YKSPPPPP VYKSPP
Sbjct: 264 YKSPPPPVYKYKSPPPPPPVYKSPP 288

 Score =  135 bits (340), Expect = 1e-30
 Identities = 62/83 (74%), Positives = 63/83 (75%), Gaps = 6/83 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPP Y Y SPPPPP VY SPPPP Y YK
Sbjct: 104 SPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYK 163

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP V+KSPPPP Y YKSPP
Sbjct: 164 SPPPPPPVHKSPPPPIYKYKSPP 186

 Score =  135 bits (339), Expect = 2e-30
 Identities = 62/83 (74%), Positives = 63/83 (75%), Gaps = 6/83 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP  +Y SPPPP     SPPPP Y YKSPPPPP VY SPPPP Y Y SPPPP Y YK
Sbjct: 54  SPPPPLPIYRSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYK 113

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP VYKSPPPP Y YKSPP
Sbjct: 114 SPPPPPPVYKSPPPPVYKYKSPP 136

 Score =  135 bits (339), Expect = 2e-30
 Identities = 59/83 (71%), Positives = 62/83 (74%), Gaps = 6/83 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP       PPPP +YKSPPPP Y Y SPPPPP V+ SPPPP Y YK
Sbjct: 124 SPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYK 183

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP Y YKSPPPPP +YKSPP
Sbjct: 184 SPPPPVYKYKSPPPPPPMYKSPP 206

 Score =  134 bits (338), Expect = 2e-30
 Identities = 68/110 (61%), Positives = 70/110 (63%), Gaps = 7/110 (6%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFS-PPPPPYVYPSPPPP-----SPPPP-YIYKSPP 159
           PP     S P    K       V  +  PPPPP VY SPPPP     SPPPP Y YKSPP
Sbjct: 87  PPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPP 146

Query: 160 PPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPP VY SPPPP Y Y SPPPPP V+KSPPPP Y YKSPPPP Y YKSPP
Sbjct: 147 PPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPP 196

 Score =  133 bits (334), Expect = 7e-30
 Identities = 62/85 (72%), Positives = 65/85 (76%), Gaps = 8/85 (9%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPP--YV 234
           SPPPPP V+ SPPPP     SPPPP Y YKSPPPPP +Y SPPPP Y + SPPPPP  Y 
Sbjct: 164 SPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPPPPPPMYKSPPPPVYKHKSPPPPPPVYK 223

Query: 235 YKSPPPPPYVYKSPPPPPYVYKSPP 309
           YKSPPPP Y YKSPPPPP VYKSPP
Sbjct: 224 YKSPPPPVYKYKSPPPPPPVYKSPP 248

 Score =  132 bits (333), Expect = 9e-30
 Identities = 62/87 (71%), Positives = 64/87 (73%), Gaps = 9/87 (10%)
 Frame = +1

Query: 76  FSPPPPP---YVYPSPPPP-----SPPPPY-IYKSPPPPPYVYNSPPPPPYVYNSPPPPP 228
           +S PPPP   YVY SPPPP     SPPPP  IY+SPPPP Y Y SPPPP Y Y SPPPPP
Sbjct: 30  YSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPVYKYKSPPPPP 89

Query: 229 YVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            VYKSPPPP Y YKSPPPP Y YKSPP
Sbjct: 90  PVYKSPPPPVYKYKSPPPPVYKYKSPP 116

 Score =  132 bits (332), Expect = 1e-29
 Identities = 60/83 (72%), Positives = 63/83 (75%), Gaps = 6/83 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPPP V+ SPPPP Y Y SPPPP Y YK
Sbjct: 134 SPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYK 193

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP +YKSPPPP Y +KSPP
Sbjct: 194 SPPPPPPMYKSPPPPVYKHKSPP 216

 Score =  132 bits (331), Expect = 2e-29
 Identities = 60/82 (73%), Positives = 61/82 (74%), Gaps = 6/82 (7%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKS 243
           PPPP Y Y SPPPP       PPPP +YKSPPPP Y Y SPPPPP VY SPPPP Y YKS
Sbjct: 217 PPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKS 276

Query: 244 PPPPPYVYKSPPPPPYVYKSPP 309
           PPPPP VYKSPPPP  VYKSPP
Sbjct: 277 PPPPPPVYKSPPPP--VYKSPP 296

 Score =  131 bits (330), Expect = 2e-29
 Identities = 59/85 (69%), Positives = 63/85 (74%), Gaps = 8/85 (9%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPPP VY SPPPP       PPPP ++KSPPPP Y Y SPPPP Y Y SPPPPP +YK
Sbjct: 144 SPPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPPPPPPMYK 203

Query: 241 SPPPPPYVYKSPPPPP--YVYKSPP 309
           SPPPP Y +KSPPPPP  Y YKSPP
Sbjct: 204 SPPPPVYKHKSPPPPPPVYKYKSPP 228

 Score =  131 bits (330), Expect = 2e-29
 Identities = 60/85 (70%), Positives = 62/85 (72%), Gaps = 8/85 (9%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPP--YVYNSPPPPPYV 234
           SPPPP Y Y SPPPP       PPPP +YKSPPPP Y + SPPPPP  Y Y SPPPP Y 
Sbjct: 174 SPPPPIYKYKSPPPPVYKYKSPPPPPPMYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYK 233

Query: 235 YKSPPPPPYVYKSPPPPPYVYKSPP 309
           YKSPPPPP VYKSPPPP Y YKSPP
Sbjct: 234 YKSPPPPPPVYKSPPPPIYKYKSPP 258

 Score =  126 bits (317), Expect = 6e-28
 Identities = 62/84 (73%), Positives = 62/84 (73%), Gaps = 7/84 (8%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPPP VY SPPPP Y Y SPPPPP VYK
Sbjct: 226 SPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYK 285

Query: 241 SPPPPPYVYKSPPPP-PYVYKSPP 309
           SPPPP  VYKSPPPP  Y Y SPP
Sbjct: 286 SPPPP--VYKSPPPPYHYYYTSPP 307

 Score =  124 bits (311), Expect = 3e-27
 Identities = 64/112 (57%), Positives = 67/112 (59%), Gaps = 9/112 (8%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYV-YPSPPPP-----SPPPP-YIYKSPP 159
           PP     S P    K          +  PPPP   Y SPPPP     SPPPP Y YKSPP
Sbjct: 127 PPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPP 186

Query: 160 PPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPP--YVYKSPPPPPYVYKSPP 309
           PP Y Y SPPPPP +Y SPPPP Y +KSPPPPP  Y YKSPPPP Y YKSPP
Sbjct: 187 PPVYKYKSPPPPPPMYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPP 238

 Score =  121 bits (304), Expect = 2e-26
 Identities = 56/79 (70%), Positives = 57/79 (72%), Gaps = 8/79 (10%)
 Frame = +1

Query: 97  YVYPSPPPP-------SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           Y Y SPPPP       SPPPP Y YKSPPPP  +Y SPPPP Y Y SPPPP Y YKSPPP
Sbjct: 28  YYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPVYKYKSPPP 87

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP VYKSPPPP Y YKSPP
Sbjct: 88  PPPVYKSPPPPVYKYKSPP 106

 Score =  116 bits (291), Expect = 7e-25
 Identities = 55/78 (70%), Positives = 56/78 (71%), Gaps = 7/78 (8%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPPP VY SPPPP       PPPP +YKSPPPP Y Y SPPPPP VY SPPPP  VYK
Sbjct: 236 SPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPP--VYK 293

Query: 241 SPPPP-PYVYKSPPPPPY 291
           SPPPP  Y Y SPPPP Y
Sbjct: 294 SPPPPYHYYYTSPPPPHY 311

[10][TOP]
>UniRef100_Q39600 Extensin n=1 Tax=Catharanthus roseus RepID=Q39600_CATRO
          Length = 217

 Score =  139 bits (351), Expect = 7e-32
 Identities = 64/91 (70%), Positives = 69/91 (75%), Gaps = 13/91 (14%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP--SPPPP--YIYKSPPPPPYVYNSPPPPPYVYNSPPPPP--YVY 237
           +S PPPPY Y SPPPP  SPPPP  Y YKSPPPPP ++ SPPPPPYVY SPPPPP  Y Y
Sbjct: 27  YSSPPPPYHYSSPPPPVHSPPPPPVYKYKSPPPPPPIHKSPPPPPYVYKSPPPPPPVYKY 86

Query: 238 KSPPP-------PPYVYKSPPPPPYVYKSPP 309
           KSPPP       PPY+YKSPPPPP +YKSPP
Sbjct: 87  KSPPPPPPVHKYPPYIYKSPPPPPPIYKSPP 117

 Score =  135 bits (339), Expect = 2e-30
 Identities = 68/108 (62%), Positives = 71/108 (65%), Gaps = 31/108 (28%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-------SPPPP--------YIYKSPPPPPYVYNSPPPPPYVYNS 213
           SPPPPPYVY SPPPP       SPPPP        YIYKSPPPPP +Y SPPPP  VY S
Sbjct: 66  SPPPPPYVYKSPPPPPPVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIYKSPPPP--VYKS 123

Query: 214 PPPP--PYVYKSPPPP--------------PYVYKSPPPPPYVYKSPP 309
           PPPP  PYVYKSPPPP              PYVYKSPPPPP+V+KSPP
Sbjct: 124 PPPPKNPYVYKSPPPPPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSPP 171

 Score =  132 bits (332), Expect = 1e-29
 Identities = 66/114 (57%), Positives = 72/114 (63%), Gaps = 34/114 (29%)
 Frame = +1

Query: 70  SPFSPPP----PPYVYPSPPPPSP----PPPYIYKSPPPP--PYVYNSPPPPP------- 198
           SP  PPP    PPY+Y SPPPP P    PPP +YKSPPPP  PYVY SPPPPP       
Sbjct: 88  SPPPPPPVHKYPPYIYKSPPPPPPIYKSPPPPVYKSPPPPKNPYVYKSPPPPPPVYKYLH 147

Query: 199 -------YVYNSPPPPPYVYKSPPPP----------PYVYKSPPPPPYVYKSPP 309
                  YVY SPPPPP+V+KSPPPP          PYVYKSPPPPP ++KSPP
Sbjct: 148 HLHQKKPYVYKSPPPPPFVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPIHKSPP 201

 Score =  129 bits (325), Expect = 8e-29
 Identities = 64/95 (67%), Positives = 67/95 (70%), Gaps = 18/95 (18%)
 Frame = +1

Query: 79  SPPPPP---YVYPSPPPP----SPPPPYIYKSPPPPP--YVYNSPPP-------PPYVYN 210
           SPPPPP   Y  P PPPP     PPPPY+YKSPPPPP  Y Y SPPP       PPY+Y 
Sbjct: 45  SPPPPPVYKYKSPPPPPPIHKSPPPPPYVYKSPPPPPPVYKYKSPPPPPPVHKYPPYIYK 104

Query: 211 SPPPPPYVYKSPPPPPYVYKSPPPP--PYVYKSPP 309
           SPPPPP +YKSPPPP  VYKSPPPP  PYVYKSPP
Sbjct: 105 SPPPPPPIYKSPPPP--VYKSPPPPKNPYVYKSPP 137

 Score =  115 bits (289), Expect = 1e-24
 Identities = 54/95 (56%), Positives = 61/95 (64%), Gaps = 22/95 (23%)
 Frame = +1

Query: 79  SPPPP--PYVYPSPPPPSP----------PPPYIYKSPPPPPYVYNSPPPP--------- 195
           SPPPP  PYVY SPPPP P            PY+YKSPPPPP+V+ SPPPP         
Sbjct: 123 SPPPPKNPYVYKSPPPPPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSPPPPVYKSPPPPK 182

Query: 196 -PYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVY 297
            PYVY SPPPPP ++KSPPPP + Y S PPPP+ Y
Sbjct: 183 KPYVYKSPPPPPPIHKSPPPPYHYYYSSPPPPHHY 217

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 1/65 (1%)
 Frame = +1

Query: 118 PPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPP-YVYKSPPPPPYV 294
           P      Y Y SPPPP Y Y+SPPPP  V++ PPPP Y YKSPPPPP   +KSPPPPPYV
Sbjct: 18  PSQTTADYKYSSPPPP-YHYSSPPPP--VHSPPPPPVYKYKSPPPPPPI-HKSPPPPPYV 73

Query: 295 YKSPP 309
           YKSPP
Sbjct: 74  YKSPP 78

[11][TOP]
>UniRef100_B9IAD8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IAD8_POPTR
          Length = 379

 Score =  139 bits (350), Expect = 1e-31
 Identities = 76/138 (55%), Positives = 81/138 (58%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP--PSPPPPYIYKSP--- 156
           PP     S P  S    P+ +  SP  P   PPPPY+Y SPPP  PSPPPPY YKSP   
Sbjct: 60  PPPYEYKSPPPPSPHPPPTYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYEYKSPPPP 119

Query: 157 ---PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKS 273
              PPPPY+Y SP      PPPPYVY SP      PPPPY+YKSP      PPPPY YKS
Sbjct: 120 SSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYYYKS 179

Query: 274 P------PPPPYVYKSPP 309
           P      PPPPYVYKSPP
Sbjct: 180 PPPPSPSPPPPYVYKSPP 197

 Score =  137 bits (345), Expect = 4e-31
 Identities = 74/135 (54%), Positives = 78/135 (57%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP--PSPPPPYIYKSP------ 156
           PP  + S  P    K  P      P S PPPPY+Y SPPP  PSPPPPY+YKSP      
Sbjct: 100 PPPPSPSPPPPYEYKSPPP-----PSSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPS 154

Query: 157 PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKSP-- 276
           PPPPY+Y SP      PPPPY Y SP      PPPPYVYKSP      PPPPY YKSP  
Sbjct: 155 PPPPYIYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSSSPPPPYYYKSPSP 214

Query: 277 ----PPPPYVYKSPP 309
               PPPPY YKSPP
Sbjct: 215 PSSSPPPPYYYKSPP 229

 Score =  133 bits (335), Expect = 5e-30
 Identities = 68/110 (61%), Positives = 71/110 (64%), Gaps = 32/110 (29%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNS 213
           +S PPPPYVY SPPP  PSPPPPY YKSP      PPP YVY SP      PPPPY+Y S
Sbjct: 40  YSSPPPPYVYKSPPPPSPSPPPPYEYKSPPPPSPHPPPTYVYKSPPPPSPSPPPPYIYKS 99

Query: 214 P------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           P      PPPPY YKSP      PPPPY+YKSP      PPPPYVYKSPP
Sbjct: 100 PPPPSPSPPPPYEYKSPPPPSSSPPPPYIYKSPPPPSPSPPPPYVYKSPP 149

 Score =  132 bits (331), Expect = 2e-29
 Identities = 66/111 (59%), Positives = 70/111 (63%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPS--PPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPPPS  PPP Y+YKSP      PPPPY+Y SP      PPPPY Y 
Sbjct: 55  PSPSPPPPYEYKSPPPPSPHPPPTYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYEYK 114

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY+YKSP      PPPPYVYKSP      PPPPY+YKSPP
Sbjct: 115 SPPPPSSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPP 165

 Score =  126 bits (317), Expect = 6e-28
 Identities = 76/153 (49%), Positives = 81/153 (52%), Gaps = 50/153 (32%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITP----SGIGVSPFSPPP--------------PPYVYPSPPP-- 120
           PP+   S SP SS+   P    S   +SP  PPP              PPY Y SPPP  
Sbjct: 205 PPYYYKSPSPPSSSPPPPYYYKSPPPLSPSPPPPYYYKSPPPPDPSPPPPYHYKSPPPPS 264

Query: 121 PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP 246
           PSPPPPY Y+SP      PPPPY Y+SP      PPPPY Y SP      PPPPY YKSP
Sbjct: 265 PSPPPPYYYRSPPPPSSSPPPPYHYSSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP 324

Query: 247 ------PPPPYVYKSP------PPPPYVYKSPP 309
                 PPPPYVYKSP      PPPPY Y SPP
Sbjct: 325 PPPSPSPPPPYVYKSPPPPSPSPPPPYYYHSPP 357

 Score =  123 bits (308), Expect = 7e-27
 Identities = 71/138 (51%), Positives = 73/138 (52%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVY--PSPPPPSPPPPYIYKSP--- 156
           PP     S P  S    P  +  SP  P   PPPPY Y  PSPP  SPPPPY YKSP   
Sbjct: 172 PPPYYYKSPPPPSPSPPPPYVYKSPPPPSSSPPPPYYYKSPSPPSSSPPPPYYYKSPPPL 231

Query: 157 ---PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKS 273
              PPPPY Y SP      PPPPY Y SP      PPPPY Y+SP      PPPPY Y S
Sbjct: 232 SPSPPPPYYYKSPPPPDPSPPPPYHYKSPPPPSPSPPPPYYYRSPPPPSSSPPPPYHYSS 291

Query: 274 P------PPPPYVYKSPP 309
           P      PPPPY YKSPP
Sbjct: 292 PPPPSPSPPPPYYYKSPP 309

 Score =  122 bits (305), Expect = 2e-26
 Identities = 72/140 (51%), Positives = 74/140 (52%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P  +  SP  P   PPPPY+Y SPPPPSP  PPPY YKSPPPP
Sbjct: 124 PPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYYYKSPPPP 183

Query: 166 ------PYVYNSPPPP------PYVYNSP------PPPPYVYKSPPP------PPYVY-- 267
                 PYVY SPPPP      PY Y SP      PPPPY YKSPPP      PPY Y  
Sbjct: 184 SPSPPPPYVYKSPPPPSSSPPPPYYYKSPSPPSSSPPPPYYYKSPPPLSPSPPPPYYYKS 243

Query: 268 ------KSPPPPPYVYKSPP 309
                    PPPPY YKSPP
Sbjct: 244 PPPPDPS--PPPPYHYKSPP 261

 Score =  119 bits (299), Expect = 8e-26
 Identities = 71/140 (50%), Positives = 73/140 (52%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P  I  SP  P   PPPPY Y SPPPPSP  PPPY+YKSPPPP
Sbjct: 140 PPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPP 199

Query: 166 ------PYVYNSP------PPPPYVYNSPPP------PPYVYKSPPPP------PYVY-- 267
                 PY Y SP      PPPPY Y SPPP      PPY YKSPPPP      PY Y  
Sbjct: 200 SSSPPPPYYYKSPSPPSSSPPPPYYYKSPPPLSPSPPPPYYYKSPPPPDPSPPPPYHYKS 259

Query: 268 ------KSPPPPPYVYKSPP 309
                    PPPPY Y+SPP
Sbjct: 260 PPPPSPS--PPPPYYYRSPP 277

 Score =  118 bits (296), Expect = 2e-25
 Identities = 67/126 (53%), Positives = 71/126 (56%), Gaps = 23/126 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP--FSPPPPPYVYPSPPP--PSPPPPYIYKSP---- 156
           PP+   S  P S +   P      P   S PPPPY Y SPPP  PSPPPPY YKSP    
Sbjct: 253 PPYHYKSPPPPSPSPPPPYYYRSPPPPSSSPPPPYHYSSPPPPSPSPPPPYYYKSPPPPS 312

Query: 157 --PPPPYVYNSPPPPPYVYNSPPPPPYVYKSP------PPPPYVYKSPPP----PP---Y 291
             PPPPY Y SPPPP    +  PPPPYVYKSP      PPPPY Y SPPP    PP   Y
Sbjct: 313 PSPPPPYYYKSPPPP----SPSPPPPYVYKSPPPPSPSPPPPYYYHSPPPAMKSPPLSVY 368

Query: 292 VYKSPP 309
           +Y SPP
Sbjct: 369 IYASPP 374

 Score =  102 bits (253), Expect = 2e-20
 Identities = 59/108 (54%), Positives = 63/108 (58%), Gaps = 23/108 (21%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF-SP-PPPPYVYPSPPPPSP--PPPYIYKSPPPP- 165
           PP+   S  P SS+   P      P  SP PPPPY Y SPPPPSP  PPPY YKSPPPP 
Sbjct: 269 PPYYYRSPPPPSSSPPPPYHYSSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 328

Query: 166 -----PYVYNSPPPP------PYVYNSPPP----PP---YVYKSPPPP 255
                PYVY SPPPP      PY Y+SPPP    PP   Y+Y SPPPP
Sbjct: 329 PSPPPPYVYKSPPPPSPSPPPPYYYHSPPPAMKSPPLSVYIYASPPPP 376

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/81 (59%), Positives = 50/81 (61%), Gaps = 24/81 (29%)
 Frame = +1

Query: 139 YIYKSPPPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYV 264
           Y+Y SP PPPYVY SP      PPPPY Y SP      PPP YVYKSP      PPPPY+
Sbjct: 38  YVYSSP-PPPYVYKSPPPPSPSPPPPYEYKSPPPPSPHPPPTYVYKSPPPPSPSPPPPYI 96

Query: 265 YKSP------PPPPYVYKSPP 309
           YKSP      PPPPY YKSPP
Sbjct: 97  YKSPPPPSPSPPPPYEYKSPP 117

[12][TOP]
>UniRef100_Q39835 Extensin n=1 Tax=Glycine max RepID=Q39835_SOYBN
          Length = 432

 Score =  134 bits (336), Expect(2) = 1e-31
 Identities = 63/93 (67%), Positives = 63/93 (67%), Gaps = 14/93 (15%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPP---YVYNSPPPP---------PYVYN 210
           P   PPPPY Y SPPPP  SPPPPY YKSPPPPP   Y Y SPPPP         PY Y 
Sbjct: 182 PKHSPPPPYYYHSPPPPKHSPPPPYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYP 241

Query: 211 SPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPPY Y SPPPP Y YKSPPPP Y YKSPP
Sbjct: 242 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPP 274

 Score =  134 bits (336), Expect(2) = 1e-31
 Identities = 62/87 (71%), Positives = 63/87 (72%), Gaps = 6/87 (6%)
 Frame = +1

Query: 67  VSPFSPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPP 228
           V  +  PPPPY YPSPPPP     SPPPP Y YKSPPPP Y Y SPPPP Y Y SPPPPP
Sbjct: 228 VYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP-YKYPSPPPPP 286

Query: 229 YVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           Y Y SPPPP Y YKSPPPP Y YKSPP
Sbjct: 287 YKYPSPPPPVYKYKSPPPPVYKYKSPP 313

 Score = 26.2 bits (56), Expect(2) = 1e-31
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 11  PPSHLHPTPPQK*HPPALESLHSP 82
           PP + H  PP K  PP     HSP
Sbjct: 124 PPYYYHSPPPPKHSPPPPYYYHSP 147

 Score = 26.2 bits (56), Expect(2) = 1e-31
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 11  PPSHLHPTPPQK*HPPALESLHSP 82
           PP + H  PP K  PP     HSP
Sbjct: 172 PPYYYHSPPPPKHSPPPPYYYHSP 195

 Score =  136 bits (343), Expect = 6e-31
 Identities = 62/92 (67%), Positives = 62/92 (67%), Gaps = 15/92 (16%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP---------------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNS 213
           SPPPPPY YPSPPPP               SPPPPY Y SPPPPPY Y SPPPP Y Y S
Sbjct: 281 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 340

Query: 214 PPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPPP Y YKS PPPPY Y SPPPPPY Y SPP
Sbjct: 341 PPPPVYKYKS-PPPPYKYPSPPPPPYKYPSPP 371

 Score =  134 bits (338), Expect = 2e-30
 Identities = 67/109 (61%), Positives = 68/109 (62%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPP-YIYKSPPP 162
           PP     S P    K       V  +  PPPPY YPSPPPP     SPPPP Y YKSPPP
Sbjct: 245 PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 304

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P Y Y SPPPP Y Y SPPPPPY Y SPPPP Y YKSPPPP Y YKSPP
Sbjct: 305 PVYKYKSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPP 352

 Score =  127 bits (320), Expect(2) = 9e-30
 Identities = 61/90 (67%), Positives = 61/90 (67%), Gaps = 11/90 (12%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSPPPP---PYVYNSPP 219
           P   PPPPY Y SPPPP  SPPPPY Y SP      PPPPY Y SPPPP   PY Y SPP
Sbjct: 166 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYKSPPPPPKKPYKYPSPP 225

Query: 220 PPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PP Y YKS PPPPY Y SPPPPPY Y SPP
Sbjct: 226 PPVYKYKS-PPPPYKYPSPPPPPYKYPSPP 254

 Score = 26.2 bits (56), Expect(2) = 9e-30
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 11  PPSHLHPTPPQK*HPPALESLHSP 82
           PP + H  PP K  PP     HSP
Sbjct: 108 PPYYYHSPPPPKHSPPPPYYYHSP 131

 Score =  130 bits (327), Expect = 4e-29
 Identities = 63/108 (58%), Positives = 64/108 (59%), Gaps = 31/108 (28%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP---------------SPPPPYIYKSPPPPPYVYNSPPPP------ 195
           SPPPPPY YPSPPPP               SPPPPY Y SPPPPPY Y SPPPP      
Sbjct: 320 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 379

Query: 196 ---PYVYNSPPPPPYVYKSPPPPPYVYK-------SPPPPPYVYKSPP 309
              PY Y SPPPPPY Y SPPPP Y YK       SPPPP Y+Y SPP
Sbjct: 380 PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVHSPPPPHYIYASPP 427

 Score =  129 bits (324), Expect = 1e-28
 Identities = 67/118 (56%), Positives = 68/118 (57%), Gaps = 15/118 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPP-YIYKSPPP 162
           PP     S P    K       V  +  PPPPY YPSPPPP     SPPPP Y YKSPPP
Sbjct: 284 PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 343

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSP---------PPPPYVYKSPPPPPYVYKSPP 309
           P Y Y SPPPP Y Y SPPPPPY Y SP         PPPPY Y SPPPPPY Y SPP
Sbjct: 344 PVYKYKSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPP 400

 Score =  126 bits (317), Expect = 6e-28
 Identities = 66/117 (56%), Positives = 66/117 (56%), Gaps = 14/117 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPPYIYKSPPPP 165
           PP     S P       P     SP  PP  PY YPSPPPP     SPPPPY Y SPPPP
Sbjct: 187 PPPYYYHSPPPPKHSPPPPYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPP 246

Query: 166 PYVYNSPPPPPYVYNSPPPPPYVYKSPPPP-------PYVYKSPPPPP--YVYKSPP 309
           PY Y SPPPP Y Y SPPPP Y YKSPPPP       P  YK P PPP  Y YKSPP
Sbjct: 247 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 303

 Score =  120 bits (302), Expect(2) = 1e-27
 Identities = 63/111 (56%), Positives = 65/111 (58%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPPP  SPPPPY Y SP      PPPPY Y+SP      PPPPY Y+
Sbjct: 102 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 161

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY Y SP      PPPPY Y SP      PPPPY YKSPP
Sbjct: 162 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYKSPP 212

 Score = 26.2 bits (56), Expect(2) = 1e-27
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 11  PPSHLHPTPPQK*HPPALESLHSP 82
           PP + H  PP K  PP     HSP
Sbjct: 44  PPYYYHSPPPPKHSPPPPYYYHSP 67

 Score =  122 bits (307), Expect(2) = 8e-27
 Identities = 63/94 (67%), Positives = 63/94 (67%), Gaps = 17/94 (18%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPP--YV 234
           SPPPPPY YPSPPPP     SPPPP Y YKSPPPP Y Y SPPPPPY Y  P PPP  Y 
Sbjct: 242 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP-YKYPSPPPPPYKY--PSPPPPVYK 298

Query: 235 YKSP---------PPPPYVYKSPPPPPYVYKSPP 309
           YKSP         PPPPY Y SPPPPPY Y SPP
Sbjct: 299 YKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPP 332

 Score = 21.2 bits (43), Expect(2) = 8e-27
 Identities = 11/27 (40%), Positives = 11/27 (40%)
 Frame = +2

Query: 2   HRSPPSHLHPTPPQK*HPPALESLHSP 82
           H  PP    P PP   H P     HSP
Sbjct: 177 HSPPPPKHSPPPPYYYHSPP-PPKHSP 202

 Score =  119 bits (298), Expect = 1e-25
 Identities = 54/74 (72%), Positives = 56/74 (75%), Gaps = 5/74 (6%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKS 243
           SPPPPPY YPSPPPP     SPPPPY Y SPPPPPY Y SPPPP Y Y SPPPP  V+ S
Sbjct: 359 SPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP--VH-S 415

Query: 244 PPPPPYVYKSPPPP 285
           PPPP Y+Y SPPPP
Sbjct: 416 PPPPHYIYASPPPP 429

 Score =  118 bits (296), Expect = 2e-25
 Identities = 62/111 (55%), Positives = 64/111 (57%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPPP  SPPPPY Y SP      PPPPY Y+SP      PPPPY Y+
Sbjct: 38  PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 97

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 98  SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPP 148

 Score =  108 bits (271), Expect = 1e-22
 Identities = 57/103 (55%), Positives = 60/103 (58%), Gaps = 32/103 (31%)
 Frame = +1

Query: 97  YVYPSPPPP--SPPPPYIYKSPPPP------PYVYNSP------PPPPYVYNSP------ 216
           Y+Y SPPPP  SPPPPY Y SPPPP      PY Y+SP      PPPPY Y+SP      
Sbjct: 30  YIYSSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHS 89

Query: 217 PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           PPPPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 90  PPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPP 132

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 38/85 (44%), Positives = 43/85 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP+   S  P      +P      P+  P PP           PPPY Y SPPPP Y Y 
Sbjct: 363 PPYKYPSPPPPVYKYKSPP----PPYKYPSPP-----------PPPYKYPSPPPPVYKYK 407

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPP 255
           SPPPP    +SPPPP Y+Y SPPPP
Sbjct: 408 SPPPP---VHSPPPPHYIYASPPPP 429

[13][TOP]
>UniRef100_Q9FSG0 Extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG0_NICSY
          Length = 161

 Score =  136 bits (343), Expect = 6e-31
 Identities = 63/85 (74%), Positives = 63/85 (74%), Gaps = 8/85 (9%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP---YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYV 234
           SPPPP Y Y SPPPP     SPPPP   Y YKSPPPP Y Y SPPPPP VY SPPPP Y 
Sbjct: 44  SPPPPVYKYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYK 103

Query: 235 YKSPPPPPYVYKSPPPPPYVYKSPP 309
           YKSPPPPP VYKSPPPP Y YKSPP
Sbjct: 104 YKSPPPPPPVYKSPPPPVYKYKSPP 128

 Score =  136 bits (343), Expect = 6e-31
 Identities = 63/85 (74%), Positives = 64/85 (75%), Gaps = 8/85 (9%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-------SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYV 234
           SPPPP Y + SPPPP       SPPPP Y YKSPPPPP VY SPPPP Y Y SPPPPP V
Sbjct: 54  SPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPV 113

Query: 235 YKSPPPPPYVYKSPPPPPYVYKSPP 309
           YKSPPPP Y YKSPPPPP VYKSPP
Sbjct: 114 YKSPPPPVYKYKSPPPPPPVYKSPP 138

 Score =  132 bits (331), Expect = 2e-29
 Identities = 60/82 (73%), Positives = 61/82 (74%), Gaps = 6/82 (7%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKS 243
           PPPP Y Y SPPPP       PPPP +YKSPPPP Y Y SPPPPP VY SPPPP Y YKS
Sbjct: 67  PPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKS 126

Query: 244 PPPPPYVYKSPPPPPYVYKSPP 309
           PPPPP VYKSPPPP  VYKSPP
Sbjct: 127 PPPPPPVYKSPPPP--VYKSPP 146

 Score =  126 bits (317), Expect = 6e-28
 Identities = 62/84 (73%), Positives = 62/84 (73%), Gaps = 7/84 (8%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPPP VY SPPPP Y Y SPPPPP VYK
Sbjct: 76  SPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYK 135

Query: 241 SPPPPPYVYKSPPPP-PYVYKSPP 309
           SPPPP  VYKSPPPP  Y Y SPP
Sbjct: 136 SPPPP--VYKSPPPPYHYYYTSPP 157

 Score =  122 bits (306), Expect = 1e-26
 Identities = 58/83 (69%), Positives = 60/83 (72%), Gaps = 5/83 (6%)
 Frame = +1

Query: 76  FSPPPPP---YVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPP--YVYNSPPPPPYVYK 240
           +S PPPP   YVY SPPPP     Y YKSPPPP Y + SPPPPP  Y Y SPPPP Y YK
Sbjct: 30  YSSPPPPTKKYVYSSPPPPV----YKYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYK 85

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP VYKSPPPP Y YKSPP
Sbjct: 86  SPPPPPPVYKSPPPPIYKYKSPP 108

 Score =  116 bits (291), Expect = 7e-25
 Identities = 55/78 (70%), Positives = 56/78 (71%), Gaps = 7/78 (8%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPPP VY SPPPP       PPPP +YKSPPPP Y Y SPPPPP VY SPPPP  VYK
Sbjct: 86  SPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPP--VYK 143

Query: 241 SPPPP-PYVYKSPPPPPY 291
           SPPPP  Y Y SPPPP Y
Sbjct: 144 SPPPPYHYYYTSPPPPHY 161

 Score =  114 bits (286), Expect = 3e-24
 Identities = 51/73 (69%), Positives = 54/73 (73%), Gaps = 2/73 (2%)
 Frame = +1

Query: 97  YVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPP--YVYKSPPPPPYVYK 270
           Y Y SPPPP+    Y+Y SPPPP Y Y SPPPP Y + SPPPPP  Y YKSPPPP Y YK
Sbjct: 28  YYYSSPPPPTKK--YVYSSPPPPVYKYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYK 85

Query: 271 SPPPPPYVYKSPP 309
           SPPPPP VYKSPP
Sbjct: 86  SPPPPPPVYKSPP 98

[14][TOP]
>UniRef100_B9GF15 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GF15_POPTR
          Length = 152

 Score =  136 bits (343), Expect = 6e-31
 Identities = 73/128 (57%), Positives = 75/128 (58%), Gaps = 25/128 (19%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P       P  I  SP  P   PPPPYVY SPPPPSP  PPPYIYKSPPPP
Sbjct: 13  PPPYIYKSPPPPPPSSPPPYIYKSPPPPSPSPPPPYVYMSPPPPSPSPPPPYIYKSPPPP 72

Query: 166 PYVYNSPPPPPYVYNSP------PPPPYVYKSP------PPPPYVYKSP--------PPP 285
           P   +  PPPPYVY SP      PPPPYVY SP      PPPPYVY SP        PPP
Sbjct: 73  PPPPSPSPPPPYVYKSPPPPSPSPPPPYVYNSPPPPSPSPPPPYVYNSPPPPPSSPSPPP 132

Query: 286 PYVYKSPP 309
           PY+YKSPP
Sbjct: 133 PYIYKSPP 140

 Score =  133 bits (334), Expect = 7e-30
 Identities = 68/115 (59%), Positives = 71/115 (61%), Gaps = 36/115 (31%)
 Frame = +1

Query: 73  PFSPPPPPYVY--PSPPPPSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P + PPPPY+Y  P PPPPS PPPYIYKSP      PPPPYVY SP      PPPPY+Y 
Sbjct: 8   PSTSPPPPYIYKSPPPPPPSSPPPYIYKSPPPPSPSPPPPYVYMSPPPPSPSPPPPYIYK 67

Query: 211 SP----------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP          PPPPYVYKSP      PPPPYVY SP      PPPPYVY SPP
Sbjct: 68  SPPPPPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYNSPPPPSPSPPPPYVYNSPP 122

 Score =  131 bits (329), Expect = 3e-29
 Identities = 70/125 (56%), Positives = 75/125 (60%), Gaps = 22/125 (17%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPP------SPPPPYIYKS 153
           PP     S P  S    P  + +SP  P   PPPPY+Y SPPPP      SPPPPY+YKS
Sbjct: 29  PPPYIYKSPPPPSPSPPPPYVYMSPPPPSPSPPPPYIYKSPPPPPPPPSPSPPPPYVYKS 88

Query: 154 PPPP------PYVYNSPPPP------PYVYNSPPPPPYVYKSP-PPPPYVYKSPPPPPYV 294
           PPPP      PYVYNSPPPP      PYVYNSPPPPP    SP PPPPY+YKSPPPP   
Sbjct: 89  PPPPSPSPPPPYVYNSPPPPSPSPPPPYVYNSPPPPP---SSPSPPPPYIYKSPPPPSPS 145

Query: 295 YKSPP 309
              PP
Sbjct: 146 PPPPP 150

 Score =  120 bits (301), Expect = 5e-26
 Identities = 63/106 (59%), Positives = 66/106 (62%), Gaps = 36/106 (33%)
 Frame = +1

Query: 100 VYPSPPPPS--PPPPYIYKSPP------PPPYVYNSP------PPPPYVYNSP------P 219
           +Y SPPPPS  PPPPYIYKSPP      PPPY+Y SP      PPPPYVY SP      P
Sbjct: 1   MYKSPPPPSTSPPPPYIYKSPPPPPPSSPPPYIYKSPPPPSPSPPPPYVYMSPPPPSPSP 60

Query: 220 PPPYVYKSP----------PPPPYVYKSP------PPPPYVYKSPP 309
           PPPY+YKSP          PPPPYVYKSP      PPPPYVY SPP
Sbjct: 61  PPPYIYKSPPPPPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYNSPP 106

 Score =  107 bits (267), Expect = 4e-22
 Identities = 59/110 (53%), Positives = 61/110 (55%), Gaps = 23/110 (20%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPP-------YVYPSPPPPSP--PPPYIYKS 153
           PP     S P  S    P  I  SP  PPPPP       YVY SPPPPSP  PPPY+Y S
Sbjct: 45  PPPYVYMSPPPPSPSPPPPYIYKSPPPPPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYNS 104

Query: 154 PPPP------PYVYNSPPPPP--------YVYNSPPPPPYVYKSPPPPPY 261
           PPPP      PYVYNSPPPPP        Y+Y SPPPP     SPPPPPY
Sbjct: 105 PPPPSPSPPPPYVYNSPPPPPSSPSPPPPYIYKSPPPPS---PSPPPPPY 151

[15][TOP]
>UniRef100_Q39866 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39866_SOYBN
          Length = 118

 Score =  136 bits (342), Expect = 8e-31
 Identities = 70/107 (65%), Positives = 70/107 (65%), Gaps = 32/107 (29%)
 Frame = +1

Query: 85  PPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP-- 216
           PPPPYVY SPPP  PSPPPPYIYKSP      PPPPYVY SP      PPPPYVY SP  
Sbjct: 3   PPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPP 62

Query: 217 ----PPPPYVYKSPPPP------PYVYKSP------PPPPYVYKSPP 309
               PPPPYVYKSPPPP      PY YKSP      PPPPY YKSPP
Sbjct: 63  PSPSPPPPYVYKSPPPPSPSPPSPYYYKSPPPPSPSPPPPYYYKSPP 109

 Score =  115 bits (288), Expect = 1e-24
 Identities = 58/93 (62%), Positives = 60/93 (64%), Gaps = 30/93 (32%)
 Frame = +1

Query: 121 PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP 246
           PSPPPPY+YKSP      PPPPY+Y SP      PPPPYVY SP      PPPPYVYKSP
Sbjct: 1   PSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSP 60

Query: 247 ------PPPPYVYKSPPPP------PYVYKSPP 309
                 PPPPYVYKSPPPP      PY YKSPP
Sbjct: 61  PPPSPSPPPPYVYKSPPPPSPSPPSPYYYKSPP 93

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 49/90 (54%), Positives = 51/90 (56%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP--PSPPPPYIYKSPPPP 165
           PP     S P  S    P  +  SP  P   PPPPYVY SPPP  PSPP PY YKSPPPP
Sbjct: 36  PPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPSPYYYKSPPPP 95

Query: 166 PYVYNSPPPPPYVYNSPPPPPYVYKSPPPP 255
               +  PPPPY Y SPPPP     SPPPP
Sbjct: 96  ----SPSPPPPYYYKSPPPPS---PSPPPP 118

[16][TOP]
>UniRef100_Q39864 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39864_SOYBN
          Length = 199

 Score =  135 bits (339), Expect = 2e-30
 Identities = 63/101 (62%), Positives = 63/101 (62%), Gaps = 24/101 (23%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP---------------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNS 213
           SPPPPPY YPSPPPP               SPPPPY Y SPPPPPY Y SPPPP Y Y S
Sbjct: 68  SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 127

Query: 214 PPPPPYVYK---------SPPPPPYVYKSPPPPPYVYKSPP 309
           PPPP Y YK         SPPPPPY Y SPPPP Y YKSPP
Sbjct: 128 PPPPVYKYKSPPPPHKYPSPPPPPYKYPSPPPPVYKYKSPP 168

 Score =  134 bits (338), Expect = 2e-30
 Identities = 67/109 (61%), Positives = 68/109 (62%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPP-YIYKSPPP 162
           PP     S P    K       V  +  PPPPY YPSPPPP     SPPPP Y YKSPPP
Sbjct: 32  PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 91

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P Y Y SPPPP Y Y SPPPPPY Y SPPPP Y YKSPPPP Y YKSPP
Sbjct: 92  PVYKYKSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPP 139

 Score =  134 bits (338), Expect = 2e-30
 Identities = 61/92 (66%), Positives = 62/92 (67%), Gaps = 15/92 (16%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP---------------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNS 213
           SPPPPPY YPSPPPP               SPPPP+ Y SPPPPPY Y SPPPP Y Y S
Sbjct: 107 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKYPSPPPPVYKYKS 166

Query: 214 PPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPPP Y Y SPPPPPY Y SPPPP Y YKSPP
Sbjct: 167 PPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPP 197

 Score =  134 bits (336), Expect = 4e-30
 Identities = 62/87 (71%), Positives = 63/87 (72%), Gaps = 6/87 (6%)
 Frame = +1

Query: 67  VSPFSPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPP 228
           V  +  PPPPY YPSPPPP     SPPPP Y YKSPPPP Y Y SPPPP Y Y SPPPPP
Sbjct: 15  VYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP-YKYPSPPPPP 73

Query: 229 YVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           Y Y SPPPP Y YKSPPPP Y YKSPP
Sbjct: 74  YKYPSPPPPVYKYKSPPPPVYKYKSPP 100

 Score =  129 bits (323), Expect = 1e-28
 Identities = 67/118 (56%), Positives = 69/118 (58%), Gaps = 15/118 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPP-YIYKSPPP 162
           PP     S P    K       V  +  PPPPY YPSPPPP     SPPPP Y YKSPPP
Sbjct: 71  PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 130

Query: 163 ---------PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
                    PP+ Y SPPPPPY Y SPPPP Y YKS PPPPY Y SPPPPPY Y SPP
Sbjct: 131 PVYKYKSPPPPHKYPSPPPPPYKYPSPPPPVYKYKS-PPPPYKYPSPPPPPYKYPSPP 187

 Score =  123 bits (309), Expect = 5e-27
 Identities = 59/90 (65%), Positives = 59/90 (65%), Gaps = 14/90 (15%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP-----SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           PP  PY YPSPPPP     SPPPPY Y SPPPPPY Y SPPPP Y Y SPPPP Y YKSP
Sbjct: 1   PPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSP 60

Query: 247 PPP-------PYVYKSPPPPP--YVYKSPP 309
           PPP       P  YK P PPP  Y YKSPP
Sbjct: 61  PPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 90

 Score =  122 bits (307), Expect = 9e-27
 Identities = 63/94 (67%), Positives = 63/94 (67%), Gaps = 17/94 (18%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPP--YV 234
           SPPPPPY YPSPPPP     SPPPP Y YKSPPPP Y Y SPPPPPY Y  P PPP  Y 
Sbjct: 29  SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP-YKYPSPPPPPYKY--PSPPPPVYK 85

Query: 235 YKSP---------PPPPYVYKSPPPPPYVYKSPP 309
           YKSP         PPPPY Y SPPPPPY Y SPP
Sbjct: 86  YKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPP 119

 Score =  119 bits (298), Expect = 1e-25
 Identities = 58/100 (58%), Positives = 60/100 (60%), Gaps = 5/100 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS-----PPPPYIYKSPPPP 165
           PP+   S  P      +P        SPPPP Y Y SPPPP      PPPPY Y SPPPP
Sbjct: 101 PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKYPSPPPP 160

Query: 166 PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
            Y Y S PPPPY Y SPPPPPY Y SPPPP Y YKSPPPP
Sbjct: 161 VYKYKS-PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 199

[17][TOP]
>UniRef100_Q40415 Extensin (Fragment) n=1 Tax=Nicotiana sylvestris RepID=Q40415_NICSY
          Length = 131

 Score =  134 bits (337), Expect = 3e-30
 Identities = 63/87 (72%), Positives = 65/87 (74%), Gaps = 9/87 (10%)
 Frame = +1

Query: 76  FSPPPPP---YVYPSPPPP-----SPPPPY-IYKSPPPPPYVYNSPPPPPYVYNSPPPPP 228
           +S PPPP   YVY SPPPP     SPPPP  IY+SPPPP Y Y SPPPP Y Y SPPPPP
Sbjct: 22  YSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPIYKYKSPPPPP 81

Query: 229 YVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            VYKSPPPP Y YKSPPPPP VYKSPP
Sbjct: 82  PVYKSPPPPVYKYKSPPPPPPVYKSPP 108

 Score =  132 bits (333), Expect = 9e-30
 Identities = 63/83 (75%), Positives = 63/83 (75%), Gaps = 6/83 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPP Y Y SPPPPP VY SPPPP Y YK
Sbjct: 36  SPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYK 95

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP VYKSPPPP  VYKSPP
Sbjct: 96  SPPPPPPVYKSPPPP--VYKSPP 116

 Score =  124 bits (310), Expect = 4e-27
 Identities = 61/84 (72%), Positives = 62/84 (73%), Gaps = 7/84 (8%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP  +Y SPPPP     SPPPP Y YKSPPPPP VY SPPPP Y Y SPPPPP VYK
Sbjct: 46  SPPPPLPIYRSPPPPVYKYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYK 105

Query: 241 SPPPPPYVYKSPPPP-PYVYKSPP 309
           SPPPP  VYKSPPPP  Y Y SPP
Sbjct: 106 SPPPP--VYKSPPPPYHYYYTSPP 127

 Score =  121 bits (303), Expect = 3e-26
 Identities = 56/79 (70%), Positives = 57/79 (72%), Gaps = 8/79 (10%)
 Frame = +1

Query: 97  YVYPSPPPP-------SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           Y Y SPPPP       SPPPP Y YKSPPPP  +Y SPPPP Y Y SPPPP Y YKSPPP
Sbjct: 20  YYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPIYKYKSPPP 79

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP VYKSPPPP Y YKSPP
Sbjct: 80  PPPVYKSPPPPVYKYKSPP 98

 Score =  114 bits (286), Expect = 3e-24
 Identities = 54/78 (69%), Positives = 55/78 (70%), Gaps = 7/78 (8%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP       PPPP +YKSPPPP Y Y SPPPPP VY SPPPP  VYK
Sbjct: 56  SPPPPVYKYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPP--VYK 113

Query: 241 SPPPP-PYVYKSPPPPPY 291
           SPPPP  Y Y SPPPP Y
Sbjct: 114 SPPPPYHYYYTSPPPPHY 131

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 48/89 (53%), Positives = 50/89 (56%), Gaps = 2/89 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFS-PPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVY 177
           PP     S P    K       +  +  PPPPP VY SP    PPP Y YKSPPPPP VY
Sbjct: 49  PPLPIYRSPPPPVYKYKSPPPPIYKYKSPPPPPPVYKSP----PPPVYKYKSPPPPPPVY 104

Query: 178 NSPPPPPYVYNSPPPP-PYVYKSPPPPPY 261
            SPPPP  VY SPPPP  Y Y SPPPP Y
Sbjct: 105 KSPPPP--VYKSPPPPYHYYYTSPPPPHY 131

[18][TOP]
>UniRef100_Q8H9E0 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Solanum
           tuberosum RepID=Q8H9E0_SOLTU
          Length = 217

 Score =  134 bits (336), Expect = 4e-30
 Identities = 61/83 (73%), Positives = 61/83 (73%), Gaps = 6/83 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPP Y Y SPPPP Y Y SPPPP Y YK
Sbjct: 72  SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYK 131

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP Y YKSPPPP Y YKSPP
Sbjct: 132 SPPPPVYKYKSPPPPVYKYKSPP 154

 Score =  134 bits (336), Expect = 4e-30
 Identities = 61/83 (73%), Positives = 61/83 (73%), Gaps = 6/83 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPP Y Y SPPPP Y Y SPPPP Y YK
Sbjct: 82  SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYK 141

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP Y YKSPPPP Y YKSPP
Sbjct: 142 SPPPPVYKYKSPPPPVYKYKSPP 164

 Score =  133 bits (334), Expect = 7e-30
 Identities = 61/85 (71%), Positives = 61/85 (71%), Gaps = 8/85 (9%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-------SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYV 234
           SPPPP Y Y SPPPP       SPPPP Y YKSPPPP Y Y SPPPP Y Y SPPPP Y 
Sbjct: 50  SPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYK 109

Query: 235 YKSPPPPPYVYKSPPPPPYVYKSPP 309
           YKSPPPP Y YKSPPPP Y YKSPP
Sbjct: 110 YKSPPPPVYKYKSPPPPVYKYKSPP 134

 Score =  132 bits (332), Expect = 1e-29
 Identities = 60/82 (73%), Positives = 60/82 (73%), Gaps = 6/82 (7%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKS 243
           PPPP Y Y SPPPP     SPPPP Y YKSPPPP Y Y SPPPP Y Y SPPPP Y YKS
Sbjct: 63  PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKS 122

Query: 244 PPPPPYVYKSPPPPPYVYKSPP 309
           PPPP Y YKSPPPP Y YKSPP
Sbjct: 123 PPPPVYKYKSPPPPVYKYKSPP 144

 Score =  132 bits (332), Expect = 1e-29
 Identities = 62/85 (72%), Positives = 62/85 (72%), Gaps = 8/85 (9%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPP Y Y SPPPP Y Y SPPPP Y YK
Sbjct: 92  SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYK 151

Query: 241 SPPPPPYVYKSPPPPP--YVYKSPP 309
           SPPPP Y YKSPPPPP  Y YKSPP
Sbjct: 152 SPPPPVYKYKSPPPPPPVYKYKSPP 176

 Score =  132 bits (332), Expect = 1e-29
 Identities = 62/85 (72%), Positives = 62/85 (72%), Gaps = 8/85 (9%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPP Y Y SPPPP Y Y SPPPP Y YK
Sbjct: 102 SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYK 161

Query: 241 SPPPPP--YVYKSPPPPPYVYKSPP 309
           SPPPPP  Y YKSPPPP Y YKSPP
Sbjct: 162 SPPPPPPVYKYKSPPPPVYKYKSPP 186

 Score =  132 bits (332), Expect = 1e-29
 Identities = 62/85 (72%), Positives = 62/85 (72%), Gaps = 8/85 (9%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPPP--YV 234
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPP Y Y SPPPP Y Y SPPPPP  Y 
Sbjct: 112 SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYK 171

Query: 235 YKSPPPPPYVYKSPPPPPYVYKSPP 309
           YKSPPPP Y YKSPPPP Y YKSPP
Sbjct: 172 YKSPPPPVYKYKSPPPPVYKYKSPP 196

 Score =  131 bits (330), Expect = 2e-29
 Identities = 62/87 (71%), Positives = 62/87 (71%), Gaps = 10/87 (11%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-------SPPPP-YIYKSPPPPP--YVYNSPPPPPYVYNSPPPPP 228
           SPPPP Y Y SPPPP       SPPPP Y YKSPPPPP  Y Y SPPPP Y Y SPPPP 
Sbjct: 28  SPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPV 87

Query: 229 YVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           Y YKSPPPP Y YKSPPPP Y YKSPP
Sbjct: 88  YKYKSPPPPVYKYKSPPPPVYKYKSPP 114

 Score =  130 bits (326), Expect = 6e-29
 Identities = 63/89 (70%), Positives = 63/89 (70%), Gaps = 12/89 (13%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-------SPPPP-YIYKSPPPPP--YVYNSPPPPPYVYNSPPPPP 228
           SPPPP Y Y SPPPP       SPPPP Y YKSPPPPP  Y Y SPPPP Y Y SPPPPP
Sbjct: 6   SPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPP 65

Query: 229 --YVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             Y YKSPPPP Y YKSPPPP Y YKSPP
Sbjct: 66  PVYKYKSPPPPVYKYKSPPPPVYKYKSPP 94

 Score =  127 bits (319), Expect = 4e-28
 Identities = 62/91 (68%), Positives = 62/91 (68%), Gaps = 14/91 (15%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPP--YVYNSPPPPPYV 234
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPP Y Y SPPPPP  Y Y SPPPP Y 
Sbjct: 122 SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYK 181

Query: 235 YKSPPPPPYVYKSPPPP------PYVYKSPP 309
           YKSPPPP Y YKSPPPP      PY Y SPP
Sbjct: 182 YKSPPPPVYKYKSPPPPVHKSPAPYYYTSPP 212

 Score =  115 bits (287), Expect = 2e-24
 Identities = 56/85 (65%), Positives = 57/85 (67%), Gaps = 14/85 (16%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPP--YVYNSPPPPPYVYNSPPPPPYV 234
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPPP  Y Y SPPPP Y Y SPPPP Y 
Sbjct: 132 SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYK 191

Query: 235 YKSPPPP------PYVYKSPPPPPY 291
           YKSPPPP      PY Y SPPPP +
Sbjct: 192 YKSPPPPVHKSPAPYYYTSPPPPSH 216

 Score =  109 bits (273), Expect = 8e-23
 Identities = 54/77 (70%), Positives = 54/77 (70%), Gaps = 6/77 (7%)
 Frame = +1

Query: 97  YVYPSPPPPSPPPPYIYKSPPPPP--YVYNSPPPPPYVYNSPPPPP--YVYKSPPPPPYV 264
           Y Y SPPPP     Y YKSPPPPP  Y Y SPPPP Y Y SPPPPP  Y YKSPPPP Y 
Sbjct: 2   YKYKSPPPPV----YKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYK 57

Query: 265 YKSPPPPP--YVYKSPP 309
           YKSPPPPP  Y YKSPP
Sbjct: 58  YKSPPPPPPVYKYKSPP 74

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 47/76 (61%), Positives = 47/76 (61%), Gaps = 15/76 (19%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP---YIYKSPPPPPYVYNSPPPPPYVYNSPPPP--- 225
           SPPPP Y Y SPPPP     SPPPP   Y YKSPPPP Y Y SPPPP Y Y SPPPP   
Sbjct: 142 SPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHK 201

Query: 226 ---PYVYKSP-PPPPY 261
              PY Y SP PP  Y
Sbjct: 202 SPAPYYYTSPPPPSHY 217

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 43/62 (69%), Positives = 44/62 (70%), Gaps = 6/62 (9%)
 Frame = +1

Query: 142 IYKSPPPPP--YVYNSPPPPP--YVYNSPPPPPYVYKSPPPPP--YVYKSPPPPPYVYKS 303
           +YK   PPP  Y Y SPPPPP  Y Y SPPPP Y YKSPPPPP  Y YKSPPPP Y YKS
Sbjct: 1   VYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKS 60

Query: 304 PP 309
           PP
Sbjct: 61  PP 62

[19][TOP]
>UniRef100_Q2A9D1 Extensin-like region containing protein n=1 Tax=Brassica oleracea
           RepID=Q2A9D1_BRAOL
          Length = 543

 Score =  133 bits (335), Expect = 5e-30
 Identities = 68/125 (54%), Positives = 73/125 (58%), Gaps = 24/125 (19%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYIY 147
           P   + SSP  S+  +PS      +  PPPPYVY SPPPP            SPPPPY+Y
Sbjct: 72  PKPYIYSSPPPSSYYSPSP--KVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVY 129

Query: 148 KSPPPPPYVYNSP------PPPPYVYNSPPPPPYVYKSP------PPPPYVYKSPPPPPY 291
            SPPPPPY   SP      PPPPYVYNSPPPPPY   SP      PPPPYVY SPPPPPY
Sbjct: 130 SSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKAEYKSPPPPYVYSSPPPPPY 189

Query: 292 VYKSP 306
              SP
Sbjct: 190 YSPSP 194

 Score =  133 bits (335), Expect = 5e-30
 Identities = 73/135 (54%), Positives = 77/135 (57%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP   V SSP      +PS      +  PPPPYVY SPPPP            SPPPPY+
Sbjct: 297 PPPPYVYSSPPPPPYYSPSP--KVEYKSPPPPYVYNSPPPPPYYSPSPKVDYKSPPPPYV 354

Query: 145 YKSPPPPPY------VYNSPPPPPYVYNSPPPPPY-------VYKSPPPPPYVYKSPPPP 285
           Y SPPPPPY      VY   PPPPYVY+SPPPPPY       VYKS PPPPYVY SPPPP
Sbjct: 355 YSSPPPPPYYSPSPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKS-PPPPYVYSSPPPP 413

Query: 286 PYV-------YKSPP 309
           PY        YKSPP
Sbjct: 414 PYYSPSPKVNYKSPP 428

 Score =  130 bits (326), Expect = 6e-29
 Identities = 71/143 (49%), Positives = 76/143 (53%), Gaps = 41/143 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP   V SSP      +PS      +  PPPPYVY SPPPP            SPPPPY+
Sbjct: 401 PPPPYVYSSPPPPPYYSPSP--KVNYKSPPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYV 458

Query: 145 YKSP----------------PPPPYVYNSPPPPPYVYNSP------PPPPYVYKSPPPPP 258
           + SP                PPPPYVY+SPPPPPY   SP      PPPPYVY SPPPPP
Sbjct: 459 HSSPPPPPFYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPP 518

Query: 259 Y-------VYKSPPPPPYVYKSP 306
           Y        YKSPPPPPYVYK P
Sbjct: 519 YYSPSPKVYYKSPPPPPYVYKMP 541

 Score =  129 bits (323), Expect = 1e-28
 Identities = 71/143 (49%), Positives = 76/143 (53%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP   V SSP      +PS   V  +  PPPPYVY SPPPP            SPPPPY+
Sbjct: 375 PPPPYVYSSPPPPPYYSPSPKMV--YKSPPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYV 432

Query: 145 YKSPPPPPYVYNSP------PPPPYVYNSPPPPP----------------YVYKSPPPPP 258
           Y SPPPPPY   SP      PPPPYV++SPPPPP                YVY SPPPPP
Sbjct: 433 YSSPPPPPYYSPSPKVNYKSPPPPYVHSSPPPPPFYSPSPKAEYKSPPPPYVYSSPPPPP 492

Query: 259 YVYKSP------PPPPYVYKSPP 309
           Y   SP      PPPPYVY SPP
Sbjct: 493 YYSPSPKVDYKSPPPPYVYSSPP 515

 Score =  127 bits (318), Expect = 5e-28
 Identities = 69/133 (51%), Positives = 71/133 (53%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPP--PPSPPPPYIYKSPPPPPY- 171
           PP   V SSP      +PS        PPPPPY  PSP     SPPPPY+Y SPPPPPY 
Sbjct: 253 PPPPYVCSSPPPPPYYSPSPKVDYKSPPPPPPYYSPSPKFEYKSPPPPYVYSSPPPPPYY 312

Query: 172 ---------------VYNSPPPPPYVYNSP------PPPPYVYKSPPPPPY------VYK 270
                          VYNSPPPPPY   SP      PPPPYVY SPPPPPY      VY 
Sbjct: 313 SPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYY 372

Query: 271 SPPPPPYVYKSPP 309
             PPPPYVY SPP
Sbjct: 373 KSPPPPYVYSSPP 385

 Score =  125 bits (315), Expect = 1e-27
 Identities = 70/143 (48%), Positives = 74/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP   V SSP      +PS      +  PPPPYVY SPPPP            SPPPPY+
Sbjct: 123 PPPPYVYSSPPPPPYYSPSP--KVEYKSPPPPYVYNSPPPPPYYSPSPKAEYKSPPPPYV 180

Query: 145 YKSPPPPPY----------------VYNSPPPPPYVYNSP------PPPPYVYKSPPPPP 258
           Y SPPPPPY                VY+SPPPPPY   SP      PPPPYVY SPPPPP
Sbjct: 181 YSSPPPPPYYSPSPKVEYKSPQPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPP 240

Query: 259 YVYKSP------PPPPYVYKSPP 309
           Y   SP      PPPPYV  SPP
Sbjct: 241 YYSPSPKVDYKSPPPPYVCSSPP 263

 Score =  125 bits (314), Expect = 1e-27
 Identities = 69/143 (48%), Positives = 75/143 (52%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP   V SSP      +PS      +  PPPPYVY SPPPP            SPPPPY+
Sbjct: 349 PPPPYVYSSPPPPPYYSPSPKVY--YKSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPPYV 406

Query: 145 YKSPPPPPY----------------VYNSPPPPPYVYNSP------PPPPYVYKSPPPPP 258
           Y SPPPPPY                VY+SPPPPPY   SP      PPPPYV+ SPPPPP
Sbjct: 407 YSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYVHSSPPPPP 466

Query: 259 YVYKSP------PPPPYVYKSPP 309
           +   SP      PPPPYVY SPP
Sbjct: 467 FYSPSPKAEYKSPPPPYVYSSPP 489

 Score =  125 bits (313), Expect = 2e-27
 Identities = 66/134 (49%), Positives = 73/134 (54%), Gaps = 31/134 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP------------PSPPPPYI 144
           P +SA  S P    +  P       ++P P PY+Y SPPP             SPPPPY+
Sbjct: 49  PYYSAPPSPPPQYRRQGPK------YTPHPKPYIYSSPPPSSYYSPSPKVEYKSPPPPYV 102

Query: 145 YKSPPPPPYVYNSP------PPPPYVYNSPPPPPYVYKSP------PPPPYVYKSPPPPP 288
           Y SPPPPPY   SP      PPPPYVY+SPPPPPY   SP      PPPPYVY SPPPPP
Sbjct: 103 YSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPP 162

Query: 289 YV-------YKSPP 309
           Y        YKSPP
Sbjct: 163 YYSPSPKAEYKSPP 176

 Score =  122 bits (306), Expect = 1e-26
 Identities = 69/136 (50%), Positives = 74/136 (54%), Gaps = 33/136 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP   V SSP      +PS      +  P PPYVY SPPPP            SPPPPY+
Sbjct: 175 PPPPYVYSSPPPPPYYSPSP--KVEYKSPQPPYVYSSPPPPPYYSPSPKVDYKSPPPPYV 232

Query: 145 YKSPPPPPYVYNSP------PPPPYVYNSPPPPPYV-------YKSPPPPP--------Y 261
           Y SPPPPPY   SP      PPPPYV +SPPPPPY        YKSPPPPP        +
Sbjct: 233 YSSPPPPPYYSPSPKVDYKSPPPPYVCSSPPPPPYYSPSPKVDYKSPPPPPPYYSPSPKF 292

Query: 262 VYKSPPPPPYVYKSPP 309
            YKS PPPPYVY SPP
Sbjct: 293 EYKS-PPPPYVYSSPP 307

 Score =  122 bits (306), Expect = 1e-26
 Identities = 69/135 (51%), Positives = 74/135 (54%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP+  V SSP      +PS      +  PPPPYVY SPPPP            SPPPPY+
Sbjct: 203 PPY--VYSSPPPPPYYSPSP--KVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYV 258

Query: 145 YKSPPPPPYV-------YNSPPPPPYVYN-SP------PPPPYVYKSPPPPPYVYKSP-- 276
             SPPPPPY        Y SPPPPP  Y+ SP      PPPPYVY SPPPPPY   SP  
Sbjct: 259 CSSPPPPPYYSPSPKVDYKSPPPPPPYYSPSPKFEYKSPPPPYVYSSPPPPPYYSPSPKV 318

Query: 277 ----PPPPYVYKSPP 309
               PPPPYVY SPP
Sbjct: 319 EYKSPPPPYVYNSPP 333

 Score =  109 bits (272), Expect = 1e-22
 Identities = 61/135 (45%), Positives = 66/135 (48%), Gaps = 40/135 (29%)
 Frame = +1

Query: 25  SPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP------------PPPYIYKSP---- 156
           SP ++ K  P     SP+ P      Y +PP P P            P PYIY SP    
Sbjct: 25  SPPTTQKYPPVHKTKSPYPPKMNSPYYSAPPSPPPQYRRQGPKYTPHPKPYIYSSPPPSS 84

Query: 157 ------------PPPPYVYNSPPPPPYVYNSP------PPPPYVYKSPPPPPYVYKSP-- 276
                       PPPPYVY+SPPPPPY   SP      PPPPYVY SPPPPPY   SP  
Sbjct: 85  YYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKV 144

Query: 277 ----PPPPYVYKSPP 309
               PPPPYVY SPP
Sbjct: 145 EYKSPPPPYVYNSPP 159

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 54/129 (41%), Positives = 58/129 (44%), Gaps = 50/129 (38%)
 Frame = +1

Query: 73  PFSPPPPPYVYP------SPPPPSPPPPYIYKSPPPP---------------PYVYNSP- 186
           P+  PP    YP      SP PP    PY    P PP               PY+Y+SP 
Sbjct: 22  PYESPPTTQKYPPVHKTKSPYPPKMNSPYYSAPPSPPPQYRRQGPKYTPHPKPYIYSSPP 81

Query: 187 ---------------PPPPYVYNSPPPPPYVYKSP------PPPPYVYKSPPPPPYV--- 294
                          PPPPYVY+SPPPPPY   SP      PPPPYVY SPPPPPY    
Sbjct: 82  PSSYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPS 141

Query: 295 ----YKSPP 309
               YKSPP
Sbjct: 142 PKVEYKSPP 150

[20][TOP]
>UniRef100_Q9ZWT0 Extensin n=1 Tax=Adiantum capillus-veneris RepID=Q9ZWT0_ADICA
          Length = 207

 Score =  133 bits (334), Expect = 7e-30
 Identities = 72/129 (55%), Positives = 75/129 (58%), Gaps = 33/129 (25%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVY 177
           SSP    K  P      P   PPPPY+Y SPPP  PSPPPPYIYKSP      PPPPY+Y
Sbjct: 80  SSPPYKYKSPPP-----PSPSPPPPYIYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYLY 134

Query: 178 NSP------PPPPYVYNSPP-------PPPYVYKSP------PPPPYVYKSPP------P 282
            SP      PPPPY+Y SPP       PPPY Y SP      PPPPY YKSPP      P
Sbjct: 135 KSPPPPSPSPPPPYIYKSPPPPPCTPSPPPYFYSSPPPPSPSPPPPYQYKSPPPPSHPSP 194

Query: 283 PPYVYKSPP 309
           PPYVYKSPP
Sbjct: 195 PPYVYKSPP 203

 Score =  129 bits (324), Expect = 1e-28
 Identities = 68/114 (59%), Positives = 71/114 (62%), Gaps = 17/114 (14%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P  I  SP  P   PPPPY+Y SPPPPSP  PPPYIYKSPPPP
Sbjct: 97  PPPYIYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYLYKSPPPPSPSPPPPYIYKSPPPP 156

Query: 166 PYVYNSPPPPPYVYNSP------PPPPYVYKSPP------PPPYVYKSPPPPPY 291
           P    +P PPPY Y+SP      PPPPY YKSPP      PPPYVYKSPPPPPY
Sbjct: 157 PC---TPSPPPYFYSSPPPPSPSPPPPYQYKSPPPPSHPSPPPYVYKSPPPPPY 207

 Score =  128 bits (322), Expect = 2e-28
 Identities = 66/112 (58%), Positives = 69/112 (61%), Gaps = 33/112 (29%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P SP  PPY Y SPPP  PSPPPPYIYKSP      PPPPY+Y SP      PPPPY+Y 
Sbjct: 76  PPSPSSPPYKYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYLYK 135

Query: 211 SP------PPPPYVYKSPP-------PPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY+YKSPP       PPPY Y SP      PPPPY YKSPP
Sbjct: 136 SPPPPSPSPPPPYIYKSPPPPPCTPSPPPYFYSSPPPPSPSPPPPYQYKSPP 187

 Score =  112 bits (280), Expect = 1e-23
 Identities = 57/108 (52%), Positives = 63/108 (58%), Gaps = 31/108 (28%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP-- 216
           +P  P Y + SPPP    PPY YKSP      PPPPY+Y SP      PPPPY+Y SP  
Sbjct: 64  TPWHPHYPHKSPPPSPSSPPYKYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYIYKSPPP 123

Query: 217 ----PPPPYVYKSP------PPPPYVYKSPP-------PPPYVYKSPP 309
               PPPPY+YKSP      PPPPY+YKSPP       PPPY Y SPP
Sbjct: 124 PSPSPPPPYLYKSPPPPSPSPPPPYIYKSPPPPPCTPSPPPYFYSSPP 171

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 29/54 (53%), Positives = 33/54 (61%)
 Frame = +1

Query: 148 KSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           ++P  P Y + SPPP      SP  PPY YKSPPPP       PPPPY+YKSPP
Sbjct: 63  RTPWHPHYPHKSPPP------SPSSPPYKYKSPPPPSP--S--PPPPYIYKSPP 106

[21][TOP]
>UniRef100_Q41707 Extensin class 1 protein n=1 Tax=Vigna unguiculata
           RepID=Q41707_VIGUN
          Length = 489

 Score =  133 bits (334), Expect = 7e-30
 Identities = 76/138 (55%), Positives = 76/138 (55%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP--PSPPPPYIYKSP--- 156
           PP     S P  S    P     SP  P   PPPPYVY SPPP  PSPPPPY YKSP   
Sbjct: 121 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPP 180

Query: 157 ---PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKS 273
              PPPPY Y SP      PPPPY Y SP      PPPPYVYKSP      PPPPY YKS
Sbjct: 181 SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKS 240

Query: 274 P------PPPPYVYKSPP 309
           P      PPPPY YKSPP
Sbjct: 241 PPPPSPSPPPPYYYKSPP 258

 Score =  133 bits (334), Expect = 7e-30
 Identities = 76/138 (55%), Positives = 76/138 (55%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP--PSPPPPYIYKSP--- 156
           PP     S P  S    P     SP  P   PPPPYVY SPPP  PSPPPPY YKSP   
Sbjct: 313 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPP 372

Query: 157 ---PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKS 273
              PPPPY Y SP      PPPPY Y SP      PPPPY YKSP      PPPPYVYKS
Sbjct: 373 SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKS 432

Query: 274 P------PPPPYVYKSPP 309
           P      PPPPY YKSPP
Sbjct: 433 PPPPSPSPPPPYYYKSPP 450

 Score =  131 bits (330), Expect = 2e-29
 Identities = 75/138 (54%), Positives = 78/138 (56%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSP--- 156
           PP+   S  P S +   P  +  SP  P   PPPPY Y SPPPPSP  PPPY YKSP   
Sbjct: 74  PPYYYKSPPPPSPSP-PPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 132

Query: 157 ---PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKS 273
              PPPPY Y SP      PPPPYVY SP      PPPPY YKSP      PPPPY YKS
Sbjct: 133 SPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKS 192

Query: 274 P------PPPPYVYKSPP 309
           P      PPPPY YKSPP
Sbjct: 193 PPPPSPSPPPPYYYKSPP 210

 Score =  131 bits (329), Expect = 3e-29
 Identities = 75/138 (54%), Positives = 75/138 (54%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP--PSPPPPYIYKSP--- 156
           PP     S P  S    P     SP  P   PPPPYVY SPPP  PSPPPPY YKSP   
Sbjct: 185 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPP 244

Query: 157 ---PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKS 273
              PPPPY Y SP      PPPPY Y SP      PPPPY YKSP      PPPPY YKS
Sbjct: 245 SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKS 304

Query: 274 P------PPPPYVYKSPP 309
           P      PPPPY YKSPP
Sbjct: 305 PPPPSPSPPPPYYYKSPP 322

 Score =  131 bits (329), Expect = 3e-29
 Identities = 75/138 (54%), Positives = 75/138 (54%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP--PSPPPPYIYKSP--- 156
           PP     S P  S    P     SP  P   PPPPY Y SPPP  PSPPPPY YKSP   
Sbjct: 249 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 308

Query: 157 ---PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKS 273
              PPPPY Y SP      PPPPY Y SP      PPPPYVYKSP      PPPPY YKS
Sbjct: 309 SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKS 368

Query: 274 P------PPPPYVYKSPP 309
           P      PPPPY YKSPP
Sbjct: 369 PPPPSPSPPPPYYYKSPP 386

 Score =  131 bits (329), Expect = 3e-29
 Identities = 75/138 (54%), Positives = 75/138 (54%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP--PSPPPPYIYKSP--- 156
           PP     S P  S    P     SP  P   PPPPY Y SPPP  PSPPPPY YKSP   
Sbjct: 281 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 340

Query: 157 ---PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKS 273
              PPPPYVY SP      PPPPY Y SP      PPPPY YKSP      PPPPY YKS
Sbjct: 341 SPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKS 400

Query: 274 P------PPPPYVYKSPP 309
           P      PPPPY YKSPP
Sbjct: 401 PPPPSPSPPPPYYYKSPP 418

 Score =  129 bits (325), Expect = 8e-29
 Identities = 74/141 (52%), Positives = 75/141 (53%), Gaps = 38/141 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP  PPPY YKSPPPP
Sbjct: 345 PPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 404

Query: 166 ------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP------PYVYKS 273
                 PY Y SPPPP      PYVY SPPPP      PY YKSPPPP      PY YKS
Sbjct: 405 SPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKS 464

Query: 274 PPPP---------PYVYKSPP 309
           PPPP         PY+Y SPP
Sbjct: 465 PPPPSPSPPPPYYPYLYNSPP 485

 Score =  129 bits (324), Expect = 1e-28
 Identities = 69/116 (59%), Positives = 70/116 (60%), Gaps = 39/116 (33%)
 Frame = +1

Query: 79  SPPPPPYV-------YPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPP 195
           SPPPPPYV       Y SPPP  PSPPPPY+YKSP      PPPPY Y SP      PPP
Sbjct: 63  SPPPPPYVHKYPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 122

Query: 196 PYVYNSP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           PY Y SP      PPPPY YKSP      PPPPYVYKSP      PPPPY YKSPP
Sbjct: 123 PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPP 178

 Score =  122 bits (305), Expect = 2e-26
 Identities = 73/140 (52%), Positives = 73/140 (52%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP  PPPY YKSPPPP
Sbjct: 89  PPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 148

Query: 166 ------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP------PYVY-- 267
                 PYVY SPPPP      PY Y SPPPP      PY YKSPPPP      PY Y  
Sbjct: 149 SPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKS 208

Query: 268 ------KSPPPPPYVYKSPP 309
                    PPPPYVYKSPP
Sbjct: 209 PPPPSPS--PPPPYVYKSPP 226

 Score =  120 bits (302), Expect = 4e-26
 Identities = 72/140 (51%), Positives = 73/140 (52%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P  +  SP  P   PPPPY Y SPPPPSP  PPPY YKSPPPP
Sbjct: 137 PPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 196

Query: 166 ------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP------PYVY-- 267
                 PY Y SPPPP      PYVY SPPPP      PY YKSPPPP      PY Y  
Sbjct: 197 SPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKS 256

Query: 268 ------KSPPPPPYVYKSPP 309
                    PPPPY YKSPP
Sbjct: 257 PPPPSPS--PPPPYYYKSPP 274

 Score =  120 bits (302), Expect = 4e-26
 Identities = 72/140 (51%), Positives = 73/140 (52%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P  +  SP  P   PPPPY Y SPPPPSP  PPPY YKSPPPP
Sbjct: 329 PPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 388

Query: 166 ------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP------PYVY-- 267
                 PY Y SPPPP      PY Y SPPPP      PYVYKSPPPP      PY Y  
Sbjct: 389 SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKS 448

Query: 268 ------KSPPPPPYVYKSPP 309
                    PPPPY YKSPP
Sbjct: 449 PPPPSPS--PPPPYYYKSPP 466

 Score =  120 bits (300), Expect = 6e-26
 Identities = 72/140 (51%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP  PPPY YKSPPPP
Sbjct: 153 PPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 212

Query: 166 ------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP------PYVY-- 267
                 PYVY SPPPP      PY Y SPPPP      PY YKSPPPP      PY Y  
Sbjct: 213 SPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKS 272

Query: 268 ------KSPPPPPYVYKSPP 309
                    PPPPY YKSPP
Sbjct: 273 PPPPSPS--PPPPYYYKSPP 290

 Score =  120 bits (300), Expect = 6e-26
 Identities = 72/140 (51%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP  PPPY YKSPPPP
Sbjct: 217 PPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 276

Query: 166 ------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP------PYVY-- 267
                 PY Y SPPPP      PY Y SPPPP      PY YKSPPPP      PY Y  
Sbjct: 277 SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKS 336

Query: 268 ------KSPPPPPYVYKSPP 309
                    PPPPYVYKSPP
Sbjct: 337 PPPPSPS--PPPPYVYKSPP 354

 Score =  119 bits (298), Expect = 1e-25
 Identities = 72/140 (51%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP  PPPY YKSPPPP
Sbjct: 233 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 292

Query: 166 ------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP------PYVY-- 267
                 PY Y SPPPP      PY Y SPPPP      PY YKSPPPP      PYVY  
Sbjct: 293 SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKS 352

Query: 268 ------KSPPPPPYVYKSPP 309
                    PPPPY YKSPP
Sbjct: 353 PPPPSPS--PPPPYYYKSPP 370

 Score =  119 bits (298), Expect = 1e-25
 Identities = 72/140 (51%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP  PPPY YKSPPPP
Sbjct: 265 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 324

Query: 166 ------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP------PYVY-- 267
                 PY Y SPPPP      PYVY SPPPP      PY YKSPPPP      PY Y  
Sbjct: 325 SPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKS 384

Query: 268 ------KSPPPPPYVYKSPP 309
                    PPPPY YKSPP
Sbjct: 385 PPPPSPS--PPPPYYYKSPP 402

 Score =  119 bits (297), Expect = 1e-25
 Identities = 71/140 (50%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P  +  SP  P   PPPPY Y SPPPPSP  PPPY YKSPPPP
Sbjct: 201 PPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 260

Query: 166 ------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP------PYVY-- 267
                 PY Y SPPPP      PY Y SPPPP      PY YKSPPPP      PY Y  
Sbjct: 261 SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKS 320

Query: 268 ------KSPPPPPYVYKSPP 309
                    PPPPY YKSPP
Sbjct: 321 PPPPSPS--PPPPYYYKSPP 338

 Score =  108 bits (271), Expect = 1e-22
 Identities = 62/124 (50%), Positives = 65/124 (52%), Gaps = 31/124 (25%)
 Frame = +1

Query: 31  NSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSP-------- 186
           N+  K TP      P+    PPY Y SPPPPSP       SPPPPPYV+  P        
Sbjct: 36  NNYPKQTP------PYYYNAPPYYYKSPPPPSP-------SPPPPPYVHKYPPYYYKSPP 82

Query: 187 -----PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVY 297
                PPPPYVY SP      PPPPY YKSP      PPPPY YKSP      PPPPY Y
Sbjct: 83  PPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYY 142

Query: 298 KSPP 309
           KSPP
Sbjct: 143 KSPP 146

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 56/100 (56%), Positives = 57/100 (57%), Gaps = 13/100 (13%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPYVY SPPPPSP  PPPY YKSPPPP
Sbjct: 393 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPP 452

Query: 166 ------PYVYNSPPPPPYVYNSPPPP--PYVYKSPPPPPY 261
                 PY Y SPPPP     SPPPP  PY+Y SPPPP Y
Sbjct: 453 SPSPPPPYYYKSPPPPSP---SPPPPYYPYLYNSPPPPAY 489

[22][TOP]
>UniRef100_Q7DLZ6 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q7DLZ6_VIGUN
          Length = 164

 Score =  132 bits (333), Expect = 9e-30
 Identities = 75/138 (54%), Positives = 76/138 (55%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSP--- 156
           PP     S P  S    P  +  SP  P   PPPPY Y SPPPPSP  PPPY YKSP   
Sbjct: 4   PPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 63

Query: 157 ---PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKS 273
              PPPPY Y SP      PPPPY Y SP      PPPPYVYKSP      PPPPY YKS
Sbjct: 64  SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKS 123

Query: 274 P------PPPPYVYKSPP 309
           P      PPPPY YKSPP
Sbjct: 124 PPPPSPSPPPPYYYKSPP 141

 Score =  130 bits (326), Expect = 6e-29
 Identities = 66/107 (61%), Positives = 67/107 (62%), Gaps = 32/107 (29%)
 Frame = +1

Query: 85  PPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP-- 216
           PPPPY Y SPPP  PSPPPPY+YKSP      PPPPY Y SP      PPPPY Y SP  
Sbjct: 3   PPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPP 62

Query: 217 ----PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
               PPPPY YKSP      PPPPY YKSP      PPPPYVYKSPP
Sbjct: 63  PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPP 109

 Score =  129 bits (325), Expect = 8e-29
 Identities = 74/141 (52%), Positives = 75/141 (53%), Gaps = 38/141 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP  PPPY YKSPPPP
Sbjct: 20  PPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 79

Query: 166 ------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP------PYVYKS 273
                 PY Y SPPPP      PYVY SPPPP      PY YKSPPPP      PY YKS
Sbjct: 80  SPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKS 139

Query: 274 PPPP---------PYVYKSPP 309
           PPPP         PY+Y SPP
Sbjct: 140 PPPPSPSPPPPYYPYLYNSPP 160

 Score =  108 bits (270), Expect = 2e-22
 Identities = 56/93 (60%), Positives = 56/93 (60%), Gaps = 30/93 (32%)
 Frame = +1

Query: 121 PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP 246
           PSPPPPY YKSP      PPPPYVY SP      PPPPY Y SP      PPPPY YKSP
Sbjct: 1   PSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP 60

Query: 247 ------PPPPYVYKSP------PPPPYVYKSPP 309
                 PPPPY YKSP      PPPPY YKSPP
Sbjct: 61  PPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPP 93

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 56/100 (56%), Positives = 57/100 (57%), Gaps = 13/100 (13%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPYVY SPPPPSP  PPPY YKSPPPP
Sbjct: 68  PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPP 127

Query: 166 ------PYVYNSPPPPPYVYNSPPPP--PYVYKSPPPPPY 261
                 PY Y SPPPP     SPPPP  PY+Y SPPPP Y
Sbjct: 128 SPSPPPPYYYKSPPPPSP---SPPPPYYPYLYNSPPPPAY 164

[23][TOP]
>UniRef100_Q39599 Extensin n=1 Tax=Catharanthus roseus RepID=Q39599_CATRO
          Length = 225

 Score =  132 bits (331), Expect = 2e-29
 Identities = 64/95 (67%), Positives = 65/95 (68%), Gaps = 17/95 (17%)
 Frame = +1

Query: 76  FSPPPP-----PYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPP 222
           +S PPP     PY Y SPPPP       PPPP  YKSPPPPP VY SPPPPPY Y SPPP
Sbjct: 16  YSSPPPPHYSPPYHYKSPPPPPPVHKYPPPPPPFYKSPPPPPPVYKSPPPPPYKYKSPPP 75

Query: 223 P---PYVYKSPPPPPYVYKSPPPP---PYVYKSPP 309
           P   PY YKSPPPPP VYKSPPPP   PY YKSPP
Sbjct: 76  PPHKPYKYKSPPPPPPVYKSPPPPPHKPYKYKSPP 110

 Score =  130 bits (328), Expect = 3e-29
 Identities = 70/118 (59%), Positives = 72/118 (61%), Gaps = 23/118 (19%)
 Frame = +1

Query: 25  SPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------SPPPPYIYKSPPPP---PYVY 177
           SP    K  P    V  + PPPPP+ Y SPPPP       PPPPY YKSPPPP   PY Y
Sbjct: 25  SPPYHYKSPPPPPPVHKYPPPPPPF-YKSPPPPPPVYKSPPPPPYKYKSPPPPPHKPYKY 83

Query: 178 NSPPPPPYVYNSPPPP---PYVYKSPPPP------PYVYKSPPP-----PPYVYKSPP 309
            SPPPPP VY SPPPP   PY YKSPPPP      PY YKSPPP     PPYVYKSPP
Sbjct: 84  KSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPPYVYKSPP 141

 Score =  130 bits (326), Expect = 6e-29
 Identities = 63/91 (69%), Positives = 64/91 (70%), Gaps = 14/91 (15%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPP---PYVYNSPPPP------PY 231
           SPPPPPY Y SPPPP P  PY YKSPPPPP VY SPPPP   PY Y SPPPP      PY
Sbjct: 62  SPPPPPYKYKSPPPP-PHKPYKYKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPY 120

Query: 232 VYKSPPP-----PPYVYKSPPPPPYVYKSPP 309
            YKSPPP     PPYVYKSPPPPP V+K PP
Sbjct: 121 KYKSPPPPPVYKPPYVYKSPPPPPSVHKYPP 151

 Score =  125 bits (313), Expect = 2e-27
 Identities = 55/74 (74%), Positives = 56/74 (75%), Gaps = 3/74 (4%)
 Frame = +1

Query: 97  YVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSP 276
           Y Y SPPPP   PPY YKSPPPPP V+  PPPPP  Y SPPPPP VYKSPPPPPY YKSP
Sbjct: 14  YHYSSPPPPHYSPPYHYKSPPPPPPVHKYPPPPPPFYKSPPPPPPVYKSPPPPPYKYKSP 73

Query: 277 PPP---PYVYKSPP 309
           PPP   PY YKSPP
Sbjct: 74  PPPPHKPYKYKSPP 87

 Score =  120 bits (301), Expect = 5e-26
 Identities = 62/93 (66%), Positives = 63/93 (67%), Gaps = 16/93 (17%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSPPPP------PYVYNSPPP-----PPYVYNSPPPP 225
           SPPPPP VY SPPPP P  PY YKSPPPP      PY Y SPPP     PPYVY SPPPP
Sbjct: 85  SPPPPPPVYKSPPPP-PHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPPYVYKSPPPP 143

Query: 226 PYVYKSPPP-PPYVYKSPPPP----PYVYKSPP 309
           P V+K PPP PP VYKSPP P    PY YKSPP
Sbjct: 144 PSVHKYPPPSPPPVYKSPPSPPPKKPYKYKSPP 176

 Score =  119 bits (298), Expect = 1e-25
 Identities = 61/97 (62%), Positives = 65/97 (67%), Gaps = 12/97 (12%)
 Frame = +1

Query: 52  PSGIGVSPFSPPPPPYVYPSPPPPSPPP--PYIYKSPPPPP-----YVYNSPPPPPYVYN 210
           P  +  SP  PP  PY Y SPPPP PPP  PY YKSPPPPP     YVY SPPPPP V+ 
Sbjct: 89  PPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPPYVYKSPPPPPSVHK 148

Query: 211 SPPP-PPYVYKSPPPPP----YVYKSPPPPPYVYKSP 306
            PPP PP VYKSPP PP    Y YKSPPPPP ++KSP
Sbjct: 149 YPPPSPPPVYKSPPSPPPKKPYKYKSPPPPP-IHKSP 184

 Score =  118 bits (296), Expect = 2e-25
 Identities = 67/121 (55%), Positives = 69/121 (57%), Gaps = 17/121 (14%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP--PYVYPSPPPPSPPPPYIYKSPPPP--- 165
           PPF      P    K  P         PPPP  PY Y SPPPP P    +YKSPPPP   
Sbjct: 47  PPFYKSPPPPPPVYKSPPPPPYKYKSPPPPPHKPYKYKSPPPPPP----VYKSPPPPPHK 102

Query: 166 PYVYNSPPPP------PYVYNSPPP-----PPYVYKSPPPPPYVYKSPPP-PPYVYKSPP 309
           PY Y SPPPP      PY Y SPPP     PPYVYKSPPPPP V+K PPP PP VYKSPP
Sbjct: 103 PYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPPYVYKSPPPPPSVHKYPPPSPPPVYKSPP 162

Query: 310 S 312
           S
Sbjct: 163 S 163

 Score =  110 bits (274), Expect = 6e-23
 Identities = 60/102 (58%), Positives = 62/102 (60%), Gaps = 22/102 (21%)
 Frame = +1

Query: 70  SPFSPPPPP---YVYPSPPPPSP-PPPYIYKSPPPPPYVYNSPPP-PPYVYNSPPPP--- 225
           SP  PPPPP   Y Y SPPPP    PPY+YKSPPPPP V+  PPP PP VY SPP P   
Sbjct: 108 SPPPPPPPPHKPYKYKSPPPPPVYKPPYVYKSPPPPPSVHKYPPPSPPPVYKSPPSPPPK 167

Query: 226 -PYVYKSPPPP-------------PYVYKSPPPPPYVYKSPP 309
            PY YKSPPPP             PY YK PPP P VYKSPP
Sbjct: 168 KPYKYKSPPPPPIHKSPLPSPPKKPYKYKYPPPTP-VYKSPP 208

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 41/87 (47%), Positives = 44/87 (50%), Gaps = 20/87 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP-PYVYPSPPPP--------SPPP-PYIYK 150
           PP  +V   P  S    P  +  SP SPPP  PY Y SPPPP        SPP  PY YK
Sbjct: 141 PPPPSVHKYPPPS----PPPVYKSPPSPPPKKPYKYKSPPPPPIHKSPLPSPPKKPYKYK 196

Query: 151 SPPP--------PP--YVYNSPPPPPY 201
            PPP        PP  Y+Y SPPPPPY
Sbjct: 197 YPPPTPVYKSPPPPHHYLYTSPPPPPY 223

[24][TOP]
>UniRef100_Q9M6R7 Extensin n=1 Tax=Pisum sativum RepID=Q9M6R7_PEA
          Length = 327

 Score =  130 bits (326), Expect(2) = 2e-29
 Identities = 61/91 (67%), Positives = 63/91 (69%), Gaps = 12/91 (13%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--------SPPPP-YIYKSPPPPPYVYNSPPPP---PYVYNSP 216
           P   PPPPY Y SPPPP        SPPPP Y YKSPPPP Y Y SPPPP   PY Y+SP
Sbjct: 103 PVHSPPPPYHYSSPPPPPKKSYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYSSP 162

Query: 217 PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPP Y YKSPPPP Y YKSPPPP Y Y+SPP
Sbjct: 163 PPPVYKYKSPPPPVYKYKSPPPPVYKYQSPP 193

 Score = 22.3 bits (46), Expect(2) = 2e-29
 Identities = 9/27 (33%), Positives = 14/27 (51%)
 Frame = +2

Query: 2   HRSPPSHLHPTPPQK*HPPALESLHSP 82
           ++SPP  +H  PP   +      +HSP
Sbjct: 42  YQSPPPPVHSPPPPYHYSSPPPPVHSP 68

 Score =  126 bits (317), Expect = 6e-28
 Identities = 62/98 (63%), Positives = 63/98 (64%), Gaps = 21/98 (21%)
 Frame = +1

Query: 79  SPPPPP---YVYPSPPPP------------SPPPPYIYKSPPPPP---YVYNSPPPPPYV 204
           SPPPPP   Y Y SPPPP            SPPPPY Y SPPPPP   Y Y+SPPPP Y 
Sbjct: 76  SPPPPPKKSYKYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPVYK 135

Query: 205 YNSPPPPPYVYKSPPPP---PYVYKSPPPPPYVYKSPP 309
           Y SPPPP Y YKSPPPP   PY Y SPPPP Y YKSPP
Sbjct: 136 YKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYKSPP 173

 Score =  124 bits (311), Expect = 3e-27
 Identities = 60/95 (63%), Positives = 60/95 (63%), Gaps = 18/95 (18%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----------SPPPP----YIYKSPPPPPYVYNSPPPPPYVYNS 213
           SPPPP Y Y SPPPP           SPPPP    Y Y SPPPP Y Y SPPPP Y Y S
Sbjct: 89  SPPPPIYKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPVYKYKSPPPPVYKYKS 148

Query: 214 PPPP---PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPPP   PY Y SPPPP Y YKSPPPP Y YKSPP
Sbjct: 149 PPPPVKKPYKYSSPPPPVYKYKSPPPPVYKYKSPP 183

 Score =  123 bits (308), Expect = 7e-27
 Identities = 68/125 (54%), Positives = 73/125 (58%), Gaps = 22/125 (17%)
 Frame = +1

Query: 1   PPF--SAVSSSPNSSTKITPSGIGVSPF-SPPPPPYVYPSPPPP--------SPPPP-YI 144
           PP+  S+    P  S K +     V  + SPPPP Y Y SPPPP        SPPPP Y 
Sbjct: 109 PPYHYSSPPPPPKKSYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYK 168

Query: 145 YKSPPPPPYVYNSPPPPPYVYNSPPPP----------PYVYKSPPPPPYVYKSPPPPPYV 294
           YKSPPPP Y Y SPPPP Y Y SPPPP          P VYKS PPPPY Y+SPPPPPY 
Sbjct: 169 YKSPPPPVYKYKSPPPPVYKYQSPPPPKKSYKYPSPPPPVYKS-PPPPYKYQSPPPPPYK 227

Query: 295 YKSPP 309
           Y SPP
Sbjct: 228 YSSPP 232

 Score =  122 bits (307), Expect = 9e-27
 Identities = 61/96 (63%), Positives = 63/96 (65%), Gaps = 20/96 (20%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSPPPPP---YVYNSPPPPP 228
           PPP PY Y SPPPP  SPPPPY Y SP      PPPPY Y+SPPPPP   Y Y+SPPPP 
Sbjct: 35  PPPKPYYYQSPPPPVHSPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPI 94

Query: 229 YVYKSP------PPPPYVYKSPPPPP---YVYKSPP 309
           Y YKSP      PPPPY Y SPPPPP   Y Y SPP
Sbjct: 95  YKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPP 130

 Score =  122 bits (306), Expect = 1e-26
 Identities = 64/125 (51%), Positives = 69/125 (55%), Gaps = 22/125 (17%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPP---YVYPSPPPP---SPPPPYIYKSPPP 162
           PP     S P    K       V  +  PPPP   Y YPSPPPP   SPPPPY Y+SPPP
Sbjct: 164 PPVYKYKSPPPPVYKYKSPPPPVYKYQSPPPPKKSYKYPSPPPPVYKSPPPPYKYQSPPP 223

Query: 163 PPYVYNSPPPPPYVYNSPPPP-----------PYVYKSPPPPPYVYKSP-----PPPPYV 294
           PPY Y+SPPPP Y YNSPPPP           P+ +  PP P Y YKSP     PPP Y 
Sbjct: 224 PPYKYSSPPPPVYKYNSPPPPYKHISPPTPGKPFKFPPPPTPIYKYKSPPPVYSPPPVYK 283

Query: 295 YKSPP 309
           YKSPP
Sbjct: 284 YKSPP 288

 Score =  118 bits (296), Expect = 2e-25
 Identities = 61/103 (59%), Positives = 64/103 (62%), Gaps = 24/103 (23%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPP---YVYNSPPPPPY--------VY-- 207
           P   PPPPY Y SPPPP  SPPPPY Y SPPPPP   Y Y+SPPPP Y        V+  
Sbjct: 48  PVHSPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPVHSP 107

Query: 208 ------NSPPPPP---YVYKSPPPPPYVYKSPPPPPYVYKSPP 309
                 +SPPPPP   Y Y SPPPP Y YKSPPPP Y YKSPP
Sbjct: 108 PPPYHYSSPPPPPKKSYKYSSPPPPVYKYKSPPPPVYKYKSPP 150

 Score =  108 bits (270), Expect = 2e-22
 Identities = 58/99 (58%), Positives = 62/99 (62%), Gaps = 4/99 (4%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPP---YVYPSPPPP-SPPPPYIYKSPPPPP 168
           PP    +S P     I+P   G  PF  PPPP   Y Y SPPP  SPPP Y YKSPPPP 
Sbjct: 233 PPVYKYNSPPPPYKHISPPTPG-KPFKFPPPPTPIYKYKSPPPVYSPPPVYKYKSPPPPV 291

Query: 169 YVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
           Y   SPPPP YVY+SPPPP Y   SPPPP Y+Y SPPPP
Sbjct: 292 Y---SPPPPHYVYSSPPPPVY---SPPPPHYIYASPPPP 324

 Score =  105 bits (262), Expect = 2e-21
 Identities = 54/92 (58%), Positives = 58/92 (63%), Gaps = 21/92 (22%)
 Frame = +1

Query: 97  YVYPSPPPPSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSPPPPP---Y 231
           Y+Y SPPPP  P PY Y+SP      PPPPY Y+SP      PPPPY Y+SPPPPP   Y
Sbjct: 28  YLYSSPPPP--PKPYYYQSPPPPVHSPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPKKSY 85

Query: 232 VYKSPPPPPYVYKSP------PPPPYVYKSPP 309
            Y SPPPP Y YKSP      PPPPY Y SPP
Sbjct: 86  KYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPP 117

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 47/80 (58%), Positives = 49/80 (61%), Gaps = 17/80 (21%)
 Frame = +1

Query: 121 PSPPPPYIYKSPPPP--PYVYNSP------PPPPYVYNSP------PPPPYVYKSPPPPP 258
           PS    Y+Y SPPPP  PY Y SP      PPPPY Y+SP      PPPPY Y SPPPPP
Sbjct: 22  PSQANNYLYSSPPPPPKPYYYQSPPPPVHSPPPPYHYSSPPPPVHSPPPPYHYSSPPPPP 81

Query: 259 ---YVYKSPPPPPYVYKSPP 309
              Y Y SPPPP Y YKSPP
Sbjct: 82  KKSYKYSSPPPPIYKYKSPP 101

[25][TOP]
>UniRef100_Q2A9D2 Extensin-like region containing protein n=1 Tax=Brassica oleracea
           RepID=Q2A9D2_BRAOL
          Length = 347

 Score =  129 bits (325), Expect = 8e-29
 Identities = 69/118 (58%), Positives = 72/118 (61%), Gaps = 16/118 (13%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPY 171
           PP   V SSP      +PS      +  PPPPYVY SPPPP   SP P   YKS PPPPY
Sbjct: 231 PPPPYVYSSPPPPPYYSPSP--KVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKS-PPPPY 287

Query: 172 VYNSPPPPPYVYNSP------PPPPYVYKSPPPPPY-------VYKSPPPPPYVYKSP 306
           VY+SPPPPPY   SP      PPPPYVY SPPPPPY        YKSPPPPPYVYK P
Sbjct: 288 VYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPPYVYKKP 345

 Score =  126 bits (316), Expect = 8e-28
 Identities = 70/143 (48%), Positives = 74/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP   V SSP      +PS      +   PPPYVY SPPPP            SPPPPY+
Sbjct: 179 PPPPYVYSSPPPPPYYSPSP--KVEYKSQPPPYVYNSPPPPPYYSPLPKVEYKSPPPPYV 236

Query: 145 YKSPPPPPY----------------VYNSPPPPPYVYNSP------PPPPYVYKSPPPPP 258
           Y SPPPPPY                VY+SPPPPPY   SP      PPPPYVY SPPPPP
Sbjct: 237 YSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPP 296

Query: 259 YVYKSP------PPPPYVYKSPP 309
           Y   SP      PPPPYVY SPP
Sbjct: 297 YYSPSPKVDYKSPPPPYVYSSPP 319

 Score =  125 bits (315), Expect = 1e-27
 Identities = 59/101 (58%), Positives = 62/101 (61%), Gaps = 24/101 (23%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP------------SPPPPYIYKSPPPPPYVYNSP------PPPPY 201
           +  PPPPYVY SPPPP            SPPPPY+Y SPPPPPY   SP      PPPPY
Sbjct: 98  YKSPPPPYVYSSPPPPPYYSPSLKVEYKSPPPPYLYNSPPPPPYYSPSPKAEYKSPPPPY 157

Query: 202 VYNSPPPPPYVYKSP------PPPPYVYKSPPPPPYVYKSP 306
           VY+ PPPPPY   SP      PPPPYVY SPPPPPY   SP
Sbjct: 158 VYSYPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSP 198

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/102 (58%), Positives = 63/102 (61%), Gaps = 24/102 (23%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP------------SPPPPYIYKSPPPPPYVYNSP------PPPPY 201
           +  PPPPYVY SPPPP            SPPPPY+Y SPPPPPY   SP      PPPPY
Sbjct: 228 YKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPY 287

Query: 202 VYNSPPPPPYVYKSP------PPPPYVYKSPPPPPYVYKSPP 309
           VY+SPPPPPY   SP      PPPPYVY SPPPPPY Y   P
Sbjct: 288 VYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPY-YSPSP 328

 Score =  121 bits (304), Expect = 2e-26
 Identities = 74/161 (45%), Positives = 80/161 (49%), Gaps = 58/161 (36%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP   V SSP      +PS + V  +  PPPPY+Y SPPPP            SPPPPY+
Sbjct: 101 PPPPYVYSSPPPPPYYSPS-LKVE-YKSPPPPYLYNSPPPPPYYSPSPKAEYKSPPPPYV 158

Query: 145 YKSPPPPPY----------------VYNSPP----------------PPPYVYNSPPPPP 228
           Y  PPPPPY                VY+SPP                PPPYVYNSPPPPP
Sbjct: 159 YSYPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSQPPPYVYNSPPPPP 218

Query: 229 YV-------YKSPPPPPYVYKSPPPPPYV-------YKSPP 309
           Y        YKS PPPPYVY SPPPPPY        YKSPP
Sbjct: 219 YYSPLPKVEYKS-PPPPYVYSSPPPPPYYSPSPKVDYKSPP 258

 Score =  117 bits (293), Expect = 4e-25
 Identities = 58/98 (59%), Positives = 60/98 (61%), Gaps = 21/98 (21%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPP--PSPPPPYIYKSPPPPPY------VYNSPPPPPYVYNSPPPPPYV 234
           SPP PPY  PSP     SPPPPY+Y SPPPPPY      V    PPPPY+YNSPPPPPY 
Sbjct: 83  SPPLPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSLKVEYKSPPPPYLYNSPPPPPYY 142

Query: 235 YKSP------PPPPYVYKSPPPPPYV-------YKSPP 309
             SP      PPPPYVY  PPPPPY        YKSPP
Sbjct: 143 SPSPKAEYKSPPPPYVYSYPPPPPYYSPSPKVEYKSPP 180

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 45/79 (56%), Positives = 48/79 (60%), Gaps = 22/79 (27%)
 Frame = +1

Query: 139 YIYKSPPPPPYVYNSP--------PPPPYVYNSPPPPPYV-------YKSPPPPPYVYKS 273
           Y+Y SPP PPY   SP        PPPPYVY+SPPPPPY        YKS PPPPY+Y S
Sbjct: 79  YVYSSPPLPPY--YSPSPKVDYKSPPPPYVYSSPPPPPYYSPSLKVEYKS-PPPPYLYNS 135

Query: 274 PPPPPYV-------YKSPP 309
           PPPPPY        YKSPP
Sbjct: 136 PPPPPYYSPSPKAEYKSPP 154

[26][TOP]
>UniRef100_B9H7Q5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H7Q5_POPTR
          Length = 173

 Score =  129 bits (324), Expect = 1e-28
 Identities = 65/97 (67%), Positives = 66/97 (68%), Gaps = 21/97 (21%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP----SPPPP---YIYKSPPPPPYVYNSPPPP--PYVYNSPPPPP-- 228
           PPPPPY Y SPPPP    SPPPP   Y YKSPPPPP V+ SPPPP  PY Y SPPPPP  
Sbjct: 43  PPPPPYHYKSPPPPPPVHSPPPPPHPYKYKSPPPPPPVHKSPPPPKKPYKYKSPPPPPVH 102

Query: 229 --------YVYKSPPPPP--YVYKSPPPPPYVYKSPP 309
                   Y YKSPPPPP  Y YKSPPPPP VYKSPP
Sbjct: 103 SPPPPSHPYKYKSPPPPPPVYKYKSPPPPPPVYKSPP 139

 Score =  117 bits (294), Expect = 3e-25
 Identities = 59/91 (64%), Positives = 63/91 (69%), Gaps = 13/91 (14%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPP-PYVYNSPPPPPYVYKSPPP 252
           +S PPPP    SPPPP  PPPY YKSPPPPP V++ PPPP PY Y SPPPPP V+KSPPP
Sbjct: 31  YSSPPPPK--KSPPPP--PPPYHYKSPPPPPPVHSPPPPPHPYKYKSPPPPPPVHKSPPP 86

Query: 253 P--PYVYKSPPPP----------PYVYKSPP 309
           P  PY YKSPPPP          PY YKSPP
Sbjct: 87  PKKPYKYKSPPPPPVHSPPPPSHPYKYKSPP 117

 Score =  114 bits (285), Expect = 3e-24
 Identities = 57/81 (70%), Positives = 58/81 (71%), Gaps = 12/81 (14%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP-----SPPPP---YIYKSPPPPPYVYNSPPPP--PYVYNSPPPPP- 228
           PPP PY Y SPPPP     SPPPP   Y YKSPPPPP   +SPPPP  PY Y SPPPPP 
Sbjct: 64  PPPHPYKYKSPPPPPPVHKSPPPPKKPYKYKSPPPPP--VHSPPPPSHPYKYKSPPPPPP 121

Query: 229 -YVYKSPPPPPYVYKSPPPPP 288
            Y YKSPPPPP VYKSPPPPP
Sbjct: 122 VYKYKSPPPPPPVYKSPPPPP 142

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 49/97 (50%), Positives = 56/97 (57%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPP 198
           SS  + +  +    I +S  S     Y Y SPPPP   PP     PPPPPY Y SPPPPP
Sbjct: 3   SSMASLTATLLLVAISLSLPSQTTANYEYSSPPPPKKSPP-----PPPPPYHYKSPPPPP 57

Query: 199 YVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            V+ SPPPPP+        PY YKSPPPPP V+KSPP
Sbjct: 58  PVH-SPPPPPH--------PYKYKSPPPPPPVHKSPP 85

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 43/60 (71%), Positives = 43/60 (71%), Gaps = 10/60 (16%)
 Frame = +1

Query: 79  SPPPP--PYVYPSPPPP---SPPPP---YIYKSPP-PPP-YVYNSPPPPPYVYNSPPPPP 228
           SPPPP  PY Y SPPPP   SPPPP   Y YKSPP PPP Y Y SPPPPP VY SPPPPP
Sbjct: 83  SPPPPKKPYKYKSPPPPPVHSPPPPSHPYKYKSPPPPPPVYKYKSPPPPPPVYKSPPPPP 142

[27][TOP]
>UniRef100_Q9STN0 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STN0_ARATH
          Length = 437

 Score =  129 bits (323), Expect = 1e-28
 Identities = 75/132 (56%), Positives = 81/132 (61%), Gaps = 29/132 (21%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP----FSPPPPPYVYPSPP------PP---SPPP-P 138
           PP  A S  P+     +P  +  SP    +SPPP PYVY SPP      PP   SPPP P
Sbjct: 67  PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 126

Query: 139 YIYKSPP-----PPPYVYNSPP-----PPPYVYNSPPPPPYVYKSPP-----PPPYVYKS 273
           Y+YKSPP     PPPYVY+SPP     PPPY Y SPPP PYVYKSPP     PPPY Y S
Sbjct: 127 YVYKSPPYVYSSPPPYVYSSPPPYAYSPPPYAY-SPPPSPYVYKSPPYVYSSPPPYAY-S 184

Query: 274 PPPPPYVYKSPP 309
           PPP PYVYKSPP
Sbjct: 185 PPPSPYVYKSPP 196

 Score =  125 bits (313), Expect = 2e-27
 Identities = 70/118 (59%), Positives = 74/118 (62%), Gaps = 15/118 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP----FSPPPPPYVYPSPPPP-SPPPPYIYKSPPPP 165
           PP  A S  P+     +P  +  SP    +SPPP PYVY SPP   S PPPY Y SPPP 
Sbjct: 209 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAY-SPPPS 267

Query: 166 PYVYNSPP-----PPPYVYNSPPPPPYVYKSPP-----PPPYVYKSPPPPPYVYKSPP 309
           PYVY SPP     PPPY Y SPPP PYVYKSPP     PPPY Y SPPP PYVYKSPP
Sbjct: 268 PYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPP 323

 Score =  123 bits (309), Expect = 5e-27
 Identities = 71/124 (57%), Positives = 75/124 (60%), Gaps = 21/124 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP----FSPPPPPYVYPSPPPP-SPPPPYIYKSPPPP 165
           PP+  V SSP      +P     SP    +SPPP PYVY SPP   S PPPY Y SPPP 
Sbjct: 132 PPY--VYSSPPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAY-SPPPS 188

Query: 166 PYVYNSPP-----PPPYVYN------SPPPPPYVYKSPP-----PPPYVYKSPPPPPYVY 297
           PYVY SPP     PPPY Y+      SPPP PYVYKSPP     PPPY Y SPPP PYVY
Sbjct: 189 PYVYKSPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVY 247

Query: 298 KSPP 309
           KSPP
Sbjct: 248 KSPP 251

 Score =  123 bits (309), Expect = 5e-27
 Identities = 73/141 (51%), Positives = 78/141 (55%), Gaps = 36/141 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP----FSPPPPPYVYPSPP------PP---SPPP-P 138
           PP  A S  P+     +P  +  SP    +SPPP PYVY SPP      PP   SPPP P
Sbjct: 257 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 316

Query: 139 YIYKSPP-----PPPYVYNSPPPPPYVYNSPP-----PPPYVYKSPPPPPYVYKSPP--- 279
           Y+YKSPP     PPPY Y SPPP PYVY SPP     PPPY Y SPPP PYVYKSPP   
Sbjct: 317 YVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPPYVY 374

Query: 280 ---------PPPYVYKSPPSC 315
                    PPPY Y  PP C
Sbjct: 375 SSPPPYTYSPPPYAYSPPPPC 395

 Score =  123 bits (308), Expect = 7e-27
 Identities = 70/121 (57%), Positives = 73/121 (60%), Gaps = 18/121 (14%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP---PSPPPPYIYKSPP---- 159
           PP+  V SSP   T   P     SP+    PPYVY SPPP     PP PY+YKSPP    
Sbjct: 36  PPY--VYSSPPPYTYSPPP----SPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYS 89

Query: 160 -PPPYVYNSPPPPPYVYNSPP-----PPPYVYKSPPPPPYVYKSPP-----PPPYVYKSP 306
            PPPY Y SPPP PYVY SPP     PPPY Y SPPP PYVYKSPP     PPPYVY SP
Sbjct: 90  SPPPYAY-SPPPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPPYVYSSPPPYVYSSP 147

Query: 307 P 309
           P
Sbjct: 148 P 148

 Score =  122 bits (305), Expect = 2e-26
 Identities = 65/107 (60%), Positives = 68/107 (63%), Gaps = 28/107 (26%)
 Frame = +1

Query: 73  PFSPP-PPPYVYPSPPPPS---PPPPYIYKSPP--------------PPPYVYNSPP--- 189
           P+SPP PPPYVY SPPP +   PP PY+YKSPP              P PYVY SPP   
Sbjct: 29  PYSPPSPPPYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVY 88

Query: 190 --PPPYVYNSPPPPPYVYKSPP-----PPPYVYKSPPPPPYVYKSPP 309
             PPPY Y SPPP PYVYKSPP     PPPY Y SPPP PYVYKSPP
Sbjct: 89  SSPPPYAY-SPPPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPP 133

 Score =  119 bits (299), Expect = 8e-26
 Identities = 71/140 (50%), Positives = 76/140 (54%), Gaps = 36/140 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP----FSPPPPPYVYPSPP------PP---SPPP-P 138
           PP  A S  P+     +P  +  SP    +SPPP PYVY SPP      PP   SPPP P
Sbjct: 281 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 340

Query: 139 YIYKSPP-----PPPYVYNSPPPPPYVYNSPP------------PPPYVYKSPPPPPYVY 267
           Y+YKSPP     PPPY Y SPPP PYVY SPP            PPPY Y  PPP P VY
Sbjct: 341 YVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCPDVY 399

Query: 268 KSPP-----PPPYVYKSPPS 312
           K PP     PPPYVY  PPS
Sbjct: 400 KPPPYVYSSPPPYVYNPPPS 419

 Score =  118 bits (296), Expect = 2e-25
 Identities = 71/154 (46%), Positives = 78/154 (50%), Gaps = 50/154 (32%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP----FSPPPPPYVYPSPPPP-SPPPPYIYKSPPP- 162
           PP  A S  P+     +P  +  SP    +SPPP PYVY SPP   S PPPY+Y SPPP 
Sbjct: 91  PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYVYSSPPPY 150

Query: 163 --------------------PPYVYNSPPP--------------PPYVYNSPPP-----P 225
                               PPYVY+SPPP              PPYVY+SPPP     P
Sbjct: 151 AYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPP 210

Query: 226 PYVYKSPPPPPYVYKSPP-----PPPYVYKSPPS 312
           PY Y SPPP PYVYKSPP     PPPY Y  PPS
Sbjct: 211 PYAY-SPPPSPYVYKSPPYVYSSPPPYAYSPPPS 243

 Score =  117 bits (294), Expect = 3e-25
 Identities = 63/99 (63%), Positives = 64/99 (64%), Gaps = 18/99 (18%)
 Frame = +1

Query: 70  SPFSPPPPPYVYPSPPP---PSPPPPYIYKSPP-----PPPYVYNSPPPPPYVYNSPP-- 219
           SP SPP  PYVY SPPP     PP PY+YKSPP     PPPY Y SPPP PYVY SPP  
Sbjct: 31  SPPSPP--PYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPPYV 87

Query: 220 ---PPPYVYKSPPPPPYVYKSPP-----PPPYVYKSPPS 312
              PPPY Y SPPP PYVYKSPP     PPPY Y  PPS
Sbjct: 88  YSSPPPYAY-SPPPSPYVYKSPPYVYSSPPPYAYSPPPS 125

 Score =  103 bits (258), Expect = 4e-21
 Identities = 62/134 (46%), Positives = 68/134 (50%), Gaps = 35/134 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP----FSPPPPPYVYPSPPPP-SPPPPYIYKSPPPP 165
           PP  A S  P+     +P  +  SP    +SPPP PYVY SPP   S PPPY Y SPPP 
Sbjct: 305 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAY-SPPPS 363

Query: 166 PYVYNSPP------------PPPYVYNSPPPPPYVYKSPP-----PPPYVYKSPP----- 279
           PYVY SPP            PPPY Y+ PPP P VYK PP     PPPYVY  PP     
Sbjct: 364 PYVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPP 423

Query: 280 --------PPPYVY 297
                   PPP +Y
Sbjct: 424 SPSYSYSSPPPPIY 437

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 47/83 (56%), Positives = 49/83 (59%), Gaps = 26/83 (31%)
 Frame = +1

Query: 139 YIYKSPPPPPYVYNSPPP--------------PPYVYN-------SPPPPPYVYKSPP-- 249
           Y Y  P PPPYVY+SPPP              PPYVY+       SPPP PYVYKSPP  
Sbjct: 28  YPYSPPSPPPYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYV 87

Query: 250 ---PPPYVYKSPPPPPYVYKSPP 309
              PPPY Y SPPP PYVYKSPP
Sbjct: 88  YSSPPPYAY-SPPPSPYVYKSPP 109

[28][TOP]
>UniRef100_Q2A9D3 Extensin, putative n=1 Tax=Brassica oleracea RepID=Q2A9D3_BRAOL
          Length = 509

 Score =  129 bits (323), Expect = 1e-28
 Identities = 70/124 (56%), Positives = 73/124 (58%), Gaps = 21/124 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSG---IGVSP---FSPPPPPYVYPSPPPP---SPPPPYIYKS 153
           PP    S SP    K  P        SP   ++ PPPPYVY SPPPP   SP P   YKS
Sbjct: 229 PPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEYNSPPPPYVYSSPPPPPYYSPSPKVEYKS 288

Query: 154 PPPPPYVYNSPPPPPYVYNSP------PPPPYVYKSPPPPPY------VYKSPPPPPYVY 297
           PPPP YVYNSPPPPPY + SP      PPPPYVY SPPPPPY      VY   PPPPYVY
Sbjct: 289 PPPP-YVYNSPPPPPYYFPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPYVY 347

Query: 298 KSPP 309
            SPP
Sbjct: 348 SSPP 351

 Score =  129 bits (323), Expect = 1e-28
 Identities = 71/143 (49%), Positives = 75/143 (52%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------------PPPPYI 144
           PP   V SSP      +PS   V  +  PPPPYVY SPPPP             PPPPY+
Sbjct: 341 PPPPYVYSSPPPPPYYSPSPKMV--YKSPPPPYVYSSPPPPPYYSPSPKVNYKYPPPPYV 398

Query: 145 YKSPPPPPYVYNSP------PPPPYVYNSPPPP----------------PYVYKSPPPPP 258
           Y SPPPPPY   SP      PPPPYVY+SPPPP                PYVY SPPPPP
Sbjct: 399 YSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPQFYSPSPKAEYKSPPPPYVYSSPPPPP 458

Query: 259 YVYKSP------PPPPYVYKSPP 309
           Y   SP      PPPPYVY SPP
Sbjct: 459 YYSPSPKVDYKSPPPPYVYSSPP 481

 Score =  128 bits (322), Expect = 2e-28
 Identities = 67/117 (57%), Positives = 71/117 (60%), Gaps = 15/117 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP--PSPPPPYIYKSPPPPPY- 171
           PP    S SP    K  P     +  SPPPPPY +PSP     SPPPPY+Y SPPPPPY 
Sbjct: 273 PPPPYYSPSPKVEYKSPPPPYVYN--SPPPPPYYFPSPKVDYKSPPPPYVYSSPPPPPYY 330

Query: 172 -----VYNSPPPPPYVYNSPPPPPY-------VYKSPPPPPYVYKSPPPPPYVYKSP 306
                VY   PPPPYVY+SPPPPPY       VYKS PPPPYVY SPPPPPY   SP
Sbjct: 331 SPSPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKS-PPPPYVYSSPPPPPYYSPSP 386

 Score =  128 bits (322), Expect = 2e-28
 Identities = 69/118 (58%), Positives = 72/118 (61%), Gaps = 16/118 (13%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPY 171
           PP   V SSP      +PS      +  PPPPYVY SPPPP   SP P   YKS PPPPY
Sbjct: 393 PPPPYVYSSPPPPPYYSPSP--KVNYKSPPPPYVYSSPPPPQFYSPSPKAEYKS-PPPPY 449

Query: 172 VYNSPPPPPYVYNSP------PPPPYVYKSPPPPPY-------VYKSPPPPPYVYKSP 306
           VY+SPPPPPY   SP      PPPPYVY SPPPPPY        YKSPPPPPYVYK P
Sbjct: 450 VYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPPYVYKMP 507

 Score =  124 bits (311), Expect = 3e-27
 Identities = 69/143 (48%), Positives = 74/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP   V SSP      +PS      +  PPPPYVY SPPPP            SPPPPY+
Sbjct: 315 PPPPYVYSSPPPPPYYSPSPKVY--YKSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPPYV 372

Query: 145 YKSPPPPPY----------------VYNSPPPPPYVYNSP------PPPPYVYKSPPPPP 258
           Y SPPPPPY                VY+SPPPPPY   SP      PPPPYVY SPPPP 
Sbjct: 373 YSSPPPPPYYSPSPKVNYKYPPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPQ 432

Query: 259 YVYKSP------PPPPYVYKSPP 309
           +   SP      PPPPYVY SPP
Sbjct: 433 FYSPSPKAEYKSPPPPYVYSSPP 455

 Score =  122 bits (307), Expect = 9e-27
 Identities = 67/135 (49%), Positives = 72/135 (53%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP   V SSP      +PS      +  PPPPYVY SPPPP            SPPPPY+
Sbjct: 167 PPPPYVYSSPPLPPYYSPSP--KVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYV 224

Query: 145 YKSPPPPPYV-------YNSPPPPPYVYN-------SPPPPPYVYKSPPPPPYVYKSP-- 276
           Y S PPPPY        Y SPPPPP  Y+       + PPPPYVY SPPPPPY   SP  
Sbjct: 225 YSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEYNSPPPPYVYSSPPPPPYYSPSPKV 284

Query: 277 ----PPPPYVYKSPP 309
               PPPPYVY SPP
Sbjct: 285 EYKSPPPPYVYNSPP 299

 Score =  119 bits (299), Expect = 8e-26
 Identities = 66/135 (48%), Positives = 72/135 (53%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP   V +SP      +PS      +  PPPPYVY SPP P            SPPPPY+
Sbjct: 141 PPPPYVYNSPPPPPYYSPSP--KVEYKSPPPPYVYSSPPLPPYYSPSPKVDYKSPPPPYV 198

Query: 145 YKSPPPPPYVYNSP------PPPPYVYNSPPPPPYV-------YKSPPPPPYVYK----- 270
           Y SPPPPPY   SP      PPPPYVY+S PPPPY        YKSPPPPP  Y      
Sbjct: 199 YSSPPPPPYYSPSPKVDYKSPPPPYVYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSPKV 258

Query: 271 --SPPPPPYVYKSPP 309
             + PPPPYVY SPP
Sbjct: 259 EYNSPPPPYVYSSPP 273

 Score =  118 bits (296), Expect = 2e-25
 Identities = 66/135 (48%), Positives = 72/135 (53%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           P +SA  S P    +  P       ++P P PY+Y SPPPP            SPPPPYI
Sbjct: 49  PYYSAPPSPPPQYRRQGPK------YTPHPKPYIYSSPPPPSYYSPSPKVEYKSPPPPYI 102

Query: 145 YKSPPPPPYV-------YNSPPPPPYVYN-SP------PPPPYVYKSPPPPPYVYKSP-- 276
           Y S PPPPY        Y SPPPPP  Y+ SP      PPPPYVY SPPPPPY   SP  
Sbjct: 103 YSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKV 162

Query: 277 ----PPPPYVYKSPP 309
               PPPPYVY SPP
Sbjct: 163 EYKSPPPPYVYSSPP 177

 Score =  116 bits (290), Expect = 9e-25
 Identities = 67/124 (54%), Positives = 69/124 (55%), Gaps = 21/124 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSG---IGVSP---FSPPPPPYVYPSPPPP---SPPPPYIYKS 153
           PP    S SP    K  P        SP   +  PPPPYVY SPPPP   SP P   YKS
Sbjct: 107 PPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKVEYKS 166

Query: 154 PPPPPYVYNSPPPPPYVYNSP------PPPPYVYKSPPPPPYVYKSP------PPPPYVY 297
           PPPP YVY+SPP PPY   SP      PPPPYVY SPPPPPY   SP      PPPPYVY
Sbjct: 167 PPPP-YVYSSPPLPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVY 225

Query: 298 KSPP 309
            S P
Sbjct: 226 SSLP 229

 Score =  101 bits (252), Expect = 2e-20
 Identities = 58/127 (45%), Positives = 64/127 (50%), Gaps = 32/127 (25%)
 Frame = +1

Query: 25  SPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP------------PPPYIYKSPPPPP 168
           SP ++ K  P     SP+ P      Y +PP P P            P PYIY SPPPP 
Sbjct: 25  SPPTTQKYPPVHKTKSPYQPKKNSPYYSAPPSPPPQYRRQGPKYTPHPKPYIYSSPPPPS 84

Query: 169 YVYNSP------PPPPYVYNSPPPPPYV-------YKS-PPPPPYVYKSP------PPPP 288
           Y   SP      PPPPY+Y+S PPPPY        YKS PPPPPY   SP      PPPP
Sbjct: 85  YYSPSPKVEYKSPPPPYIYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEYKSPPPP 144

Query: 289 YVYKSPP 309
           YVY SPP
Sbjct: 145 YVYNSPP 151

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 46/113 (40%), Positives = 50/113 (44%), Gaps = 34/113 (30%)
 Frame = +1

Query: 73  PFSPPPPPYVYP------SPPPPSPPPPYIYKSPPPP---------------PYVYNSPP 189
           P+  PP    YP      SP  P    PY    P PP               PY+Y+SPP
Sbjct: 22  PYESPPTTQKYPPVHKTKSPYQPKKNSPYYSAPPSPPPQYRRQGPKYTPHPKPYIYSSPP 81

Query: 190 PPPYVYNSP------PPPPYVYKSPPPPPYV-------YKSPPPPPYVYKSPP 309
           PP Y   SP      PPPPY+Y S PPPPY        YKSPPPPP  Y   P
Sbjct: 82  PPSYYSPSPKVEYKSPPPPYIYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSP 134

[29][TOP]
>UniRef100_B9GU80 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9GU80_POPTR
          Length = 153

 Score =  129 bits (323), Expect = 1e-28
 Identities = 67/111 (60%), Positives = 67/111 (60%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPP  PSPPPPY YKSP      PPPPY Y SP      PPPPY Y 
Sbjct: 5   PSPSPPPPYYYKSPPPPSPSPPPPYHYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 64

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY YKSP      PPPPY YKSP      PPPPYVYKSPP
Sbjct: 65  SPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSSSPPPPYVYKSPP 115

 Score =  127 bits (318), Expect = 5e-28
 Identities = 72/135 (53%), Positives = 73/135 (54%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP--PPPYIYKSP------ 156
           PP  + S  P    K  P      P   PPPPY Y SPPPPSP  PPPY YKSP      
Sbjct: 2   PPPPSPSPPPPYYYKSPPP-----PSPSPPPPYHYKSPPPPSPSPPPPYYYKSPPPPSPS 56

Query: 157 PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKSP-- 276
           PPPPY Y SP      PPPPY Y SP      PPPPY YKSP      PPPPYVYKSP  
Sbjct: 57  PPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSSSPPPPYVYKSPPP 116

Query: 277 ----PPPPYVYKSPP 309
               PPPPY Y SPP
Sbjct: 117 PSPSPPPPYYYHSPP 131

 Score =  121 bits (303), Expect = 3e-26
 Identities = 65/114 (57%), Positives = 67/114 (58%), Gaps = 11/114 (9%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP--PSPPPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPP  PSPPPPY YKSPPPP
Sbjct: 42  PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 101

Query: 166 PYVYNSPPPPPYVYNSP------PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
               +S PPPPYVY SP      PPPPY Y SPPPP    KSPPPP Y+Y SPP
Sbjct: 102 ----SSSPPPPYVYKSPPPPSPSPPPPYYYHSPPPP---VKSPPPPVYIYASPP 148

 Score =  110 bits (275), Expect = 5e-23
 Identities = 59/99 (59%), Positives = 59/99 (59%), Gaps = 32/99 (32%)
 Frame = +1

Query: 109 SPPPPS--PPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP------PPPP 228
           SPPPPS  PPPPY YKSP      PPPPY Y SP      PPPPY Y SP      PPPP
Sbjct: 1   SPPPPSPSPPPPYYYKSPPPPSPSPPPPYHYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 60

Query: 229 YVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           Y YKSP      PPPPY YKSP      PPPPY YKSPP
Sbjct: 61  YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPP 99

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 54/98 (55%), Positives = 58/98 (59%), Gaps = 11/98 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPS--PPPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPPS  PPPPY+YKSPPPP
Sbjct: 58  PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSSSPPPPYVYKSPPPP 117

Query: 166 ------PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPY 261
                 PY Y+SPPPP  V  SPPPP Y+Y SPPPP +
Sbjct: 118 SPSPPPPYYYHSPPPP--VK-SPPPPVYIYASPPPPTH 152

[30][TOP]
>UniRef100_Q9T0L0 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0L0_ARATH
          Length = 429

 Score =  127 bits (320), Expect = 3e-28
 Identities = 68/128 (53%), Positives = 75/128 (58%), Gaps = 25/128 (19%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP   + +SP   +  +PS      +  PPPPYVY SPPPP            SPPPPY+
Sbjct: 279 PPPPYIYNSPPPPSYYSPSP--KIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPPPYV 336

Query: 145 YKSPPPPPYVYNSPPPPPYVYNSP------PPPPYVYKSPPPPPYV-------YKSPPPP 285
           Y S PPP YVYNSPPPPPY   SP      PPPPYVY SPPPPPY        YKSPPPP
Sbjct: 337 YNSLPPP-YVYNSPPPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPP 395

Query: 286 PYVYKSPP 309
            Y+Y SPP
Sbjct: 396 -YIYNSPP 402

 Score =  127 bits (319), Expect = 4e-28
 Identities = 73/146 (50%), Positives = 75/146 (51%), Gaps = 43/146 (29%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPPS------------PPP 135
           PP   V SSP       P     SP   F  PPPPY+Y SPPPPS            PPP
Sbjct: 254 PPPPYVYSSP------PPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSPKIDYKSPPP 307

Query: 136 PYIYKSPPPPPYV-------YNSPPPP--------PYVYNSPPPPPYVYKSP------PP 252
           PY+Y SPPPP Y        Y SPPPP        PYVYNSPPPPPY   SP      PP
Sbjct: 308 PYVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPPPYVYNSPPPPPYYSPSPTVNYKSPP 367

Query: 253 PPYVYKSPPPPPYV-------YKSPP 309
           PPYVY SPPPPPY        YKSPP
Sbjct: 368 PPYVYNSPPPPPYYSPFPKVEYKSPP 393

 Score =  124 bits (310), Expect = 4e-27
 Identities = 68/140 (48%), Positives = 73/140 (52%), Gaps = 36/140 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP-----FSPPPPPYVYPSPPP------------PSP 129
           P     S  P S    +P  +  SP     +  PPPPYVY S PP             SP
Sbjct: 91  PKLDIKSPPPPSVYTFSPPQLYYSPSPKVEYKSPPPPYVYSSLPPLTYYSPSPKVIYNSP 150

Query: 130 PPPYIYKSPPPPPYVYNSP------PPPPYVYNSPPPPPYVYKSP------PPPPYVYKS 273
           PPPYIY SPPPPPY   SP      PPPPYVY+SPPPPPY   SP      PPPPYVY  
Sbjct: 151 PPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSF 210

Query: 274 PPPPPYV-------YKSPPS 312
           PPPPPY        YKSPP+
Sbjct: 211 PPPPPYYSPSPKVGYKSPPA 230

 Score =  123 bits (309), Expect = 5e-27
 Identities = 67/142 (47%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP   + SSP      +PS      +  PPPPYVY SPPPP            SPPPPY+
Sbjct: 150 PPPPYIYSSPPPPPYYSPSP--KVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYV 207

Query: 145 YKSPPPPPY----------------VYNSPPPPPYVYNSP------PPPPYVYKSPPPPP 258
           Y  PPPPPY                VY+SPPPPPY   SP      PPPPYVY SPPPPP
Sbjct: 208 YSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPP 267

Query: 259 Y-----VYKSPPPPPYVYKSPP 309
           Y     V    PPPPY+Y SPP
Sbjct: 268 YSPSPKVEFKSPPPPYIYNSPP 289

 Score =  122 bits (307), Expect = 9e-27
 Identities = 71/135 (52%), Positives = 73/135 (54%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYV-------YPSPPPP----SPPPPYIY 147
           PP S  S SP    K  P     S  SPPPP Y        Y SPPPP    S PPPY+Y
Sbjct: 289 PPPSYYSPSPKIDYKSPPPPYVYS--SPPPPTYYSPSPRVDYKSPPPPYVYNSLPPPYVY 346

Query: 148 KSPPPPPYVYNSP------PPPPYVYNSPPPPPYVYKSP--------PPPPYVYKSPPPP 285
            SPPPPPY   SP      PPPPYVYNSPPPPPY   SP        PPPPY+Y SPPPP
Sbjct: 347 NSPPPPPYYSPSPTVNYKSPPPPYVYNSPPPPPY--YSPFPKVEYKSPPPPYIYNSPPPP 404

Query: 286 PY-------VYKSPP 309
           PY        YKSPP
Sbjct: 405 PYYSPSPKITYKSPP 419

 Score =  122 bits (306), Expect = 1e-26
 Identities = 69/136 (50%), Positives = 73/136 (53%), Gaps = 32/136 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP   V SSP      +PS      +  PPPPYVY SPPPP           SPPPPYIY
Sbjct: 228 PPAPYVYSSPPPPPYYSPSP--KVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIY 285

Query: 148 KSPPPPPYVYNSP------PPPPYVYNSPPPPPYV-------YKSPPPP--------PYV 264
            SPPPP Y   SP      PPPPYVY+SPPPP Y        YKSPPPP        PYV
Sbjct: 286 NSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPPPYV 345

Query: 265 YKSPPPPPYVYKSPPS 312
           Y SPPPPPY Y   P+
Sbjct: 346 YNSPPPPPY-YSPSPT 360

 Score =  122 bits (306), Expect = 1e-26
 Identities = 69/125 (55%), Positives = 73/125 (58%), Gaps = 23/125 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP--------PYVYPSPPPP---SPPPPYIY 147
           PP   V SSP   T  +PS   V   SPPPP        PYVY SPPPP   SP P   Y
Sbjct: 305 PPPPYVYSSPPPPTYYSPSP-RVDYKSPPPPYVYNSLPPPYVYNSPPPPPYYSPSPTVNY 363

Query: 148 KSPPPPPYVYNSPPPPPYVYNSP------PPPPYVYKSPPPPPYVYKSP------PPPPY 291
           KS PPPPYVYNSPPPPPY    P      PPPPY+Y SPPPPPY   SP      PPPPY
Sbjct: 364 KS-PPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPPYYSPSPKITYKSPPPPY 422

Query: 292 VYKSP 306
           +YK+P
Sbjct: 423 IYKTP 427

 Score =  120 bits (300), Expect = 6e-26
 Identities = 65/118 (55%), Positives = 71/118 (60%), Gaps = 15/118 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPY 171
           PP   V SS    T  +PS   +  ++ PPPPY+Y SPPPP   SP P   YKSPPPP Y
Sbjct: 124 PPPPYVYSSLPPLTYYSPSPKVI--YNSPPPPYIYSSPPPPPYYSPSPKVDYKSPPPP-Y 180

Query: 172 VYNSPPPPPYVYNSP------PPPPYVYKSPPPPPYVYKSP------PPPPYVYKSPP 309
           VY+SPPPPPY   SP      PPPPYVY  PPPPPY   SP      PP PYVY SPP
Sbjct: 181 VYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPP 238

 Score =  119 bits (299), Expect = 8e-26
 Identities = 69/141 (48%), Positives = 72/141 (51%), Gaps = 38/141 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP--PSPPPPYIYKSPPPPPY- 171
           PP    S SP    K  P+    S  SPPPPPY  PSP     SPPPPY+Y SPPPPPY 
Sbjct: 212 PPPPYYSPSPKVGYKSPPAPYVYS--SPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYS 269

Query: 172 --------------VYNSPPPPPYVYNSP------PPPPYVYKSPPPPPYV-------YK 270
                         +YNSPPPP Y   SP      PPPPYVY SPPPP Y        YK
Sbjct: 270 PSPKVEFKSPPPPYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYK 329

Query: 271 SPP--------PPPYVYKSPP 309
           SPP        PPPYVY SPP
Sbjct: 330 SPPPPYVYNSLPPPYVYNSPP 350

 Score =  103 bits (258), Expect = 4e-21
 Identities = 59/124 (47%), Positives = 64/124 (51%), Gaps = 47/124 (37%)
 Frame = +1

Query: 79  SPPPPPYVYP-------SPPPPSP---PPPYIYKSP--------PPPPYVYNS------- 183
           SP P PY +P       SPPPPS     PP +Y SP        PPPPYVY+S       
Sbjct: 80  SPTPLPYYFPFPKLDIKSPPPPSVYTFSPPQLYYSPSPKVEYKSPPPPYVYSSLPPLTYY 139

Query: 184 ---------PPPPPYVYNSPPPPPYVYKSP------PPPPYVYKSPPPPPYV-------Y 297
                     PPPPY+Y+SPPPPPY   SP      PPPPYVY SPPPPPY        Y
Sbjct: 140 SPSPKVIYNSPPPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEY 199

Query: 298 KSPP 309
           KSPP
Sbjct: 200 KSPP 203

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 52/161 (32%), Positives = 59/161 (36%), Gaps = 80/161 (49%)
 Frame = +1

Query: 67  VSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPP----------------PYVYNSP---- 186
           V+ +  P     Y SP PP    PY+ +SPPPP                P VY+SP    
Sbjct: 26  VTAYDSPSSTPQYTSPYPPKNYSPYLSESPPPPPPQYRRQEPKYTPHPEPNVYDSPTPLP 85

Query: 187 --------------------------------------PPPPYVYNS------------- 213
                                                 PPPPYVY+S             
Sbjct: 86  YYFPFPKLDIKSPPPPSVYTFSPPQLYYSPSPKVEYKSPPPPYVYSSLPPLTYYSPSPKV 145

Query: 214 ---PPPPPYVYKSPPPPPYVYKSP------PPPPYVYKSPP 309
               PPPPY+Y SPPPPPY   SP      PPPPYVY SPP
Sbjct: 146 IYNSPPPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPP 186

[31][TOP]
>UniRef100_Q09082 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q09082_SOLLC
          Length = 388

 Score =  127 bits (320), Expect = 3e-28
 Identities = 68/105 (64%), Positives = 71/105 (67%), Gaps = 18/105 (17%)
 Frame = +1

Query: 49  TPSGIGVSPFSPPPPPYVYPSPPPPSP------PPP----YIYKSPPP--PPYVYNSPPP 192
           +P  +  SP  PP P YVY SPPPPSP      PPP    Y+YKSPPP  P YVY SPPP
Sbjct: 151 SPKYVYKSP-PPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPP 209

Query: 193 --PPYVYNSPPP--PPYVYKSPPP--PPYVYKSPPPPPYVYKSPP 309
             P YVY SPPP  P YVYKSPPP  P YVYKSPPPPPY YKSPP
Sbjct: 210 PSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPPYYYKSPP 254

 Score =  126 bits (317), Expect = 6e-28
 Identities = 68/117 (58%), Positives = 71/117 (60%), Gaps = 30/117 (25%)
 Frame = +1

Query: 49  TPSGIGVSPFSPPPPPYVYPSPPPPSP------PPP----YIYKSPPP--PPYVYNSPPP 192
           +P  +  SP  PP P YVY SPPPPSP      PPP    Y+YKSPPP  P YVY SPPP
Sbjct: 187 SPKYVYKSP-PPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPP 245

Query: 193 PPYVYNSP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           PPY Y SP      PPPPY YKSP      PPPPY YKSP      PPPPY YKSPP
Sbjct: 246 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPP 302

 Score =  122 bits (305), Expect = 2e-26
 Identities = 68/109 (62%), Positives = 70/109 (64%), Gaps = 20/109 (18%)
 Frame = +1

Query: 43  KITPSGIGVSPFSPPPPPYVYPSPPPPSP------PPP----YIYKSPPP--PPYVYNSP 186
           K TP+        PP P YVY SPPPPSP      PPP    Y+YKSPPP  P YVY SP
Sbjct: 4   KPTPTPYYYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSP 63

Query: 187 PP--PPYVYNSPPP--PPYVYKSPPP--PPYVYKSPPP--PPYVYKSPP 309
           PP  P YVY SPPP  P YVYKSPPP  P YVYKSPPP  P YVYKSPP
Sbjct: 64  PPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPP 112

 Score =  121 bits (304), Expect = 2e-26
 Identities = 68/107 (63%), Positives = 71/107 (66%), Gaps = 20/107 (18%)
 Frame = +1

Query: 49  TPSGIGVSPFSPPPPPYVYPSPPPPSP------PPP----YIYKSPPP--PPYVYNSPPP 192
           +P  +  SP  PP P YVY SPPPPSP      PPP    Y+YKSPPP  P YVY SPPP
Sbjct: 55  SPKYVYKSP-PPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPP 113

Query: 193 --PPYVYNSPPP--PPYVYKSPPP--PPYVYKSPPP--PPYVYKSPP 309
             P YVY SPPP  P YVYKSPPP  P YVYKSPPP  P YVYKSPP
Sbjct: 114 PSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPP 160

 Score =  121 bits (304), Expect = 2e-26
 Identities = 68/107 (63%), Positives = 71/107 (66%), Gaps = 20/107 (18%)
 Frame = +1

Query: 49  TPSGIGVSPFSPPPPPYVYPSPPPPSP------PPP----YIYKSPPP--PPYVYNSPPP 192
           +P  +  SP  PP P YVY SPPPPSP      PPP    Y+YKSPPP  P YVY SPPP
Sbjct: 103 SPKYVYKSP-PPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPP 161

Query: 193 --PPYVYNSPPP--PPYVYKSPPP--PPYVYKSPPP--PPYVYKSPP 309
             P YVY SPPP  P YVYKSPPP  P YVYKSPPP  P YVYKSPP
Sbjct: 162 PSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPP 208

 Score =  121 bits (304), Expect = 2e-26
 Identities = 63/111 (56%), Positives = 63/111 (56%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPP  PSPPPPY YKSP      PPPPY Y SP      PPPPY Y 
Sbjct: 256 PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 315

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
            P      PPPPY YKSP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 316 CPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPVNSPPPPYYYSSPP 366

 Score =  120 bits (300), Expect = 6e-26
 Identities = 64/110 (58%), Positives = 64/110 (58%), Gaps = 33/110 (30%)
 Frame = +1

Query: 79  SPPPPPYVY---PSPPPPSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNS 213
           SPPPPPY Y   P PP PSPPPPY YKSP      PPPPY Y SP      PPPPY Y S
Sbjct: 242 SPPPPPY-YYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKS 300

Query: 214 P------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           P      PPPPY YK P      PPPPY YKSP      PPPPY Y SPP
Sbjct: 301 PPPPSPSPPPPYYYKCPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPP 350

 Score =  120 bits (300), Expect = 6e-26
 Identities = 70/139 (50%), Positives = 71/139 (51%), Gaps = 36/139 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSP--- 156
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP  PPPY YKSP   
Sbjct: 245 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 304

Query: 157 ---PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVY-- 267
              PPPPY Y  P      PPPPY Y SP      PPPPY Y SP      PPPPY Y  
Sbjct: 305 SPSPPPPYYYKCPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPVNSPPPPYYYSS 364

Query: 268 -----KSPPPPPYVYKSPP 309
                KSPPPP Y+Y SPP
Sbjct: 365 PPPPVKSPPPPVYIYGSPP 383

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/115 (56%), Positives = 68/115 (59%), Gaps = 28/115 (24%)
 Frame = +1

Query: 49  TPSGIGVSPFSPPPPPYVYPSPPPPSP-------PPP---YIYKSPPPPP--YVYNSPPP 192
           +P  +  SP  PP P YVY SPPPPSP       PPP   Y+YKSPPPP   YVY SPPP
Sbjct: 175 SPKYVYKSP-PPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPP 233

Query: 193 PP--YVYNSPPPPPYVYKSPPPP------PYVY--------KSPPPPPYVYKSPP 309
           P   YVY SPPPPPY YKSPPPP      PY Y           PPPPY YKSPP
Sbjct: 234 PSPKYVYKSPPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS--PPPPYYYKSPP 286

 Score =  112 bits (280), Expect = 1e-23
 Identities = 64/123 (52%), Positives = 67/123 (54%), Gaps = 36/123 (29%)
 Frame = +1

Query: 49  TPSGIGVSPFSPPPPPYVYPSPPPPSP-------PPP---YIYKSPPPPPYVYNSPPPP- 195
           +P  +  SP  PP P YVY SPPPPSP       PPP   Y+YKSPPPPPY Y SPPPP 
Sbjct: 199 SPKYVYKSP-PPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPPYYYKSPPPPS 257

Query: 196 -----PYVYNSPPPP------PYVYKSPPPP------PYVY--------KSPPPPPYVYK 300
                PY Y SPPPP      PY YKSPPPP      PY Y           PPPPY YK
Sbjct: 258 PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS--PPPPYYYK 315

Query: 301 SPP 309
            PP
Sbjct: 316 CPP 318

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/112 (54%), Positives = 64/112 (57%), Gaps = 17/112 (15%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y  PPPPSP  PPPY YKSPPPP
Sbjct: 277 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKCPPPPSPSPPPPYYYKSPPPP 336

Query: 166 ------PYVYNSPPPP------PYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
                 PY Y+SPPPP      PY Y+SPPPP  V  SPPPP Y+Y SPPPP
Sbjct: 337 SPSPPPPYYYHSPPPPVNSPPPPYYYSSPPPP--VK-SPPPPVYIYGSPPPP 385

 Score =  100 bits (248), Expect = 6e-20
 Identities = 52/74 (70%), Positives = 52/74 (70%), Gaps = 10/74 (13%)
 Frame = +1

Query: 118 PPSPPPPYIYKSPPPPP--YVYNSPPP--PPYVYNSPPP--PPYVYKSPPP--PPYVYKS 273
           P   P PY YKSPPPP   YVY SPPP  P YVY SPPP  P YVYKSPPP  P YVYKS
Sbjct: 3   PKPTPTPYYYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKS 62

Query: 274 PPP--PPYVYKSPP 309
           PPP  P YVYKSPP
Sbjct: 63  PPPPSPKYVYKSPP 76

[32][TOP]
>UniRef100_Q9ZUC3 F5O8.27 protein n=1 Tax=Arabidopsis thaliana RepID=Q9ZUC3_ARATH
          Length = 895

 Score =  127 bits (319), Expect = 4e-28
 Identities = 69/133 (51%), Positives = 73/133 (54%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
            PP   V SSP      +PS      +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 734  PPPPYVYSSPPPPPYYSPSP--KVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVY 791

Query: 148  KSPPPPPYVYNSP------PPPPYVYNSPPPPPYVYKSP------PPPPYVYKSPPPPPY 291
             SPPPPPY   SP      PPPPYVY+SPPPP Y   SP      PPPPYVY SPPPP Y
Sbjct: 792  SSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPPAY 851

Query: 292  V-------YKSPP 309
                    YKSPP
Sbjct: 852  YSPSPKIEYKSPP 864

 Score =  125 bits (313), Expect = 2e-27
 Identities = 71/145 (48%), Positives = 74/145 (51%), Gaps = 42/145 (28%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP------------SPPP 135
            PP   V SSP       P     SP   +  PPPPYVY SPPPP            SPPP
Sbjct: 709  PPPPYVYSSP------PPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPP 762

Query: 136  PYIYKSPPPP---------------PYVYNSPPPPPYVYNSP------PPPPYVYKSPPP 252
            PY+Y SPPPP               PYVY+SPPPPPY   SP      PPPPYVY SPPP
Sbjct: 763  PYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPP 822

Query: 253  PPYVYKSP------PPPPYVYKSPP 309
            P Y   SP      PPPPYVY SPP
Sbjct: 823  PTYYSPSPKVEYKSPPPPYVYNSPP 847

 Score =  124 bits (310), Expect = 4e-27
 Identities = 74/160 (46%), Positives = 77/160 (48%), Gaps = 57/160 (35%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
            PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 659  PPPPYVYSSP------PPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPP 712

Query: 139  YIYKSPPPP---------------PYVYNSPPPPPYVYNSP------PPPPYVYKSP--- 246
            Y+Y SPPPP               PYVY+SPPPPPY   SP      PPPPYVY SP   
Sbjct: 713  YVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 772

Query: 247  ------------PPPPYVYKSPPPPPYV-------YKSPP 309
                        PPPPYVY SPPPPPY        YKSPP
Sbjct: 773  YYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPP 812

 Score =  120 bits (301), Expect = 5e-26
 Identities = 65/140 (46%), Positives = 69/140 (49%), Gaps = 62/140 (44%)
 Frame = +1

Query: 76   FSPPPPPYVYPSPPPP-----------SPPPPYIYKSP---------------PPPPYVY 177
            +  PPPPYVY SPPPP           SPPPPY+Y SP               PPPPYVY
Sbjct: 631  YKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVY 690

Query: 178  NSP---------------PPPPYVYNSP---------------PPPPYVYKSPPPPPYVY 267
            +SP               PPPPYVY+SP               PPPPYVY SPPPPPY  
Sbjct: 691  SSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYS 750

Query: 268  KSP------PPPPYVYKSPP 309
             SP      PPPPYVY SPP
Sbjct: 751  PSPKVEYKSPPPPYVYSSPP 770

 Score =  119 bits (299), Expect = 8e-26
 Identities = 72/144 (50%), Positives = 75/144 (52%), Gaps = 41/144 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 107 PPPPYVYSSP------PPPYYSPSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPP 160

Query: 139 YIYKSPPPP---------------PYVYNSPPPPPY------VYNSPPPPPYVYKSPPPP 255
           Y+Y SPPPP               PYVYNSPPPP Y       Y S PPPPY+Y SPPPP
Sbjct: 161 YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKS-PPPPYIYSSPPPP 219

Query: 256 PY------VYKSPPPPPYVYKSPP 309
            Y      VYKS PPPPYVY SPP
Sbjct: 220 YYSPSPKPVYKS-PPPPYVYSSPP 242

 Score =  119 bits (298), Expect = 1e-25
 Identities = 70/138 (50%), Positives = 72/138 (52%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP------------SPPP 135
            PP   V SSP       P     SP   +  PPPPYVY SPPPP            SPPP
Sbjct: 760  PPPPYVYSSP------PPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPP 813

Query: 136  PYIYKSPPPPPYVYNSP------PPPPYVYNSPPPPPYVYKSP--------PPPPYVYKS 273
            PY+Y SPPPP Y   SP      PPPPYVYNSPPPP   Y SP        PPPPYVY S
Sbjct: 814  PYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPP--AYYSPSPKIEYKSPPPPYVYSS 871

Query: 274  PPPPPY------VYKSPP 309
            PPPP Y       YKSPP
Sbjct: 872  PPPPSYSPSPKAEYKSPP 889

 Score =  119 bits (297), Expect = 1e-25
 Identities = 71/143 (49%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 57  PPPPYVYSSP------PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 110

Query: 139 YIYKSP---------------PPPPYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SP               PPPPYVYNSPPPP     P V    PPPPYVY SPPPP 
Sbjct: 111 YVYSSPPPPYYSPSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 170

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 171 YSPSPKVDYKS-PPPPYVYNSPP 192

 Score =  119 bits (297), Expect = 1e-25
 Identities = 69/132 (52%), Positives = 72/132 (54%), Gaps = 29/132 (21%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P      +P  I    +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 258 PPPYVYSSPPPPYYSPSPKPI----YKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVY 313

Query: 148 KSPPPPPY------VYNSPPPPPYVYNSPPPPPY------VYKSPPPPPYVYKSPPPPPY 291
             PPPP Y      VY SPPPP YVYNSPPPP Y       YKSPPPP YVY SPPPP Y
Sbjct: 314 SFPPPPYYSPSPKPVYKSPPPP-YVYNSPPPPYYSPSPKPAYKSPPPP-YVYSSPPPPYY 371

Query: 292 ------VYKSPP 309
                  YKSPP
Sbjct: 372 SPSPKPTYKSPP 383

 Score =  118 bits (296), Expect = 2e-25
 Identities = 75/180 (41%), Positives = 79/180 (43%), Gaps = 77/180 (42%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP   V SSP      +PS      +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 31  PPPPYVYSSPPPPLSYSPSP--KVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVY 88

Query: 148 KSPPPP---------------PYVYNSPPPP---------------PYVYNSPPPP---- 225
            SPPPP               PYVY+SPPPP               PYVYNSPPPP    
Sbjct: 89  SSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYNSPPPPYYSP 148

Query: 226 -----------PYVYKSPPPP---------------PYVYKSPPPPPY------VYKSPP 309
                      PYVY SPPPP               PYVY SPPPP Y       YKSPP
Sbjct: 149 SPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPP 208

 Score =  118 bits (296), Expect = 2e-25
 Identities = 69/141 (48%), Positives = 73/141 (51%), Gaps = 38/141 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P      +P  +    +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 208 PPPYIYSSPPPPYYSPSPKPV----YKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVY 263

Query: 148 KSPPPP---------------PYVYNSPPPPPY------VYNSPPPPPYVYKSPPPPPY- 261
            SPPPP               PYVYNSPPPP Y       Y S PPPPYVY  PPPP Y 
Sbjct: 264 SSPPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKS-PPPPYVYSFPPPPYYS 322

Query: 262 -----VYKSPPPPPYVYKSPP 309
                VYKS PPPPYVY SPP
Sbjct: 323 PSPKPVYKS-PPPPYVYNSPP 342

 Score =  118 bits (296), Expect = 2e-25
 Identities = 66/140 (47%), Positives = 70/140 (50%), Gaps = 62/140 (44%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP-----------SPPPPYIYKSPPPP---------------PYVY 177
           +  PPPPYVY SPPPP           SPPPPY+Y SPPPP               PY+Y
Sbjct: 354 YKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPPYIY 413

Query: 178 NSP---------------PPPPYVYNSPP---------------PPPYVYKSPPPPPY-- 261
           NSP               PPPPYVY+SPP               PPPYVY SPPPP Y  
Sbjct: 414 NSPPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYVYSSPPPPYYSP 473

Query: 262 ----VYKSPPPPPYVYKSPP 309
               VYKS PPPPYVY SPP
Sbjct: 474 SPKVVYKS-PPPPYVYSSPP 492

 Score =  118 bits (296), Expect = 2e-25
 Identities = 76/168 (45%), Positives = 79/168 (47%), Gaps = 65/168 (38%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 357 PPPPYVYSSP------PPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPP 410

Query: 139 YIYKSPPPP---------------PYVYNSPPPP---------------PYVYNSPPPPP 228
           YIY SPPPP               PYVY+SPPPP               PYVY+SPPPP 
Sbjct: 411 YIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYVYSSPPPPY 470

Query: 229 Y------VYKSPPPPPYVYKSP---------------PPPPYVYKSPP 309
           Y      VYKSPPPP YVY SP               PPPPYVY SPP
Sbjct: 471 YSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPP 517

 Score =  118 bits (295), Expect = 2e-25
 Identities = 72/144 (50%), Positives = 75/144 (52%), Gaps = 41/144 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 157 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPP 210

Query: 139 YIYKSPPPP---------------PYVYNSPPPPPY------VYNSPPPPPYVYKSPPPP 255
           YIY SPPPP               PYVY+SPPPP Y       Y S PPPPYVY SPPPP
Sbjct: 211 YIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKS-PPPPYVYSSPPPP 269

Query: 256 PY------VYKSPPPPPYVYKSPP 309
            Y      +YKS PPPPYVY SPP
Sbjct: 270 YYSPSPKPIYKS-PPPPYVYNSPP 292

 Score =  117 bits (293), Expect = 4e-25
 Identities = 69/136 (50%), Positives = 73/136 (53%), Gaps = 34/136 (25%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSP-----FSPPPPPYVYPSPPPP-----------SPPP 135
           P  A  SSP      +P     SP     +  PPPPYVY SPPPP           SPPP
Sbjct: 577 PKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPP 636

Query: 136 PYIYKSPPPPPY------VYNSPPPPPYVYNSPPPPPY------VYKSPPPPPYVYKSPP 279
           PY+Y SPPPP Y       Y S PPPPYVY+SPPPP Y       YKS PPPPYVY SPP
Sbjct: 637 PYVYSSPPPPYYSPTPKPTYKS-PPPPYVYSSPPPPYYSPSPKPTYKS-PPPPYVYSSPP 694

Query: 280 PPPY------VYKSPP 309
           PP Y       YKSPP
Sbjct: 695 PPYYSPAPKPTYKSPP 710

 Score =  117 bits (292), Expect = 5e-25
 Identities = 70/152 (46%), Positives = 77/152 (50%), Gaps = 49/152 (32%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSP--------PPPPYVYPSPPPP-------- 123
           PP+ + S  P   +   P      P   +SP        PPPPYVY SPPPP        
Sbjct: 293 PPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKP 352

Query: 124 ---SPPPPYIYKSPPPPPY------VYNSPPPPPYVYNSPPPPPY------VYKSPPPPP 258
              SPPPPY+Y SPPPP Y       Y SPPPP YVY+SPPPP Y      VYKSPPPP 
Sbjct: 353 AYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP-YVYSSPPPPYYSPSPKPVYKSPPPP- 410

Query: 259 YVYKSP---------------PPPPYVYKSPP 309
           Y+Y SP               PPPPYVY SPP
Sbjct: 411 YIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPP 442

 Score =  116 bits (290), Expect = 9e-25
 Identities = 61/116 (52%), Positives = 64/116 (55%), Gaps = 38/116 (32%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP------------SPPPPYIYKSPPPP-----PYVYNSPPPPPYV 204
           +  PPPPYVY SPPPP            SPPPPY+Y SPPPP     P V    PPPPYV
Sbjct: 28  YKSPPPPYVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV 87

Query: 205 YNSP---------------PPPPYVYKSPPPPPY------VYKSPPPPPYVYKSPP 309
           Y+SP               PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 88  YSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKS-PPPPYVYNSPP 142

 Score =  115 bits (289), Expect = 1e-24
 Identities = 71/150 (47%), Positives = 75/150 (50%), Gaps = 47/150 (31%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF---SPPPPPYVYPSPPPP--SPPPPYIYKSPPPP 165
           PP    S SP    K  P+     P+   SPPPPPY  PSP P   S PPPY+Y SPPPP
Sbjct: 542 PPPPCYSHSPKIEYKSPPT-----PYVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPP 596

Query: 166 ---------------PYVYNSPPPP---------------PYVYNSPPPPPY------VY 237
                          PYVYNSPPPP               PYVY+SPPPP Y       Y
Sbjct: 597 YYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTY 656

Query: 238 KSPPPPPYVYKSPPPPPY------VYKSPP 309
           KSPPPP YVY SPPPP Y       YKSPP
Sbjct: 657 KSPPPP-YVYSSPPPPYYSPSPKPTYKSPP 685

 Score =  111 bits (277), Expect = 3e-23
 Identities = 72/179 (40%), Positives = 74/179 (41%), Gaps = 76/179 (42%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPP-------------PPPYVYPSPPPP------ 123
           PP    S SP  S K  P     S   PP             PPPYVY SPPPP      
Sbjct: 416 PPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSP 475

Query: 124 -----SPPPPYIYKSPPPP---------------PYVYNSPPPPPY------VYNSP--- 216
                SPPPPY+Y SPPPP               PYVYNSPPPP Y      +Y SP   
Sbjct: 476 KVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSPKVIYKSPPHP 535

Query: 217 ----------------------PPPPYVYKSPPPPPYVYKSP------PPPPYVYKSPP 309
                                 PP PYVY SPPPPPY   SP       PPPYVY SPP
Sbjct: 536 HVCVCPPPPPCYSHSPKIEYKSPPTPYVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPP 594

 Score =  108 bits (270), Expect = 2e-22
 Identities = 68/149 (45%), Positives = 72/149 (48%), Gaps = 46/149 (30%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSP-----------------PPP-- 123
           PP    S SP  S K  P       ++ PPPPY  PSP                 PPP  
Sbjct: 491 PPPPYYSPSPKPSYKSPPPPY---VYNSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPPCY 547

Query: 124 ---------SPPPPYIYKSPPPPPYVYNSPPP------PPYVYNSPPPPPY------VYK 240
                    SPP PY+Y SPPPPPY   SP P      PPYVY+SPPPP Y      VYK
Sbjct: 548 SHSPKIEYKSPPTPYVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYK 607

Query: 241 SPPPPPYVYKSPPPPPY------VYKSPP 309
           SPPPP YVY SPPPP Y       YKSPP
Sbjct: 608 SPPPP-YVYNSPPPPYYSPSPKPTYKSPP 635

 Score =  104 bits (260), Expect = 3e-21
 Identities = 58/109 (53%), Positives = 62/109 (56%), Gaps = 31/109 (28%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP----SPPPPYIYKSPPPP------PYVYNSPPPPPYVYNSP--- 216
           +S PPPP +Y SP P     SPPPPY+Y SPPPP      P V    PPPPYVY+SP   
Sbjct: 11  YSSPPPP-LYDSPTPKVDYKSPPPPYVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPPPP 69

Query: 217 ------------PPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
                       PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 70  YYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKS-PPPPYVYSSPP 117

 Score =  102 bits (255), Expect = 1e-20
 Identities = 58/117 (49%), Positives = 62/117 (52%), Gaps = 18/117 (15%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
            PP   V SSP      +PS      +  PPPPYVY SPPPP            SPPPPY+
Sbjct: 785  PPPPYVYSSPPPPPYYSPSP--KVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYV 842

Query: 145  YKSPPPPPYVYNSP------PPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVY 297
            Y SPPPP Y   SP      PPPPYVY+SPPPP   Y   P P   YKSPPPP   Y
Sbjct: 843  YNSPPPPAYYSPSPKIEYKSPPPPYVYSSPPPPS--YS--PSPKAEYKSPPPPSLYY 895

 Score =  100 bits (250), Expect = 4e-20
 Identities = 54/87 (62%), Positives = 55/87 (63%), Gaps = 15/87 (17%)
 Frame = +1

Query: 94  PYVYPSPPPP---SPPPPYIYKSPPPPPYVYNSPPPP------PYVYNSPPPPPYVYKSP 246
           PY Y SPPPP   SP P   YKSPPPP YVY+SPPPP      P V    PPPPYVY SP
Sbjct: 8   PYTYSSPPPPLYDSPTPKVDYKSPPPP-YVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSP 66

Query: 247 PPPPY------VYKSPPPPPYVYKSPP 309
           PPP Y       YKS PPPPYVY SPP
Sbjct: 67  PPPYYSPSPKVEYKS-PPPPYVYSSPP 92

[33][TOP]
>UniRef100_Q01943 Extensin (Class I) (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q01943_SOLLC
          Length = 181

 Score =  127 bits (319), Expect = 4e-28
 Identities = 73/138 (52%), Positives = 73/138 (52%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSP--- 156
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP  PPPY YKSP   
Sbjct: 4   PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 63

Query: 157 ---PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKS 273
              PPPPY Y SP      PPPPY Y SP      PPPPY Y SP      PPPPY YKS
Sbjct: 64  SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYSSPPPPKKSPPPPYYYKS 123

Query: 274 P------PPPPYVYKSPP 309
           P      PPPPY YKSPP
Sbjct: 124 PPPPSPSPPPPYYYKSPP 141

 Score =  124 bits (312), Expect = 2e-27
 Identities = 64/107 (59%), Positives = 64/107 (59%), Gaps = 32/107 (29%)
 Frame = +1

Query: 85  PPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP-- 216
           PPPPY Y SPPP  PSPPPPY YKSP      PPPPY Y SP      PPPPY Y SP  
Sbjct: 3   PPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPP 62

Query: 217 ----PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
               PPPPY YKSP      PPPPY YKSP      PPPPY Y SPP
Sbjct: 63  PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYSSPP 109

 Score =  119 bits (298), Expect = 1e-25
 Identities = 67/126 (53%), Positives = 68/126 (53%), Gaps = 23/126 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP--PSPPPPYIYKSP--- 156
           PP     S P  S    P     SP  P   PPPPY Y SPPP  PSPPPPY Y SP   
Sbjct: 52  PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYSSPPPP 111

Query: 157 ---PPPPYVYNSPPPPPYVYNSPPPPPYVYKSP------PPPPYVYKS------PPPPPY 291
              PPPPY Y SPPPP    +  PPPPY YKSP      PPPPY YKS       PPPPY
Sbjct: 112 KKSPPPPYYYKSPPPP----SPSPPPPYYYKSPPPPSPSPPPPYYYKSSPPPSPSPPPPY 167

Query: 292 VYKSPP 309
            YKSPP
Sbjct: 168 YYKSPP 173

 Score =  104 bits (260), Expect = 3e-21
 Identities = 58/108 (53%), Positives = 59/108 (54%), Gaps = 5/108 (4%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP--PSPPPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPP  PSPPPPY YKSPPPP
Sbjct: 84  PPPYYYKSPPPPSPSPPPPYYYSSPPPPKKSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 143

Query: 166 PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
               +  PPPPY Y S PPP       PPPPY YKSPPPP     SPP
Sbjct: 144 ----SPSPPPPYYYKSSPPP----SPSPPPPYYYKSPPPPS---PSPP 180

 Score =  103 bits (258), Expect = 4e-21
 Identities = 54/92 (58%), Positives = 54/92 (58%), Gaps = 30/92 (32%)
 Frame = +1

Query: 124 SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP- 246
           SPPPPY YKSP      PPPPY Y SP      PPPPY Y SP      PPPPY YKSP 
Sbjct: 2   SPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPP 61

Query: 247 -----PPPPYVYKSP------PPPPYVYKSPP 309
                PPPPY YKSP      PPPPY YKSPP
Sbjct: 62  PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPP 93

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 46/78 (58%), Positives = 46/78 (58%), Gaps = 24/78 (30%)
 Frame = +1

Query: 148 KSPPPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKS 273
           KSPPPP Y Y SP      PPPPY Y SP      PPPPY YKSP      PPPPY YKS
Sbjct: 1   KSPPPP-YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKS 59

Query: 274 P------PPPPYVYKSPP 309
           P      PPPPY YKSPP
Sbjct: 60  PPPPSPSPPPPYYYKSPP 77

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 44/87 (50%), Positives = 44/87 (50%), Gaps = 11/87 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP    SS P       P     SP  P   PPPPY Y SPPPPSP  PPPY YKS PPP
Sbjct: 100 PPPYYYSSPPPPKKSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSSPPP 159

Query: 166 ------PYVYNSPPPPPYVYNSPPPPP 228
                 PY Y SPPPP      P PPP
Sbjct: 160 SPSPPPPYYYKSPPPPS-----PSPPP 181

[34][TOP]
>UniRef100_B9GWA6 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9GWA6_POPTR
          Length = 202

 Score =  127 bits (319), Expect = 4e-28
 Identities = 73/139 (52%), Positives = 79/139 (56%), Gaps = 36/139 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITP-SGIGVSPFSP---PPPPYVYPSPPPP--SPPPPYIYKSPPP 162
           PP+   S  P    K  P S +  SP  P   PPPPY Y SPPPP  SPPPPY+YKSPPP
Sbjct: 53  PPYHYSSPPPPPLKKSPPPSYVYKSPPPPSPSPPPPYHYSSPPPPKKSPPPPYVYKSPPP 112

Query: 163 ------PPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYK 270
                 PPY Y+SP      PPPPY+Y SP      PPPPY Y SP      PPP Y+YK
Sbjct: 113 PSPSLSPPYHYSSPPPPKKSPPPPYIYKSPPPPSPSPPPPYHYSSPSPPKKSPPPLYIYK 172

Query: 271 SP------PPPPYVYKSPP 309
           SP      PPPPY YKSPP
Sbjct: 173 SPPPPSPSPPPPYYYKSPP 191

 Score =  123 bits (309), Expect = 5e-27
 Identities = 66/121 (54%), Positives = 71/121 (58%), Gaps = 25/121 (20%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPP----SPPPPYIYKSP------PP 162
           +SP      TP  +  SP  P   PPPPY Y SPPPP    SPPP Y+YKSP      PP
Sbjct: 27  TSPAKEVSPTPRYVYKSPPPPSPSPPPPYHYSSPPPPPLKKSPPPSYVYKSPPPPSPSPP 86

Query: 163 PPYVYNSP------PPPPYVYNSPPP------PPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
           PPY Y+SP      PPPPYVY SPPP      PPY Y SPPPP    K  PPPPY+YKSP
Sbjct: 87  PPYHYSSPPPPKKSPPPPYVYKSPPPPSPSLSPPYHYSSPPPP----KKSPPPPYIYKSP 142

Query: 307 P 309
           P
Sbjct: 143 P 143

 Score =  117 bits (293), Expect = 4e-25
 Identities = 68/133 (51%), Positives = 73/133 (54%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVS----PFSPPPPPYVYPSPPPPSPP--PPYIYKSPPP 162
           PP S V  SP   +   P     S    P   PPPPYVY SPPPPSP   PPY Y SPPP
Sbjct: 69  PPPSYVYKSPPPPSPSPPPPYHYSSPPPPKKSPPPPYVYKSPPPPSPSLSPPYHYSSPPP 128

Query: 163 P------PYVYNSPPPP------PYVYNSP------PPPPYVYKSPPPP------PYVYK 270
           P      PY+Y SPPPP      PY Y+SP      PPP Y+YKSPPPP      PY YK
Sbjct: 129 PKKSPPPPYIYKSPPPPSPSPPPPYHYSSPSPPKKSPPPLYIYKSPPPPSPSPPPPYYYK 188

Query: 271 SPPPPPYVYKSPP 309
           SPPPP +   SPP
Sbjct: 189 SPPPPTH---SPP 198

 Score =  108 bits (269), Expect = 2e-22
 Identities = 69/150 (46%), Positives = 73/150 (48%), Gaps = 48/150 (32%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSP-----FSPPPPP--------YVYPSPPPPSP----- 129
           P   VS +P    K  P      P      SPPPPP        YVY SPPPPSP     
Sbjct: 29  PAKEVSPTPRYVYKSPPPPSPSPPPPYHYSSPPPPPLKKSPPPSYVYKSPPPPSPSPPPP 88

Query: 130 ------PPPYIYKSPPPPPYVYNSPPP------PPYVYNSP------PPPPYVYKSP--- 246
                 PPP      PPPPYVY SPPP      PPY Y+SP      PPPPY+YKSP   
Sbjct: 89  YHYSSPPPPKK---SPPPPYVYKSPPPPSPSLSPPYHYSSPPPPKKSPPPPYIYKSPPPP 145

Query: 247 ---PPPPYVYKSP------PPPPYVYKSPP 309
              PPPPY Y SP      PPP Y+YKSPP
Sbjct: 146 SPSPPPPYHYSSPSPPKKSPPPLYIYKSPP 175

 Score =  101 bits (252), Expect = 2e-20
 Identities = 62/120 (51%), Positives = 66/120 (55%), Gaps = 23/120 (19%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPP---PPYVYPSPPPP--SPPPPYIYKSPPPP 165
           PP    SS P       P  +  SP  P P   PPY Y SPPPP  SPPPPYIYKSPPPP
Sbjct: 86  PPPYHYSSPPPPKKSPPPPYVYKSPPPPSPSLSPPYHYSSPPPPKKSPPPPYIYKSPPPP 145

Query: 166 ------PYVYNSP------PPPPYVYNSPPPP-----PYVY-KSPPPPPYVYKSPPPPPY 291
                 PY Y+SP      PPP Y+Y SPPPP     P  Y KSPPPP +   SPPPP Y
Sbjct: 146 SPSPPPPYHYSSPSPPKKSPPPLYIYKSPPPPSPSPPPPYYYKSPPPPTH---SPPPPYY 202

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 51/93 (54%), Positives = 55/93 (59%), Gaps = 21/93 (22%)
 Frame = +1

Query: 94  PYVYPSPPPP-SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPP--------YVYKSP 246
           P ++ SP    SP P Y+YKSPPPP       PPPPY Y+SPPPPP        YVYKSP
Sbjct: 23  PLLFTSPAKEVSPTPRYVYKSPPPPS-P---SPPPPYHYSSPPPPPLKKSPPPSYVYKSP 78

Query: 247 ------PPPPYVYKSP------PPPPYVYKSPP 309
                 PPPPY Y SP      PPPPYVYKSPP
Sbjct: 79  PPPSPSPPPPYHYSSPPPPKKSPPPPYVYKSPP 111

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/82 (50%), Positives = 45/82 (54%), Gaps = 19/82 (23%)
 Frame = +1

Query: 121 PSPPPPYIYKSP-----PPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPP--------Y 261
           P+   P ++ SP     P P YVY SPPPP    +  PPPPY Y SPPPPP        Y
Sbjct: 18  PATSIPLLFTSPAKEVSPTPRYVYKSPPPP----SPSPPPPYHYSSPPPPPLKKSPPPSY 73

Query: 262 VYKSP------PPPPYVYKSPP 309
           VYKSP      PPPPY Y SPP
Sbjct: 74  VYKSPPPPSPSPPPPYHYSSPP 95

[35][TOP]
>UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH
          Length = 470

 Score =  127 bits (318), Expect = 5e-28
 Identities = 62/99 (62%), Positives = 64/99 (64%), Gaps = 7/99 (7%)
 Frame = +1

Query: 34  SSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPP----- 198
           SS  I  +  G SP SPPPPP   P PPPP PPPP     PPPPPYVY SPPPPP     
Sbjct: 363 SSYPIDCASFGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422

Query: 199 YVYNSPPPPPYVYKSPPPPPYVYKSPP--PPPYVYKSPP 309
           YVY  PPPPPYVY  PP PPYVY  PP  P PY+Y SPP
Sbjct: 423 YVY-PPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460

 Score =  103 bits (258), Expect = 4e-21
 Identities = 51/80 (63%), Positives = 53/80 (66%), Gaps = 5/80 (6%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSP-PPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPP 249
           P  PPPPPYVYPSPPPP P PPPY+Y  PPPPPYVY  PP PPYVY  PPPP      P 
Sbjct: 400 PPPPPPPPYVYPSPPPPPPSPPPYVY-PPPPPPYVYPPPPSPPYVY--PPPP------PS 450

Query: 250 PPPYVYKSPP----PPPYVY 297
           P PY+Y SPP    P P  Y
Sbjct: 451 PQPYMYPSPPCNDLPTPVHY 470

[36][TOP]
>UniRef100_Q09085 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q09085_PHAVU
          Length = 368

 Score =  127 bits (318), Expect = 5e-28
 Identities = 74/144 (51%), Positives = 74/144 (51%), Gaps = 41/144 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP  PPPY YKSPPPP
Sbjct: 171 PPPYYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 230

Query: 166 ------PYVYNSP------------PPPPYVYNSP------PPPPYVYKSP------PPP 255
                 PY Y SP            PPPPY Y SP      PPPPY YKSP      PPP
Sbjct: 231 SPSPPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPP 290

Query: 256 PYVYKSP------PPPPYVYKSPP 309
           PY YKSP      PPPPY YKSPP
Sbjct: 291 PYYYKSPPPPSPSPPPPYYYKSPP 314

 Score =  125 bits (314), Expect = 1e-27
 Identities = 66/117 (56%), Positives = 66/117 (56%), Gaps = 38/117 (32%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSP--PPPYIYKSPPPP------PYVYNSPPPP------PYVYN 210
           P   PPPPY Y SPPPPSP  PPPY YKSPPPP      PY Y SPPPP      PY Y 
Sbjct: 166 PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYK 225

Query: 211 SPPPP------PYVYKSPPPP------------PYVYKSP------PPPPYVYKSPP 309
           SPPPP      PY YKSPPPP            PY YKSP      PPPPY YKSPP
Sbjct: 226 SPPPPSPSPPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPP 282

 Score =  125 bits (314), Expect = 1e-27
 Identities = 66/117 (56%), Positives = 66/117 (56%), Gaps = 38/117 (32%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSP--PPPYIYKSP------------PPPPYVYNSP------PP 192
           P   PPPPY Y SPPPPSP  PPPY YKSP            PPPPY Y SP      PP
Sbjct: 214 PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPP 273

Query: 193 PPYVYNSP------PPPPYVYKSP------PPPPYVYKSPPPP------PYVYKSPP 309
           PPY Y SP      PPPPY YKSP      PPPPY YKSPPPP      PY YKSPP
Sbjct: 274 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPDPPTPYYYKSPP 330

 Score =  124 bits (311), Expect = 3e-27
 Identities = 72/137 (52%), Positives = 73/137 (53%), Gaps = 34/137 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP-PPPPYVYPSPPP--PSPPPPYIYKSP----- 156
           PP  + S  P    K  P      P SP PPPPY Y SPPP  PSPPPPY YKSP     
Sbjct: 227 PPPPSPSPPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSP 286

Query: 157 -PPPPYVYNSP------PPPPYVYNSPPPP------PYVYKSP------PPPPYVY---- 267
            PPPPY Y SP      PPPPY Y SPPPP      PY YKSP      PPPPY Y    
Sbjct: 287 SPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPDPPTPYYYKSPPPPSPSPPPPYYYVSPP 346

Query: 268 ---KSPPPPPYVYKSPP 309
              KSPPPP Y Y SPP
Sbjct: 347 PPTKSPPPPAYSYASPP 363

 Score =  121 bits (303), Expect = 3e-26
 Identities = 66/115 (57%), Positives = 66/115 (57%), Gaps = 38/115 (33%)
 Frame = +1

Query: 79  SPPPP------PYVYPSPPPPSP-PPPYIYKSPPP-------PPYVYNSP------PPPP 198
           SPPPP      PY Y SPPPPSP P PY YKSPPP       PPY Y SP      PPPP
Sbjct: 114 SPPPPYYYKSPPYYYKSPPPPSPSPSPYYYKSPPPPHKDPYYPPYYYKSPPPPSPSPPPP 173

Query: 199 YVYNSP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           Y Y SP      PPPPY YKSP      PPPPY YKSP      PPPPY YKSPP
Sbjct: 174 YYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPP 228

 Score =  117 bits (293), Expect = 4e-25
 Identities = 63/112 (56%), Positives = 63/112 (56%), Gaps = 33/112 (29%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPP---PPYIYKSP------PPPPYVYNSP------PPPPYVY 207
           P SP P PY Y SPPPP      PPY YKSP      PPPPY Y SP      PPPPY Y
Sbjct: 133 PPSPSPSPYYYKSPPPPHKDPYYPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYY 192

Query: 208 NSP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
            SP      PPPPY YKSP      PPPPY YKSP      PPPPY YKSPP
Sbjct: 193 KSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPP 244

 Score =  115 bits (289), Expect = 1e-24
 Identities = 70/140 (50%), Positives = 71/140 (50%), Gaps = 36/140 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF---SPPPP-------PYVYPSPPPPSP--PPPYI 144
           PP     S P       P     SP+   SPPPP       PY Y SPPPPSP  PPPY 
Sbjct: 116 PPPYYYKSPPYYYKSPPPPSPSPSPYYYKSPPPPHKDPYYPPYYYKSPPPPSPSPPPPYY 175

Query: 145 YKSPPPP------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP----- 255
           YKSPPPP      PY Y SPPPP      PY Y SPPPP      PY YKSPPPP     
Sbjct: 176 YKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP 235

Query: 256 -PYVYKSPPPPPYVYKSPPS 312
            PY YKSPPPP      PPS
Sbjct: 236 PPYYYKSPPPPSP--SPPPS 253

 Score =  113 bits (282), Expect = 7e-24
 Identities = 71/144 (49%), Positives = 71/144 (49%), Gaps = 41/144 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--------PPPYIY 147
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP        PPPY Y
Sbjct: 203 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPSPSPPPPYYY 262

Query: 148 KSPPPP------PYVYNSPPPP------PYVYNSPPPP----PYVYK--SPPPP------ 255
           KSPPPP      PY Y SPPPP      PY Y SPPPP    P  Y   SPPPP      
Sbjct: 263 KSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPDPPT 322

Query: 256 PYVYKSP------PPPPYVYKSPP 309
           PY YKSP      PPPPY Y SPP
Sbjct: 323 PYYYKSPPPPSPSPPPPYYYVSPP 346

 Score =  110 bits (276), Expect = 4e-23
 Identities = 62/111 (55%), Positives = 62/111 (55%), Gaps = 34/111 (30%)
 Frame = +1

Query: 79  SPPP--PPYVYPSPPPPS--PPPPYIYKSPPPP-----PYVYNSPPP-------PPYVYN 210
           SP P   PY Y SPPPP     PPY YKSPPPP     PY Y SPPP       PPY Y 
Sbjct: 102 SPTPYHKPYYYNSPPPPYYYKSPPYYYKSPPPPSPSPSPYYYKSPPPPHKDPYYPPYYYK 161

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY YKSP      PPPPY YKSP      PPPPY YKSPP
Sbjct: 162 SPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPP 212

 Score =  108 bits (270), Expect = 2e-22
 Identities = 64/121 (52%), Positives = 64/121 (52%), Gaps = 30/121 (24%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP------ 165
           S SP  S    P     SP  P   PPPPY Y SPPPPSP  PPPY YKSPPPP      
Sbjct: 247 SPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 306

Query: 166 PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP-----PYVYK--SPPPPP 288
           PY Y SPPPP      PY Y SPPPP      PY Y SPPPP     P  Y   SPPPP 
Sbjct: 307 PYYYKSPPPPSPDPPTPYYYKSPPPPSPSPPPPYYYVSPPPPTKSPPPPAYSYASPPPPT 366

Query: 289 Y 291
           Y
Sbjct: 367 Y 367

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 46/93 (49%), Positives = 48/93 (51%), Gaps = 31/93 (33%)
 Frame = +1

Query: 124 SPPPPYI---YKSPPPP---PYVYNSPPPPPYVYNSPP------------PPPYVYKSPP 249
           +P  PY    +K  P P   PY YNSPPPP Y Y SPP            P PY YKSPP
Sbjct: 89  APKKPYDCEKHKHSPTPYHKPYYYNSPPPP-YYYKSPPYYYKSPPPPSPSPSPYYYKSPP 147

Query: 250 P-------PPYVYKSP------PPPPYVYKSPP 309
           P       PPY YKSP      PPPPY YKSPP
Sbjct: 148 PPHKDPYYPPYYYKSPPPPSPSPPPPYYYKSPP 180

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 38/80 (47%), Positives = 39/80 (48%), Gaps = 10/80 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PP PY Y SPPPPSP  PPPY Y SPPPP
Sbjct: 289 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPDPPTPYYYKSPPPPSPSPPPPYYYVSPPPP 348

Query: 166 -----PYVYNSPPPPPYVYN 210
                P  Y+   PPP  YN
Sbjct: 349 TKSPPPPAYSYASPPPPTYN 368

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 39/82 (47%), Positives = 40/82 (48%), Gaps = 22/82 (26%)
 Frame = +1

Query: 130 PPPYIYKSPPPPPYVYNSPPP--PPYVYNSPPPPPYVY--------KSPPPP-----PYV 264
           P  Y  K P       +SP P   PY YNSPPPP   Y        KSPPPP     PY 
Sbjct: 85  PFAYAPKKPYDCEKHKHSPTPYHKPYYYNSPPPP--YYYKSPPYYYKSPPPPSPSPSPYY 142

Query: 265 YKSPPP-------PPYVYKSPP 309
           YKSPPP       PPY YKSPP
Sbjct: 143 YKSPPPPHKDPYYPPYYYKSPP 164

[37][TOP]
>UniRef100_Q43687 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q43687_VIGUN
          Length = 242

 Score =  126 bits (316), Expect = 8e-28
 Identities = 66/115 (57%), Positives = 66/115 (57%), Gaps = 39/115 (33%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP--SPPPPYIYKSP-------------PPPPYVYNSP------PPPP 198
           PPPPPYVY SPPPP  SPPPPY YK P             PPPPY Y SP      PPPP
Sbjct: 43  PPPPPYVYSSPPPPSLSPPPPYKYKDPHYEYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 102

Query: 199 YVYNSP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           Y Y SP      PPPPY YKSP      PPPPY YKSP      PPPPY YKSPP
Sbjct: 103 YYYKSPPPPSPSPPPPYYYKSPPPPRPSPPPPYYYKSPPPPSPSPPPPYYYKSPP 157

 Score =  125 bits (315), Expect = 1e-27
 Identities = 70/132 (53%), Positives = 71/132 (53%), Gaps = 30/132 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP--PSPPPPYIYK----- 150
           PP     S P  S    P     SP  P   PPPPY Y SPPP  PSPPPPY YK     
Sbjct: 100 PPPYYYKSPPPPSPSPPPPYYYKSPPPPRPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 159

Query: 151 --SPPPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYK 270
             SPPPP Y Y SP      PPPPY Y SP      PPPPY YKSP      PPPPY YK
Sbjct: 160 SPSPPPPSYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 219

Query: 271 SPPPPPYVYKSP 306
           SPPPPPY +K P
Sbjct: 220 SPPPPPYEHKDP 231

 Score =  124 bits (312), Expect = 2e-27
 Identities = 72/138 (52%), Positives = 72/138 (52%), Gaps = 36/138 (26%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSP---- 156
           P     S P  S    P     SP  P   PPPPY Y SPPPPSP  PPPY YKSP    
Sbjct: 69  PHYEYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPR 128

Query: 157 --PPPPYVYNSP------PPPPYVYN-------SPPPPPYVYKSP------PPPPYVYKS 273
             PPPPY Y SP      PPPPY Y        SPPPP Y YKSP      PPPPY YKS
Sbjct: 129 PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPSYYYKSPPPPSPSPPPPYYYKS 188

Query: 274 P------PPPPYVYKSPP 309
           P      PPPPY YKSPP
Sbjct: 189 PPPPSPSPPPPYYYKSPP 206

 Score =  118 bits (296), Expect = 2e-25
 Identities = 69/136 (50%), Positives = 70/136 (51%), Gaps = 33/136 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP--PSPPPPYIYKSP------ 156
           PP    SS P  S    P      P+    P Y Y SPPP  PSPPPPY YKSP      
Sbjct: 45  PPPYVYSSPPPPSLSPPP------PYKYKDPHYEYKSPPPPSPSPPPPYYYKSPPPPSPS 98

Query: 157 PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYK---- 270
           PPPPY Y SP      PPPPY Y SP      PPPPY YKSP      PPPPY YK    
Sbjct: 99  PPPPYYYKSPPPPSPSPPPPYYYKSPPPPRPSPPPPYYYKSPPPPSPSPPPPYYYKSPPP 158

Query: 271 ---SPPPPPYVYKSPP 309
              SPPPP Y YKSPP
Sbjct: 159 PSPSPPPPSYYYKSPP 174

 Score =  118 bits (295), Expect = 2e-25
 Identities = 72/140 (51%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPP--SPPPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPP  SPPPPY YKSPPPP
Sbjct: 84  PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPRPSPPPPYYYKSPPPP 143

Query: 166 ------PYVYNSPPPPP-------YVYNSPPPP------PYVYKSPPPP------PYVYK 270
                 PY Y SPPPP        Y Y SPPPP      PY YKSPPPP      PY YK
Sbjct: 144 SPSPPPPYYYKSPPPPSPSPPPPSYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 203

Query: 271 -------SPPPPPYVYKSPP 309
                  S PPPPY YKSPP
Sbjct: 204 SPPPPSPS-PPPPYYYKSPP 222

 Score =  108 bits (271), Expect = 1e-22
 Identities = 58/100 (58%), Positives = 59/100 (59%), Gaps = 21/100 (21%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPP---YIYKSPPPP------PYVYNSPPPP------PYVY 207
           P   PPPPY Y SPPPPSP PP   Y YKSPPPP      PY Y SPPPP      PY Y
Sbjct: 143 PSPSPPPPYYYKSPPPPSPSPPPPSYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYY 202

Query: 208 NSPPPP------PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            SPPPP      PY YKSPPPPPY  +    P Y YKSPP
Sbjct: 203 KSPPPPSPSPPPPYYYKSPPPPPY--EH-KDPYYQYKSPP 239

 Score =  100 bits (250), Expect = 4e-20
 Identities = 60/112 (53%), Positives = 63/112 (56%), Gaps = 18/112 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITP----SGIGVSPFSPPPPPYVYPSPPPPSP--PPPYIYKSPPP 162
           PP+   S  P S +   P    S    SP SPPPP Y Y SPPPPSP  PPPY YKSPPP
Sbjct: 133 PPYYYKSPPPPSPSPPPPYYYKSPPPPSP-SPPPPSYYYKSPPPPSPSPPPPYYYKSPPP 191

Query: 163 P------PYVYNSPPPP------PYVYNSPPPPPYVYKSPPPPPYVYKSPPP 282
           P      PY Y SPPPP      PY Y SPPPPPY  +    P Y YKSPPP
Sbjct: 192 PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPPY--EH-KDPYYQYKSPPP 240

 Score = 99.8 bits (247), Expect = 8e-20
 Identities = 52/100 (52%), Positives = 53/100 (53%), Gaps = 37/100 (37%)
 Frame = +1

Query: 121 PSPPPPYIYKSP------PPPPYVYNSP-------------PPPPYVYNSP------PPP 225
           P PPPPY+Y SP      PPPPY Y  P             PPPPY Y SP      PPP
Sbjct: 42  PPPPPPYVYSSPPPPSLSPPPPYKYKDPHYEYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 101

Query: 226 PYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           PY YKSP      PPPPY YKSP      PPPPY YKSPP
Sbjct: 102 PYYYKSPPPPSPSPPPPYYYKSPPPPRPSPPPPYYYKSPP 141

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 46/88 (52%), Positives = 48/88 (54%), Gaps = 31/88 (35%)
 Frame = +1

Query: 139 YIYKSPPPPPYVYNSP------PPPPYVYNSP-------------PPPPYVYKSP----- 246
           Y +  PPPPPYVY+SP      PPPPY Y  P             PPPPY YKSP     
Sbjct: 38  YTHSPPPPPPYVYSSPPPPSLSPPPPYKYKDPHYEYKSPPPPSPSPPPPYYYKSPPPPSP 97

Query: 247 -PPPPYVYKSP------PPPPYVYKSPP 309
            PPPPY YKSP      PPPPY YKSPP
Sbjct: 98  SPPPPYYYKSPPPPSPSPPPPYYYKSPP 125

[38][TOP]
>UniRef100_O65760 Extensin (Fragment) n=1 Tax=Cicer arietinum RepID=O65760_CICAR
          Length = 192

 Score =  125 bits (315), Expect = 1e-27
 Identities = 65/111 (58%), Positives = 67/111 (60%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPP  PSPPPPY YKSP      PPPPY Y+SP      PPPPY Y 
Sbjct: 12  PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPSPSPPPPYYYK 71

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSPPPP------PYVYKSPP 309
           SP      PPPPY YKSP      PPPPY Y+SPPPP      PY YKSPP
Sbjct: 72  SPPPPSPSPPPPYYYKSPPPPSPSPPPPYHYQSPPPPSPTPRTPYYYKSPP 122

 Score =  121 bits (304), Expect = 2e-26
 Identities = 63/106 (59%), Positives = 65/106 (61%), Gaps = 32/106 (30%)
 Frame = +1

Query: 88  PPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP--- 216
           PPPY Y SPPP  PSPPPPY YKSP      PPPPY Y SP      PPPPY Y+SP   
Sbjct: 1   PPPYYYHSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPP 60

Query: 217 ---PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
              PPPPY YKSP      PPPPY YKSP      PPPPY Y+SPP
Sbjct: 61  SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYHYQSPP 106

 Score =  120 bits (302), Expect = 4e-26
 Identities = 71/138 (51%), Positives = 72/138 (52%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPP--SPPPPYIYKSP--- 156
           PP     S P  S    P     SP  P   PPPPY Y SPPPP  SPPPPY Y SP   
Sbjct: 1   PPPYYYHSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPP 60

Query: 157 ---PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSPPPP------PYVYKS 273
              PPPPY Y SP      PPPPY Y SP      PPPPY Y+SPPPP      PY YKS
Sbjct: 61  SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYHYQSPPPPSPTPRTPYYYKS 120

Query: 274 P------PPPPYVYKSPP 309
           P      PPPPY Y SPP
Sbjct: 121 PPPPTSSPPPPYHYVSPP 138

 Score =  120 bits (300), Expect = 6e-26
 Identities = 71/138 (51%), Positives = 72/138 (52%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP--PSPPPPYIYKSP--- 156
           PP     S P  S    P     SP  P   PPPPY Y SPPP  PSPPPPY YKSP   
Sbjct: 33  PPPYYYKSPPPPSPSPPPPYYYHSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 92

Query: 157 ---PPPPYVYNSPPPP------PYVYNSP------PPPPYVYKSP------PPPPYVYKS 273
              PPPPY Y SPPPP      PY Y SP      PPPPY Y SP      PPPPY Y S
Sbjct: 93  SPSPPPPYHYQSPPPPSPTPRTPYYYKSPPPPTSSPPPPYHYVSPPPPIKSPPPPYHYTS 152

Query: 274 PPP------PPYVYKSPP 309
           PPP      P Y+YKSPP
Sbjct: 153 PPPPSPSPAPTYIYKSPP 170

 Score =  116 bits (291), Expect = 7e-25
 Identities = 67/126 (53%), Positives = 69/126 (54%), Gaps = 23/126 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSPPP--PYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP P  PY YKSPPPP
Sbjct: 65  PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYHYQSPPPPSPTPRTPYYYKSPPPP 124

Query: 166 ------PYVYNSPPPP------PYVYNSPPPPP------YVYKSPPPPPYVYKSPPPPPY 291
                 PY Y SPPPP      PY Y SPPPP       Y+YKSPPPP    KSPPPP Y
Sbjct: 125 TSSPPPPYHYVSPPPPIKSPPPPYHYTSPPPPSPSPAPTYIYKSPPPP---VKSPPPPVY 181

Query: 292 VYKSPP 309
           +Y SPP
Sbjct: 182 IYASPP 187

 Score =  112 bits (280), Expect = 1e-23
 Identities = 70/140 (50%), Positives = 70/140 (50%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP  PPPY YKSPPPP
Sbjct: 17  PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPSPSPPPPYYYKSPPPP 76

Query: 166 ------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPP------PYVY-- 267
                 PY Y SPPPP      PY Y SPPPP      PY YKSPPPP      PY Y  
Sbjct: 77  SPSPPPPYYYKSPPPPSPSPPPPYHYQSPPPPSPTPRTPYYYKSPPPPTSSPPPPYHYVS 136

Query: 268 ------KSPPPPPYVYKSPP 309
                    PPPPY Y SPP
Sbjct: 137 PPPPIKS--PPPPYHYTSPP 154

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/101 (55%), Positives = 60/101 (59%), Gaps = 4/101 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP--FSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPP 168
           PP+   S  P S T  TP      P   S PPPPY Y SPPPP  SPPPPY Y SPPPP 
Sbjct: 98  PPYHYQSPPPPSPTPRTPYYYKSPPPPTSSPPPPYHYVSPPPPIKSPPPPYHYTSPPPP- 156

Query: 169 YVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPY 291
              +  P P Y+Y SPPPP    KSPPPP Y+Y SPPPP Y
Sbjct: 157 ---SPSPAPTYIYKSPPPP---VKSPPPPVYIYASPPPPIY 191

[39][TOP]
>UniRef100_UPI0001739340 ATHRGP1 (HYDROXYPROLINE-RICH GLYCOPROTEIN); structural constituent
           of cell wall n=1 Tax=Arabidopsis thaliana
           RepID=UPI0001739340
          Length = 699

 Score =  125 bits (314), Expect = 1e-27
 Identities = 71/142 (50%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 452 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 505

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVYNSPPPP     P VY   PPPPYVY SPPPP 
Sbjct: 506 YVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 565

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P VY   PPPPYVY SPP
Sbjct: 566 YSPSPKVYYKSPPPPYVYSSPP 587

 Score =  124 bits (310), Expect = 4e-27
 Identities = 67/139 (48%), Positives = 72/139 (51%), Gaps = 36/139 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P  +   +P       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 303 PPPYVYSSPPPPTYSPSPK----VDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVY 358

Query: 148 KSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP---- 255
            SPPPP               PYVY+SPPPP     P VY   PPPPYVY SPPPP    
Sbjct: 359 SSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 418

Query: 256 -PYVYKSPPPPPYVYKSPP 309
            P VY   PPPPYVY SPP
Sbjct: 419 SPKVYYKSPPPPYVYSSPP 437

 Score =  124 bits (310), Expect = 4e-27
 Identities = 70/142 (49%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 352 PPPPYVYSSP------PPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 405

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVY+SPPPP     P VY   PPPPYVY SPPPP 
Sbjct: 406 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 465

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P VY   PPPPYVY SPP
Sbjct: 466 YSPSPKVYYKSPPPPYVYSSPP 487

 Score =  121 bits (304), Expect = 2e-26
 Identities = 69/140 (49%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP   V SSP  +    P       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 53  PPLPYVDSSPPPTYTPAPE----VEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVY 108

Query: 148 KSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPPY-- 261
            SPPPP               PYVYNSPPPP     P V    PPPPYVY SPPPP Y  
Sbjct: 109 SSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 168

Query: 262 ----VYKSPPPPPYVYKSPP 309
                YKS PPPPYVY SPP
Sbjct: 169 SPKVEYKS-PPPPYVYSSPP 187

 Score =  119 bits (299), Expect = 8e-26
 Identities = 68/142 (47%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 402 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 455

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVY+SPPPP     P V+   PPPPYVY SPPPP 
Sbjct: 456 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 515

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P V+   PPPPYVY SPP
Sbjct: 516 YSPSPKVHYKSPPPPYVYNSPP 537

 Score =  119 bits (298), Expect = 1e-25
 Identities = 73/167 (43%), Positives = 77/167 (46%), Gaps = 64/167 (38%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 227 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 280

Query: 139 YIYKSPPPP---------------PYVYNSP---------------PPPPYVYNSP---- 216
           Y+Y SPPPP               PYVY+SP               PPPPYVY+SP    
Sbjct: 281 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPY 340

Query: 217 -----------PPPPYVYKSPPPPPY-----VYKSPPPPPYVYKSPP 309
                      PPPPYVY SPPPP Y     VY   PPPPYVY SPP
Sbjct: 341 YSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPP 387

 Score =  116 bits (291), Expect = 7e-25
 Identities = 70/143 (48%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 152 PPPPYVYSSP------PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 205

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 206 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 265

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 266 YSPSPKVDYKS-PPPPYVYSSPP 287

 Score =  116 bits (290), Expect = 9e-25
 Identities = 70/143 (48%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 102 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 155

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 156 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 215

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 216 YSPSPKVDYKS-PPPPYVYSSPP 237

 Score =  114 bits (285), Expect = 3e-24
 Identities = 68/136 (50%), Positives = 71/136 (52%), Gaps = 33/136 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 202 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 255

Query: 139 YIYKSPPPP-----PYVYNSPPPPPYVYNSPPPPPYVYKSP--------PPPPYVYKSPP 279
           Y+Y SPPPP     P V    PPPPYVY+SPPPP   Y SP        PPPPYVY SPP
Sbjct: 256 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP---YYSPSPKVDYKSPPPPYVYSSPP 312

Query: 280 PPPYV------YKSPP 309
           PP Y       YKSPP
Sbjct: 313 PPTYSPSPKVDYKSPP 328

 Score =  108 bits (269), Expect = 2e-22
 Identities = 72/160 (45%), Positives = 75/160 (46%), Gaps = 57/160 (35%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 502 PPPPYVYSSP------PPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP 555

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPY-------VY 237
           Y+Y SPPPP               PYVY+SPPPP     P VY   PPPPY        Y
Sbjct: 556 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYY 615

Query: 238 KSPP-------PPP---------YVYKSPPPPPYVYKSPP 309
           KSPP       PPP          VYKS PPPPYVY SPP
Sbjct: 616 KSPPHPHVCVCPPPPPCYSPSPKVVYKS-PPPPYVYNSPP 654

 Score =  102 bits (255), Expect = 1e-20
 Identities = 51/89 (57%), Positives = 54/89 (60%), Gaps = 11/89 (12%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPY-----VYNSPPPPPYVYK 240
           +  PP PYV  SPPP   P P +    PPPPYVY+SPPPP Y     V    PPPPYVY 
Sbjct: 50  YKTPPLPYVDSSPPPTYTPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYS 109

Query: 241 SPPPPPYV------YKSPPPPPYVYKSPP 309
           SPPPP Y       YKS PPPPYVY SPP
Sbjct: 110 SPPPPYYSPSPKVDYKS-PPPPYVYNSPP 137

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 65/144 (45%), Positives = 66/144 (45%), Gaps = 41/144 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 552 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 605

Query: 139 YI-------YKSPP---------PPPYVYNSP------PPPPYVYNSPPPP-----PYVY 237
           Y        YKSPP         PPP    SP      PPPPYVYNSPPPP     P VY
Sbjct: 606 YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVY 665

Query: 238 KSPPPPPYVYKSPPPPPYVYKSPP 309
              PPPP  Y   P P   YKSPP
Sbjct: 666 YKSPPPPSYYS--PSPKVEYKSPP 687

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 35/69 (50%), Positives = 36/69 (52%), Gaps = 14/69 (20%)
 Frame = +1

Query: 82  PPPPPYVYPSPPP--PSPPPPYIYKSPPPPPY------VYNSPPPPPY------VYNSPP 219
           PPPPP   PSP     SPPPPY+Y SPPPP Y       Y SPPPP Y      V    P
Sbjct: 627 PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSP 686

Query: 220 PPPYVYKSP 246
           PPP    SP
Sbjct: 687 PPPSYSPSP 695

[40][TOP]
>UniRef100_Q9SK35 Putative uncharacterized protein At2g24980 n=1 Tax=Arabidopsis
           thaliana RepID=Q9SK35_ARATH
          Length = 559

 Score =  125 bits (314), Expect = 1e-27
 Identities = 71/142 (50%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 323 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 376

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVYNSPPPP     P VY   PPPPYVY SPPPP 
Sbjct: 377 YVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 436

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P VY   PPPPYVY SPP
Sbjct: 437 YSPSPKVYYKSPPPPYVYSSPP 458

 Score =  123 bits (309), Expect = 5e-27
 Identities = 70/142 (49%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 173 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 226

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVY+SPPPP     P VY   PPPPYVY SPPPP 
Sbjct: 227 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 286

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P VY   PPPPYVY SPP
Sbjct: 287 YSPSPKVYYKSPPPPYVYSSPP 308

 Score =  123 bits (309), Expect = 5e-27
 Identities = 70/142 (49%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 223 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 276

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVY+SPPPP     P VY   PPPPYVY SPPPP 
Sbjct: 277 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 336

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P VY   PPPPYVY SPP
Sbjct: 337 YSPSPKVYYKSPPPPYVYSSPP 358

 Score =  123 bits (309), Expect = 5e-27
 Identities = 70/142 (49%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 273 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 326

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVY+SPPPP     P VY   PPPPYVY SPPPP 
Sbjct: 327 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 386

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P VY   PPPPYVY SPP
Sbjct: 387 YSPSPKVYYKSPPPPYVYNSPP 408

 Score =  123 bits (308), Expect = 7e-27
 Identities = 70/142 (49%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 123 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 176

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVY+SPPPP     P VY   PPPPYVY SPPPP 
Sbjct: 177 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 236

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P VY   PPPPYVY SPP
Sbjct: 237 YSPSPKVYYKSPPPPYVYSSPP 258

 Score =  121 bits (304), Expect = 2e-26
 Identities = 70/142 (49%), Positives = 72/142 (50%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 73  PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 126

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVYNSPPPP     P V    PPPPYVY SPPPP 
Sbjct: 127 YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 186

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P VY   PPPPYVY SPP
Sbjct: 187 YSPSPKVYYKSPPPPYVYSSPP 208

 Score =  117 bits (292), Expect = 5e-25
 Identities = 68/142 (47%), Positives = 71/142 (50%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 373 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP 426

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVY+SPPPP     P VY   PPP YVY SPPPP 
Sbjct: 427 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPY 486

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P VY   PPP YVY SPP
Sbjct: 487 YSPSPKVYYKSPPPSYVYSSPP 508

 Score =  116 bits (290), Expect = 9e-25
 Identities = 69/142 (48%), Positives = 72/142 (50%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 348 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 401

Query: 139 YIYKSPPPP-----PYVYNSPPPPPYVYNSPPPP-----PYVYKSPPPPPYVYK------ 270
           Y+Y SPPPP     P VY   PPPPYVY+SPPPP     P VY   PPPPYVY       
Sbjct: 402 YVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 461

Query: 271 -SP--------PPPPYVYKSPP 309
            SP        PPP YVY SPP
Sbjct: 462 YSPSPKVYYKSPPPSYVYSSPP 483

 Score =  116 bits (290), Expect = 9e-25
 Identities = 59/114 (51%), Positives = 62/114 (54%), Gaps = 36/114 (31%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP-----------SPPPPYIYKSPPPP---------------PYVY 177
           +  PPPPYVY SPPPP           SPPPPY+Y SPPPP                YVY
Sbjct: 420 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPSYVY 479

Query: 178 NSPPPP-----PYVYNSPPPPPYVYKSPPPP-----PYVYKSPPPPPYVYKSPP 309
           +SPPPP     P VY   PPP YVY SPPPP     P VY   PPPPYVY SPP
Sbjct: 480 SSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 533

 Score =  113 bits (282), Expect = 7e-24
 Identities = 68/142 (47%), Positives = 72/142 (50%), Gaps = 40/142 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPP 
Sbjct: 423 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPS 476

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP                YVY+SPPPP     P VY   PPPPYVY SPPPP 
Sbjct: 477 YVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 536

Query: 259 Y------VYKSPPPPPYVYKSP 306
           Y       YKS PPPPYVYK+P
Sbjct: 537 YSPSPKVTYKS-PPPPYVYKTP 557

 Score =  112 bits (279), Expect = 2e-23
 Identities = 58/91 (63%), Positives = 60/91 (65%), Gaps = 13/91 (14%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYVYNSPPPP-----PYVYNSPPPPPYV 234
           +  PPPPYVY SPPPP  SP P   YKSPPPP YVY+SPPPP     P V    PPPPYV
Sbjct: 70  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYV 128

Query: 235 YKSPPPPPYV------YKSPPPPPYVYKSPP 309
           Y SPPPP Y       YKS PPPPYVY SPP
Sbjct: 129 YSSPPPPYYSPSPKVDYKS-PPPPYVYNSPP 158

 Score =  104 bits (259), Expect = 3e-21
 Identities = 60/110 (54%), Positives = 67/110 (60%), Gaps = 14/110 (12%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSP-FSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYVYNSPPP 192
           SSP + +  +PS     P ++P P PYV  SPPP   +P P   YKSPPPP YVY+SPPP
Sbjct: 26  SSPQTPSYNSPSYEHKGPKYAPHPKPYVKSSPPPQYYTPSPKVNYKSPPPP-YVYSSPPP 84

Query: 193 P-----PYVYNSPPPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           P     P V    PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 85  PYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKS-PPPPYVYSSPP 133

[41][TOP]
>UniRef100_Q9M1G9 Extensin-2 n=1 Tax=Arabidopsis thaliana RepID=EXTN2_ARATH
          Length = 743

 Score =  125 bits (314), Expect = 1e-27
 Identities = 71/142 (50%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 496 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 549

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVYNSPPPP     P VY   PPPPYVY SPPPP 
Sbjct: 550 YVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 609

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P VY   PPPPYVY SPP
Sbjct: 610 YSPSPKVYYKSPPPPYVYSSPP 631

 Score =  124 bits (310), Expect = 4e-27
 Identities = 67/139 (48%), Positives = 72/139 (51%), Gaps = 36/139 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P  +   +P       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 347 PPPYVYSSPPPPTYSPSPK----VDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVY 402

Query: 148 KSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP---- 255
            SPPPP               PYVY+SPPPP     P VY   PPPPYVY SPPPP    
Sbjct: 403 SSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 462

Query: 256 -PYVYKSPPPPPYVYKSPP 309
            P VY   PPPPYVY SPP
Sbjct: 463 SPKVYYKSPPPPYVYSSPP 481

 Score =  124 bits (310), Expect = 4e-27
 Identities = 70/142 (49%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 396 PPPPYVYSSP------PPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 449

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVY+SPPPP     P VY   PPPPYVY SPPPP 
Sbjct: 450 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 509

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P VY   PPPPYVY SPP
Sbjct: 510 YSPSPKVYYKSPPPPYVYSSPP 531

 Score =  121 bits (304), Expect = 2e-26
 Identities = 69/140 (49%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP   V SSP  +    P       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 47  PPLPYVDSSPPPTYTPAPE----VEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVY 102

Query: 148 KSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPPY-- 261
            SPPPP               PYVYNSPPPP     P V    PPPPYVY SPPPP Y  
Sbjct: 103 SSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 162

Query: 262 ----VYKSPPPPPYVYKSPP 309
                YKS PPPPYVY SPP
Sbjct: 163 SPKVEYKS-PPPPYVYSSPP 181

 Score =  119 bits (299), Expect = 8e-26
 Identities = 68/142 (47%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 446 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 499

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVY+SPPPP     P V+   PPPPYVY SPPPP 
Sbjct: 500 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 559

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P V+   PPPPYVY SPP
Sbjct: 560 YSPSPKVHYKSPPPPYVYNSPP 581

 Score =  119 bits (298), Expect = 1e-25
 Identities = 73/167 (43%), Positives = 77/167 (46%), Gaps = 64/167 (38%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 271 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 324

Query: 139 YIYKSPPPP---------------PYVYNSP---------------PPPPYVYNSP---- 216
           Y+Y SPPPP               PYVY+SP               PPPPYVY+SP    
Sbjct: 325 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPY 384

Query: 217 -----------PPPPYVYKSPPPPPY-----VYKSPPPPPYVYKSPP 309
                      PPPPYVY SPPPP Y     VY   PPPPYVY SPP
Sbjct: 385 YSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPP 431

 Score =  116 bits (291), Expect = 7e-25
 Identities = 70/143 (48%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 146 PPPPYVYSSP------PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 199

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 200 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 259

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 260 YSPSPKVDYKS-PPPPYVYSSPP 281

 Score =  116 bits (291), Expect = 7e-25
 Identities = 70/143 (48%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 196 PPPPYVYSSP------PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 249

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 250 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 309

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 310 YSPSPKVDYKS-PPPPYVYSSPP 331

 Score =  116 bits (290), Expect = 9e-25
 Identities = 70/143 (48%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 96  PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 149

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 150 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 209

Query: 259 Y------VYKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 210 YSPSPKVEYKS-PPPPYVYSSPP 231

 Score =  114 bits (285), Expect = 3e-24
 Identities = 68/136 (50%), Positives = 71/136 (52%), Gaps = 33/136 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 246 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 299

Query: 139 YIYKSPPPP-----PYVYNSPPPPPYVYNSPPPPPYVYKSP--------PPPPYVYKSPP 279
           Y+Y SPPPP     P V    PPPPYVY+SPPPP   Y SP        PPPPYVY SPP
Sbjct: 300 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP---YYSPSPKVDYKSPPPPYVYSSPP 356

Query: 280 PPPYV------YKSPP 309
           PP Y       YKSPP
Sbjct: 357 PPTYSPSPKVDYKSPP 372

 Score =  108 bits (269), Expect = 2e-22
 Identities = 72/160 (45%), Positives = 75/160 (46%), Gaps = 57/160 (35%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
            PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 546  PPPPYVYSSP------PPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP 599

Query: 139  YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPY-------VY 237
            Y+Y SPPPP               PYVY+SPPPP     P VY   PPPPY        Y
Sbjct: 600  YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYY 659

Query: 238  KSPP-------PPP---------YVYKSPPPPPYVYKSPP 309
            KSPP       PPP          VYKS PPPPYVY SPP
Sbjct: 660  KSPPHPHVCVCPPPPPCYSPSPKVVYKS-PPPPYVYNSPP 698

 Score =  102 bits (255), Expect = 1e-20
 Identities = 51/89 (57%), Positives = 54/89 (60%), Gaps = 11/89 (12%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPY-----VYNSPPPPPYVYK 240
           +  PP PYV  SPPP   P P +    PPPPYVY+SPPPP Y     V    PPPPYVY 
Sbjct: 44  YKTPPLPYVDSSPPPTYTPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYS 103

Query: 241 SPPPPPYV------YKSPPPPPYVYKSPP 309
           SPPPP Y       YKS PPPPYVY SPP
Sbjct: 104 SPPPPYYSPSPKVDYKS-PPPPYVYNSPP 131

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 65/144 (45%), Positives = 66/144 (45%), Gaps = 41/144 (28%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
            PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 596  PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 649

Query: 139  YI-------YKSPP---------PPPYVYNSP------PPPPYVYNSPPPP-----PYVY 237
            Y        YKSPP         PPP    SP      PPPPYVYNSPPPP     P VY
Sbjct: 650  YYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVY 709

Query: 238  KSPPPPPYVYKSPPPPPYVYKSPP 309
               PPPP  Y   P P   YKSPP
Sbjct: 710  YKSPPPPSYYS--PSPKVEYKSPP 731

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 35/69 (50%), Positives = 36/69 (52%), Gaps = 14/69 (20%)
 Frame = +1

Query: 82  PPPPPYVYPSPPP--PSPPPPYIYKSPPPPPY------VYNSPPPPPY------VYNSPP 219
           PPPPP   PSP     SPPPPY+Y SPPPP Y       Y SPPPP Y      V    P
Sbjct: 671 PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSP 730

Query: 220 PPPYVYKSP 246
           PPP    SP
Sbjct: 731 PPPSYSPSP 739

[42][TOP]
>UniRef100_Q76KW2 Hydroxyproline-rich glycoprotein-3 (Fragment) n=1 Tax=Pisum sativum
           RepID=Q76KW2_PEA
          Length = 137

 Score =  125 bits (313), Expect = 2e-27
 Identities = 57/80 (71%), Positives = 57/80 (71%), Gaps = 3/80 (3%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPP 258
           SPPPP Y Y SPPPP   P Y Y SPPPP Y YNSPPPP Y Y SPPPP Y YKSPPPP 
Sbjct: 5   SPPPPVYKYKSPPPPVKKP-YKYSSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPV 63

Query: 259 YVYKSPPPP---PYVYKSPP 309
           Y YKSPPPP   PY Y SPP
Sbjct: 64  YKYKSPPPPVKKPYKYTSPP 83

 Score =  123 bits (308), Expect = 7e-27
 Identities = 60/88 (68%), Positives = 60/88 (68%), Gaps = 12/88 (13%)
 Frame = +1

Query: 79  SPPPP---PYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPPPYVYNSPPPP-- 225
           SPPPP   PY Y SPPPP     SPPPP Y YKSPPPP Y Y SPPPP Y Y SPPPP  
Sbjct: 15  SPPPPVKKPYKYSSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVK 74

Query: 226 -PYVYKSPPPPPYVYKSPPPPPYVYKSP 306
            PY Y SPPPP Y Y SPPPP Y YKSP
Sbjct: 75  KPYKYTSPPPPVYKYNSPPPPVYKYKSP 102

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/86 (68%), Positives = 59/86 (68%), Gaps = 9/86 (10%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP-YIYKSPPPPPYVYNSPPPP---PYVYNSPPPPPY 231
           SPPPP Y Y SPPPP     SPPPP Y YKSPPPP Y Y SPPPP   PY Y SPPPP Y
Sbjct: 28  SPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYTSPPPPVY 87

Query: 232 VYKSPPPPPYVYKSPPPPPYVYKSPP 309
            Y SPPPP Y YKSP  P Y YKSPP
Sbjct: 88  KYNSPPPPVYKYKSPXTPIYKYKSPP 113

 Score =  106 bits (265), Expect = 7e-22
 Identities = 53/75 (70%), Positives = 54/75 (72%), Gaps = 4/75 (5%)
 Frame = +1

Query: 97  YVYPSPPPPSPPPPYIYKSPPPP---PYVYNSPPPPPYV-YNSPPPPPYVYKSPPPPPYV 264
           Y Y SPPPP     Y YKSPPPP   PY Y+SPPPP Y  YNSPPPP Y YKSPPPP Y 
Sbjct: 1   YKYKSPPPPV----YKYKSPPPPVKKPYKYSSPPPPVY-KYNSPPPPVYKYKSPPPPVYK 55

Query: 265 YKSPPPPPYVYKSPP 309
           YKSPPPP Y YKSPP
Sbjct: 56  YKSPPPPVYKYKSPP 70

 Score =  105 bits (263), Expect = 1e-21
 Identities = 56/99 (56%), Positives = 57/99 (57%), Gaps = 4/99 (4%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPPPP-YVYPSPPPPSPPPPYIYKSPPPP---PYVYNSP 186
           SS P    K       V  +  PPPP Y Y SP    PPP Y YKSPPPP   PY Y SP
Sbjct: 27  SSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSP----PPPVYKYKSPPPPVKKPYKYTSP 82

Query: 187 PPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKS 303
           PPP Y YNSPPPP Y YKSP  P Y YKSPPP  Y Y S
Sbjct: 83  PPPVYKYNSPPPPVYKYKSPXTPIYKYKSPPPXVYKYNS 121

 Score = 99.8 bits (247), Expect = 8e-20
 Identities = 50/85 (58%), Positives = 50/85 (58%), Gaps = 9/85 (10%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPP----YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPY 231
           SPPPP Y Y SPPPP     SPPPP    Y Y SPPPP Y YNSPPPP Y Y SP  P Y
Sbjct: 48  SPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYTSPPPPVYKYNSPPPPVYKYKSPXTPIY 107

Query: 232 VYKSPPPPPYVYKSPPPPPYVYKSP 306
            YKSPPP  Y Y S      VY  P
Sbjct: 108 KYKSPPPXVYKYNSLLNSVQVYSPP 132

[43][TOP]
>UniRef100_Q41120 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q41120_PHAVU
          Length = 154

 Score =  124 bits (312), Expect = 2e-27
 Identities = 65/111 (58%), Positives = 66/111 (59%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPP  PSPPPPY YKSP      PPPPY Y SP      PPPPY Y+
Sbjct: 13  PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYH 72

Query: 211 SPPP------PPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SPPP      PPY YKSP      PPPPY Y SP      PPPPY YKSPP
Sbjct: 73  SPPPPSPTPHPPYYYKSPPPPTSYPPPPYHYVSPPPPSPSPPPPYYYKSPP 123

 Score =  124 bits (311), Expect = 3e-27
 Identities = 71/147 (48%), Positives = 76/147 (51%), Gaps = 44/147 (29%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGI-GVSPFSP-PPPPYVYPSPPPPSP--PPPYIYKSP---- 156
           PP+   S  P S +   P       P SP PPPPY Y SPPPPSP  PPPY YKSP    
Sbjct: 3   PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 62

Query: 157 --PPPPYVYNSPPP------PPYVYNSP----------------------PPPPYVYKSP 246
             PPPPY Y+SPPP      PPY Y SP                      PPPPY YKSP
Sbjct: 63  PSPPPPYYYHSPPPPSPTPHPPYYYKSPPPPTSYPPPPYHYVSPPPPSPSPPPPYYYKSP 122

Query: 247 PP------PPYVYKSPPPPPYVYKSPP 309
           PP      P Y+YKSPPPP Y+Y SPP
Sbjct: 123 PPPSPAPAPKYIYKSPPPPAYIYSSPP 149

 Score =  117 bits (292), Expect = 5e-25
 Identities = 64/120 (53%), Positives = 66/120 (55%), Gaps = 23/120 (19%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSPPP--PYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP P  PY YKSPPPP
Sbjct: 34  PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPSPTPHPPYYYKSPPPP 93

Query: 166 ------PYVYNSPPPP------PYVYNSPPPPP------YVYKSPPPPPYVYKSPPPPPY 291
                 PY Y SPPPP      PY Y SPPPP       Y+YKSPPPP Y+Y SPPPP Y
Sbjct: 94  TSYPPPPYHYVSPPPPSPSPPPPYYYKSPPPPSPAPAPKYIYKSPPPPAYIYSSPPPPIY 153

 Score =  113 bits (283), Expect = 6e-24
 Identities = 68/137 (49%), Positives = 70/137 (51%), Gaps = 37/137 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPPSP  PPPY Y SPPPP
Sbjct: 18  PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPP 77

Query: 166 ------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPPP------YVYKS 273
                 PY Y SPPPP      PY Y SPPPP      PY YKSPPPP       Y+YKS
Sbjct: 78  SPTPHPPYYYKSPPPPTSYPPPPYHYVSPPPPSPSPPPPYYYKSPPPPSPAPAPKYIYKS 137

Query: 274 PPP--------PPYVYK 300
           PPP        PP +YK
Sbjct: 138 PPPPAYIYSSPPPPIYK 154

[44][TOP]
>UniRef100_Q39865 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39865_SOYBN
          Length = 169

 Score =  124 bits (311), Expect = 3e-27
 Identities = 64/106 (60%), Positives = 66/106 (62%), Gaps = 32/106 (30%)
 Frame = +1

Query: 88  PPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSPPPP 225
           PPPY Y SPPP  PSPPPPY YKSP      PPPPY Y+SP      PPPPY Y+SPPPP
Sbjct: 1   PPPYYYHSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPSPSPPPPYYYHSPPPP 60

Query: 226 ------PYVYKSP------PPPPYVYKSPPP------PPYVYKSPP 309
                 PY YKSP      PPPPY YKSPPP      PPY YKSPP
Sbjct: 61  SPSPPSPYYYKSPPPPSPSPPPPYYYKSPPPPSPTSHPPYYYKSPP 106

 Score =  122 bits (306), Expect = 1e-26
 Identities = 64/111 (57%), Positives = 65/111 (58%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSPPPP------PYVYN 210
           P   PPPPY Y SPPP  PSPPPPY Y SP      PPPPY Y+SPPPP      PY Y 
Sbjct: 12  PSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPSPSPPPPYYYHSPPPPSPSPPSPYYYK 71

Query: 211 SP------PPPPYVYKSPPP------PPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY YKSPPP      PPY YKSP      PPPPY Y SPP
Sbjct: 72  SPPPPSPSPPPPYYYKSPPPPSPTSHPPYYYKSPPPPTSYPPPPYHYVSPP 122

 Score =  118 bits (295), Expect = 2e-25
 Identities = 70/148 (47%), Positives = 72/148 (48%), Gaps = 45/148 (30%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPP----------------- 120
           PP     S P  S    P     SP  P   PPPPY Y SPPP                 
Sbjct: 17  PPPYYYKSPPPPSPSPPPPYYYHSPPPPSPSPPPPYYYHSPPPPSPSPPSPYYYKSPPPP 76

Query: 121 -PSPPPPYIYKSPPP------PPYVYNSP------PPPPYVYNSP------PPPPYVYKS 243
            PSPPPPY YKSPPP      PPY Y SP      PPPPY Y SP      PPPPY Y S
Sbjct: 77  SPSPPPPYYYKSPPPPSPTSHPPYYYKSPPPPTSYPPPPYHYVSPPPPSPSPPPPYHYTS 136

Query: 244 PPP------PPYVYKSPPPPPYVYKSPP 309
           PPP      P Y+YKSPPPP Y+Y SPP
Sbjct: 137 PPPPSPAPAPKYIYKSPPPPVYIYASPP 164

 Score =  115 bits (288), Expect = 1e-24
 Identities = 64/119 (53%), Positives = 69/119 (57%), Gaps = 22/119 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGI-GVSPFSP-PPPPYVYPSPPPPSPP--PPYIYKSPPPP- 165
           PP+   S  P S +  +P       P SP PPPPY Y SPPPPSP   PPY YKSPPPP 
Sbjct: 50  PPYYYHSPPPPSPSPPSPYYYKSPPPPSPSPPPPYYYKSPPPPSPTSHPPYYYKSPPPPT 109

Query: 166 -----PYVYNSPPPP------PYVYNSPPPPP------YVYKSPPPPPYVYKSPPPPPY 291
                PY Y SPPPP      PY Y SPPPP       Y+YKSPPPP Y+Y SPPPP Y
Sbjct: 110 SYPPPPYHYVSPPPPSPSPPPPYHYTSPPPPSPAPAPKYIYKSPPPPVYIYASPPPPIY 168

[45][TOP]
>UniRef100_Q7DMV8 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q7DMV8_PHAVU
          Length = 230

 Score =  118 bits (296), Expect(2) = 5e-27
 Identities = 62/111 (55%), Positives = 64/111 (57%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPPP  SPPPPY Y SP      PPPPY Y+SP      PPPPY Y+
Sbjct: 115 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 174

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 175 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPP 225

 Score = 26.2 bits (56), Expect(2) = 5e-27
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 11  PPSHLHPTPPQK*HPPALESLHSP 82
           PP + H  PP K  PP     HSP
Sbjct: 57  PPYYYHSPPPPKHSPPPPYYYHSP 80

 Score =  118 bits (296), Expect = 2e-25
 Identities = 62/111 (55%), Positives = 64/111 (57%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPPP  SPPPPY Y SP      PPPPY Y+SP      PPPPY Y+
Sbjct: 51  PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 110

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 111 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPP 161

 Score =  117 bits (294), Expect = 3e-25
 Identities = 61/108 (56%), Positives = 63/108 (58%), Gaps = 32/108 (29%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP- 216
           PPP PY Y SPPPP  SPPPPY Y SP      PPPPY Y+SP      PPPPY Y+SP 
Sbjct: 38  PPPKPYYYQSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPP 97

Query: 217 -----PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
                PPPPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 98  PPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPP 145

 Score =  112 bits (279), Expect(2) = 4e-25
 Identities = 56/99 (56%), Positives = 60/99 (60%), Gaps = 20/99 (20%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPP------PYVYNSPPPP------PYVYN 210
           P   PPPPY Y SPPPP  SPPPPY Y SPPPP      PY Y+SPPPP      PY Y+
Sbjct: 131 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 190

Query: 211 SPPPP------PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP      PY Y SPPPP +   SPPPP Y +  PP
Sbjct: 191 SPPPPKHSPPPPYYYHSPPPPKH---SPPPPYYYHSPPP 226

 Score = 26.2 bits (56), Expect(2) = 4e-25
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 11  PPSHLHPTPPQK*HPPALESLHSP 82
           PP + H  PP K  PP     HSP
Sbjct: 73  PPYYYHSPPPPKHSPPPPYYYHSP 96

 Score =  103 bits (256), Expect(2) = 2e-22
 Identities = 51/87 (58%), Positives = 55/87 (63%), Gaps = 14/87 (16%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPP------PYVYNSPPPP------PYVYN 210
           P   PPPPY Y SPPPP  SPPPPY Y SPPPP      PY Y+SPPPP      PY Y+
Sbjct: 147 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 206

Query: 211 SPPPPPYVYKSPPPPPYVYKSPPPPPY 291
           SPPPP +     PPPPY Y SPPPP +
Sbjct: 207 SPPPPKH--S--PPPPYYYHSPPPPKH 229

 Score = 26.2 bits (56), Expect(2) = 2e-22
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 11  PPSHLHPTPPQK*HPPALESLHSP 82
           PP + H  PP K  PP     HSP
Sbjct: 89  PPYYYHSPPPPKHSPPPPYYYHSP 112

 Score =  102 bits (254), Expect = 1e-20
 Identities = 54/101 (53%), Positives = 58/101 (57%), Gaps = 30/101 (29%)
 Frame = +1

Query: 97  YVYPSPPPPSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP------PP 222
           Y+Y SPPPP  P PY Y+SP      PPPPY Y+SP      PPPPY Y+SP      PP
Sbjct: 31  YIYSSPPPP--PKPYYYQSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP 88

Query: 223 PPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           PPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 89  PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPP 129

[46][TOP]
>UniRef100_Q9FG07 Gb|AAD23015.1 n=2 Tax=Arabidopsis thaliana RepID=Q9FG07_ARATH
          Length = 434

 Score =  123 bits (309), Expect = 5e-27
 Identities = 70/142 (49%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 148 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 201

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVY+SPPPP     P VY   PPPPYVY SPPPP 
Sbjct: 202 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 261

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P VY   PPPPYVY SPP
Sbjct: 262 YSPSPKVYYKSPPPPYVYSSPP 283

 Score =  123 bits (309), Expect = 5e-27
 Identities = 70/142 (49%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 198 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 251

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVY+SPPPP     P VY   PPPPYVY SPPPP 
Sbjct: 252 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 311

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P VY   PPPPYVY SPP
Sbjct: 312 YSPSPKVYYKSPPPPYVYSSPP 333

 Score =  122 bits (306), Expect = 1e-26
 Identities = 61/114 (53%), Positives = 64/114 (56%), Gaps = 36/114 (31%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP-----------SPPPPYIYKSPPP---------------PPYVY 177
           +  PPPPYVY SPPPP           SPPPPY+Y SPPP               PPYVY
Sbjct: 95  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPPYVY 154

Query: 178 NSPPPP-----PYVYNSPPPPPYVYKSPPPP-----PYVYKSPPPPPYVYKSPP 309
           +SPPPP     P VY   PPPPYVY SPPPP     P VY   PPPPYVY SPP
Sbjct: 155 SSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 208

 Score =  121 bits (304), Expect = 2e-26
 Identities = 69/142 (48%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 248 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 301

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVY+SPPPP     P VY   PPPPYVY SPPPP 
Sbjct: 302 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPPPPY 361

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P V+   PPPPYVY SPP
Sbjct: 362 YSPSPKVHYKSPPPPYVYSSPP 383

 Score =  121 bits (304), Expect = 2e-26
 Identities = 69/142 (48%), Positives = 73/142 (51%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 273 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 326

Query: 139 YIYKSPPPP-----PYVYNSPPPPPYVYNSPPPP---------------PYVYKSPPPP- 255
           Y+Y SPPPP     P VY   PPPPYVY+SPPPP               PYVY SPPPP 
Sbjct: 327 YVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 386

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P V+   PPPPYVY SPP
Sbjct: 387 YSPSPKVHYKSPPPPYVYSSPP 408

 Score =  120 bits (301), Expect = 5e-26
 Identities = 67/118 (56%), Positives = 69/118 (58%), Gaps = 15/118 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP--SPPPPYIYKSPPPP 165
           PP   V SSP       P     SP   +  PPPPYVY SPPPP  SP P   YKSPPPP
Sbjct: 123 PPPPYVYSSP------PPLYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 176

Query: 166 PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP-----PYVYKSPPPPPYVYKSPP 309
            YVY+SPPPP     P VY   PPPPYVY SPPPP     P VY   PPPPYVY SPP
Sbjct: 177 -YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 233

 Score =  119 bits (298), Expect = 1e-25
 Identities = 65/133 (48%), Positives = 72/133 (54%), Gaps = 37/133 (27%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSP-FSPPPPPYVYPSPPPP-----------SPPPPYIYKSPPPP 165
           SSP++    +PS     P ++P P PYVY SPPPP           SPPPPY+Y SPPPP
Sbjct: 26  SSPHTPAYDSPSYEHKGPKYAPHPKPYVYSSPPPPYYTPSPKVNYKSPPPPYVYNSPPPP 85

Query: 166 ---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPP-----PPPYVYK 270
                          PYVY+SPPPP     P VY   PPPPYVY SPP     P P VY 
Sbjct: 86  YYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPLYYSPSPKVYY 145

Query: 271 SPPPPPYVYKSPP 309
             PPPPYVY SPP
Sbjct: 146 KSPPPPYVYSSPP 158

 Score =  117 bits (293), Expect = 4e-25
 Identities = 69/142 (48%), Positives = 74/142 (52%), Gaps = 40/142 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 298 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYKSPPPP 351

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP     P V+   PPPPYVY SPPPP 
Sbjct: 352 YVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 411

Query: 259 Y------VYKSPPPPPYVYKSP 306
           Y       YKS PPPPYVYK+P
Sbjct: 412 YSPSPKVTYKS-PPPPYVYKTP 432

[47][TOP]
>UniRef100_Q9ZW80 Putative extensin n=1 Tax=Arabidopsis thaliana RepID=Q9ZW80_ARATH
          Length = 212

 Score =  123 bits (309), Expect = 5e-27
 Identities = 64/110 (58%), Positives = 67/110 (60%), Gaps = 32/110 (29%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNS 213
           +S PPPPY Y SPPPP  SPPPPY YKSP      PPPPY Y+SP      PPPPYVY+S
Sbjct: 33  YSSPPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSS 92

Query: 214 P------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           P      PPPPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 93  PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 142

 Score =  123 bits (308), Expect = 7e-27
 Identities = 63/111 (56%), Positives = 66/111 (59%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPYVY SPPPP  SPPPPY Y SP      PPPPY Y+SP      PPPPY Y+
Sbjct: 80  PVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYH 139

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY Y SP      PPPPY Y SP      PPPPY+Y SPP
Sbjct: 140 SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPP 190

 Score =  122 bits (307), Expect = 9e-27
 Identities = 67/127 (52%), Positives = 71/127 (55%), Gaps = 24/127 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVS----PFSPPPPPYVYPSPPPP--SPPPPYIYKSPPP 162
           PP   V SSP    K  P          P   PPPPY Y SPPPP  SPPPPY Y SPPP
Sbjct: 84  PPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP 143

Query: 163 P------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPPPYVYKSPPPPP 288
           P      PY Y+SPPPP      PY Y+SPPPP      PY+Y SPPPP    KSPPPP 
Sbjct: 144 PVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPP---VKSPPPPV 200

Query: 289 YVYKSPP 309
           Y+Y SPP
Sbjct: 201 YIYASPP 207

 Score =  121 bits (304), Expect = 2e-26
 Identities = 63/111 (56%), Positives = 65/111 (58%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPPP  SPPPPY Y SP      PPPPYVY+SP      PPPPY Y+
Sbjct: 48  PVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYH 107

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 108 SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 158

 Score =  108 bits (269), Expect = 2e-22
 Identities = 53/87 (60%), Positives = 58/87 (66%), Gaps = 14/87 (16%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPP------PYVYNSPPPP------PYVYN 210
           P   PPPPY Y SPPPP  SPPPPY Y SPPPP      PY Y+SPPPP      PY+Y+
Sbjct: 128 PVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYS 187

Query: 211 SPPPPPYVYKSPPPPPYVYKSPPPPPY 291
           SPPPP  V  SPPPP Y+Y SPPPP +
Sbjct: 188 SPPPP--VK-SPPPPVYIYASPPPPTH 211

[48][TOP]
>UniRef100_Q76KW3 Hydroxyproline-rich glycoprotein-2 (Fragment) n=1 Tax=Pisum sativum
           RepID=Q76KW3_PEA
          Length = 155

 Score =  122 bits (307), Expect = 9e-27
 Identities = 61/96 (63%), Positives = 63/96 (65%), Gaps = 20/96 (20%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSPPPPP---YVYNSPPPPP 228
           PPP PY Y SPPPP  SPPPPY Y SP      PPPPY Y+SPPPPP   Y Y+SPPPP 
Sbjct: 38  PPPKPYYYQSPPPPVHSPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPI 97

Query: 229 YVYKSP------PPPPYVYKSPPPPP---YVYKSPP 309
           Y YKSP      PPPPY Y SPPPPP   Y Y SPP
Sbjct: 98  YKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPP 133

 Score =  115 bits (287), Expect = 2e-24
 Identities = 58/94 (61%), Positives = 61/94 (64%), Gaps = 16/94 (17%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPP---YVYNSPPPPPY--------VYNS 213
           P   PPPPY Y SPPPP  SPPPPY Y SPPPPP   Y Y+SPPPP Y        V++ 
Sbjct: 51  PVHSPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPVHS- 109

Query: 214 PPPPPYVYKSPPPPP---YVYKSPPPPPYVYKSP 306
            PPPPY Y SPPPPP   Y Y SPPPP Y YKSP
Sbjct: 110 -PPPPYHYSSPPPPPKKSYKYSSPPPPVYKYKSP 142

 Score =  105 bits (262), Expect = 2e-21
 Identities = 54/92 (58%), Positives = 58/92 (63%), Gaps = 21/92 (22%)
 Frame = +1

Query: 97  YVYPSPPPPSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSPPPPP---Y 231
           Y+Y SPPPP  P PY Y+SP      PPPPY Y+SP      PPPPY Y+SPPPPP   Y
Sbjct: 31  YLYSSPPPP--PKPYYYQSPPPPVHSPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPKKSY 88

Query: 232 VYKSPPPPPYVYKSP------PPPPYVYKSPP 309
            Y SPPPP Y YKSP      PPPPY Y SPP
Sbjct: 89  KYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPP 120

 Score = 94.4 bits (233), Expect(2) = 1e-18
 Identities = 49/81 (60%), Positives = 51/81 (62%), Gaps = 6/81 (7%)
 Frame = +1

Query: 79  SPPPPP---YVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPP---YVYK 240
           SPPPPP   Y Y SPPPP     Y YKSPPPP +     PPPPY Y+SPPPPP   Y Y 
Sbjct: 79  SPPPPPKKSYKYSSPPPPI----YKYKSPPPPVH----SPPPPYHYSSPPPPPKKSYKYS 130

Query: 241 SPPPPPYVYKSPPPPPYVYKS 303
           SPPPP Y YKSP    Y YKS
Sbjct: 131 SPPPPVYKYKSPHQQVYKYKS 151

 Score = 22.3 bits (46), Expect(2) = 1e-18
 Identities = 9/27 (33%), Positives = 14/27 (51%)
 Frame = +2

Query: 2   HRSPPSHLHPTPPQK*HPPALESLHSP 82
           ++SPP  +H  PP   +      +HSP
Sbjct: 45  YQSPPPPVHSPPPPYHYSSPPPPVHSP 71

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/86 (44%), Positives = 44/86 (51%), Gaps = 5/86 (5%)
 Frame = +1

Query: 1   PPF--SAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPP-- 168
           PP+  S+    P  S K +     +  +  PPPP         SPPPPY Y SPPPPP  
Sbjct: 73  PPYHYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPVH-------SPPPPYHYSSPPPPPKK 125

Query: 169 -YVYNSPPPPPYVYNSPPPPPYVYKS 243
            Y Y+SPPPP Y Y SP    Y YKS
Sbjct: 126 SYKYSSPPPPVYKYKSPHQQVYKYKS 151

[49][TOP]
>UniRef100_Q39949 Hydroxyproline-rich protein n=1 Tax=Helianthus annuus
           RepID=Q39949_HELAN
          Length = 263

 Score =  122 bits (306), Expect = 1e-26
 Identities = 73/142 (51%), Positives = 77/142 (54%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP-----FSPPPP--PYVYPSPPPPSP----PPPYIY 147
           PP     S P    K  P  +  SP      SPPPP  PYVY SPPPP P    PPP +Y
Sbjct: 66  PPPPVYKSPPPPVHKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVY 125

Query: 148 KSPPPPPY------VYNSPPPPPY--------------VYNSPPPP--PYVYKSPPPPPY 261
           KSPPPP Y      VY SPPPP Y              VY SPPPP  PYVYKSPPPPP 
Sbjct: 126 KSPPPPVYESPPPPVYKSPPPPVYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPP 185

Query: 262 VYKSPPPPPY------VYKSPP 309
           V+KSPPPP Y      V+KSPP
Sbjct: 186 VHKSPPPPVYKSPTPPVHKSPP 207

 Score =  119 bits (298), Expect = 1e-25
 Identities = 64/92 (69%), Positives = 67/92 (72%), Gaps = 15/92 (16%)
 Frame = +1

Query: 79  SPPPPP---YVYPSPPPP----SPPPPYIYKSPPPPPYVYNSPPPP------PYVYNSPP 219
           SPPPPP   YVY SPPPP    SPPPP +YKSPPPP  V+ SPPPP      P VY SPP
Sbjct: 43  SPPPPPKQQYVYKSPPPPPVYKSPPPP-VYKSPPPP--VHKSPPPPVHKSPPPPVYKSPP 99

Query: 220 PP--PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PP  PYVYKSPPPPP V+KSPPPP  VYKSPP
Sbjct: 100 PPKKPYVYKSPPPPPPVHKSPPPP--VYKSPP 129

 Score =  118 bits (295), Expect = 2e-25
 Identities = 64/94 (68%), Positives = 67/94 (71%), Gaps = 17/94 (18%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP---SPPPPYIYKSPP------PPPYVYNSPPPP--PYVYNSPPPP 225
           SPPPPP VY SPPPP   SPPPP ++KSPP      PPP VY SPPPP  PYVY SPPPP
Sbjct: 56  SPPPPP-VYKSPPPPVYKSPPPP-VHKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPP 113

Query: 226 PYVYKSPPPPPYVYKSPPPPPY------VYKSPP 309
           P V+KSPPPP  VYKSPPPP Y      VYKSPP
Sbjct: 114 PPVHKSPPPP--VYKSPPPPVYESPPPPVYKSPP 145

 Score =  115 bits (288), Expect = 1e-24
 Identities = 60/92 (65%), Positives = 63/92 (68%), Gaps = 15/92 (16%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPP------ 219
           SPPPPP     PPPP       SPPPP +YKSPPPP  VY SPPPP  V+ SPP      
Sbjct: 34  SPPPPPPKKSPPPPPKQQYVYKSPPPPPVYKSPPPP--VYKSPPPP--VHKSPPPPVHKS 89

Query: 220 PPPYVYKSPPPP--PYVYKSPPPPPYVYKSPP 309
           PPP VYKSPPPP  PYVYKSPPPPP V+KSPP
Sbjct: 90  PPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPP 121

 Score =  113 bits (283), Expect = 6e-24
 Identities = 68/127 (53%), Positives = 71/127 (55%), Gaps = 24/127 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPSPPPPYIYKSPPPPPY 171
           PP     S P    K  P  +  SP  P    PPP VY SPPPP  P  Y+YKSPPPPP 
Sbjct: 58  PPPPVYKSPPPPVYKSPPPPVHKSPPPPVHKSPPPPVYKSPPPPKKP--YVYKSPPPPPP 115

Query: 172 VYNSPPPPPYV-------YNSPPPPPY------VYKSPP------PPPYVYKSPPPP--P 288
           V+ SPPPP Y        Y SPPPP Y      VYKSPP      PPP VYKSPPPP  P
Sbjct: 116 VHKSPPPPVY-KSPPPPVYESPPPPVYKSPPPPVYKSPPPPVHKSPPPPVYKSPPPPKKP 174

Query: 289 YVYKSPP 309
           YVYKSPP
Sbjct: 175 YVYKSPP 181

 Score =  108 bits (270), Expect = 2e-22
 Identities = 65/126 (51%), Positives = 69/126 (54%), Gaps = 23/126 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP-----FSPPPP--PYVYPSPPPPSP----PPPYIY 147
           PP     S P    K  P  +  SP      SPPPP  PYVY SPPPP P    PPP +Y
Sbjct: 136 PPPPVYKSPPPPVYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVY 195

Query: 148 KSPPPPPY------VYNSPPP----PPYVYNSPPPP--PYVYKSPPPPPYVYKSPPPPPY 291
           KSP PP +      VY SP P    PP VY SPPPP  PYVYKSPPPP    K  PPP Y
Sbjct: 196 KSPTPPVHKSPPHPVYKSPLPVHKSPPPVYKSPPPPKKPYVYKSPPPP---VKKHPPPHY 252

Query: 292 VYKSPP 309
           +Y SPP
Sbjct: 253 IYSSPP 258

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 51/120 (42%), Positives = 55/120 (45%), Gaps = 35/120 (29%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---------FSPPPPPYVYPSPPPP---------- 123
           PP     S P    K  P  +  SP          SPPPPP V+ SPPPP          
Sbjct: 144 PPPPVYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPTPPVH 203

Query: 124 -SPP-------------PPYIYKSPPPP--PYVYNSPPPPPYVYNSPPPPPYVYKSPPPP 255
            SPP             PP +YKSPPPP  PYVY SPPPP       PPP Y+Y SPPPP
Sbjct: 204 KSPPHPVYKSPLPVHKSPPPVYKSPPPPKKPYVYKSPPPP---VKKHPPPHYIYSSPPPP 260

[50][TOP]
>UniRef100_Q6GUG3 Serine/proline-rich repeat protein n=2 Tax=Lupinus angustifolius
           RepID=Q6GUG3_LUPAN
          Length = 198

 Score =  122 bits (305), Expect = 2e-26
 Identities = 66/117 (56%), Positives = 68/117 (58%), Gaps = 37/117 (31%)
 Frame = +1

Query: 70  SPFSPPPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVY 207
           SP   PPPPYVY SPPP  PSPPPPY YKSP      PPPPY+Y SP      PPPPYV 
Sbjct: 52  SPSPSPPPPYVYKSPPPPSPSPPPPYAYKSPPPPSPSPPPPYLYKSPPPPSPSPPPPYVN 111

Query: 208 NSP------PPPPYVYKSPPP----PPYVYKSP-------------PPPPYVYKSPP 309
            SP      PPPPY+YKSPPP    PP    SP             PPPPYVYKSPP
Sbjct: 112 KSPPPPSSSPPPPYIYKSPPPPSPSPPPPSPSPPPPSPSPPPPSPSPPPPYVYKSPP 168

 Score =  114 bits (284), Expect = 4e-24
 Identities = 60/108 (55%), Positives = 65/108 (60%), Gaps = 22/108 (20%)
 Frame = +1

Query: 52  PSGIGVSPFSPPPPPYVYPSPPPP----SPPPPYIYKSP------PPPPYVYNSPPPPPY 201
           P   G   +   PP Y Y SPPPP    SPPPPY+YKSP      PPPPY Y SPPPP  
Sbjct: 28  PYNAGQPYYYYQPPSYYYQSPPPPSPSPSPPPPYVYKSPPPPSPSPPPPYAYKSPPPP-- 85

Query: 202 VYNSPPPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
             +  PPPPY+YKSP      PPPPYV KSP      PPPPY+YKSPP
Sbjct: 86  --SPSPPPPYLYKSPPPPSPSPPPPYVNKSPPPPSSSPPPPYIYKSPP 131

 Score =  113 bits (283), Expect = 6e-24
 Identities = 67/121 (55%), Positives = 70/121 (57%), Gaps = 18/121 (14%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPP--SPPPPYIYKSPPP- 162
           PP  A  S P  S    P  +  SP  P   PPPPYV  SPPPP  SPPPPYIYKSPPP 
Sbjct: 74  PPPYAYKSPPPPSPSPPPPYLYKSPPPPSPSPPPPYVNKSPPPPSSSPPPPYIYKSPPPP 133

Query: 163 ---PPYVYNSPPPP---PYVYNSPPPPPYVYKSPPP----PPYVYKSPPPP--PYVYKSP 306
              PP    SPPPP   P   +  PPPPYVYKSPPP    PP    SPPPP  PY+Y SP
Sbjct: 134 SPSPPPPSPSPPPPSPSPPPPSPSPPPPYVYKSPPPPSPSPPPPSPSPPPPYHPYLYSSP 193

Query: 307 P 309
           P
Sbjct: 194 P 194

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 38/69 (55%), Positives = 42/69 (60%), Gaps = 2/69 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPP--PYV 174
           PP  + S  P S +   PS     P   PPPPYVY SPPPPSP PP    SPPPP  PY+
Sbjct: 130 PPPPSPSPPPPSPSPPPPSPSPPPPSPSPPPPYVYKSPPPPSPSPPPPSPSPPPPYHPYL 189

Query: 175 YNSPPPPPY 201
           Y+SPPPP Y
Sbjct: 190 YSSPPPPVY 198

[51][TOP]
>UniRef100_Q9FG06 Genomic DNA, chromosome 5, BAC clone:F15M7 n=1 Tax=Arabidopsis
           thaliana RepID=Q9FG06_ARATH
          Length = 689

 Score =  121 bits (304), Expect = 2e-26
 Identities = 70/142 (49%), Positives = 72/142 (50%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 203 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 256

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVYNSPPPP     P V    PPPPYVY SPPPP 
Sbjct: 257 YVYSSPPPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 316

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P VY   PPPPYVY SPP
Sbjct: 317 YSPSPKVYYKSPPPPYVYSSPP 338

 Score =  119 bits (297), Expect = 1e-25
 Identities = 73/153 (47%), Positives = 78/153 (50%), Gaps = 50/153 (32%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPS-GIGVSP----FSP--------PPPPYVYPSPPPP------ 123
           PP S  S SP  + K  P   +  SP    +SP        PPPPYVY SPPPP      
Sbjct: 87  PPPSYYSPSPKVNYKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 146

Query: 124 -----SPPPPYIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPP 228
                SPPPPY+Y SPPPP               PYVYNSPPPP     P +    PPPP
Sbjct: 147 KVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPP 206

Query: 229 YVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           YVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 207 YVYSSPPPPYYSPSPKVDYKS-PPPPYVYNSPP 238

 Score =  117 bits (294), Expect = 3e-25
 Identities = 69/142 (48%), Positives = 71/142 (50%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 153 PPPPYVYSSP------PPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPP 206

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVYNSPPPP     P V    PPPPYVY SPPPP 
Sbjct: 207 YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 266

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P V    PPPPYVY SPP
Sbjct: 267 FSPSPKVEYKSPPPPYVYNSPP 288

 Score =  117 bits (292), Expect = 5e-25
 Identities = 70/143 (48%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 328 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 381

Query: 139 YIYKSPPP---------------PPYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPP               PPYVY+SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 382 YVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPPYVYSSPPPPY 441

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 442 YSPSPKVDYKS-PPPPYVYSSPP 463

 Score =  116 bits (291), Expect = 7e-25
 Identities = 70/143 (48%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 253 PPPPYVYSSP------PPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPP 306

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 307 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 366

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 367 YSPSPKVDYKS-PPPPYVYSSPP 388

 Score =  114 bits (285), Expect = 3e-24
 Identities = 66/117 (56%), Positives = 72/117 (61%), Gaps = 15/117 (12%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSP-FSPPPPPYVYPSPPPPS---PPPPYIYKSPPPPPY 171
           P+S+  SSP +    +PS    SP ++P P PYVY SPPPPS   P P   YKSPPPP  
Sbjct: 49  PYSSPYSSPQTPHYNSPSHEHKSPKYAPHPKPYVYISPPPPSYYSPSPKVNYKSPPPPN- 107

Query: 172 VYNSPPPP-----PYVYNSPPPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           VYNSPPPP     P V    PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 108 VYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKS-PPPPYVYSSPP 163

 Score =  114 bits (285), Expect = 3e-24
 Identities = 67/119 (56%), Positives = 69/119 (57%), Gaps = 16/119 (13%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP--SPPPPYIYKSPPPP 165
           PP   V SSP       P     SP   +  PPPPYVY SPPPP  SP P   YKSPPPP
Sbjct: 378 PPPPYVYSSP------PPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPP 431

Query: 166 PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPPY------VYKSPPPPPYVYKSPP 309
            YVY+SPPPP     P V    PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 432 -YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKS-PPPPYVYSSPP 488

 Score =  113 bits (282), Expect = 7e-24
 Identities = 67/142 (47%), Positives = 70/142 (49%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 403 PPPPYVYSSP------PPPYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 456

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP- 255
           Y+Y SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 457 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 516

Query: 256 ----PYVYKSPPPPPYVYKSPP 309
               P V    PPPPYVY S P
Sbjct: 517 HSPSPKVNYKSPPPPYVYSSHP 538

 Score =  108 bits (270), Expect = 2e-22
 Identities = 67/143 (46%), Positives = 70/143 (48%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 478 PPPPYVYSSP------PPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSPPPP 531

Query: 139 YIYKS---------------PPPPPYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y S                PPPPYVY+SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 532 YVYSSHPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPY 591

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS  PPPYVY  PP
Sbjct: 592 YSPSPMVDYKS-TPPPYVYSFPP 613

 Score =  105 bits (261), Expect = 2e-21
 Identities = 65/142 (45%), Positives = 70/142 (49%), Gaps = 40/142 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           S PPP
Sbjct: 553 PPPPYVYSSP------PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPMVDYKSTPPP 606

Query: 139 YIYKSP---------------PPPPYVYNSPP-----PPPYVYNSPPPPPYVYKSPPPPP 258
           Y+Y  P               PP PYVY+SPP     P P V+   PPPPYVY SPPPP 
Sbjct: 607 YVYSFPPLPYYSPSPKVDYKSPPLPYVYSSPPPLYYSPSPKVHYKSPPPPYVYNSPPPPY 666

Query: 259 Y------VYKSPPPPPYVYKSP 306
           Y       YKS PPPPYVYK+P
Sbjct: 667 YSPSPKVTYKS-PPPPYVYKAP 687

 Score =  104 bits (260), Expect = 3e-21
 Identities = 55/114 (48%), Positives = 59/114 (51%), Gaps = 36/114 (31%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP-----------SPPPPYIYKSPPPP-----PYVYNSPPPPPYVY 207
           +  PPPPYVY SPPPP           SPPPPY+Y SPPPP     P V     PPPYVY
Sbjct: 550 YKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPMVDYKSTPPPYVY 609

Query: 208 NSPPPP---------------PYVYKSPPP-----PPYVYKSPPPPPYVYKSPP 309
           + PP P               PYVY SPPP      P V+   PPPPYVY SPP
Sbjct: 610 SFPPLPYYSPSPKVDYKSPPLPYVYSSPPPLYYSPSPKVHYKSPPPPYVYNSPP 663

[52][TOP]
>UniRef100_Q01945 Extensin (Class I) (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q01945_SOLLC
          Length = 90

 Score =  121 bits (304), Expect = 2e-26
 Identities = 57/87 (65%), Positives = 60/87 (68%), Gaps = 8/87 (9%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           P   PPPPYVY SPPP  PSPPPPY+YKSPPPP    +  PPPPYVY SPPPP +     
Sbjct: 2   PSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPP----SPSPPPPYVYKSPPPPSH----S 53

Query: 247 PPPPYVYKSP------PPPPYVYKSPP 309
           PPPPY YKSP      PPPPY YKSPP
Sbjct: 54  PPPPYYYKSPPPPSPSPPPPYYYKSPP 80

 Score =  110 bits (274), Expect = 6e-23
 Identities = 52/81 (64%), Positives = 54/81 (66%), Gaps = 2/81 (2%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           P   PPPPYVY SPPP  PSPPPPY+YKSPPPP +     PPPPY Y SPPPP       
Sbjct: 18  PSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSH----SPPPPYYYKSPPPP----SPS 69

Query: 247 PPPPYVYKSPPPPPYVYKSPP 309
           PPPPY YKSPPPP     SPP
Sbjct: 70  PPPPYYYKSPPPPS---PSPP 87

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 45/87 (51%), Positives = 47/87 (54%), Gaps = 10/87 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPPS--PPPPYIYKSPPPP 165
           PP     S P  S    P  +  SP  P   PPPPYVY SPPPPS  PPPPY YKSPPPP
Sbjct: 7   PPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSHSPPPPYYYKSPPPP 66

Query: 166 -----PYVYNSPPPPPYVYNSPPPPPY 231
                P  Y   PPPP   +  PPPPY
Sbjct: 67  SPSPPPPYYYKSPPPP---SPSPPPPY 90

[53][TOP]
>UniRef100_Q9M564 CRANTZ hydroxyproline-rich glycoprotein n=1 Tax=Manihot esculenta
           RepID=Q9M564_MANES
          Length = 232

 Score =  121 bits (303), Expect = 3e-26
 Identities = 66/128 (51%), Positives = 71/128 (55%), Gaps = 32/128 (25%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP--PPPYIYKSP------PPPPYVY 177
           + P +  K +PS         PPPPY Y SPPPPSP  PPPY YKSP      PPPPY Y
Sbjct: 2   AGPAAKLKTSPS---------PPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYY 52

Query: 178 NSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKSP------PPP 285
           +SP      PPPPY Y+SP      PPPPY Y SP      PPPPY Y SP      PPP
Sbjct: 53  HSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPP 112

Query: 286 PYVYKSPP 309
           PY Y SPP
Sbjct: 113 PYYYHSPP 120

 Score =  119 bits (299), Expect = 8e-26
 Identities = 62/111 (55%), Positives = 64/111 (57%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPPP  SPPPPY Y SP      PPPPY Y+SP      PPPPY Y+
Sbjct: 90  PVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYH 149

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 150 SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 200

 Score =  119 bits (298), Expect = 1e-25
 Identities = 62/111 (55%), Positives = 64/111 (57%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPP  PSPPPPY Y SP      PPPPY Y+SP      PPPPY Y+
Sbjct: 26  PSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYH 85

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 86  SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 136

 Score =  115 bits (287), Expect = 2e-24
 Identities = 67/137 (48%), Positives = 71/137 (51%), Gaps = 34/137 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPP--PPYVYPSPPPP--SPPPPYIYKSP---- 156
           PP+   S  P S +   P      P   P   PPY Y SPPPP  SPPPPY Y SP    
Sbjct: 16  PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV 75

Query: 157 --PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKSP 276
             PPPPY Y+SP      PPPPY Y+SP      PPPPY Y SP      PPPPY Y SP
Sbjct: 76  KSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSP 135

Query: 277 ------PPPPYVYKSPP 309
                 PPPPY Y SPP
Sbjct: 136 PPPVKSPPPPYYYHSPP 152

 Score =  114 bits (285), Expect = 3e-24
 Identities = 59/99 (59%), Positives = 61/99 (61%), Gaps = 20/99 (20%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPP------PYVYNSPPPP------PYVYN 210
           P   PPPPY Y SPPPP  SPPPPY Y SPPPP      PY Y+SPPPP      PY Y+
Sbjct: 122 PVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYH 181

Query: 211 SPPPP------PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP      PY Y SPPPP    KS PPPPY Y SPP
Sbjct: 182 SPPPPVKSPPPPYYYHSPPPP---VKS-PPPPYYYHSPP 216

 Score =  110 bits (276), Expect = 4e-23
 Identities = 53/86 (61%), Positives = 55/86 (63%), Gaps = 8/86 (9%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSPPPPPYVYNSPPPPP 228
           P   PPPPY Y SPPPP  SPPPPY Y SP      PPPPY Y+SPPPP       PPPP
Sbjct: 154 PVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV----KSPPPP 209

Query: 229 YVYKSPPPPPYVYKSPPPPPYVYKSP 306
           Y Y SPPPP    KSPPPP Y+Y SP
Sbjct: 210 YYYHSPPPP---VKSPPPPVYIYASP 232

[54][TOP]
>UniRef100_Q9M1H0 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9M1H0_ARATH
          Length = 951

 Score =  121 bits (303), Expect = 3e-26
 Identities = 67/140 (47%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP   + SSP  +    P       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 47  PPLPYIDSSPPPTYSPAPE----VEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVY 102

Query: 148 KSPPPP---------------PYVYNSPPPPPY-----VYNSPPPPPYVYKSPPPPPY-- 261
            SPPPP               PYVY+SPPPP Y     V    PPPPYVY SPPPP Y  
Sbjct: 103 SSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 162

Query: 262 ----VYKSPPPPPYVYKSPP 309
                YKS PPPPYVY SPP
Sbjct: 163 SPKVEYKS-PPPPYVYSSPP 181

 Score =  120 bits (301), Expect = 5e-26
 Identities = 66/139 (47%), Positives = 71/139 (51%), Gaps = 36/139 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P  +   +P       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 372 PPPYVYSSPPPPTYSPSPK----VEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVY 427

Query: 148 KSPPPP---------------PYVYNSPPPPPY-----VYNSPPPPPYVYKSPPPP---- 255
            SPPPP               PYVY+SPPPP Y     V    PPPPYVY SPPPP    
Sbjct: 428 SSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP 487

Query: 256 -PYVYKSPPPPPYVYKSPP 309
            P VY   PPPPYVY SPP
Sbjct: 488 SPKVYYKSPPPPYVYSSPP 506

 Score =  119 bits (297), Expect = 1e-25
 Identities = 71/143 (49%), Positives = 74/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
            PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 804  PPPPYVYSSP------PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 857

Query: 139  YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
            Y+Y SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 858  YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPPPPY 917

Query: 259  YV------YKSPPPPPYVYKSPP 309
            Y       YKS PPPPYVYKSPP
Sbjct: 918  YSPSPKVEYKS-PPPPYVYKSPP 939

 Score =  118 bits (296), Expect = 2e-25
 Identities = 67/140 (47%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P  +   +P       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 272 PPPYVYSSPPPPTYSPSPK----VDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 327

Query: 148 KSPPPP---------------PYVYNSPPPPPY-----VYNSPPPPPYVYKSPPPPPY-- 261
            SPPPP               PYVY+SPPPP Y     V    PPPPYVY SPPPP Y  
Sbjct: 328 SSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 387

Query: 262 ----VYKSPPPPPYVYKSPP 309
                YKS PPPPYVY SPP
Sbjct: 388 SPKVEYKS-PPPPYVYSSPP 406

 Score =  118 bits (296), Expect = 2e-25
 Identities = 72/158 (45%), Positives = 76/158 (48%), Gaps = 55/158 (34%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 421 PPPPYVYSSP------PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 474

Query: 139 YIYKSPPPP---------------PYVYNSP---------------PPPPYVYNSPPPPP 228
           Y+Y SPPPP               PYVY+SP               PPPPYVY+SPPPP 
Sbjct: 475 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 534

Query: 229 Y------VYKSPPPP-----PYVYKSPPPPPYVYKSPP 309
           Y       YKSPPPP     P VY   PPPPYVY SPP
Sbjct: 535 YSPSPKVYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPP 572

 Score =  118 bits (296), Expect = 2e-25
 Identities = 68/133 (51%), Positives = 70/133 (52%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 496 PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 549

Query: 139 YIYKSP------PPPPYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPP-----PYVYK 270
           Y   SP      PPPPYVY+SPPPP     P VY   PPPPYVY SPPPP     P V  
Sbjct: 550 YYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSPKVQY 609

Query: 271 SPPPPPYVYKSPP 309
             PPPPYVY SPP
Sbjct: 610 KSPPPPYVYSSPP 622

 Score =  117 bits (294), Expect = 3e-25
 Identities = 67/140 (47%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P  +   +P       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 97  PPPYVYSSPPPPTYSPSPK----VEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVY 152

Query: 148 KSPPPP---------------PYVYNSPPPPPY-----VYNSPPPPPYVYKSPPPPPY-- 261
            SPPPP               PYVY+SPPPP Y     V    PPPPYVY SPPPP Y  
Sbjct: 153 SSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSP 212

Query: 262 ----VYKSPPPPPYVYKSPP 309
                YKS PPPPYVY SPP
Sbjct: 213 SPKVEYKS-PPPPYVYSSPP 231

 Score =  117 bits (294), Expect = 3e-25
 Identities = 67/140 (47%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P  +   +P       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 322 PPPYVYSSPPPPTYSPSPK----VEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVY 377

Query: 148 KSPPPP---------------PYVYNSPPPPPY-----VYNSPPPPPYVYKSPPPPPY-- 261
            SPPPP               PYVY+SPPPP Y     V    PPPPYVY SPPPP Y  
Sbjct: 378 SSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSP 437

Query: 262 ----VYKSPPPPPYVYKSPP 309
                YKS PPPPYVY SPP
Sbjct: 438 SPKVEYKS-PPPPYVYSSPP 456

 Score =  117 bits (293), Expect = 4e-25
 Identities = 67/140 (47%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P  +   +P       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 147 PPPYVYSSPPPPTYSPSPK----VEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVY 202

Query: 148 KSPPPP---------------PYVYNSPPPPPY-----VYNSPPPPPYVYKSPPPPPY-- 261
            SPPPP               PYVY+SPPPP Y     V    PPPPYVY SPPPP Y  
Sbjct: 203 SSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP 262

Query: 262 ----VYKSPPPPPYVYKSPP 309
                YKS PPPPYVY SPP
Sbjct: 263 SPKVEYKS-PPPPYVYSSPP 281

 Score =  117 bits (292), Expect = 5e-25
 Identities = 70/143 (48%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 196 PPPPYVYSSP------PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 249

Query: 139 YIYKSPPPP---------------PYVYNSPPPPPY-----VYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP Y     V    PPPPYVY SPPPP 
Sbjct: 250 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPY 309

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 310 YSPSPKVDYKS-PPPPYVYSSPP 331

 Score =  115 bits (288), Expect = 1e-24
 Identities = 65/133 (48%), Positives = 70/133 (52%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P  +   +P       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 122 PPPYVYSSPPPPTYSPSPK----VEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVY 177

Query: 148 KSPPPPPY-----VYNSPPPPPYVYNSPPPPPYVYKSP--------PPPPYVYKSPPPPP 288
            SPPPP Y     V    PPPPYVY+SPPPP   Y SP        PPPPYVY SPPPP 
Sbjct: 178 SSPPPPTYSPSPKVEYKSPPPPYVYSSPPPP---YYSPSPKVEYKSPPPPYVYSSPPPPT 234

Query: 289 YV------YKSPP 309
           Y       YKSPP
Sbjct: 235 YSPSPKVDYKSPP 247

 Score =  115 bits (288), Expect = 1e-24
 Identities = 65/133 (48%), Positives = 70/133 (52%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P  +   +P       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 347 PPPYVYSSPPPPTYSPSPK----VEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVY 402

Query: 148 KSPPPPPY-----VYNSPPPPPYVYNSPPPPPYVYKSP--------PPPPYVYKSPPPPP 288
            SPPPP Y     V    PPPPYVY+SPPPP   Y SP        PPPPYVY SPPPP 
Sbjct: 403 SSPPPPTYSPSPKVEYKSPPPPYVYSSPPPP---YYSPSPKVEYKSPPPPYVYSSPPPPT 459

Query: 289 YV------YKSPP 309
           Y       YKSPP
Sbjct: 460 YSPSPKVDYKSPP 472

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/133 (48%), Positives = 70/133 (52%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P  +   +P       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 172 PPPYVYSSPPPPTYSPSPK----VEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVY 227

Query: 148 KSPPPPPY-----VYNSPPPPPYVYNSPPPPPYVYKSP--------PPPPYVYKSPPPPP 288
            SPPPP Y     V    PPPPYVY+SPPPP   Y SP        PPPPYVY SPPPP 
Sbjct: 228 SSPPPPTYSPSPKVDYKSPPPPYVYSSPPPP---YYSPSPKVEYKSPPPPYVYSSPPPPT 284

Query: 289 YV------YKSPP 309
           Y       YKSPP
Sbjct: 285 YSPSPKVDYKSPP 297

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/133 (48%), Positives = 70/133 (52%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P  +   +P       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 222 PPPYVYSSPPPPTYSPSPK----VDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVY 277

Query: 148 KSPPPPPY-----VYNSPPPPPYVYNSPPPPPYVYKSP--------PPPPYVYKSPPPPP 288
            SPPPP Y     V    PPPPYVY+SPPPP   Y SP        PPPPYVY SPPPP 
Sbjct: 278 SSPPPPTYSPSPKVDYKSPPPPYVYSSPPPP---YYSPSPKVDYKSPPPPYVYSSPPPPT 334

Query: 289 Y------VYKSPP 309
           Y       YKSPP
Sbjct: 335 YSPSPKVEYKSPP 347

 Score =  114 bits (286), Expect = 3e-24
 Identities = 65/122 (53%), Positives = 68/122 (55%), Gaps = 25/122 (20%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
            PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 829  PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 882

Query: 139  YIYKSPPPP-----PYVYNSPPPPPYVYNSPPPPPYV------YKSPPPPPYVYKSPPPP 285
            Y+Y SPPPP     P V    PPPPYVY+SPPPP Y       YKSPPPP YVYKSPPPP
Sbjct: 883  YVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP-YVYKSPPPP 941

Query: 286  PY 291
             Y
Sbjct: 942  SY 943

 Score =  114 bits (285), Expect = 3e-24
 Identities = 72/168 (42%), Positives = 75/168 (44%), Gaps = 65/168 (38%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
            PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 562  PPPPYVYSSP------PPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSPKVQYKSPPPP 615

Query: 139  YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
            Y+Y SPPPP               PYVY+SPPPP     P VY   PPPPYVY SPPPP 
Sbjct: 616  YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 675

Query: 259  Y------VYKSP-------------------------PPPPYVYKSPP 309
            Y       YKSP                         PPPPYVY SPP
Sbjct: 676  YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYSSPP 723

 Score =  112 bits (280), Expect = 1e-23
 Identities = 58/91 (63%), Positives = 60/91 (65%), Gaps = 13/91 (14%)
 Frame = +1

Query: 76   FSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYVYNSPPPP-----PYVYNSPPPPPYV 234
            +  PPPPYVY SPPPP  SP P   YKSPPPP YVY+SPPPP     P V    PPPPYV
Sbjct: 776  YKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPPYV 834

Query: 235  YKSPPPPPYV------YKSPPPPPYVYKSPP 309
            Y SPPPP Y       YKS PPPPYVY SPP
Sbjct: 835  YSSPPPPYYSPSPKVDYKS-PPPPYVYSSPP 864

 Score =  111 bits (277), Expect = 3e-23
 Identities = 65/131 (49%), Positives = 69/131 (52%), Gaps = 28/131 (21%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
            PP   V   P      +PS   V  +  PPPPYVY SPPPP  SP P   YKSPPPP YV
Sbjct: 687  PPHPHVCVCPPPPPCYSPSPKVV--YKSPPPPYVYSSPPPPHYSPSPKVYYKSPPPP-YV 743

Query: 175  YNSPPPPPYV------YNSP---------------PPPPYVYKSPPPP-----PYVYKSP 276
            Y+SPPPP Y       Y SP               PPPPYVY SPPPP     P V+   
Sbjct: 744  YSSPPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKS 803

Query: 277  PPPPYVYKSPP 309
            PPPPYVY SPP
Sbjct: 804  PPPPYVYSSPP 814

 Score =  110 bits (274), Expect = 6e-23
 Identities = 67/152 (44%), Positives = 72/152 (47%), Gaps = 49/152 (32%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP-----FSPPPPPYVYPSP---------------PP 120
            PP    SS P      +P     SP     +S PPPPY  PSP               PP
Sbjct: 638  PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPP 697

Query: 121  P-------------SPPPPYIYKSPPPP-----PYVYNSPPPPPYVYNSPPPPPYV---- 234
            P             SPPPPY+Y SPPPP     P VY   PPPPYVY+SPPPP Y     
Sbjct: 698  PPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPK 757

Query: 235  --YKSPPPP-----PYVYKSPPPPPYVYKSPP 309
              YKSPPPP     P V+   PPPPYVY SPP
Sbjct: 758  VHYKSPPPPYYAPTPKVHYKSPPPPYVYSSPP 789

 Score =  109 bits (273), Expect = 8e-23
 Identities = 67/145 (46%), Positives = 71/145 (48%), Gaps = 41/145 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 246 PPPPYVYSSP------PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 299

Query: 139 YIYKSPPPP---------------PYVYNSPPPPPY-----VYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP Y     V    PPPPYVY SPPPP 
Sbjct: 300 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPT 359

Query: 259 YV------YKSPPPP-PYVYKSPPS 312
           Y       YKSPPPP  Y    PP+
Sbjct: 360 YSPSPKVEYKSPPPPYVYSSPPPPT 384

 Score =  103 bits (257), Expect = 6e-21
 Identities = 50/89 (56%), Positives = 54/89 (60%), Gaps = 11/89 (12%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPY-----VYNSPPPPPYVYK 240
           +  PP PY+  SPPP   P P +    PPPPYVY+SPPPP Y     V    PPPPYVY 
Sbjct: 44  YKTPPLPYIDSSPPPTYSPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYS 103

Query: 241 SPPPPPY------VYKSPPPPPYVYKSPP 309
           SPPPP Y       YKS PPPPYVY SPP
Sbjct: 104 SPPPPTYSPSPKVEYKS-PPPPYVYSSPP 131

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 58/120 (48%), Positives = 60/120 (50%), Gaps = 43/120 (35%)
 Frame = +1

Query: 79  SPPPPPYVYPSP---------------PPP-----------SPPPPYIYKSPPPPPY--- 171
           S PPP Y  P P               PPP           SPPPPY+Y SPPPP Y   
Sbjct: 29  SSPPPLYSSPLPKIEYKTPPLPYIDSSPPPTYSPAPEVEYKSPPPPYVYSSPPPPTYSPS 88

Query: 172 --VYNSPPPPPYVYNSPPPPPY------VYKSPPPPPYVYKSPPPPPY------VYKSPP 309
             V    PPPPYVY+SPPPP Y       YKS PPPPYVY SPPPP Y       YKSPP
Sbjct: 89  PKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKS-PPPPYVYSSPPPPTYSPSPKVEYKSPP 147

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/100 (51%), Positives = 55/100 (55%), Gaps = 28/100 (28%)
 Frame = +1

Query: 94  PYVYPSPPP--PSPPPPYIYKSPPPPPYVYNSP--------------PPPPYVYNSPPPP 225
           PY   SPPP   SP P   YK+PP P Y+ +SP              PPPPYVY+SPPPP
Sbjct: 25  PYTDSSPPPLYSSPLPKIEYKTPPLP-YIDSSPPPTYSPAPEVEYKSPPPPYVYSSPPPP 83

Query: 226 PY------VYKSPPPPPYVYKSPPPPPY------VYKSPP 309
            Y       YKS PPPPYVY SPPPP Y       YKSPP
Sbjct: 84  TYSPSPKVEYKS-PPPPYVYSSPPPPTYSPSPKVEYKSPP 122

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 43/89 (48%), Positives = 49/89 (55%), Gaps = 9/89 (10%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP----SPPPPYIYKSPPPP----PYVYNSPPPPPYVYNSPPPPP 228
           P++   PP +Y SP P     +PP PYI  SPPP     P V    PPPPYVY+SPPPP 
Sbjct: 25  PYTDSSPPPLYSSPLPKIEYKTPPLPYIDSSPPPTYSPAPEVEYKSPPPPYVYSSPPPPT 84

Query: 229 YVYKSPPPPPYVYKSPPPP-PYVYKSPPS 312
           Y     P P   YKSPPPP  Y    PP+
Sbjct: 85  Y----SPSPKVEYKSPPPPYVYSSPPPPT 109

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 39/77 (50%), Positives = 41/77 (53%), Gaps = 3/77 (3%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPY 171
            PP    SS P      +P    V  +  PPPPYV  S PPP   SP P   YKS PPPPY
Sbjct: 880  PPPYVYSSPPPPYYSPSP----VVDYKSPPPPYV-YSSPPPPYYSPSPKVEYKS-PPPPY 933

Query: 172  VYNSPPPPPYVYNSPPP 222
            VY SPPPP Y   SP P
Sbjct: 934  VYKSPPPPSY---SPSP 947

[55][TOP]
>UniRef100_Q9LJK0 Genomic DNA, chromosome 3, P1 clone: MZN14 n=1 Tax=Arabidopsis
           thaliana RepID=Q9LJK0_ARATH
          Length = 1018

 Score =  121 bits (303), Expect = 3e-26
 Identities = 70/133 (52%), Positives = 75/133 (56%), Gaps = 29/133 (21%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P      +P  +    +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 489 PPPYVYSSPPPPYYSPSPKVL----YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVY 544

Query: 148 KSPPPPPY------VYNSPPPPPYVYNSPPPPPY------VYKSPPPPPYVYKSPPPPPY 291
            SPPPP Y      VY SPPPP YVY+SPPPP Y      VYKSPPPP YVY SPPPP Y
Sbjct: 545 SSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYY 602

Query: 292 ------VYKSPPS 312
                  YKSPPS
Sbjct: 603 SPSPKVYYKSPPS 615

 Score =  120 bits (301), Expect = 5e-26
 Identities = 70/141 (49%), Positives = 75/141 (53%), Gaps = 38/141 (26%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
            PP    SS P      +P  +    +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 731  PPPYVYSSPPPPYYSPSPKVV----YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVY 786

Query: 148  KSPPPP---------------PYVYNSPPPPPY------VYNSPPPPPYVYKSPPPPPY- 261
             SPPPP               PYVY+SPPPP Y      VY S PPPPYVY SPPPP Y 
Sbjct: 787  SSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKS-PPPPYVYSSPPPPYYS 845

Query: 262  -----VYKSPPPPPYVYKSPP 309
                 VYKS PPPPYVY SPP
Sbjct: 846  PSPKVVYKS-PPPPYVYSSPP 865

 Score =  120 bits (300), Expect = 6e-26
 Identities = 73/144 (50%), Positives = 76/144 (52%), Gaps = 41/144 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 463 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPP 516

Query: 139 YIYKSPPPP---------------PYVYNSPPPPPY------VYNSPPPPPYVYKSPPPP 255
           Y+Y SPPPP               PYVY+SPPPP Y      VY S PPPPYVY SPPPP
Sbjct: 517 YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKS-PPPPYVYSSPPPP 575

Query: 256 PY------VYKSPPPPPYVYKSPP 309
            Y      VYKS PPPPYVY SPP
Sbjct: 576 YYSPSPKVVYKS-PPPPYVYSSPP 598

 Score =  120 bits (300), Expect = 6e-26
 Identities = 73/144 (50%), Positives = 76/144 (52%), Gaps = 41/144 (28%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
            PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 680  PPPPYVYSSP------PPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP 733

Query: 139  YIYKSPPPP---------------PYVYNSPPPPPY------VYNSPPPPPYVYKSPPPP 255
            Y+Y SPPPP               PYVY+SPPPP Y      VY S PPPPYVY SPPPP
Sbjct: 734  YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKS-PPPPYVYSSPPPP 792

Query: 256  PY------VYKSPPPPPYVYKSPP 309
             Y      VYKS PPPPYVY SPP
Sbjct: 793  YYSPSPKVVYKS-PPPPYVYSSPP 815

 Score =  119 bits (298), Expect = 1e-25
 Identities = 68/119 (57%), Positives = 72/119 (60%), Gaps = 16/119 (13%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP--SPPPPYIYKSPPPP 165
           PP   V +SP       PS    SP   +  PPPPYVY SPPPP  SP P  +YKSPPPP
Sbjct: 163 PPSPYVYNSP------PPSYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP 216

Query: 166 PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPPY------VYKSPPPPPYVYKSPP 309
            YVY+SPPPP     P V    PPPPYVY SPPPP Y      VYKS PPPPYVY SPP
Sbjct: 217 -YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKS-PPPPYVYSSPP 273

 Score =  119 bits (298), Expect = 1e-25
 Identities = 68/140 (48%), Positives = 73/140 (52%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P      +P  +    +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 189 PPPYVYSSPPPPYYSPSPKVV----YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 244

Query: 148 KSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPPY-- 261
            SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP Y  
Sbjct: 245 SSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 304

Query: 262 ----VYKSPPPPPYVYKSPP 309
               VYKS PPPPYVY SPP
Sbjct: 305 SPKVVYKS-PPPPYVYSSPP 323

 Score =  119 bits (298), Expect = 1e-25
 Identities = 75/156 (48%), Positives = 80/156 (51%), Gaps = 53/156 (33%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP   V SSP      TPS   V  +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 388 PPPPYVYSSP-PPPYYTPSPKVV--YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 444

Query: 148 KSPPPP---------------PYVYNSP---------------PPPPYVYNSPPPPPY-- 231
            SPPPP               PYVY+SP               PPPPYVY+SPPPP Y  
Sbjct: 445 SSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 504

Query: 232 ----VYKSPPPPPYVYKSPPPPPY------VYKSPP 309
               +YKS PPPPYVY SPPPP Y      VYKSPP
Sbjct: 505 SPKVLYKS-PPPPYVYSSPPPPYYSPSPKVVYKSPP 539

 Score =  119 bits (297), Expect = 1e-25
 Identities = 73/165 (44%), Positives = 77/165 (46%), Gaps = 62/165 (37%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P      TP       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 314 PPPYVYSSPPPPYYSPTPK----VDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 369

Query: 148 KSPPPP---------------PYVYNSP---------------PPPPYVYNSP------- 216
            SPPPP               PYVY+SP               PPPPYVY+SP       
Sbjct: 370 SSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSP 429

Query: 217 --------PPPPYVYKSPPPPPY------VYKSPPPPPYVYKSPP 309
                   PPPPYVY SPPPP Y      VYKS PPPPYVY SPP
Sbjct: 430 SPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKS-PPPPYVYSSPP 473

 Score =  118 bits (295), Expect = 2e-25
 Identities = 72/165 (43%), Positives = 78/165 (47%), Gaps = 62/165 (37%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P      +P  +    +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 239 PPPYVYSSPPPPYYSPSPKIV----YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 294

Query: 148 KSPPPP---------------PYVYNSP---------------PPPPYVYNSP------- 216
            SPPPP               PYVY+SP               PPPPYVY+SP       
Sbjct: 295 SSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 354

Query: 217 --------PPPPYVYKSPPPPPY------VYKSPPPPPYVYKSPP 309
                   PPPPYVY SPPPP Y      VYKS PPPPYVY SPP
Sbjct: 355 SPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKS-PPPPYVYSSPP 398

 Score =  117 bits (292), Expect = 5e-25
 Identities = 70/141 (49%), Positives = 74/141 (52%), Gaps = 38/141 (26%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
            PP   V   P      +PS   V  +   PPPYVY SPPPP           SPPPPY+Y
Sbjct: 629  PPHPHVCVCPPPPPCYSPSPKVV--YKSSPPPYVYSSPPPPYHSPSPKVHYKSPPPPYVY 686

Query: 148  KSPPPP---------------PYVYNSPPPPPY------VYNSPPPPPYVYKSPPPPPY- 261
             SPPPP               PYVY+SPPPP Y      VY S PPPPYVY SPPPP Y 
Sbjct: 687  SSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKS-PPPPYVYSSPPPPYYS 745

Query: 262  -----VYKSPPPPPYVYKSPP 309
                 VYKS PPPPYVY SPP
Sbjct: 746  PSPKVVYKS-PPPPYVYSSPP 765

 Score =  117 bits (292), Expect = 5e-25
 Identities = 67/140 (47%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
            PP    SS P      +P  +    +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 781  PPPYVYSSPPPPYYSPSPKVV----YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVY 836

Query: 148  KSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPPYV- 264
             SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP Y  
Sbjct: 837  SSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 896

Query: 265  -----YKSPPPPPYVYKSPP 309
                 YKS PPPPYVY SPP
Sbjct: 897  SPKVDYKS-PPPPYVYSSPP 915

 Score =  117 bits (292), Expect = 5e-25
 Identities = 67/140 (47%), Positives = 72/140 (51%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
            PP    SS P      +P  +    +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 831  PPPYVYSSPPPPYYSPSPKVV----YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 886

Query: 148  KSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPPYV- 264
             SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP Y  
Sbjct: 887  SSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 946

Query: 265  -----YKSPPPPPYVYKSPP 309
                 YKS PPPPYVY SPP
Sbjct: 947  APKVDYKS-PPPPYVYSSPP 965

 Score =  115 bits (289), Expect = 1e-24
 Identities = 69/134 (51%), Positives = 72/134 (53%), Gaps = 31/134 (23%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
            PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 880  PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 933

Query: 139  YIYKSPPPP-----PYVYNSPPPPPYVYNSPPPPPYV------YKSPPPPPYV------Y 267
            Y+Y SPPPP     P V    PPPPYVY+SPPPP Y       YKSPPPP Y       Y
Sbjct: 934  YVYSSPPPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSPKVDY 993

Query: 268  KSPPPPPYVYKSPP 309
            KSPPPP YVY SPP
Sbjct: 994  KSPPPP-YVYSSPP 1006

 Score =  112 bits (280), Expect = 1e-23
 Identities = 64/123 (52%), Positives = 70/123 (56%), Gaps = 19/123 (15%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPP--- 165
           PP   V SSP    + +P+      +  PPPPY  PSP     SPPPPY+Y SPPPP   
Sbjct: 46  PPLPDVYSSPPPPLEYSPAP--KVDYKSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYS 103

Query: 166 --PYVYNSPPPPPYVYNSPPPPPYV------YKSPPPPPYVYKSPPPPPYV------YKS 303
             P V    PPPPYVY+SPPPP Y       YKSPPPP YVY SPPPP Y       YKS
Sbjct: 104 PSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKS 162

Query: 304 PPS 312
           PPS
Sbjct: 163 PPS 165

 Score =  107 bits (267), Expect = 4e-22
 Identities = 59/107 (55%), Positives = 60/107 (56%), Gaps = 29/107 (27%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP------------SPPPPYIYKSP------PPPPYVYNSPPPP-- 195
           +  PP P VY SPPPP            SPPPPY   SP      PPPPYVYNSPPPP  
Sbjct: 43  YKSPPLPDVYSSPPPPLEYSPAPKVDYKSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYY 102

Query: 196 ---PYVYNSPPPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
              P V    PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 103 SPSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKS-PPPPYVYSSPP 148

 Score =  105 bits (263), Expect = 1e-21
 Identities = 69/181 (38%), Positives = 75/181 (41%), Gaps = 78/181 (43%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
            PP    SS P      +P  +    +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 514  PPPYVYSSPPPPYYSPSPKVV----YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVY 569

Query: 148  KSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPY-------VYKSP 246
             SPPPP               PYVY+SPPPP     P VY   PP PY       +YKSP
Sbjct: 570  SSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSPYHAPSPKVLYKSP 629

Query: 247  P-------------------------PPPYVYKSP---------------PPPPYVYKSP 306
            P                         PPPYVY SP               PPPPYVY SP
Sbjct: 630  PHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSPSPKVHYKSPPPPYVYSSP 689

Query: 307  P 309
            P
Sbjct: 690  P 690

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 59/120 (49%), Positives = 61/120 (50%), Gaps = 26/120 (21%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
            PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 905  PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYKSPPPP 958

Query: 139  YIYKSPPPPPYV------YNSPPPPPYV------YNSPPPPPYVYKSPPPPPYVYKSPPP 282
            Y+Y SPPPP Y       Y SPPPP Y       Y S PPPPYVY SPPPP Y   SP P
Sbjct: 959  YVYSSPPPPYYSPSPKVDYKSPPPPYYSPSPKVDYKS-PPPPYVYSSPPPPSY---SPSP 1014

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 49/100 (49%), Positives = 51/100 (51%), Gaps = 28/100 (28%)
 Frame = +1

Query: 94  PYVYPSPPPPSPPPPYIYKSPPPPPYVYNSP----------------PPPPYVYNSP--- 216
           PY   SPPP S P P +    PP P VY+SP                PPPPY   SP   
Sbjct: 25  PYTDSSPPPYSVPLPKVEYKSPPLPDVYSSPPPPLEYSPAPKVDYKSPPPPYYSPSPKVE 84

Query: 217 ---PPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
              PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 85  YKSPPPPYVYNSPPPPYYSPSPKVDYKS-PPPPYVYSSPP 123

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 35/69 (50%), Positives = 38/69 (55%), Gaps = 17/69 (24%)
 Frame = +1

Query: 76   FSPPPPPYVYPSPPPP-----------SPPPPYIYKSP------PPPPYVYNSPPPPPYV 204
            +  PPPPYVY SPPPP           SPPPPY   SP      PPPPYVY+SPPPP   
Sbjct: 952  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPS-- 1009

Query: 205  YNSPPPPPY 231
            Y+  P   Y
Sbjct: 1010 YSPSPKTEY 1018

[56][TOP]
>UniRef100_Q9STM8 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STM8_ARATH
          Length = 513

 Score =  120 bits (300), Expect = 6e-26
 Identities = 73/165 (44%), Positives = 76/165 (46%), Gaps = 62/165 (37%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P      TP       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 308 PPPYVYSSPPPPYYSPTPK----VDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 363

Query: 148 KSPPPP---------------PYVYNSP---------------PPPPYVYNSP------- 216
            SPPPP               PYVYNSP               PPPPY+YNSP       
Sbjct: 364 SSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYIYNSPPPPYYSP 423

Query: 217 --------PPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
                   PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 424 SPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYKS-PPPPYVYSSPP 467

 Score =  117 bits (293), Expect = 4e-25
 Identities = 72/152 (47%), Positives = 76/152 (50%), Gaps = 49/152 (32%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP----FSP--------PPPPYVYPSPPPP------- 123
           PP    S SP  + K  P     SP    +SP        PPPPYVY SPPPP       
Sbjct: 242 PPPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPK 301

Query: 124 ----SPPPPYIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPY 231
               SPPPPY+Y SPPPP               PYVY+SPPPP     P V    PPPPY
Sbjct: 302 VDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 361

Query: 232 VYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           VY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 362 VYSSPPPPYYSPSPKVDYKS-PPPPYVYNSPP 392

 Score =  115 bits (288), Expect = 1e-24
 Identities = 61/115 (53%), Positives = 64/115 (55%), Gaps = 37/115 (32%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP-----------SPPPPYIYKSPPPP---------------PYVY 177
           +  PPPPYVY SPPPP           SPPPPY+Y SPPPP               PYVY
Sbjct: 130 YKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 189

Query: 178 NSPPPP-----PYVYNSPPPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           +SPPPP     P V    PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 190 SSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKS-PPPPYVYSSPP 243

 Score =  115 bits (288), Expect = 1e-24
 Identities = 73/171 (42%), Positives = 78/171 (45%), Gaps = 67/171 (39%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 332 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 385

Query: 139 YIYKSPPPP---------------PYVYNSPPPP---------------PYVYNSPPPPP 228
           Y+Y SPPPP               PY+YNSPPPP               PYVY+SPPPP 
Sbjct: 386 YVYNSPPPPYYSPSPKVDYKSPPPPYIYNSPPPPYYSPSPKVNYKTPPPPYVYSSPPPP- 444

Query: 229 YVYKSP--------PPPPYVYKSP---------------PPPPYVYKSPPS 312
             Y SP        PPPPYVY SP               PPPPYVY SPP+
Sbjct: 445 --YYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPNVDYKSPPPPYVYSSPPT 493

 Score =  112 bits (280), Expect = 1e-23
 Identities = 72/154 (46%), Positives = 74/154 (48%), Gaps = 51/154 (33%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPP-------------PPPYVYPSPPPP--SPPP 135
           PP S  S SP    K  P     S   PP             PPPYVY SPPPP  SP P
Sbjct: 67  PPPSYYSPSPKVDYKSPPPSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSP 126

Query: 136 PYIYKSPPPPPYVYNSP---------------PPPPYVYNSP---------------PPP 225
              YKSPPPP YVY+SP               PPPPYVY+SP               PPP
Sbjct: 127 KVNYKSPPPP-YVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP 185

Query: 226 PYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           PYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 186 PYVYSSPPPPYYSPTPKVDYKS-PPPPYVYSSPP 218

 Score =  111 bits (278), Expect = 2e-23
 Identities = 69/143 (48%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 158 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPP 211

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP     P V    PPPPY Y+SPPPP 
Sbjct: 212 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPY-YRSPPPPY 270

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 271 YSPSPKVDYKS-PPPPYVYSSPP 292

 Score =  111 bits (278), Expect = 2e-23
 Identities = 69/142 (48%), Positives = 71/142 (50%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP---------------- 123
           PP   V SSP       P     SP   +  PPPPYVY SPPPP                
Sbjct: 208 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPP 261

Query: 124 ---SPPPPYIYKSP------PPPPYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPPY 261
              SPPPPY   SP      PPPPYVY+SPPPP     P V    PPPPYVY SPPPP Y
Sbjct: 262 YYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYY 321

Query: 262 V------YKSPPPPPYVYKSPP 309
                  YKS PPPPYVY SPP
Sbjct: 322 SPTPKVDYKS-PPPPYVYSSPP 342

 Score =  104 bits (259), Expect = 3e-21
 Identities = 55/111 (49%), Positives = 60/111 (54%), Gaps = 37/111 (33%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP-----------SPPPPYIYKSPPPP---------------PYVY 177
           +  PPPPY+Y SPPPP           +PPPPY+Y SPPPP               PYVY
Sbjct: 404 YKSPPPPYIYNSPPPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVY 463

Query: 178 NSPPPP-----PYVYNSPPPPPYVYKSPPPPPY------VYKSPPPPPYVY 297
           +SPPPP     P V    PPPPYVY SPP P Y       YKS PPPPYVY
Sbjct: 464 SSPPPPYYSPSPNVDYKSPPPPYVYSSPPTPYYSPSSKVTYKS-PPPPYVY 513

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 57/120 (47%), Positives = 63/120 (52%), Gaps = 39/120 (32%)
 Frame = +1

Query: 67  VSPFSPPPPPYVYPSPPPPS---PPPPYIYKSPPPPPYVYNSPP---------------P 192
           +  ++P P P +Y S PPPS   P P   YKSPPP  YVY+SPP               P
Sbjct: 51  IPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPS-YVYSSPPPPYYSPSPKVDYKSLP 109

Query: 193 PPYVYNSP---------------PPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           PPYVY+SP               PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 110 PPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKS-PPPPYVYSSPP 168

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/109 (47%), Positives = 53/109 (48%), Gaps = 32/109 (29%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSP-----PPPYIYKSPPPPPYVYNSP------PPPPYVYNSPP-- 219
           SP  P Y  PS     P     P P IY S PPP Y   SP      PPP YVY+SPP  
Sbjct: 36  SPQTPHYNSPSHEHKIPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPSYVYSSPPPP 95

Query: 220 -------------PPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
                        PPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 96  YYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKS-PPPPYVYSSPP 143

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 40/93 (43%), Positives = 44/93 (47%), Gaps = 26/93 (27%)
 Frame = +1

Query: 109 SPPPPSPPPPYIYKSPPP----PPYVYNSPPPPPYVYNSPPPPPYVYK-SP------PPP 255
           S P  SP  P+ Y SP      P Y   +P P P +Y+S PPP Y Y  SP      PPP
Sbjct: 31  SYPYTSPQTPH-YNSPSHEHKIPKY---TPHPKPSIYSSSPPPSY-YSPSPKVDYKSPPP 85

Query: 256 PYVYKSPP---------------PPPYVYKSPP 309
            YVY SPP               PPPYVY SPP
Sbjct: 86  SYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPP 118

[57][TOP]
>UniRef100_Q9FH26 Genomic DNA, chromosome 5, TAC clone: K20J1 n=1 Tax=Arabidopsis
           thaliana RepID=Q9FH26_ARATH
          Length = 609

 Score =  118 bits (296), Expect = 2e-25
 Identities = 71/143 (49%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 373 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 426

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVYNSPPPP     P V    PPPPYVY SPPPP 
Sbjct: 427 YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 486

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 487 YSPSPKVDYKS-PPPPYVYSSPP 508

 Score =  116 bits (291), Expect = 7e-25
 Identities = 72/165 (43%), Positives = 76/165 (46%), Gaps = 62/165 (37%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P      TP       +  PPPPYVY SPPPP           SPPPPY+Y
Sbjct: 149 PPPYVYSSPPPPYYSPTPK----VDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 204

Query: 148 KSPPPP---------------PYVYNSP---------------PPPPYVYNSPPPP---- 225
            SPPPP               PYVY+SP               PPPPYVY+SPPPP    
Sbjct: 205 SSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 264

Query: 226 -----------PYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
                      PYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 265 SPKVDYKSPPLPYVYSSPPPPYYSPSPKVDYKS-PPPPYVYSSPP 308

 Score =  116 bits (291), Expect = 7e-25
 Identities = 70/143 (48%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 298 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 351

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 352 YVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 411

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 412 YSPSPKVDYKS-PPPPYVYSSPP 433

 Score =  116 bits (290), Expect = 9e-25
 Identities = 70/143 (48%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 423 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 476

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 477 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 536

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 537 YSPSPKVDYKS-PPPPYVYNSPP 558

 Score =  115 bits (288), Expect = 1e-24
 Identities = 61/115 (53%), Positives = 64/115 (55%), Gaps = 37/115 (32%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP-----------SPPPPYIYKSPPPP---------------PYVY 177
           +  PPPPYVY SPPPP           SPPPPY+Y SPPPP               PYVY
Sbjct: 470 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 529

Query: 178 NSPPPP-----PYVYNSPPPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           +SPPPP     P V    PPPPYVY SPPPP Y       YKSPPPP YVY SPP
Sbjct: 530 SSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP-YVYSSPP 583

 Score =  114 bits (286), Expect = 3e-24
 Identities = 67/119 (56%), Positives = 69/119 (57%), Gaps = 16/119 (13%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP--SPPPPYIYKSPPPP 165
           PP   V SSP       P     SP   +  PPPPYVY SPPPP  SP P   YKSPPPP
Sbjct: 273 PPLPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 326

Query: 166 PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
            YVY+SPPPP     P V    PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 327 -YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKS-PPPPYVYSSPP 383

 Score =  114 bits (285), Expect = 3e-24
 Identities = 69/144 (47%), Positives = 72/144 (50%), Gaps = 42/144 (29%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 473 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 526

Query: 139 YIYKSPPPP-----PYVYNSPPPPPYVYNSPPPPPYVYKSP--------PPPPYVYKSPP 279
           Y+Y SPPPP     P V    PPPPYVYNSPPPP   Y SP        PPPPYVY SPP
Sbjct: 527 YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPP---YYSPSPKVDYKSPPPPYVYSSPP 583

Query: 280 ---------------PPPYVYKSP 306
                          PPPYVYK+P
Sbjct: 584 PPYYSPSPKVTYKSLPPPYVYKAP 607

 Score =  113 bits (283), Expect = 6e-24
 Identities = 67/140 (47%), Positives = 70/140 (50%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP    SS P      TP       +  PPPPYVY SPPPP           SPP PY+Y
Sbjct: 224 PPPYVYSSPPPPYYSPTPK----VDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPLPYVY 279

Query: 148 KSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPPYV- 264
            SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP Y  
Sbjct: 280 SSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 339

Query: 265 -----YKSPPPPPYVYKSPP 309
                YKS PPPPYVY SPP
Sbjct: 340 SPKVDYKS-PPPPYVYSSPP 358

 Score =  112 bits (281), Expect = 1e-23
 Identities = 60/115 (52%), Positives = 63/115 (54%), Gaps = 37/115 (32%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP-----------SPPPPYIYKSPPPP-----PYVYNSPPPPPYVY 207
           +  PPPPYVY SPPPP           SPPPPY Y SPPPP     P +    PPPPYVY
Sbjct: 70  YKSPPPPYVYSSPPPPYYTPSPKVDYKSPPPPYEYSSPPPPYYSPSPKIDYKSPPPPYVY 129

Query: 208 NSP---------------PPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           +SP               PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 130 SSPPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKS-PPPPYVYSSPP 183

 Score =  112 bits (279), Expect = 2e-23
 Identities = 58/91 (63%), Positives = 60/91 (65%), Gaps = 13/91 (14%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYVYNSPPPP-----PYVYNSPPPPPYV 234
           +  PPPPYVY SPPPP  SP P   YKSPPPP YVY+SPPPP     P V    PPPPYV
Sbjct: 145 YKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYV 203

Query: 235 YKSPPPPPYV------YKSPPPPPYVYKSPP 309
           Y SPPPP Y       YKS PPPPYVY SPP
Sbjct: 204 YSSPPPPYYSPSPKVDYKS-PPPPYVYSSPP 233

 Score =  109 bits (272), Expect = 1e-22
 Identities = 64/134 (47%), Positives = 70/134 (52%), Gaps = 38/134 (28%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSP-FSPPPPPYVYPSPPPP-----------SPPPPYIYKSPPPP 165
           SSP +     PS    SP ++P   PY+Y SPPPP           SPPPPY+Y SPPPP
Sbjct: 26  SSPQTPQYNFPSHQHKSPKYTPHSKPYIYNSPPPPYYSPSPKVNYKSPPPPYVYSSPPPP 85

Query: 166 -----PYVYNSPPPPPYVYNSPPPPPYV------YKSPPPPPYVYKSP------------ 276
                P V    PPPPY Y+SPPPP Y       YKS PPPPYVY SP            
Sbjct: 86  YYTPSPKVDYKSPPPPYEYSSPPPPYYSPSPKIDYKS-PPPPYVYSSPPLPYYSPSPKVD 144

Query: 277 ---PPPPYVYKSPP 309
              PPPPYVY SPP
Sbjct: 145 YKSPPPPYVYSSPP 158

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/87 (47%), Positives = 42/87 (48%), Gaps = 30/87 (34%)
 Frame = +1

Query: 139 YIYKSPPPP-------------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSP 246
           Y Y SP  P                   PY+YNSPPPP     P V    PPPPYVY SP
Sbjct: 23  YPYSSPQTPQYNFPSHQHKSPKYTPHSKPYIYNSPPPPYYSPSPKVNYKSPPPPYVYSSP 82

Query: 247 PPPPYV------YKSPPPPPYVYKSPP 309
           PPP Y       YKS PPPPY Y SPP
Sbjct: 83  PPPYYTPSPKVDYKS-PPPPYEYSSPP 108

[58][TOP]
>UniRef100_Q9STM7 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STM7_ARATH
          Length = 707

 Score =  117 bits (292), Expect = 5e-25
 Identities = 71/143 (49%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 526 PPPPYVYSSP------PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 579

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           YIY SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 580 YIYSSPPPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 639

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 640 YSPSPKVNYKS-PPPPYVYSSPP 661

 Score =  116 bits (290), Expect = 9e-25
 Identities = 70/143 (48%), Positives = 73/143 (51%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 176 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPP 229

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 230 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPY 289

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 290 YSPSPKVDYKS-PPPPYVYSSPP 311

 Score =  115 bits (288), Expect = 1e-24
 Identities = 61/115 (53%), Positives = 64/115 (55%), Gaps = 37/115 (32%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP-----------SPPPPYIYKSPPPP---------------PYVY 177
           +  PPPPYVY SPPPP           SPPPPY+Y SPPPP               PYVY
Sbjct: 148 YKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 207

Query: 178 NSPPPP-----PYVYNSPPPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           +SPPPP     P V    PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 208 SSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKS-PPPPYVYSSPP 261

 Score =  115 bits (287), Expect = 2e-24
 Identities = 68/143 (47%), Positives = 72/143 (50%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY  PPPP           SPPPP
Sbjct: 476 PPPPYVYSSP------PPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSPSPKVDYKSPPPP 529

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP     P V    PPPPY+Y SPPPP 
Sbjct: 530 YVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYIYSSPPPPY 589

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY SPP
Sbjct: 590 YAPSPKVDYKS-PPPPYVYSSPP 611

 Score =  113 bits (283), Expect = 6e-24
 Identities = 68/144 (47%), Positives = 73/144 (50%), Gaps = 40/144 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPY+Y SPPPP           SPPPP
Sbjct: 551 PPPPYVYSSP------PPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSPPPP 604

Query: 139 YIYKSPPPP-----PYVYNSPPPPPYVYNSPPPPPYV------YKSPPPPPYVYKSPPPP 285
           Y+Y SPPPP     P V    PPPPYVY+SPPPP Y       YKSPPPP YVY SPPPP
Sbjct: 605 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPP-YVYSSPPPP 663

Query: 286 ---------------PYVYKSPPS 312
                           YVY SPP+
Sbjct: 664 YYSPSPKVDYKSSPPQYVYSSPPT 687

 Score =  112 bits (281), Expect = 1e-23
 Identities = 69/143 (48%), Positives = 71/143 (49%), Gaps = 40/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   V SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 251 PPPPYVYSSP------PPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPP 304

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY SPPPP     P V    PPPPYVY SPPPP 
Sbjct: 305 YVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 364

Query: 259 YV------YKSPPPPPYVYKSPP 309
           Y       YKS PPPPYVY S P
Sbjct: 365 YSPSPKVDYKS-PPPPYVYSSTP 386

 Score =  112 bits (280), Expect = 1e-23
 Identities = 72/154 (46%), Positives = 74/154 (48%), Gaps = 51/154 (33%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPP-------------PPPYVYPSPPPP--SPPP 135
           PP S  S SP    K  P     S   PP             PPPYVY SPPPP  SP P
Sbjct: 85  PPPSYYSPSPKVDYKSPPPSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSP 144

Query: 136 PYIYKSPPPPPYVYNSP---------------PPPPYVYNSP---------------PPP 225
              YKSPPPP YVY+SP               PPPPYVY+SP               PPP
Sbjct: 145 KVNYKSPPPP-YVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP 203

Query: 226 PYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           PYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 204 PYVYSSPPPPYYSPTPKVDYKS-PPPPYVYSSPP 236

 Score =  112 bits (280), Expect = 1e-23
 Identities = 70/175 (40%), Positives = 78/175 (44%), Gaps = 72/175 (41%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSP--------PPPPYVYPSPPPP-------- 123
           PP+ + S   N  +   P   G  P   +SP        PPPPYVY SPPPP        
Sbjct: 312 PPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 371

Query: 124 ---SPPPPYIYKSPPPP---------------PYVYNSP---------------PPPPYV 204
              SPPPPY+Y S PPP               PYVY+SP               PPPPY+
Sbjct: 372 DYKSPPPPYVYSSTPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYI 431

Query: 205 YNS---------------PPPPPYVYKSPPPP-----PYVYKSPPPPPYVYKSPP 309
           Y+S                PPPPYVY SPPPP     P V   PPPPPYVY SPP
Sbjct: 432 YSSTPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKPPPPPYVYSSPP 486

 Score =  111 bits (277), Expect = 3e-23
 Identities = 63/116 (54%), Positives = 67/116 (57%), Gaps = 13/116 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
           PP    SS+P      +P       +  PPPPYVY SPPPP  SP P   YK PPPPPYV
Sbjct: 427 PPPYIYSSTPLPYYSPSPK----VDYKSPPPPYVYSSPPPPYYSPSPKVDYK-PPPPPYV 481

Query: 175 YNSPPPP-----PYVYNSPPPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           Y+SPPPP     P V    PPPPYVY  PPPP Y       YKS PPPPYVY SPP
Sbjct: 482 YSSPPPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSPSPKVDYKS-PPPPYVYSSPP 536

 Score =  100 bits (250), Expect = 4e-20
 Identities = 63/139 (45%), Positives = 67/139 (48%), Gaps = 40/139 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP   + SSP       P     SP   +  PPPPYVY SPPPP           SPPPP
Sbjct: 576 PPPPYIYSSP------PPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 629

Query: 139 YIYKSPPPP---------------PYVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPP 258
           Y+Y SPPPP               PYVY+SPPPP     P V     PP YVY SPP P 
Sbjct: 630 YVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVDYKSSPPQYVYSSPPTPY 689

Query: 259 Y------VYKSPPPPPYVY 297
           Y       YKS PPPPYVY
Sbjct: 690 YSPSPKVTYKS-PPPPYVY 707

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 57/120 (47%), Positives = 63/120 (52%), Gaps = 39/120 (32%)
 Frame = +1

Query: 67  VSPFSPPPPPYVYPSPPPPS---PPPPYIYKSPPPPPYVYNSPP---------------P 192
           +  ++P P P +Y S PPPS   P P   YKSPPP  YVY+SPP               P
Sbjct: 69  IPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPS-YVYSSPPPPYYSPSPKVDYKSLP 127

Query: 193 PPYVYNSP---------------PPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           PPYVY+SP               PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 128 PPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKS-PPPPYVYSSPP 186

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/109 (47%), Positives = 53/109 (48%), Gaps = 32/109 (29%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSP-----PPPYIYKSPPPPPYVYNSP------PPPPYVYNSPP-- 219
           SP  P Y  PS     P     P P IY S PPP Y   SP      PPP YVY+SPP  
Sbjct: 54  SPQTPHYNSPSHEHKIPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPSYVYSSPPPP 113

Query: 220 -------------PPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
                        PPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 114 YYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKS-PPPPYVYSSPP 161

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 40/93 (43%), Positives = 44/93 (47%), Gaps = 26/93 (27%)
 Frame = +1

Query: 109 SPPPPSPPPPYIYKSPPP----PPYVYNSPPPPPYVYNSPPPPPYVYK-SP------PPP 255
           S P  SP  P+ Y SP      P Y   +P P P +Y+S PPP Y Y  SP      PPP
Sbjct: 49  SYPYTSPQTPH-YNSPSHEHKIPKY---TPHPKPSIYSSSPPPSY-YSPSPKVDYKSPPP 103

Query: 256 PYVYKSPP---------------PPPYVYKSPP 309
            YVY SPP               PPPYVY SPP
Sbjct: 104 SYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPP 136

[59][TOP]
>UniRef100_Q01944 Extensin (Class I) (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q01944_SOLLC
          Length = 75

 Score =  116 bits (291), Expect = 7e-25
 Identities = 53/82 (64%), Positives = 55/82 (67%), Gaps = 6/82 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSP------PPPPYVYK 240
           SP PPPY Y SPPPPSPPPPY YKSPPPP    +  PPPPY Y+SP      PPPPY Y 
Sbjct: 2   SPSPPPYYYKSPPPPSPPPPYYYKSPPPP----SPSPPPPYYYSSPPPPKPSPPPPYYYS 57

Query: 241 SPPPPPYVYKSPPPPPYVYKSP 306
           SPPPP    K  PPPPY Y SP
Sbjct: 58  SPPPP----KKSPPPPYYYSSP 75

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 44/70 (62%), Positives = 45/70 (64%), Gaps = 2/70 (2%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           P   PPPPY Y SPPP  PSPPPPY Y SPPPP       PPPPY Y+SPPPP    K  
Sbjct: 14  PPPSPPPPYYYKSPPPPSPSPPPPYYYSSPPPP----KPSPPPPYYYSSPPPP----KKS 65

Query: 247 PPPPYVYKSP 276
           PPPPY Y SP
Sbjct: 66  PPPPYYYSSP 75

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 33/53 (62%), Positives = 33/53 (62%)
 Frame = +1

Query: 151 SPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SP PPPY Y SPPPP       PPPPY YKSPPPP       PPPPY Y SPP
Sbjct: 2   SPSPPPYYYKSPPPPS------PPPPYYYKSPPPPSP--S--PPPPYYYSSPP 44

[60][TOP]
>UniRef100_B9IKD0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IKD0_POPTR
          Length = 190

 Score =  116 bits (291), Expect = 7e-25
 Identities = 57/93 (61%), Positives = 63/93 (67%), Gaps = 16/93 (17%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP------SPPPP-YIYKSPPPP-PYVYNSPPPPPYVYNSPPPPPYV 234
           SPPPPP+ Y SPPPP      SPPPP Y Y+SPPPP P  + SPPP P+++ SPPPPPY 
Sbjct: 51  SPPPPPHKYKSPPPPHHKCKYSPPPPVYTYRSPPPPTPMHHKSPPPSPHMFKSPPPPPYR 110

Query: 235 YKSPPPPP-------YVYKSPPPPP-YVYKSPP 309
           Y SPPPPP       Y Y SPPPPP Y Y SPP
Sbjct: 111 YISPPPPPPHPPCHAYKYLSPPPPPSYKYASPP 143

 Score =  108 bits (269), Expect = 2e-22
 Identities = 65/140 (46%), Positives = 70/140 (50%), Gaps = 37/140 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSST---KITPSGIGVSPFSPPPPPYVYPSPPPPSP-------PPPYIYK 150
           PPF     SP       K  P       +SPPPP Y Y SPPPP+P       P P+++K
Sbjct: 43  PPFHNKHKSPPPPPHKYKSPPPPHHKCKYSPPPPVYTYRSPPPPTPMHHKSPPPSPHMFK 102

Query: 151 SPPPPPYVYNSPPPPP-------YVYNSPPPPP-YVYKSPPPP-----------PY---V 264
           SPPPPPY Y SPPPPP       Y Y SPPPPP Y Y SPPPP           PY    
Sbjct: 103 SPPPPPYRYISPPPPPPHPPCHAYKYLSPPPPPSYKYASPPPPKHHHHHKHKWSPYPFIT 162

Query: 265 YKSPPP-----PPYVYKSPP 309
           Y SPPP     P Y Y SPP
Sbjct: 163 YMSPPPPHHNYPDYHYSSPP 182

 Score =  103 bits (257), Expect = 6e-21
 Identities = 51/99 (51%), Positives = 62/99 (62%), Gaps = 2/99 (2%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN-SPPPP 195
           SSS  + T  + +      +  PPPP+      PP  PPP+ YKSPPPP +    SPPPP
Sbjct: 19  SSSEATDTTFSRNSALWLTYKSPPPPFHNKHKSPP--PPPHKYKSPPPPHHKCKYSPPPP 76

Query: 196 PYVYNSPPPP-PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            Y Y SPPPP P  +KSPPP P+++KSPPPPPY Y SPP
Sbjct: 77  VYTYRSPPPPTPMHHKSPPPSPHMFKSPPPPPYRYISPP 115

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 44/84 (52%), Positives = 48/84 (57%), Gaps = 14/84 (16%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPP-----YIYKSPPPPPYVYNSPPPPPYVYNS----PPPPPY 231
           SPPPPPY Y SPPPP P PP     Y+   PPPP Y Y SPPPP + ++      P P  
Sbjct: 103 SPPPPPYRYISPPPPPPHPPCHAYKYLS-PPPPPSYKYASPPPPKHHHHHKHKWSPYPFI 161

Query: 232 VYKSPPP-----PPYVYKSPPPPP 288
            Y SPPP     P Y Y SPPPPP
Sbjct: 162 TYMSPPPPHHNYPDYHYSSPPPPP 185

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 36/86 (41%), Positives = 43/86 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP+  +S  P        +   +SP  PPPP Y Y SPPPP     + +K  P P   Y 
Sbjct: 107 PPYRYISPPPPPPHPPCHAYKYLSP--PPPPSYKYASPPPPKHHHHHKHKWSPYPFITYM 164

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPP 258
           SPPPP + Y     P Y Y SPPPPP
Sbjct: 165 SPPPPHHNY-----PDYHYSSPPPPP 185

[61][TOP]
>UniRef100_Q9LHS1 Genomic DNA, chromosome 5, TAC clone:K3D20 n=2 Tax=Arabidopsis
           thaliana RepID=Q9LHS1_ARATH
          Length = 334

 Score =  116 bits (290), Expect = 9e-25
 Identities = 69/164 (42%), Positives = 71/164 (43%), Gaps = 86/164 (52%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP-----------SPPPPYIYKSPPPP---------------PYVY 177
           +  PPPPYVY SPPPP           SPPPPY+Y SPPPP               PYVY
Sbjct: 101 YKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVY 160

Query: 178 NSP---------------PPPPYVYNSPP---------------PPPYVYKSP------- 246
           NSP               PPPPYVYNSPP               PPPYVY SP       
Sbjct: 161 NSPPPPYYSLSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYSP 220

Query: 247 --------PPPPYVYKSP---------------PPPPYVYKSPP 309
                   PPPPYVY SP               PPPPYVY SPP
Sbjct: 221 SPKVDYKSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPP 264

 Score =  113 bits (283), Expect = 6e-24
 Identities = 74/172 (43%), Positives = 76/172 (44%), Gaps = 69/172 (40%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYV-------YPSPPPP----SPPPPYIY 147
           PP    S SP    K  P       ++ PPPPY        Y SPPPP    SPPPPY  
Sbjct: 113 PPPPYYSPSPKVDYKSPPPPY---VYNSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYS 169

Query: 148 KSP------PPPPYVYNSPP---------------PPPYVYNSP---------------P 219
            SP      PPPPYVYNSPP               PPPYVYNSP               P
Sbjct: 170 LSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYSPSPKVDYKSP 229

Query: 220 PPPYVYKSP---------------PPPPYVYKSPPPPPYV-------YKSPP 309
           PPPYVY SP               PPPPYVY SPPPPPY        YKSPP
Sbjct: 230 PPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKSPP 281

 Score =  111 bits (277), Expect = 3e-23
 Identities = 61/106 (57%), Positives = 62/106 (58%), Gaps = 28/106 (26%)
 Frame = +1

Query: 76  FSPPPPPYV-------YPSPPPP----SPPPPYIYKSP------PPPPYVYNSPPPP--- 195
           F+ PPPPY        Y SPPPP    SPPPPY   SP      PPPPYVYNSPPPP   
Sbjct: 85  FNSPPPPYYSPSPKEDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYS 144

Query: 196 --PYVYNSPPPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
             P V    PPPPYVY SPPPP Y       YKS PPPPYVY SPP
Sbjct: 145 PSPKVEYKSPPPPYVYNSPPPPYYSLSPKVDYKS-PPPPYVYNSPP 189

 Score =  110 bits (275), Expect = 5e-23
 Identities = 67/140 (47%), Positives = 73/140 (52%), Gaps = 36/140 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPP-------------PPPYVYPSPPPP--SPPP 135
           PP    S SP    K +P     +  SPP             PPPYVY SPPPP  SP P
Sbjct: 188 PPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYSPSPKVDYKSPPPPYVYNSPPPPYFSPSP 247

Query: 136 PYIYKSPPPPPYVYNSPPPPPYV-------YNSPPPPPYV-------YKSPPPPPYVYKS 273
              YKSPPPP YVY+SPPPPPY        Y SPPPPPY        YKS PPP +VY  
Sbjct: 248 KVDYKSPPPP-YVYSSPPPPPYYSPSPEVSYKSPPPPPYYSPSLEVSYKS-PPPLFVYNF 305

Query: 274 PPPPPYV-------YKSPPS 312
           PPPPP+        YKSPP+
Sbjct: 306 PPPPPFYSPSPKVSYKSPPA 325

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 49/102 (48%), Positives = 52/102 (50%), Gaps = 10/102 (9%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYV-------YPSPPPP---SPPPPYIYK 150
           PP    S SP    K  P     S  SPPPPPY        Y SPPPP   SP     YK
Sbjct: 238 PPPPYFSPSPKVDYKSPPPPYVYS--SPPPPPYYSPSPEVSYKSPPPPPYYSPSLEVSYK 295

Query: 151 SPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSP 276
           S PPP +VYN PPPPP+     P P   YKS PP PYV K+P
Sbjct: 296 S-PPPLFVYNFPPPPPFY---SPSPKVSYKS-PPAPYVSKTP 332

[62][TOP]
>UniRef100_Q01942 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q01942_SOLLC
          Length = 132

 Score =  116 bits (290), Expect = 9e-25
 Identities = 60/111 (54%), Positives = 62/111 (55%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPP  PSPPPPY YKSP      PPPPY Y SP      PPPPY Y 
Sbjct: 2   PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 61

Query: 211 SP------PPPPYVYKSPP------------PPPYVYKSPPPPPYVYKSPP 309
           SP      PPPPY YKSPP            PPP  Y SPPPPP  Y++ P
Sbjct: 62  SPPPPDPSPPPPYYYKSPPPPSPSPPPPSPSPPPPTYSSPPPPPPFYENIP 112

 Score =  106 bits (265), Expect = 7e-22
 Identities = 52/84 (61%), Positives = 53/84 (63%), Gaps = 18/84 (21%)
 Frame = +1

Query: 112 PPPPSPPPPYIYKSP------PPPPYVYNSPPPPPYVYNSPPPPPYVYKSP------PPP 255
           PP PSPPPPY YKSP      PPPPY Y SPPPP    +  PPPPY YKSP      PPP
Sbjct: 1   PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP----SPSPPPPYYYKSPPPPSPSPPP 56

Query: 256 PYVYKSP------PPPPYVYKSPP 309
           PY YKSP      PPPPY YKSPP
Sbjct: 57  PYYYKSPPPPDPSPPPPYYYKSPP 80

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 57/111 (51%), Positives = 61/111 (54%), Gaps = 12/111 (10%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPP--SPPPPYIYKSPPPP 165
           PP     S P  S    P     SP  P   PPPPY Y SPPPP  SPPPPY YKSPPPP
Sbjct: 23  PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPP 82

Query: 166 ----PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYV---YKSPPPPPYVY 297
               P    SPPPP   Y+SPPPPP  Y++ P PP +   Y SPPPP   Y
Sbjct: 83  SPSPPPPSPSPPPP--TYSSPPPPPPFYENIPLPPVIGVSYASPPPPVIPY 131

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/115 (46%), Positives = 60/115 (52%), Gaps = 12/115 (10%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYV-------YPSPPP--PSPPPPYIYKS 153
           PP+   S  P S +   P       +  PPPP         Y SPPP  PSPPPPY YKS
Sbjct: 24  PPYYYKSPPPPSPSPPPPYY-----YKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKS 78

Query: 154 PPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYV---YKSPP 309
           PPPP     SP PPP    SP PPP  Y SPPPPP  Y++ P PP +   Y SPP
Sbjct: 79  PPPP-----SPSPPP---PSPSPPPPTYSSPPPPPPFYENIPLPPVIGVSYASPP 125

[63][TOP]
>UniRef100_B9NAX9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NAX9_POPTR
          Length = 312

 Score =  116 bits (290), Expect = 9e-25
 Identities = 70/139 (50%), Positives = 72/139 (51%), Gaps = 36/139 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVS----PFSPPPPPYVYPSPPPP--SPPPPYIYKSP-- 156
           PP     SSP    K  P     S    P   PPPPY Y SPPPP  SPPPPY Y SP  
Sbjct: 76  PPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPP 135

Query: 157 ----PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYK 270
               PPPPY Y+SP      PPPPY Y+SP      PPPPY Y SP      PPPPY Y 
Sbjct: 136 PKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYT 195

Query: 271 SP------PPPPYVYKSPP 309
           SP      PPPPY Y SPP
Sbjct: 196 SPPPPKKSPPPPYHYSSPP 214

 Score =  115 bits (289), Expect = 1e-24
 Identities = 70/139 (50%), Positives = 71/139 (51%), Gaps = 36/139 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVS----PFSPPPPPYVYPSPPPP--SPPPPYIYKSP-- 156
           PP     SSP    K  P     S    P   PPPPY Y SPPPP  SPPPPY Y SP  
Sbjct: 124 PPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPP 183

Query: 157 ----PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYK 270
               PPPPY Y SP      PPPPY Y+SP      PPPPY Y SP      PPPPY Y 
Sbjct: 184 PKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYS 243

Query: 271 SP------PPPPYVYKSPP 309
           SP      PPPPY Y SPP
Sbjct: 244 SPPPPKKSPPPPYHYSSPP 262

 Score =  115 bits (288), Expect = 1e-24
 Identities = 62/111 (55%), Positives = 64/111 (57%), Gaps = 32/111 (28%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYN 210
           P   PPPPY Y SPPPP  SPPPPY Y SP      PPPPY Y+SP      PPPPY Y+
Sbjct: 40  PSQSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYS 99

Query: 211 SP------PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           SP      PPPPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 100 SPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPP 150

 Score =  114 bits (284), Expect = 4e-24
 Identities = 63/125 (50%), Positives = 67/125 (53%), Gaps = 22/125 (17%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP--FSPPPPPYVYPSPPPP--SPPPPYIYKSP---- 156
           PP+   S  P   +   P      P     PPPPY Y SPPPP  SPPPPY Y SP    
Sbjct: 190 PPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPK 249

Query: 157 --PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSPPPPPYVYKSPPPPPYV 294
             PPPPY Y+SP      PPPPY Y+SP      PPPPY Y SPPPP    K  PPPPY 
Sbjct: 250 KSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPP----KKSPPPPYH 305

Query: 295 YKSPP 309
           Y SPP
Sbjct: 306 YTSPP 310

 Score =  106 bits (265), Expect = 7e-22
 Identities = 58/104 (55%), Positives = 59/104 (56%), Gaps = 32/104 (30%)
 Frame = +1

Query: 94  PYVYPSPPPP--SPPPPYIYKSP------PPPPYVYNSP------PPPPYVYNSP----- 216
           PY Y SPPPP  SPPPPY Y SP      PPPPY Y SP      PPPPY Y+SP     
Sbjct: 31  PYYYKSPPPPSQSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKK 90

Query: 217 -PPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
            PPPPY Y SP      PPPPY Y SP      PPPPY Y SPP
Sbjct: 91  SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPP 134

 Score =  105 bits (262), Expect = 2e-21
 Identities = 64/137 (46%), Positives = 68/137 (49%), Gaps = 34/137 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYP--SPPPP--SPPPPYIYKSP---- 156
           PP+   S  P   +   P      P     PP  Y   SPPPP  SPPPPY Y SP    
Sbjct: 62  PPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPK 121

Query: 157 --PPPPYVYNSP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKSP 276
             PPPPY Y+SP      PPPPY Y+SP      PPPPY Y SP      PPPPY Y SP
Sbjct: 122 KSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSP 181

Query: 277 ------PPPPYVYKSPP 309
                 PPPPY Y SPP
Sbjct: 182 PPPKKSPPPPYHYTSPP 198

 Score =  105 bits (261), Expect = 2e-21
 Identities = 62/127 (48%), Positives = 64/127 (50%), Gaps = 48/127 (37%)
 Frame = +1

Query: 73  PFSPPPPPYVYP-------SPPPP-----------SPPPPYIYKSP------PPPPYVYN 180
           P   PPPPY Y        SPPPP           SPPPPY Y SP      PPPPY Y+
Sbjct: 56  PKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYS 115

Query: 181 SP------PPPPYVYNSP------PPPPYVYKSP------PPPPYVYKSP------PPPP 288
           SP      PPPPY Y+SP      PPPPY Y SP      PPPPY Y SP      PPPP
Sbjct: 116 SPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPP 175

Query: 289 YVYKSPP 309
           Y Y SPP
Sbjct: 176 YHYSSPP 182

 Score =  104 bits (259), Expect = 3e-21
 Identities = 61/112 (54%), Positives = 63/112 (56%), Gaps = 17/112 (15%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPP--SPPPPYIYKSPPPP 165
           PP    SS P       P     SP  P   PPPPY Y SPPPP  SPPPPY Y SPPPP
Sbjct: 205 PPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPP 264

Query: 166 ------PYVYNSPPPP------PYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
                 PY Y+SPPPP      PY Y+SPPPP    KS PPPPY Y SPPPP
Sbjct: 265 KKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPK---KS-PPPPYHYTSPPPP 312

[64][TOP]
>UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0K5_ARATH
          Length = 760

 Score =  115 bits (289), Expect = 1e-24
 Identities = 61/120 (50%), Positives = 64/120 (53%), Gaps = 17/120 (14%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS--------------PPPP 138
           PP     SSP       P      P SPPPP Y Y SPPPP               PPPP
Sbjct: 554 PPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPP 613

Query: 139 YIYKSPPPPPYVYNSPPPPPYV--YNSPPPPPYVYKSPPPPPYVYKSPPPPPYV-YKSPP 309
              + PPPPP +  SPPPPP V  Y+SPPPPP  Y SPPPPP  Y SPPPPP V Y SPP
Sbjct: 614 PCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPP 673

 Score =  115 bits (289), Expect = 1e-24
 Identities = 60/111 (54%), Positives = 66/111 (59%), Gaps = 8/111 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYI-YKSPP 159
           PP + VSS P +           SP  PPPPP + P PPPP       PPPP + Y SPP
Sbjct: 593 PPPTPVSSPPPTPV--------YSP--PPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPP 642

Query: 160 PPPYVYNSPPPPPYVYNSPPPPPYV-YKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPP  Y+SPPPPP  Y+SPPPPP V Y SPPPP   Y SPPP P  Y SPP
Sbjct: 643 PPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPP 693

 Score =  109 bits (273), Expect = 8e-23
 Identities = 65/141 (46%), Positives = 72/141 (51%), Gaps = 38/141 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPP-PYVYPSPPPP-------------SP 129
           PP  + + +P   T+  P      P   FSPPPP PY Y SPPPP             SP
Sbjct: 522 PPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSP 581

Query: 130 PPP-YIYKSPPPPPY---------VYNSPPPPPYV----------YNSPPPPPYV-YKSP 246
           PPP Y Y SPPPPP          VY+ PPPPP +          Y+ PPPPP V Y SP
Sbjct: 582 PPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSP 641

Query: 247 PPPPYVYKSPPPPPYVYKSPP 309
           PPPP  Y SPPPPP  Y SPP
Sbjct: 642 PPPPVYYSSPPPPPVYYSSPP 662

 Score =  107 bits (268), Expect = 3e-22
 Identities = 58/108 (53%), Positives = 62/108 (57%), Gaps = 5/108 (4%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S  S  P +    TP  +  SP  P PPP VY SPPPP PPPP +Y  PPPPP    
Sbjct: 403 PPPSLPSPPPPAPIFSTPPTL-TSPPPPSPPPPVY-SPPPPPPPPPPVYSPPPPPP---- 456

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVY-----KSPPPPPYVYKSPP 309
            PPPPP VY+ PPPPP     PPPPP VY       PPPPP VY  PP
Sbjct: 457 -PPPPPPVYSPPPPPP----PPPPPPPVYSPPPPSPPPPPPPVYSPPP 499

 Score =  105 bits (261), Expect = 2e-21
 Identities = 58/124 (46%), Positives = 67/124 (54%), Gaps = 19/124 (15%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSG----IGVSPFSPPPPPYVY-PSPPPPSPPPPYIYKSPPPP 165
           PP + + S+P + T   P      +   P  PPPPP VY P PPPP PPPP +Y  PPPP
Sbjct: 411 PPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 470

Query: 166 PY------VYNSPPP-----PPYVYNSPPPPPYVYKSP---PPPPYVYKSPPPPPYVYKS 303
           P       VY+ PPP     PP VY+ PPPPP     P   PPPP VY SPPPPP    +
Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPT 530

Query: 304 PPSC 315
           P  C
Sbjct: 531 PVYC 534

 Score =  100 bits (248), Expect = 6e-20
 Identities = 52/91 (57%), Positives = 55/91 (60%), Gaps = 12/91 (13%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPP-------YVYNSPPPPPY 231
           P  PPPPP VY  PPPP PPPP    SPPPPP VY+SPPPPP       Y    PPPPP+
Sbjct: 485 PSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP-VYSSPPPPPSPAPTPVYCTRPPPPPPH 543

Query: 232 VYK----SPPPP-PYVYKSPPPPPYVYKSPP 309
                  SPPPP PY Y SPPPP   + SPP
Sbjct: 544 SPPPPQFSPPPPEPYYYSSPPPP---HSSPP 571

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 54/108 (50%), Positives = 61/108 (56%), Gaps = 9/108 (8%)
 Frame = +1

Query: 13  AVSSSPNSSTKITPSGIGVSPFSPPPPPYVY------PSPPPPSPPPPYIYK---SPPPP 165
           +VS  P   T + P  +     SPPPP  ++       SPPPPSPPPP +Y     PPPP
Sbjct: 391 SVSPRPPVVTPLPPPSLP----SPPPPAPIFSTPPTLTSPPPPSPPPP-VYSPPPPPPPP 445

Query: 166 PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P VY+ PPPPP     PPPPP VY  PPPPP     PPPPP VY  PP
Sbjct: 446 PPVYSPPPPPP-----PPPPPPVYSPPPPPP----PPPPPPPVYSPPP 484

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 48/88 (54%), Positives = 56/88 (63%), Gaps = 10/88 (11%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYV--YKSPP 249
           +S PPPP VY S PP  PPPP  Y SPPPP   Y+SPPP P  Y+SPPPPP     +SPP
Sbjct: 648 YSSPPPPPVYYSSPP--PPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPP 705

Query: 250 PPPYVYKSP--------PPPPYVYKSPP 309
           P P V+ SP        PPPP +++SPP
Sbjct: 706 PAPVVHHSPPPPMVHHSPPPPVIHQSPP 733

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 55/119 (46%), Positives = 63/119 (52%), Gaps = 16/119 (13%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP---PSPPPPYIYKSPPPPPY 171
           PP   V S P       P  +    +SPPPPP VY SPPP   P+P P Y  + PPPPP+
Sbjct: 489 PPPPPVYSPPPPPPPPPPPPV----YSPPPPP-VYSSPPPPPSPAPTPVYCTRPPPPPPH 543

Query: 172 -----VYNSPPPPPYVYNSPPPP--------PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
                 ++ PPP PY Y+SPPPP        P    SPPPP Y Y SPPPPP    SPP
Sbjct: 544 SPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPP 602

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 48/109 (44%), Positives = 57/109 (52%), Gaps = 12/109 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKI---TPSGIGVSPFSPPPPPYVYPSPPPP-------SPPPPYIYK 150
           PP     SSP     +   +P    V   SPPP P  Y SPPPP       SPPP  +  
Sbjct: 652 PPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVH 711

Query: 151 SPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPP--PYVYKSPPPPPY 291
             PPPP V++S PPPP ++ SPPPP   Y+ P PP     Y SPPPPP+
Sbjct: 712 HSPPPPMVHHS-PPPPVIHQSPPPPSPEYEGPLPPVIGVSYASPPPPPF 759

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 46/96 (47%), Positives = 54/96 (56%), Gaps = 20/96 (20%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP-----SPPP-PYIYKSPPPPP------------YVYNSPPPPPYVY 207
           PPPPP  Y SPPPP     SPPP P  Y SPPPPP             V++SPPPP  + 
Sbjct: 662 PPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPP--MV 719

Query: 208 NSPPPPPYVYKSPPPPPYVYKSPPPP--PYVYKSPP 309
           +  PPPP +++SPPPP   Y+ P PP     Y SPP
Sbjct: 720 HHSPPPPVIHQSPPPPSPEYEGPLPPVIGVSYASPP 755

[65][TOP]
>UniRef100_Q41983 Extensin precusor (Fragment) n=1 Tax=Arabidopsis thaliana
           RepID=Q41983_ARATH
          Length = 99

 Score =  115 bits (289), Expect = 1e-24
 Identities = 63/100 (63%), Positives = 69/100 (69%), Gaps = 10/100 (10%)
 Frame = +1

Query: 34  SSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPP--PPYVYNSPPP--PPY 201
           S + + P+ +  SP  PP P YVY SPPPP+  P Y+YKSPPP  P YVY SPPP  P Y
Sbjct: 3   SVSNLAPTYVYKSPX-PPTPTYVYKSPPPPT--PTYVYKSPPPPTPTYVYKSPPPPTPTY 59

Query: 202 VYNSPPP--PPYVYKSPPP--PPYVYKSPPP--PPYVYKS 303
           VY SPPP  P YVYKSPPP  P YVYKSPPP  P YVYKS
Sbjct: 60  VYKSPPPPTPKYVYKSPPPPTPTYVYKSPPPPTPKYVYKS 99

 Score =  110 bits (276), Expect = 4e-23
 Identities = 58/83 (69%), Positives = 60/83 (72%), Gaps = 10/83 (12%)
 Frame = +1

Query: 91  PPYVYPSPPPPSPPPPYIYKSPPPPP--YVYNSPPPPP--YVYNSPPPPP--YVYKSPPP 252
           P YVY SP PP+P   Y+YKSPPPP   YVY SPPPP   YVY SPPPP   YVYKSPPP
Sbjct: 9   PTYVYKSPXPPTPT--YVYKSPPPPTPTYVYKSPPPPTPTYVYKSPPPPTPTYVYKSPPP 66

Query: 253 PP--YVYKSPPPPP--YVYKSPP 309
           P   YVYKSPPPP   YVYKSPP
Sbjct: 67  PTPKYVYKSPPPPTPTYVYKSPP 89

[66][TOP]
>UniRef100_Q06446 Extensin n=1 Tax=Solanum tuberosum RepID=Q06446_SOLTU
          Length = 291

 Score =  115 bits (288), Expect = 1e-24
 Identities = 68/134 (50%), Positives = 73/134 (54%), Gaps = 31/134 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPPPYVYPSPPPP-----------SPPPPY 141
           PP + V  SP   T +  S    +P   SPPPP  VY SPPPP           SPPPP 
Sbjct: 153 PPHTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPVKPYHPAPVYKSPPPPT 212

Query: 142 -IYKSPPPPPY----VYNSPPPPPYVYNSPPPP---------PY----VYKSPPPPPYVY 267
            +YKSPP  PY    VY SPPPP  +Y SPPPP         PY    VYKSPPPP  VY
Sbjct: 213 PVYKSPPVKPYHPAPVYKSPPPPTPIYKSPPPPVKPYHPSPTPYHPKPVYKSPPPPTPVY 272

Query: 268 KSPPPPPYVYKSPP 309
           KSPPP  YVY SPP
Sbjct: 273 KSPPPTHYVYSSPP 286

 Score =  114 bits (284), Expect = 4e-24
 Identities = 67/125 (53%), Positives = 69/125 (55%), Gaps = 22/125 (17%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPP----PPYVYPSPPPP---SPPPPY------ 141
           PP     S P   T   P    V   SPPP    P Y +P PP P   SPPPP       
Sbjct: 96  PPTPVYKSPPPPKTPHYPPHTPVYK-SPPPHHHHPVYKFPPPPTPVYKSPPPPKDPHYPP 154

Query: 142 ---IYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPP--PY----VYKSPPPPPYV 294
              +YKSPPPP  VY SPPPP  VY SPPPP  VYKSPPPP  PY    VYKSPPPP  V
Sbjct: 155 HTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPVKPYHPAPVYKSPPPPTPV 214

Query: 295 YKSPP 309
           YKSPP
Sbjct: 215 YKSPP 219

 Score =  111 bits (277), Expect = 3e-23
 Identities = 59/101 (58%), Positives = 62/101 (61%), Gaps = 24/101 (23%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-------------SPPPPY---IYKSPPPPPYVYNSPPPP--PY- 201
           SPPPP  VY SPPPP             SPPP +   +YK PPPP  VY SPPPP  P+ 
Sbjct: 93  SPPPPTPVYKSPPPPKTPHYPPHTPVYKSPPPHHHHPVYKFPPPPTPVYKSPPPPKDPHY 152

Query: 202 -----VYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
                VY SPPPP  VYKSPPPP  VYKSPPPP  VYKSPP
Sbjct: 153 PPHTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPTPVYKSPP 193

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 62/127 (48%), Positives = 66/127 (51%), Gaps = 32/127 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPP--PY----VYPSPPPP----------- 123
           PP + V  SP   T +  S    +P   SPPPP  PY    VY SPPPP           
Sbjct: 163 PPPTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPVKPYHPAPVYKSPPPPTPVYKSPPVKP 222

Query: 124 --------SPPPPY-IYKSPPPPPYVYNSPPPPPY----VYNSPPPPPYVYKSPPPPPYV 264
                   SPPPP  IYKSPPPP   Y+ P P PY    VY SPPPP  VYKSPPP  YV
Sbjct: 223 YHPAPVYKSPPPPTPIYKSPPPPVKPYH-PSPTPYHPKPVYKSPPPPTPVYKSPPPTHYV 281

Query: 265 YKSPPPP 285
           Y SPPPP
Sbjct: 282 YSSPPPP 288

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 60/139 (43%), Positives = 67/139 (48%), Gaps = 36/139 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP----PPPY----IYKSP 156
           PP     S P+     +P      P    PPP   P  PP +P    PPP+    +YKSP
Sbjct: 35  PPVHVYPSPPHHPVYKSPPPHHHHPVYKSPPPSEKPHYPPHTPVYKSPPPHHHHPVYKSP 94

Query: 157 PPPPYVYNSPPPP--PY------------------VYNSPPPPPYVYKSPPPP--PY--- 261
           PPP  VY SPPPP  P+                  VY  PPPP  VYKSPPPP  P+   
Sbjct: 95  PPPTPVYKSPPPPKTPHYPPHTPVYKSPPPHHHHPVYKFPPPPTPVYKSPPPPKDPHYPP 154

Query: 262 ---VYKSPPPPPYVYKSPP 309
              VYKSPPPP  VYKSPP
Sbjct: 155 HTPVYKSPPPPTPVYKSPP 173

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 46/81 (56%), Positives = 51/81 (62%), Gaps = 4/81 (4%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPY--VYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           SPPPP +VYPSPP        +YKSPPP  +  VY SPPP    +  P  P  VYKSPPP
Sbjct: 32  SPPPPVHVYPSPPHHP-----VYKSPPPHHHHPVYKSPPPSEKPHYPPHTP--VYKSPPP 84

Query: 253 PPY--VYKSPPPPPYVYKSPP 309
             +  VYKSPPPP  VYKSPP
Sbjct: 85  HHHHPVYKSPPPPTPVYKSPP 105

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/62 (58%), Positives = 39/62 (62%), Gaps = 9/62 (14%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPP---------PPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPY 231
           SPPPP  +Y SPPPP  P         P  +YKSPPPP  VY SPPP  YVY+SPP PPY
Sbjct: 231 SPPPPTPIYKSPPPPVKPYHPSPTPYHPKPVYKSPPPPTPVYKSPPPTHYVYSSPP-PPY 289

Query: 232 VY 237
            Y
Sbjct: 290 HY 291

[67][TOP]
>UniRef100_Q9FS16 Extensin-3 n=1 Tax=Arabidopsis thaliana RepID=EXTN3_ARATH
          Length = 427

 Score =  110 bits (275), Expect(2) = 2e-24
 Identities = 59/93 (63%), Positives = 63/93 (67%), Gaps = 16/93 (17%)
 Frame = +1

Query: 79  SPPPPP--YVYPSPPPP----SPPPPYIYKSPPPPP--YVYNSPPPP------PYVYNSP 216
           SPPPP   YVY SPPPP    SPPP  +Y SPPPP   YVY SPPPP      P VY+SP
Sbjct: 332 SPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 389

Query: 217 PPPP--YVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPP   YVYKSPPPPP  + SPP  PY+YKSPP
Sbjct: 390 PPPKEKYVYKSPPPPPVHHYSPPHHPYLYKSPP 422

 Score = 25.4 bits (54), Expect(2) = 2e-24
 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 6/37 (16%)
 Frame = +2

Query: 2   HRSPPSHLHPTPPQK*H------PPALESLHSPHLLH 94
           H SPP   H  PP K H      PP ++    P + H
Sbjct: 267 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 303

 Score =  108 bits (269), Expect(2) = 1e-23
 Identities = 63/101 (62%), Positives = 65/101 (64%), Gaps = 24/101 (23%)
 Frame = +1

Query: 79  SPPPPP--YVYPSPPPP----SPPPPYIYKSPPPPP--YVYNSPPP------PPYVYNSP 216
           SPPPP   YVY SPPPP    SPPP  +Y SPPPP   YVY SPPP      PP VY+SP
Sbjct: 80  SPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 137

Query: 217 PPPP--YVYKSPPP------PPYVYKSPPPPP--YVYKSPP 309
           PPP   YVYKSPPP      PP VY SPPPP   YVYKSPP
Sbjct: 138 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 178

 Score =  108 bits (269), Expect(2) = 1e-23
 Identities = 63/101 (62%), Positives = 65/101 (64%), Gaps = 24/101 (23%)
 Frame = +1

Query: 79  SPPPPP--YVYPSPPPP----SPPPPYIYKSPPPPP--YVYNSPPP------PPYVYNSP 216
           SPPPP   YVY SPPPP    SPPP  +Y SPPPP   YVY SPPP      PP VY+SP
Sbjct: 108 SPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 165

Query: 217 PPPP--YVYKSPPP------PPYVYKSPPPPP--YVYKSPP 309
           PPP   YVYKSPPP      PP VY SPPPP   YVYKSPP
Sbjct: 166 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 206

 Score =  108 bits (269), Expect(2) = 1e-23
 Identities = 63/101 (62%), Positives = 65/101 (64%), Gaps = 24/101 (23%)
 Frame = +1

Query: 79  SPPPPP--YVYPSPPPP----SPPPPYIYKSPPPPP--YVYNSPPP------PPYVYNSP 216
           SPPPP   YVY SPPPP    SPPP  +Y SPPPP   YVY SPPP      PP VY+SP
Sbjct: 136 SPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 193

Query: 217 PPPP--YVYKSPPP------PPYVYKSPPPPP--YVYKSPP 309
           PPP   YVYKSPPP      PP VY SPPPP   YVYKSPP
Sbjct: 194 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 234

 Score =  108 bits (269), Expect(2) = 1e-23
 Identities = 63/101 (62%), Positives = 65/101 (64%), Gaps = 24/101 (23%)
 Frame = +1

Query: 79  SPPPPP--YVYPSPPPP----SPPPPYIYKSPPPPP--YVYNSPPP------PPYVYNSP 216
           SPPPP   YVY SPPPP    SPPP  +Y SPPPP   YVY SPPP      PP VY+SP
Sbjct: 164 SPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 221

Query: 217 PPPP--YVYKSPPP------PPYVYKSPPPPP--YVYKSPP 309
           PPP   YVYKSPPP      PP VY SPPPP   YVYKSPP
Sbjct: 222 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 262

 Score =  108 bits (269), Expect(2) = 1e-23
 Identities = 63/101 (62%), Positives = 65/101 (64%), Gaps = 24/101 (23%)
 Frame = +1

Query: 79  SPPPPP--YVYPSPPPP----SPPPPYIYKSPPPPP--YVYNSPPP------PPYVYNSP 216
           SPPPP   YVY SPPPP    SPPP  +Y SPPPP   YVY SPPP      PP VY+SP
Sbjct: 192 SPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 249

Query: 217 PPPP--YVYKSPPP------PPYVYKSPPPPP--YVYKSPP 309
           PPP   YVYKSPPP      PP VY SPPPP   YVYKSPP
Sbjct: 250 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 290

 Score =  108 bits (269), Expect(2) = 1e-23
 Identities = 63/101 (62%), Positives = 65/101 (64%), Gaps = 24/101 (23%)
 Frame = +1

Query: 79  SPPPPP--YVYPSPPPP----SPPPPYIYKSPPPPP--YVYNSPPP------PPYVYNSP 216
           SPPPP   YVY SPPPP    SPPP  +Y SPPPP   YVY SPPP      PP VY+SP
Sbjct: 220 SPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 277

Query: 217 PPPP--YVYKSPPP------PPYVYKSPPPPP--YVYKSPP 309
           PPP   YVYKSPPP      PP VY SPPPP   YVYKSPP
Sbjct: 278 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 318

 Score =  108 bits (269), Expect(2) = 1e-23
 Identities = 63/101 (62%), Positives = 65/101 (64%), Gaps = 24/101 (23%)
 Frame = +1

Query: 79  SPPPPP--YVYPSPPPP----SPPPPYIYKSPPPPP--YVYNSPPP------PPYVYNSP 216
           SPPPP   YVY SPPPP    SPPP  +Y SPPPP   YVY SPPP      PP VY+SP
Sbjct: 248 SPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 305

Query: 217 PPPP--YVYKSPPP------PPYVYKSPPPPP--YVYKSPP 309
           PPP   YVYKSPPP      PP VY SPPPP   YVYKSPP
Sbjct: 306 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 346

 Score =  108 bits (269), Expect(2) = 1e-23
 Identities = 63/101 (62%), Positives = 65/101 (64%), Gaps = 24/101 (23%)
 Frame = +1

Query: 79  SPPPPP--YVYPSPPPP----SPPPPYIYKSPPPPP--YVYNSPPP------PPYVYNSP 216
           SPPPP   YVY SPPPP    SPPP  +Y SPPPP   YVY SPPP      PP VY+SP
Sbjct: 276 SPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 333

Query: 217 PPPP--YVYKSPPP------PPYVYKSPPPPP--YVYKSPP 309
           PPP   YVYKSPPP      PP VY SPPPP   YVYKSPP
Sbjct: 334 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 374

 Score = 25.4 bits (54), Expect(2) = 1e-23
 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 6/37 (16%)
 Frame = +2

Query: 2   HRSPPSHLHPTPPQK*H------PPALESLHSPHLLH 94
           H SPP   H  PP K H      PP ++    P + H
Sbjct: 43  HYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPVYH 79

 Score = 25.4 bits (54), Expect(2) = 1e-23
 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 6/37 (16%)
 Frame = +2

Query: 2   HRSPPSHLHPTPPQK*H------PPALESLHSPHLLH 94
           H SPP   H  PP K H      PP ++    P + H
Sbjct: 71  HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 107

 Score = 25.4 bits (54), Expect(2) = 1e-23
 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 6/37 (16%)
 Frame = +2

Query: 2   HRSPPSHLHPTPPQK*H------PPALESLHSPHLLH 94
           H SPP   H  PP K H      PP ++    P + H
Sbjct: 99  HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 135

 Score = 25.4 bits (54), Expect(2) = 1e-23
 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 6/37 (16%)
 Frame = +2

Query: 2   HRSPPSHLHPTPPQK*H------PPALESLHSPHLLH 94
           H SPP   H  PP K H      PP ++    P + H
Sbjct: 127 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 163

 Score = 25.4 bits (54), Expect(2) = 1e-23
 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 6/37 (16%)
 Frame = +2

Query: 2   HRSPPSHLHPTPPQK*H------PPALESLHSPHLLH 94
           H SPP   H  PP K H      PP ++    P + H
Sbjct: 155 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 191

 Score = 25.4 bits (54), Expect(2) = 1e-23
 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 6/37 (16%)
 Frame = +2

Query: 2   HRSPPSHLHPTPPQK*H------PPALESLHSPHLLH 94
           H SPP   H  PP K H      PP ++    P + H
Sbjct: 183 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 219

 Score = 25.4 bits (54), Expect(2) = 1e-23
 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 6/37 (16%)
 Frame = +2

Query: 2   HRSPPSHLHPTPPQK*H------PPALESLHSPHLLH 94
           H SPP   H  PP K H      PP ++    P + H
Sbjct: 211 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 247

 Score = 25.4 bits (54), Expect(2) = 1e-23
 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 6/37 (16%)
 Frame = +2

Query: 2   HRSPPSHLHPTPPQK*H------PPALESLHSPHLLH 94
           H SPP   H  PP K H      PP ++    P + H
Sbjct: 239 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH 275

 Score =  108 bits (269), Expect = 2e-22
 Identities = 63/101 (62%), Positives = 65/101 (64%), Gaps = 24/101 (23%)
 Frame = +1

Query: 79  SPPPPP--YVYPSPPPP----SPPPPYIYKSPPPPP--YVYNSPPP------PPYVYNSP 216
           SPPPP   YVY SPPPP    SPPP  +Y SPPPP   YVY SPPP      PP VY+SP
Sbjct: 304 SPPPPKKHYVYKSPPPPVKHYSPPP--VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 361

Query: 217 PPPP--YVYKSPPP------PPYVYKSPPPP--PYVYKSPP 309
           PPP   YVYKSPPP      PP VY SPPPP   YVYKSPP
Sbjct: 362 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYKSPP 402

 Score =  107 bits (266), Expect = 5e-22
 Identities = 69/125 (55%), Positives = 71/125 (56%), Gaps = 28/125 (22%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSP----FSPPPPP--YVYPSPPPP----SPPPPYIYKSPPPPP 168
           SS P      TP     SP     SPPPP   Y Y SPPPP    SPPP  +Y SPPPP 
Sbjct: 28  SSPPPPVKHYTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPP--VYHSPPPPK 85

Query: 169 --YVYNSPPP------PPYVYNSPPPPP--YVYKSPPP------PPYVYKSPPPPP--YV 294
             YVY SPPP      PP VY+SPPPP   YVYKSPPP      PP VY SPPPP   YV
Sbjct: 86  KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 145

Query: 295 YKSPP 309
           YKSPP
Sbjct: 146 YKSPP 150

 Score =  104 bits (260), Expect = 3e-21
 Identities = 60/105 (57%), Positives = 64/105 (60%), Gaps = 27/105 (25%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP--PSPPPP---YIYKSPPP------PPYVYNSPPPPP--YVYNSP 216
           +  PPPP  + SPPP   SPPPP   Y+YKSPPP      PP VY+SPPPP   YVY SP
Sbjct: 146 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 205

Query: 217 PP------PPYVYKSPPPPP--YVYKSPPP------PPYVYKSPP 309
           PP      PP VY SPPPP   YVYKSPPP      PP VY SPP
Sbjct: 206 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 250

 Score =  104 bits (260), Expect = 3e-21
 Identities = 60/105 (57%), Positives = 64/105 (60%), Gaps = 27/105 (25%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP--PSPPPP---YIYKSPPP------PPYVYNSPPPPP--YVYNSP 216
           +  PPPP  + SPPP   SPPPP   Y+YKSPPP      PP VY+SPPPP   YVY SP
Sbjct: 258 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSP 317

Query: 217 PP------PPYVYKSPPPPP--YVYKSPPP------PPYVYKSPP 309
           PP      PP VY SPPPP   YVYKSPPP      PP VY SPP
Sbjct: 318 PPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 362

 Score = 99.8 bits (247), Expect = 8e-20
 Identities = 54/96 (56%), Positives = 59/96 (61%), Gaps = 18/96 (18%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPP--YVYNSPPP------PPYVYNSPPPPP- 228
           +S PPPP  + +PP     PP +Y SPPPP   Y Y SPPP      PP VY+SPPPP  
Sbjct: 27  YSSPPPPVKHYTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKK 86

Query: 229 -YVYKSPPP------PPYVYKSPPPPP--YVYKSPP 309
            YVYKSPPP      PP VY SPPPP   YVYKSPP
Sbjct: 87  HYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 122

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 55/109 (50%), Positives = 60/109 (55%), Gaps = 14/109 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPP-----PPYVYPSPPPP-------SPPPPYI 144
           PP    S  P   +   P    V    PPP     PP VY SPPPP       SPPPP  
Sbjct: 319 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVK 378

Query: 145 YKSPPPPPYVYNSPPPP--PYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
           + SPPP   VY+SPPPP   YVY SPPPPP  + SPP  PY+YKSPPPP
Sbjct: 379 HYSPPP---VYHSPPPPKEKYVYKSPPPPPVHHYSPPHHPYLYKSPPPP 424

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 38/70 (54%), Positives = 40/70 (57%), Gaps = 23/70 (32%)
 Frame = +1

Query: 169 YVYNSPPP-------------PPYVYNSPPPPP--YVYKSPPP------PPYVYKSPPPP 285
           Y Y+SPPP             PP VY+SPPPP   Y YKSPPP      PP VY SPPPP
Sbjct: 25  YFYSSPPPPVKHYTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPP 84

Query: 286 P--YVYKSPP 309
              YVYKSPP
Sbjct: 85  KKHYVYKSPP 94

[68][TOP]
>UniRef100_Q212G2 Peptidase C14, caspase catalytic subunit p20 n=1 Tax=Rhodopseudomonas
            palustris BisB18 RepID=Q212G2_RHOPB
          Length = 1026

 Score =  113 bits (282), Expect = 7e-24
 Identities = 50/101 (49%), Positives = 66/101 (65%), Gaps = 7/101 (6%)
 Frame = +1

Query: 28   PNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPP-------PPYIYKSPPPPPYVYNSP 186
            P ++   TP+   V P +P PPP V P+PPPP P        PP +  +PPPPP V  +P
Sbjct: 866  PAAAPPATPTPPAVRP-APAPPPVVRPAPPPPPPAARPAPAAPPVVRPAPPPPPVVRQAP 924

Query: 187  PPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPP V  +PPPPP V ++PPPPP V+++PPPPP V ++PP
Sbjct: 925  PPPPVVRQAPPPPPVVRQAPPPPPVVHQAPPPPPVVRQAPP 965

 Score =  103 bits (258), Expect = 4e-21
 Identities = 52/121 (42%), Positives = 67/121 (55%), Gaps = 18/121 (14%)
 Frame = +1

Query: 1    PPFSAVSSSPNSST----KITPSGIGVSPFSPPP--------PPYVYPSPPPPS------ 126
            PP +A  ++P           P  +  +P  PPP        PP V P+PPPP       
Sbjct: 865  PPAAAPPATPTPPAVRPAPAPPPVVRPAPPPPPPAARPAPAAPPVVRPAPPPPPVVRQAP 924

Query: 127  PPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
            PPPP + ++PPPPP V  +PPPPP V+ +PPPPP V ++PPPPP     PPPPP V  +P
Sbjct: 925  PPPPVVRQAPPPPPVVRQAPPPPPVVHQAPPPPPVVRQAPPPPP-----PPPPPVVRPAP 979

Query: 307  P 309
            P
Sbjct: 980  P 980

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 49/113 (43%), Positives = 62/113 (54%), Gaps = 10/113 (8%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------PPPPYIYKSPPP 162
            PP  A   +P +   + P+        PPPPP V  +PPPP       PPPP + ++PPP
Sbjct: 895  PPPPAARPAPAAPPVVRPA--------PPPPPVVRQAPPPPPVVRQAPPPPPVVRQAPPP 946

Query: 163  PPYVYNSPPPPPYVYNSPPPPPY----VYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PP V+ +PPPPP V  +PPPPP     V +  PPPP     PPPPP V + PP
Sbjct: 947  PPVVHQAPPPPPVVRQAPPPPPPPPPPVVRPAPPPP-----PPPPPPVMRPPP 994

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 44/109 (40%), Positives = 62/109 (56%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPP-----PYIYKSPPPP 165
            PP +   + P ++ +  P+    +P  PPPP    P+PPP + PP     P +  +P PP
Sbjct: 830  PPATVAPTPPPAAARPQPAA--PAPV-PPPPAAGRPTPPPAAAPPATPTPPAVRPAPAPP 886

Query: 166  PYVYNSPPPPPYVYN-SPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            P V  +PPPPP     +P  PP V  +PPPPP V ++PPPPP V ++PP
Sbjct: 887  PVVRPAPPPPPPAARPAPAAPPVVRPAPPPPPVVRQAPPPPPVVRQAPP 935

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 41/95 (43%), Positives = 48/95 (50%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP    +  P    +  P    V   +PPPPP V  +PPPP PPPP + +  PPPP    
Sbjct: 927  PPVVRQAPPPPPVVRQAPPPPPVVHQAPPPPPVVRQAPPPPPPPPPPVVRPAPPPP---- 982

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
             PPPPP V   PPPP      PPPP     +PPPP
Sbjct: 983  -PPPPPPVMRPPPPP------PPPPAAARPAPPPP 1010

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 49/180 (27%), Positives = 65/180 (36%), Gaps = 78/180 (43%)
 Frame = +1

Query: 4    PFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPS----------PPPPSPPP------ 135
            P S  + +P ++   TP G      +PPP P   P+          P PP+ PP      
Sbjct: 771  PPSPAAGAPTTAPAATPGGP-----TPPPAPNAKPASQALPGSNGQPLPPAAPPSPATPP 825

Query: 136  --------------------------------------------PYIYKSPP-------P 162
                                                        P    +PP       P
Sbjct: 826  SAAKPPATVAPTPPPAAARPQPAAPAPVPPPPAAGRPTPPPAAAPPATPTPPAVRPAPAP 885

Query: 163  PPYVYNSPPP-----------PPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PP V  +PPP           PP V  +PPPPP V ++PPPPP V ++PPPPP V ++PP
Sbjct: 886  PPVVRPAPPPPPPAARPAPAAPPVVRPAPPPPPVVRQAPPPPPVVRQAPPPPPVVRQAPP 945

[69][TOP]
>UniRef100_Q40502 Extensin n=1 Tax=Nicotiana tabacum RepID=Q40502_TOBAC
          Length = 280

 Score =  112 bits (281), Expect = 1e-23
 Identities = 68/125 (54%), Positives = 74/125 (59%), Gaps = 22/125 (17%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPPPYVYPSPPPPSPP--PPY--IYKSPPP 162
           PP + +  SP    K  P     +P   SPPPP  VY SPPPP  P  PP+  +YKSPPP
Sbjct: 142 PPHTPIYKSPPPPNK--PYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPP 199

Query: 163 P--PY------VYNSPPPPPYVYNSPPP------PPY--VYKSPPPPPYVYKSPPPPPYV 294
           P  PY      VY SPPPP  VY SPPP      PP+  VYKSPPPP  VYKSPPPP  V
Sbjct: 200 PKKPYYPPHTPVYKSPPPPTPVYKSPPPSKKPYYPPHTPVYKSPPPPTPVYKSPPPPTPV 259

Query: 295 YKSPP 309
           YKSPP
Sbjct: 260 YKSPP 264

 Score =  110 bits (276), Expect = 4e-23
 Identities = 72/133 (54%), Positives = 76/133 (57%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPPPYVYPSPPPPSPP--PPY--IYKSPPP 162
           PP   V  SP    K  P  +  +P   SPPPP  VY SPPPP  P  PP+  IYKSPPP
Sbjct: 96  PPHPPVYKSPPPPKK--PYSLPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPIYKSPPP 153

Query: 163 P--PY------VYNSPPPPPYVYNSPPPP------PY--VYKSPPPP--PY------VYK 270
           P  PY      VY SPPPP  VY SPPPP      P+  VYKSPPPP  PY      VYK
Sbjct: 154 PNKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYK 213

Query: 271 SPPPPPYVYKSPP 309
           SPPPP  VYKSPP
Sbjct: 214 SPPPPTPVYKSPP 226

 Score =  110 bits (276), Expect = 4e-23
 Identities = 65/118 (55%), Positives = 71/118 (60%), Gaps = 15/118 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPY--VYPSPPPPSPP--PPY--IYKSPPP 162
           PP + V  SP   T +  S     P  P  PP+  VY SPPPP  P  PP+  +YKSPPP
Sbjct: 160 PPHTPVYKSPPPPTPVYKSP--PPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPP 217

Query: 163 PPYVYNSPPP------PPY--VYNSPPPPPYVYKSPPPPPYVYKSPPP-PPYVYKSPP 309
           P  VY SPPP      PP+  VY SPPPP  VYKSPPPP  VYKSPPP  PYVY SPP
Sbjct: 218 PTPVYKSPPPSKKPYYPPHTPVYKSPPPPTPVYKSPPPPTPVYKSPPPHHPYVYASPP 275

 Score =  107 bits (268), Expect = 3e-22
 Identities = 68/135 (50%), Positives = 72/135 (53%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPY----VYPSPPPPS----PPPPYIYKSP 156
           PP   V  SP    K         P+ P P PY    VY SPPPP     PP P +YKSP
Sbjct: 55  PPHHPVYKSPPPPKK---------PYHPSPTPYHPVPVYKSPPPPKKPYYPPHPPVYKSP 105

Query: 157 PPP--PY------VYNSPPPPPYVYNSPPPP--PY------VYKSPPPP--PY------V 264
           PPP  PY      VY SPPPP  VY SPPPP  P+      +YKSPPPP  PY      V
Sbjct: 106 PPPKKPYSLPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPIYKSPPPPNKPYYPPHTPV 165

Query: 265 YKSPPPPPYVYKSPP 309
           YKSPPPP  VYKSPP
Sbjct: 166 YKSPPPPTPVYKSPP 180

 Score =  102 bits (254), Expect = 1e-20
 Identities = 60/104 (57%), Positives = 63/104 (60%), Gaps = 27/104 (25%)
 Frame = +1

Query: 79  SPPPP--PYVYPSPPPP-----SPPPPYIYKSPPPPPYVYNSPPPPPY----VYNSPPPP 225
           SPPPP  PY+Y SPPPP     SPP   +YKSPPPP   Y+ P P PY    VY SPPPP
Sbjct: 32  SPPPPKKPYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYH-PSPTPYHPVPVYKSPPPP 90

Query: 226 --------PYVYKSPPPP--PY------VYKSPPPPPYVYKSPP 309
                   P VYKSPPPP  PY      VYKSPPPP  VYKSPP
Sbjct: 91  KKPYYPPHPPVYKSPPPPKKPYSLPHTPVYKSPPPPTPVYKSPP 134

 Score =  100 bits (250), Expect = 4e-20
 Identities = 64/127 (50%), Positives = 68/127 (53%), Gaps = 50/127 (39%)
 Frame = +1

Query: 79  SPPPPPYVYPSPP-------PPSPPPPY-----------IYKSPPPP--------PYVYN 180
           SPPPP +VYPSPP       PP P  PY           +YKSPPPP        P VY 
Sbjct: 44  SPPPPVHVYPSPPHHPVYKSPPPPKKPYHPSPTPYHPVPVYKSPPPPKKPYYPPHPPVYK 103

Query: 181 SPPPP--PY------VYNSPPPPPYVYKSPPPP--PY------VYKSPPPP--PY----- 291
           SPPPP  PY      VY SPPPP  VYKSPPPP  P+      +YKSPPPP  PY     
Sbjct: 104 SPPPPKKPYSLPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPIYKSPPPPNKPYYPPHT 163

Query: 292 -VYKSPP 309
            VYKSPP
Sbjct: 164 PVYKSPP 170

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 51/92 (55%), Positives = 55/92 (59%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPPPYVYPSPPPPSPP--PPY--IYKSPPP 162
           PP + V  SP    K  P     +P   SPPPP  VY SPPP   P  PP+  +YKSPPP
Sbjct: 188 PPHTPVYKSPPPPKK--PYYPPHTPVYKSPPPPTPVYKSPPPSKKPYYPPHTPVYKSPPP 245

Query: 163 PPYVYNSPPPPPYVYNSPPP-PPYVYKSPPPP 255
           P  VY SPPPP  VY SPPP  PYVY SPPPP
Sbjct: 246 PTPVYKSPPPPTPVYKSPPPHHPYVYASPPPP 277

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 46/80 (57%), Positives = 48/80 (60%), Gaps = 23/80 (28%)
 Frame = +1

Query: 139 YIYKSPPPP--PYVYNSPPPPPYVYNSPPPPPYVYKSPPPP--PY-----------VYKS 273
           Y Y SPPPP  PY+Y SPPPP +VY SPP  P VYKSPPPP  PY           VYKS
Sbjct: 28  YQYSSPPPPKKPYLYKSPPPPVHVYPSPPHHP-VYKSPPPPKKPYHPSPTPYHPVPVYKS 86

Query: 274 PPPP--------PYVYKSPP 309
           PPPP        P VYKSPP
Sbjct: 87  PPPPKKPYYPPHPPVYKSPP 106

[70][TOP]
>UniRef100_Q06802 Extensin n=1 Tax=Nicotiana tabacum RepID=Q06802_TOBAC
          Length = 318

 Score =  112 bits (281), Expect = 1e-23
 Identities = 70/130 (53%), Positives = 74/130 (56%), Gaps = 27/130 (20%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPPPYVYPSPPPPSPP--PPY--IYKSPPP 162
           PP + V  SP    K  P     +P   SPPPP  VY SPPPP  P  PP+  +YKSPPP
Sbjct: 175 PPHTPVYKSPPPPKK--PYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPP 232

Query: 163 PPYVYNSPPPP--PY------VYNSPPPPPYVYKSPPPP--PY-----------VYKSPP 279
           P  VY SPPPP  PY      VY SPPPP  VYKSPPPP  PY           VYKSPP
Sbjct: 233 PTPVYKSPPPPKKPYYPPYTPVYKSPPPPTPVYKSPPPPKKPYYPSPTPYHPAPVYKSPP 292

Query: 280 PPPYVYKSPP 309
           PP  VYKSPP
Sbjct: 293 PPTPVYKSPP 302

 Score =  107 bits (268), Expect(2) = 1e-23
 Identities = 63/105 (60%), Positives = 66/105 (62%), Gaps = 28/105 (26%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPP--PPY--IYKSPPPP--PY------VYNSPPPPPYVYNSPPP 222
           SPPPP  VY SPPPP  P  PP+  +YKSPPPP  PY      VY SPPPP  VY SPPP
Sbjct: 81  SPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPP 140

Query: 223 P--PY------VYKSPPPPPYVYKSPPP------PPY--VYKSPP 309
           P  PY      VYKSPPPP  VYKSPPP      PP+  VYKSPP
Sbjct: 141 PKKPYYPPHTPVYKSPPPPTPVYKSPPPHKKPYYPPHTPVYKSPP 185

 Score = 25.8 bits (55), Expect(2) = 1e-23
 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 4/29 (13%)
 Frame = +2

Query: 11  PPSHLHPTPPQ----K*HPPALESLHSPH 85
           PP H++P+PP     K  PP  +  + PH
Sbjct: 47  PPVHVYPSPPHHPVYKSPPPPKKPYYPPH 75

 Score =  112 bits (280), Expect = 1e-23
 Identities = 68/124 (54%), Positives = 73/124 (58%), Gaps = 21/124 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIG-VSPFSPPPPPYVYPSPPPPSPP--PPY--IYKSPPPP 165
           PP + V  SP   T +  S      P+ PP  P VY SPPPP  P  PP+  +YKSPPPP
Sbjct: 147 PPHTPVYKSPPPPTPVYKSPPPHKKPYYPPHTP-VYKSPPPPKKPYYPPHTPVYKSPPPP 205

Query: 166 PYVYNSPPPP--PY------VYNSPPPPPYVYKSPPPP--PY------VYKSPPPPPYVY 297
             VY SPPPP  PY      VY SPPPP  VYKSPPPP  PY      VYKSPPPP  VY
Sbjct: 206 TPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPYTPVYKSPPPPTPVY 265

Query: 298 KSPP 309
           KSPP
Sbjct: 266 KSPP 269

 Score =  111 bits (277), Expect = 3e-23
 Identities = 66/113 (58%), Positives = 67/113 (59%), Gaps = 9/113 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPP--PPY--IYKSPPPPP 168
           PP     S P       P    V   SPPPP  VY SPPPP  P  PPY  +YKSPPPP 
Sbjct: 204 PPTPVYKSPPPPKKPYYPPHTPVYK-SPPPPTPVYKSPPPPKKPYYPPYTPVYKSPPPPT 262

Query: 169 YVYNSPPPP--PYVYNSPPP--PPYVYKSPPPPPYVYKSPPPP-PYVYKSPPS 312
            VY SPPPP  PY Y SP P  P  VYKSPPPP  VYKSPPP  PYVY SPPS
Sbjct: 263 PVYKSPPPPKKPY-YPSPTPYHPAPVYKSPPPPTPVYKSPPPHHPYVYASPPS 314

 Score =  109 bits (272), Expect = 1e-22
 Identities = 65/114 (57%), Positives = 67/114 (58%), Gaps = 37/114 (32%)
 Frame = +1

Query: 79  SPPPPPYVYPSPP-------PPSPPPPY------IYKSPPPPPYVYNSPPPP--PY---- 201
           SPPPP +VYPSPP       PP P  PY      +YKSPPPP  VY SPPPP  PY    
Sbjct: 44  SPPPPVHVYPSPPHHPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPH 103

Query: 202 --VYNSPPPP--PY------VYKSPPPPPYVYKSPPPP--PY------VYKSPP 309
             VY SPPPP  PY      VYKSPPPP  VYKSPPPP  PY      VYKSPP
Sbjct: 104 TPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPP 157

 Score =  108 bits (269), Expect = 2e-22
 Identities = 71/133 (53%), Positives = 76/133 (57%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPPPYVYPSPPPPSPP--PPY--IYKSPPP 162
           PP + V  SP    K  P     +P   SPPPP  VY SPPPP  P  PP+  +YKSPPP
Sbjct: 101 PPHTPVYKSPPPPKK--PYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPP 158

Query: 163 PPYVYNSPPP------PPY--VYNSPPPP--PY------VYKSPPPPPYVYKSPPPP--P 288
           P  VY SPPP      PP+  VY SPPPP  PY      VYKSPPPP  VYKSPPPP  P
Sbjct: 159 PTPVYKSPPPHKKPYYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKP 218

Query: 289 Y------VYKSPP 309
           Y      VYKSPP
Sbjct: 219 YYPPHTPVYKSPP 231

 Score =  107 bits (268), Expect = 3e-22
 Identities = 64/110 (58%), Positives = 67/110 (60%), Gaps = 32/110 (29%)
 Frame = +1

Query: 76  FSPPPPP---YVYPSPPPP-----SPPPPYIYKSPPPP--PY------VYNSPPPPPYVY 207
           +S PPPP   Y+Y SPPPP     SPP   +YKSPPPP  PY      VY SPPPP  VY
Sbjct: 30  YSSPPPPKKSYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVY 89

Query: 208 NSPPPP--PY------VYKSPPPP--PY------VYKSPPPPPYVYKSPP 309
            SPPPP  PY      VYKSPPPP  PY      VYKSPPPP  VYKSPP
Sbjct: 90  KSPPPPKKPYYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPP 139

 Score =  105 bits (261), Expect = 2e-21
 Identities = 71/142 (50%), Positives = 76/142 (53%), Gaps = 39/142 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVS-PFSPPPPPYVYPSPPPP-------------SPPPP 138
           PP + V  SP   T +  S      P+ PP  P VY SPPPP             SPPPP
Sbjct: 73  PPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTP-VYKSPPPPKKPYYPPHTPVYKSPPPP 131

Query: 139 Y-IYKSPPPP--PY------VYNSPPPPPYVYNSPPP------PPY--VYKSPPPP--PY 261
             +YKSPPPP  PY      VY SPPPP  VY SPPP      PP+  VYKSPPPP  PY
Sbjct: 132 TPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPHKKPYYPPHTPVYKSPPPPKKPY 191

Query: 262 ------VYKSPPPPPYVYKSPP 309
                 VYKSPPPP  VYKSPP
Sbjct: 192 YPPHTPVYKSPPPPTPVYKSPP 213

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 56/99 (56%), Positives = 60/99 (60%), Gaps = 16/99 (16%)
 Frame = +1

Query: 61  IGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPP--PY- 231
           + +S  S     Y Y SPPPP     Y+YKSPPPP +VY SPP  P VY SPPPP  PY 
Sbjct: 16  VSLSLASESSANYQYSSPPPPKKS--YLYKSPPPPVHVYPSPPHHP-VYKSPPPPKKPYY 72

Query: 232 -----VYKSPPPPPYVYKSPPPP--PY------VYKSPP 309
                VYKSPPPP  VYKSPPPP  PY      VYKSPP
Sbjct: 73  PPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPP 111

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 43/88 (48%), Positives = 43/88 (48%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPP--PPYV 174
           PP     S P       P    V    PPP P  Y SPPPP  P    Y SP P  P  V
Sbjct: 232 PPTPVYKSPPPPKKPYYPPYTPVYKSPPPPTPV-YKSPPPPKKP---YYPSPTPYHPAPV 287

Query: 175 YNSPPPPPYVYNSPPP-PPYVYKSPPPP 255
           Y SPPPP  VY SPPP  PYVY SPP P
Sbjct: 288 YKSPPPPTPVYKSPPPHHPYVYASPPSP 315

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 43/95 (45%), Positives = 47/95 (49%), Gaps = 20/95 (21%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKI-----TPSGIGVSPF-----SPPPPPYVYPSPPPPSPP------ 132
           PP + V  SP   T +      P      P+     SPPPP  VY SPPPP  P      
Sbjct: 221 PPHTPVYKSPPPPTPVYKSPPPPKKPYYPPYTPVYKSPPPPTPVYKSPPPPKKPYYPSPT 280

Query: 133 ---PPYIYKSPPPPPYVYNSPPP-PPYVYNSPPPP 225
              P  +YKSPPPP  VY SPPP  PYVY SPP P
Sbjct: 281 PYHPAPVYKSPPPPTPVYKSPPPHHPYVYASPPSP 315

[71][TOP]
>UniRef100_Q40768 Extensin n=1 Tax=Prunus dulcis RepID=Q40768_PRUDU
          Length = 278

 Score =  112 bits (280), Expect = 1e-23
 Identities = 66/128 (51%), Positives = 67/128 (52%), Gaps = 49/128 (38%)
 Frame = +1

Query: 73  PFSPPPPP----YVYPSPPPPSPPP---------PYIYKSPPPP--------PYVYNSPP 189
           P+S PPPP    Y Y SPPPPSP P         PY YKSPPPP        PY Y SPP
Sbjct: 34  PYSSPPPPVSPPYHYKSPPPPSPTPPVHYSPPKHPYHYKSPPPPVHYSPPKHPYHYKSPP 93

Query: 190 PP-------PYVYNSPPPP-------PYVYKSPPPP-------PYVYKSPPPP------- 285
           PP       PY Y SPPPP       PY YKSPPPP       PY YKSPPPP       
Sbjct: 94  PPVYSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKH 153

Query: 286 PYVYKSPP 309
           PY YKSPP
Sbjct: 154 PYHYKSPP 161

 Score =  112 bits (279), Expect = 2e-23
 Identities = 73/150 (48%), Positives = 75/150 (50%), Gaps = 47/150 (31%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF---SPPPP--------PYVYPSPPPP--SPPP-P 138
           PP+   S  P S T          P+   SPPPP        PY Y SPPPP  SPP  P
Sbjct: 44  PPYHYKSPPPPSPTPPVHYSPPKHPYHYKSPPPPVHYSPPKHPYHYKSPPPPVYSPPKHP 103

Query: 139 YIYKSPPPP-------PYVYNSPPPP-------PYVYNSPPPP-------PYVYKSPPPP 255
           Y YKSPPPP       PY Y SPPPP       PY Y SPPPP       PY YKSPPPP
Sbjct: 104 YHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPP 163

Query: 256 -------PYVYKSPPPP-----PYVYKSPP 309
                  PY YKSPPPP     PY YKSPP
Sbjct: 164 SPSPPKHPYHYKSPPPPSPPKKPYHYKSPP 193

 Score =  108 bits (270), Expect = 2e-22
 Identities = 64/117 (54%), Positives = 64/117 (54%), Gaps = 40/117 (34%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPS-PPP--PYIYKSPPPP-------PYVYNSPPPP-------PYVY 207
           SPP  PY Y SPPPPS  PP  PY YKSPPPP       PY Y SPPPP       PY Y
Sbjct: 115 SPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHY 174

Query: 208 NSPPPP-----PYVYKSPPPP-------------PYVYKSPPPP-----PYVYKSPP 309
            SPPPP     PY YKSPPPP             PY YKSPPPP     PY YKSPP
Sbjct: 175 KSPPPPSPPKKPYHYKSPPPPPSPTPPVYSPPKHPYHYKSPPPPSPPKKPYHYKSPP 231

 Score =  106 bits (265), Expect = 7e-22
 Identities = 61/109 (55%), Positives = 61/109 (55%), Gaps = 33/109 (30%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPS-PPP--PYIYKSPPPP-------PYVYNSPPPP-----PYVYNS 213
           SPP  PY Y SPPPPS  PP  PY YKSPPPP       PY Y SPPPP     PY Y S
Sbjct: 132 SPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPPKKPYHYKS 191

Query: 214 PPPP-------------PYVYKSPPPP-----PYVYKSPPPPPYVYKSP 306
           PPPP             PY YKSPPPP     PY YKSPPPP  VYK P
Sbjct: 192 PPPPPSPTPPVYSPPKHPYHYKSPPPPSPPKKPYHYKSPPPPTPVYKPP 240

 Score =  105 bits (263), Expect = 1e-21
 Identities = 62/125 (49%), Positives = 63/125 (50%), Gaps = 48/125 (38%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPP---YIYKSPPPP-----PYVYNSPPPPP------------ 198
           SPP  PY Y SPPPPSP PP   Y YKSPPPP     PY Y SPPPPP            
Sbjct: 149 SPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPPKKPYHYKSPPPPPSPTPPVYSPPKH 208

Query: 199 -YVYNSPPPP-----PYVYKSPPPPPYVYK----SPPPPP------------------YV 294
            Y Y SPPPP     PY YKSPPPP  VYK    SPPPPP                  Y+
Sbjct: 209 PYHYKSPPPPSPPKKPYHYKSPPPPTPVYKPPVYSPPPPPKKPYKPPTPPVHTAPPHPYI 268

Query: 295 YKSPP 309
           Y SPP
Sbjct: 269 YSSPP 273

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 50/81 (61%), Positives = 52/81 (64%), Gaps = 10/81 (12%)
 Frame = +1

Query: 97  YVYPSPPPPSPPPPYIYKSPPPP---PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVY 267
           Y Y SPPPP  PP Y YKSPPPP   P V+ SPP  PY Y SPPPP  V+ SPP  PY Y
Sbjct: 33  YPYSSPPPPVSPP-YHYKSPPPPSPTPPVHYSPPKHPYHYKSPPPP--VHYSPPKHPYHY 89

Query: 268 KSPPPP-------PYVYKSPP 309
           KSPPPP       PY YKSPP
Sbjct: 90  KSPPPPVYSPPKHPYHYKSPP 110

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 45/75 (60%), Positives = 48/75 (64%), Gaps = 5/75 (6%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPP-PYIYKSPPPPPYVYN----SPPPPPYVYNSPPPPPYVYK 240
           +SPP  PY Y SPPPPSPP  PY YKSPPPP  VY     SPPPPP     PP PP    
Sbjct: 203 YSPPKHPYHYKSPPPPSPPKKPYHYKSPPPPTPVYKPPVYSPPPPPKKPYKPPTPP--VH 260

Query: 241 SPPPPPYVYKSPPPP 285
           + PP PY+Y SPPPP
Sbjct: 261 TAPPHPYIYSSPPPP 275

[72][TOP]
>UniRef100_C6TK91 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TK91_SOYBN
          Length = 146

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/94 (59%), Positives = 61/94 (64%), Gaps = 15/94 (15%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSP------PPPPYVYNSPPPPPYVYNSPPPPP 228
           P+    PPY Y SPPP  PSPPPPY+YKSP      PPPPY+Y SPPPP    + PPP P
Sbjct: 51  PYYYKSPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPS--PSPPPPSP 108

Query: 229 YVYKSPPPP-----PYVYKSPPPP--PYVYKSPP 309
           YVYKSPPPP     P    SPPPP  PY+Y SPP
Sbjct: 109 YVYKSPPPPSPSPSPPPSHSPPPPHHPYLYNSPP 142

 Score =  110 bits (275), Expect = 5e-23
 Identities = 54/82 (65%), Positives = 56/82 (68%), Gaps = 9/82 (10%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPP-----PY 231
           P   PPPPYVY SPPP  PSPPPPYIYKSPPPP    + PPP PYVY SPPPP     P 
Sbjct: 67  PSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPS--PSPPPPSPYVYKSPPPPSPSPSPP 124

Query: 232 VYKSPPPP--PYVYKSPPPPPY 291
              SPPPP  PY+Y SPPPP Y
Sbjct: 125 PSHSPPPPHHPYLYNSPPPPVY 146

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 51/96 (53%), Positives = 58/96 (60%), Gaps = 9/96 (9%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPP--SPPP--PYIYKSPP 159
           PP+   S  P S +   P  +  SP  P   PPPPY+Y SPPPP  SPPP  PY+YKSPP
Sbjct: 57  PPYYYKSPPPPSPSP-PPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPSPYVYKSPP 115

Query: 160 PPPYVYNSPPPPPYVYNSPPPP--PYVYKSPPPPPY 261
           PP     SP P P   +SPPPP  PY+Y SPPPP Y
Sbjct: 116 PP-----SPSPSPPPSHSPPPPHHPYLYNSPPPPVY 146

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 46/82 (56%), Positives = 50/82 (60%), Gaps = 3/82 (3%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPP---PPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKS 243
           P+   P  Y YP P PP+     PPY YKSPP   Y Y SPPPP    +  PPPPYVYKS
Sbjct: 28  PYYGQPSNY-YPHPTPPTYRQINPPYYYKSPP---YYYKSPPPP----SPSPPPPYVYKS 79

Query: 244 PPPPPYVYKSPPPPPYVYKSPP 309
           PPPP       PPPPY+YKSPP
Sbjct: 80  PPPPSP--S--PPPPYIYKSPP 97

[73][TOP]
>UniRef100_Q40503 Extensin n=1 Tax=Nicotiana tabacum RepID=Q40503_TOBAC
          Length = 224

 Score =  112 bits (279), Expect = 2e-23
 Identities = 70/126 (55%), Positives = 74/126 (58%), Gaps = 23/126 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPPPYVYPSPPPPSPP--PPY--IYKSPPP 162
           PP   V  SP    K  P  +  +P   SPPPP  VY SPPPP  P  PP+  IYKSPPP
Sbjct: 96  PPHPPVYKSPPPPKK--PYSLPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPIYKSPPP 153

Query: 163 P--PY------VYNSPPPPPYVYNSPPPP--PY------VYKSPPPPPYVYKSPPP-PPY 291
           P  PY      VY SPPPP  VY SPPPP  P+      VYKSPPPP  VYKSPPP  PY
Sbjct: 154 PNKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPTPVYKSPPPHHPY 213

Query: 292 VYKSPP 309
           VY SPP
Sbjct: 214 VYASPP 219

 Score =  107 bits (268), Expect = 3e-22
 Identities = 68/135 (50%), Positives = 72/135 (53%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPY----VYPSPPPPS----PPPPYIYKSP 156
           PP   V  SP    K         P+ P P PY    VY SPPPP     PP P +YKSP
Sbjct: 55  PPHHPVYKSPPPPKK---------PYHPSPTPYHPVPVYKSPPPPKKPYYPPHPPVYKSP 105

Query: 157 PPP--PY------VYNSPPPPPYVYNSPPPP--PY------VYKSPPPP--PY------V 264
           PPP  PY      VY SPPPP  VY SPPPP  P+      +YKSPPPP  PY      V
Sbjct: 106 PPPKKPYSLPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPIYKSPPPPNKPYYPPHTPV 165

Query: 265 YKSPPPPPYVYKSPP 309
           YKSPPPP  VYKSPP
Sbjct: 166 YKSPPPPTPVYKSPP 180

 Score =  102 bits (254), Expect = 1e-20
 Identities = 60/104 (57%), Positives = 63/104 (60%), Gaps = 27/104 (25%)
 Frame = +1

Query: 79  SPPPP--PYVYPSPPPP-----SPPPPYIYKSPPPPPYVYNSPPPPPY----VYNSPPPP 225
           SPPPP  PY+Y SPPPP     SPP   +YKSPPPP   Y+ P P PY    VY SPPPP
Sbjct: 32  SPPPPKKPYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYH-PSPTPYHPVPVYKSPPPP 90

Query: 226 --------PYVYKSPPPP--PY------VYKSPPPPPYVYKSPP 309
                   P VYKSPPPP  PY      VYKSPPPP  VYKSPP
Sbjct: 91  KKPYYPPHPPVYKSPPPPKKPYSLPHTPVYKSPPPPTPVYKSPP 134

 Score =  100 bits (250), Expect = 4e-20
 Identities = 64/127 (50%), Positives = 68/127 (53%), Gaps = 50/127 (39%)
 Frame = +1

Query: 79  SPPPPPYVYPSPP-------PPSPPPPY-----------IYKSPPPP--------PYVYN 180
           SPPPP +VYPSPP       PP P  PY           +YKSPPPP        P VY 
Sbjct: 44  SPPPPVHVYPSPPHHPVYKSPPPPKKPYHPSPTPYHPVPVYKSPPPPKKPYYPPHPPVYK 103

Query: 181 SPPPP--PY------VYNSPPPPPYVYKSPPPP--PY------VYKSPPPP--PY----- 291
           SPPPP  PY      VY SPPPP  VYKSPPPP  P+      +YKSPPPP  PY     
Sbjct: 104 SPPPPKKPYSLPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPIYKSPPPPNKPYYPPHT 163

Query: 292 -VYKSPP 309
            VYKSPP
Sbjct: 164 PVYKSPP 170

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/96 (51%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP + +  SP    K         P+ PP  P VY SPPPP+P    +YKSPPPP   + 
Sbjct: 142 PPHTPIYKSPPPPNK---------PYYPPHTP-VYKSPPPPTP----VYKSPPPPKKPHY 187

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPP-PPYVYKSPPPP 285
            P  P  VY SPPPP  VYKSPPP  PYVY SPPPP
Sbjct: 188 PPHTP--VYKSPPPPTPVYKSPPPHHPYVYASPPPP 221

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 46/80 (57%), Positives = 48/80 (60%), Gaps = 23/80 (28%)
 Frame = +1

Query: 139 YIYKSPPPP--PYVYNSPPPPPYVYNSPPPPPYVYKSPPPP--PY-----------VYKS 273
           Y Y SPPPP  PY+Y SPPPP +VY SPP  P VYKSPPPP  PY           VYKS
Sbjct: 28  YQYSSPPPPKKPYLYKSPPPPVHVYPSPPHHP-VYKSPPPPKKPYHPSPTPYHPVPVYKS 86

Query: 274 PPPP--------PYVYKSPP 309
           PPPP        P VYKSPP
Sbjct: 87  PPPPKKPYYPPHPPVYKSPP 106

[74][TOP]
>UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO
          Length = 538

 Score =  111 bits (278), Expect = 2e-23
 Identities = 52/86 (60%), Positives = 55/86 (63%), Gaps = 8/86 (9%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPP 255
           +SPPPPP VY  PPPP  PPP +Y  PPPPP VY SPPPPP VY+ PPPPP     PPPP
Sbjct: 256 YSPPPPPPVYSPPPPPPSPPPPVYSPPPPPPPVY-SPPPPPPVYSPPPPPP---SPPPPP 311

Query: 256 PYVYKSPP--------PPPYVYKSPP 309
           P VY  PP        PPP VY  PP
Sbjct: 312 PPVYSPPPPPSPPPPSPPPPVYSPPP 337

 Score =  102 bits (255), Expect = 1e-20
 Identities = 52/82 (63%), Positives = 56/82 (68%), Gaps = 4/82 (4%)
 Frame = +1

Query: 76  FSPPPP-PYVYPSPPPPSPP---PPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKS 243
           FSPPPP PY Y SPPPPSPP   PP  +  PPP P   +SPPPPP+   SPPPP Y Y S
Sbjct: 375 FSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPP--HSPPPPPH---SPPPPIYPYLS 429

Query: 244 PPPPPYVYKSPPPPPYVYKSPP 309
           PPPPP+   SPPPPP VY  PP
Sbjct: 430 PPPPPHPVYSPPPPP-VYSPPP 450

 Score =  102 bits (253), Expect = 2e-20
 Identities = 58/116 (50%), Positives = 62/116 (53%), Gaps = 13/116 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVY-----PSPPPPSPPPPYIYKSPPPP 165
           PP   V S P      +P     SP  PPPPP VY     PSPPPPSPPPP +Y  PPPP
Sbjct: 283 PPPPPVYSPPPPPPVYSPPPPPPSP--PPPPPPVYSPPPPPSPPPPSPPPP-VYSPPPPP 339

Query: 166 PYVYNSPPPP--------PYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P    SPPPP        P     PPPPP    SPPPPP ++  PPP PY Y SPP
Sbjct: 340 P----SPPPPSPPPPSPLPPCVRPPPPPP--PNSPPPPPPLFSPPPPTPYYYSSPP 389

 Score =  101 bits (251), Expect = 3e-20
 Identities = 57/112 (50%), Positives = 64/112 (57%), Gaps = 9/112 (8%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP----FSPPPPPYVYPSPPPPSPPPPY-----IYKS 153
           PP       P  S    PS    SP    +SPPPPP   PSPPPPSPPPP      +   
Sbjct: 304 PPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPP---PSPPPPSPPPPSPLPPCVRPP 360

Query: 154 PPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPPPP   NSPPPPP +++ PPP PY Y SPPPP   + SPPPPP+   SPP
Sbjct: 361 PPPPP---NSPPPPPPLFSPPPPTPYYYSSPPPPSPPH-SPPPPPH---SPP 405

 Score =  100 bits (249), Expect = 5e-20
 Identities = 51/83 (61%), Positives = 54/83 (65%), Gaps = 4/83 (4%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPP--PPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           P SPPPPP+   SPPPPSPP  PP    SPPPP Y Y SPPPPP+   SPPPPP VY  P
Sbjct: 394 PHSPPPPPH---SPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPP-VYSPP 449

Query: 247 PP--PPYVYKSPPPPPYVYKSPP 309
           PP  PP   + PPPPP    SPP
Sbjct: 450 PPPSPPPCIEPPPPPPCAEYSPP 472

 Score =  100 bits (248), Expect = 6e-20
 Identities = 56/107 (52%), Positives = 59/107 (55%), Gaps = 5/107 (4%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSPPP-PPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PF  V  S        P+     P  PPP PP   PSPP   PPP Y   SPPPPP VY+
Sbjct: 214 PFKPVDCSSFRCKPFVPT----LPAPPPPSPPMPVPSPPVYLPPPVY---SPPPPPPVYS 266

Query: 181 SPPPPPY----VYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP     VY+ PPPPP VY SPPPPP VY  PPPPP     PP
Sbjct: 267 PPPPPPSPPPPVYSPPPPPPPVY-SPPPPPPVYSPPPPPPSPPPPPP 312

 Score =  100 bits (248), Expect = 6e-20
 Identities = 59/114 (51%), Positives = 63/114 (55%), Gaps = 10/114 (8%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP-PYVYPSPPPPSPPPP-YIYKSPPPPPYV 174
           PP     SSP   +   P      P SPPPP P   P PPP SPPPP Y Y SPPPPP+ 
Sbjct: 379 PPTPYYYSSPPPPSP--PHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHP 436

Query: 175 YNSPPPPPYVYNSPPP--PPYVYKSPPPPPYVYKSP------PPPPYVYKSPPS 312
             SPPPPP VY+ PPP  PP   + PPPPP    SP      PPPP  YK PPS
Sbjct: 437 VYSPPPPP-VYSPPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPS 489

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 59/125 (47%), Positives = 63/125 (50%), Gaps = 22/125 (17%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP----PYVYPSPPPP--SPPPPYIYKSPPP 162
           PP     S P       P      P SPPPP    P V P PPPP  SPPPP    SPPP
Sbjct: 320 PPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPP 379

Query: 163 P-PYVYNSP---------------PPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYV 294
           P PY Y+SP               PPPP   +SPPPPP+   SPPPP Y Y SPPPPP+ 
Sbjct: 380 PTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPH---SPPPPIYPYLSPPPPPHP 436

Query: 295 YKSPP 309
             SPP
Sbjct: 437 VYSPP 441

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 48/82 (58%), Positives = 51/82 (62%), Gaps = 3/82 (3%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKS 243
           P SPPPP Y  P PPPP    PPPP +Y  PPPPP   + PPPPP VY+ PPPP     S
Sbjct: 271 PPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPP---SPPPPPPPVYSPPPPPSPPPPS 327

Query: 244 PPPPPYVYKSPPPPPYVYKSPP 309
           PPPP  VY  PPPPP    SPP
Sbjct: 328 PPPP--VYSPPPPPP----SPP 343

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 57/117 (48%), Positives = 59/117 (50%), Gaps = 14/117 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPPYIYKSPPPP 165
           PP S    SP       P      P SPPPP Y Y SPPPP     SPPPP +Y  PPPP
Sbjct: 400 PPHSPPPPSP-------PHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPP 452

Query: 166 --PYVYNSPPPPPYVYNSPPPPPYVYKSP-PPPPYVYK-----SPPPPP-YVYKSPP 309
             P     PPPPP    SPPPP     SP PPPP  YK     SPPPPP + Y  PP
Sbjct: 453 SPPPCIEPPPPPPCAEYSPPPP-----SPSPPPPTQYKPPPSPSPPPPPVHYYSPPP 504

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 48/81 (59%), Positives = 49/81 (60%), Gaps = 9/81 (11%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPSP--PPPYIYK-----SPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           PPPPP    SPPPPSP  PPP  YK     SPPPPP  Y SPPPP     SPPPP  VY+
Sbjct: 461 PPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPPPPS---QSPPPPAPVYE 517

Query: 241 SPPPP--PYVYKSPPPPPYVY 297
            P PP     Y SPPPPPY Y
Sbjct: 518 GPLPPITGVSYASPPPPPYYY 538

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/113 (46%), Positives = 59/113 (52%), Gaps = 11/113 (9%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P     ++P       +SPPPPP VY  PPPPSPPP    + PPPPP    
Sbjct: 413 PPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPP-VYSPPPPPSPPP--CIEPPPPPPCAEY 469

Query: 181 SP------PPPPYVYN-----SPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
           SP      PPPP  Y      SPPPPP  Y SPPPP    +SPPPP  VY+ P
Sbjct: 470 SPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPPPPS---QSPPPPAPVYEGP 519

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 39/82 (47%), Positives = 42/82 (51%), Gaps = 3/82 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF-SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVY 177
           PP +  S  P S +   P+     P  SPPPPP  Y SPPPPS        SPPPP  VY
Sbjct: 464 PPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPPPPSQ-------SPPPPAPVY 516

Query: 178 NSPPPP--PYVYNSPPPPPYVY 237
             P PP     Y SPPPPPY Y
Sbjct: 517 EGPLPPITGVSYASPPPPPYYY 538

[75][TOP]
>UniRef100_Q40402 Extensin (ext) n=1 Tax=Nicotiana plumbaginifolia RepID=Q40402_NICPL
          Length = 416

 Score =  108 bits (271), Expect = 1e-22
 Identities = 65/123 (52%), Positives = 69/123 (56%), Gaps = 20/123 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPP--PPY--IYKSPPPPP 168
           PP     S P       P    V   SPPPP  VY SPPPP  P  PP+  +YKSPPPP 
Sbjct: 58  PPIPVYKSPPPPKKPYYPPHTPVYK-SPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPT 116

Query: 169 YVYNSPPPP------PY--VYNSPPPPPYVYKSPPPP------PY--VYKSPPPPPYVYK 300
            VY SPP P      P+  VY SPPPP  VYKSPPPP      P+  VYKSPPPP  VYK
Sbjct: 117 PVYKSPPSPKKPHYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPTPVYK 176

Query: 301 SPP 309
           SPP
Sbjct: 177 SPP 179

 Score =  107 bits (267), Expect = 4e-22
 Identities = 72/138 (52%), Positives = 77/138 (55%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPPPYVYPSPPPPSPP--PPY--IYKSPPP 162
           PP + V  SP S  K  P     +P   SPPPP  VY SPPPP  P  PP+  +YKSPPP
Sbjct: 113 PPPTPVYKSPPSPKK--PHYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPP 170

Query: 163 PPYVYNSPPPP------PY--VYNSPPPP--PY------VYKSPPPPPYVYKSPPPP--P 288
           P  VY SPPPP      P+  VY SPPPP  PY      VYKSPPPP  VYKSPPPP  P
Sbjct: 171 PTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKP 230

Query: 289 Y-----------VYKSPP 309
           Y           VYKSPP
Sbjct: 231 YHPSPTPYHPSPVYKSPP 248

 Score =  106 bits (265), Expect = 7e-22
 Identities = 59/97 (60%), Positives = 63/97 (64%), Gaps = 20/97 (20%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPP--PPY--IYKSPPPPPYVYNSPPPP------PY--VYNSPPP 222
           SPPPP  VY SPPPP  P  PP+  +YKSPPPP  VY SPPPP      P+  VY SPPP
Sbjct: 55  SPPPPIPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPP 114

Query: 223 PPYVYKSPPPP--PY------VYKSPPPPPYVYKSPP 309
           P  VYKSPP P  P+      VYKSPPPP  VYKSPP
Sbjct: 115 PTPVYKSPPSPKKPHYPPHTPVYKSPPPPTPVYKSPP 151

 Score =  105 bits (263), Expect = 1e-21
 Identities = 64/115 (55%), Positives = 66/115 (57%), Gaps = 38/115 (33%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPP--PPY--IYKSPPPP--PY------VYNSPPPPPYVYNSPPP 222
           SPPPP  VY SPPPP  P  PP+  +YKSPPPP  PY      VY SPPPP  VY SPPP
Sbjct: 167 SPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPP 226

Query: 223 P---------PY----VYKSPPPPPYVYKSPPPP--PY-----------VYKSPP 309
           P         PY    VYKSPPPP  VYKSPPPP  PY           VYKSPP
Sbjct: 227 PKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSPVYKSPP 281

 Score =  104 bits (260), Expect = 3e-21
 Identities = 67/133 (50%), Positives = 71/133 (53%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPN--------SSTKITPSGIGVSPFSP------PPPPY--VYPSPPPPSPP 132
           PP + V  SP         S T   PS +  SP  P      PPPP    +PSP P  P 
Sbjct: 281 PPPTPVYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPA 340

Query: 133 PPYIYKSPPPPPYVYNSPPPP--PY-----------VYNSPPPPPYVYKSPPPPPYVYKS 273
           P  +YKSPPPP  VY SPPPP  PY           VY SPPPP  VYKSPPPP  VYKS
Sbjct: 341 P--VYKSPPPPTPVYKSPPPPVKPYHPSPTPYHPAPVYKSPPPPTPVYKSPPPPTPVYKS 398

Query: 274 PPP-PPYVYKSPP 309
           PPP  PYVY SPP
Sbjct: 399 PPPHHPYVYASPP 411

 Score =  103 bits (258), Expect = 4e-21
 Identities = 60/96 (62%), Positives = 63/96 (65%), Gaps = 18/96 (18%)
 Frame = +1

Query: 79  SPPPP--PYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPP--PY------VYNSPPPPP 228
           SPPPP  PY +PSP P  P P  +YKSPPPP  VY SPPPP  PY      VY SPPPP 
Sbjct: 32  SPPPPKKPY-HPSPTPYYPAP--VYKSPPPPIPVYKSPPPPKKPYYPPHTPVYKSPPPPT 88

Query: 229 YVYKSPPPP--PY------VYKSPPPPPYVYKSPPS 312
            VYKSPPPP  P+      VYKSPPPP  VYKSPPS
Sbjct: 89  PVYKSPPPPKKPHYPPHTPVYKSPPPPTPVYKSPPS 124

 Score =  103 bits (258), Expect = 4e-21
 Identities = 64/133 (48%), Positives = 66/133 (49%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF----SPPPPPYVYPSPPPPSPP---------PPY 141
           PP     S P       PS     P     SPPPP  VY SPPPP  P         P  
Sbjct: 216 PPTPVYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSP 275

Query: 142 IYKSPPPPPYVYNSPPPPPYVYNSPPPPPY----VYKSPPPPPYVYKSPPPP--PY---- 291
           +YKSPPPP  VY SPPPP   Y+ P P PY    VYKSPPPP  VYKSPPPP  PY    
Sbjct: 276 VYKSPPPPTPVYKSPPPPKKPYH-PSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSP 334

Query: 292 -------VYKSPP 309
                  VYKSPP
Sbjct: 335 TPYHPAPVYKSPP 347

 Score =  103 bits (258), Expect = 4e-21
 Identities = 64/133 (48%), Positives = 66/133 (49%), Gaps = 30/133 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF----SPPPPPYVYPSPPPPSPP---------PPY 141
           PP     S P       PS     P     SPPPP  VY SPPPP  P         P  
Sbjct: 249 PPTPVYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSP 308

Query: 142 IYKSPPPPPYVYNSPPPPPYVYNSPPPPPY----VYKSPPPPPYVYKSPPPP--PY---- 291
           +YKSPPPP  VY SPPPP   Y+ P P PY    VYKSPPPP  VYKSPPPP  PY    
Sbjct: 309 VYKSPPPPTPVYKSPPPPKKPYH-PSPTPYHPAPVYKSPPPPTPVYKSPPPPVKPYHPSP 367

Query: 292 -------VYKSPP 309
                  VYKSPP
Sbjct: 368 TPYHPAPVYKSPP 380

 Score =  102 bits (253), Expect = 2e-20
 Identities = 65/131 (49%), Positives = 69/131 (52%), Gaps = 28/131 (21%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPPPYVYPSPPPPSPP---------PPYIY 147
           PP + V  SP    K  P     +P   SPPPP  VY SPPPP  P         P  +Y
Sbjct: 187 PPHTPVYKSPPPPKK--PYYPPHTPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSPVY 244

Query: 148 KSPPPPPYVYNSPPPPPYVYNSPPPPPY----VYKSPPPPPYVYKSPPPP--PY------ 291
           KSPPPP  VY SPPPP   Y+ P P PY    VYKSPPPP  VYKSPPPP  PY      
Sbjct: 245 KSPPPPTPVYKSPPPPKKPYH-PSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTP 303

Query: 292 -----VYKSPP 309
                VYKSPP
Sbjct: 304 YHPSPVYKSPP 314

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 59/106 (55%), Positives = 62/106 (58%), Gaps = 29/106 (27%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPP--PPY--IYKSPPPPPYVYNSPPPPPYV---------YNSPP 219
           SPPPP  VY SPP P  P  PP+  +YKSPPPP  VY SPPPP            Y SPP
Sbjct: 111 SPPPPTPVYKSPPSPKKPHYPPHTPVYKSPPPPTPVYKSPPPPKK-PHYPPHTPVYKSPP 169

Query: 220 PPPYVYKSPPPP--PY------VYKSPPPP--PY------VYKSPP 309
           PP  VYKSPPPP  P+      VYKSPPPP  PY      VYKSPP
Sbjct: 170 PPTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYKSPP 215

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 55/102 (53%), Positives = 56/102 (54%), Gaps = 7/102 (6%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF----SPPPPPYVYPSPPPPSPPPPYIYKSPPP-- 162
           PP     S P       PS     P     SPPPP  VY SPPP  P  PY + SP P  
Sbjct: 315 PPTPVYKSPPPPKKPYHPSPTPYHPAPVYKSPPPPTPVYKSPPP--PVKPY-HPSPTPYH 371

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPP-PPYVYKSPPPP 285
           P  VY SPPPP  VY SPPPP  VYKSPPP  PYVY SPPPP
Sbjct: 372 PAPVYKSPPPPTPVYKSPPPPTPVYKSPPPHHPYVYASPPPP 413

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 53/101 (52%), Positives = 57/101 (56%), Gaps = 18/101 (17%)
 Frame = +1

Query: 61  IGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPP--PPYVYNSPPPPPYVYNSPPPP--P 228
           + +S  S     Y Y SPPPP  P    + SP P  P  VY SPPPP  VY SPPPP  P
Sbjct: 16  VSLSLASESSANYQYSSPPPPKKP---YHPSPTPYYPAPVYKSPPPPIPVYKSPPPPKKP 72

Query: 229 Y------VYKSPPPPPYVYKSPPPP--PY------VYKSPP 309
           Y      VYKSPPPP  VYKSPPPP  P+      VYKSPP
Sbjct: 73  YYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPP 113

[76][TOP]
>UniRef100_UPI00001631D5 LRX2 (LEUCINE-RICH REPEAT/EXTENSIN 2); protein binding / structural
           constituent of cell wall n=1 Tax=Arabidopsis thaliana
           RepID=UPI00001631D5
          Length = 826

 Score =  107 bits (266), Expect = 5e-22
 Identities = 62/138 (44%), Positives = 69/138 (50%), Gaps = 36/138 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP-------PPPPYVYPSPPPPSP--PPPYIYKS 153
           PP     S P  S++++PS     P  P       PPPPY+Y SPPPPSP  PPPYIY S
Sbjct: 505 PPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSS 564

Query: 154 PPP---------------------PPYVYNSPPPPPYVYNSPPPPP--YVYKSPPPPP-- 258
           PPP                     P   Y SP PP Y Y S PPPP  Y  +SPPPPP  
Sbjct: 565 PPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPP 624

Query: 259 --YVYKSPPPPPYVYKSP 306
             Y  +SPPPPP VY  P
Sbjct: 625 TYYAVQSPPPPPPVYYPP 642

 Score =  102 bits (255), Expect = 1e-20
 Identities = 65/149 (43%), Positives = 72/149 (48%), Gaps = 46/149 (30%)
 Frame = +1

Query: 1   PPFSAVSSS-----PNSSTKITPSGIGVSPFSPPPPPYVYP------------------- 108
           PP S +S S     P  S+K++PS     P  PPPPP   P                   
Sbjct: 473 PPSSKMSPSFRATPPPPSSKMSPSVKAYPP--PPPPPEYEPSPPPPSSEMSPSVRAYPPP 530

Query: 109 ---SPPPPSPPPPYIYKSP------PPPPYVYNSPPPP---PYVYNSPPPPPY------- 231
              SPPPPSPPPPYIY SP      PPPPY+Y+SPPP    P    SPPPP Y       
Sbjct: 531 PPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPR 590

Query: 232 -VYKSPPPPPYVYKSPPPPP--YVYKSPP 309
             Y SP PP Y Y S PPPP  Y  +SPP
Sbjct: 591 EYYPSPSPPYYQYTSSPPPPTYYATQSPP 619

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 62/146 (42%), Positives = 67/146 (45%), Gaps = 44/146 (30%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP--------FSPPPPPYVYP----SPPPP------- 123
            PP+   +SSP   T          P          PPPPP  YP    SPPPP       
Sbjct: 598  PPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPV 657

Query: 124  --SPPPPYIY-----KSPPPPPYVY-----NSPPPPPYVY----NSPPPPPYVY----KS 243
              SPPPP +Y     +SPPPPP VY      SPPP P  Y     SPPPPP  Y    +S
Sbjct: 658  IQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQS 717

Query: 244  PPPPPYVY-----KSPPPPPYVYKSP 306
            PPPP  VY     KSPPPP  VY  P
Sbjct: 718  PPPPSPVYYPPVAKSPPPPSPVYYPP 743

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 56/128 (43%), Positives = 65/128 (50%), Gaps = 25/128 (19%)
 Frame = +1

Query: 1   PPFSAVSSS-----PNSSTKITPSGIGVSPFSPPPP-----PYVYPSPPPPSP---PPPY 141
           PP S +S +     P  S+K++PS       +PPPP     P    +PPPPS    P   
Sbjct: 443 PPSSKMSPTFRATPPPPSSKMSPSFRA----TPPPPSSKMSPSFRATPPPPSSKMSPSVK 498

Query: 142 IYKSPPPPPYVYNSPPPP-----PYVYNSPPPPPYVYKSP-PPPPYVYKSP------PPP 285
            Y  PPPPP    SPPPP     P V   PPPPP     P PPPPY+Y SP      PPP
Sbjct: 499 AYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPP 558

Query: 286 PYVYKSPP 309
           PY+Y SPP
Sbjct: 559 PYIYSSPP 566

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 50/119 (42%), Positives = 57/119 (47%), Gaps = 16/119 (13%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPPPYVYPSPPPPSPPPPYIY-----KSPP 159
            PP   V  SP + +   P  +   P   SPPP P  YP P   SPPPP +Y     +SPP
Sbjct: 661  PPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYP-PVTQSPPPPPVYYLPVTQSPP 719

Query: 160  PPPYVY-----NSPPPPPYVYNSP----PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PP  VY      SPPPP  VY  P    PPPP       PP    +SPPP    Y+SPP
Sbjct: 720  PPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPE---YQSPP 775

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 50/128 (39%), Positives = 53/128 (41%), Gaps = 50/128 (39%)
 Frame = +1

Query: 76  FSPPPPPY-------VYPSPPPPS---------PPPPYIYKSP-----PPPPYVYNSP-- 186
           FSPPPP +       V P PPP S         PPPP    SP     PPPP    SP  
Sbjct: 423 FSPPPPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSF 482

Query: 187 ---PPPPYVYNSP-------PPPPYVYKSPPPPPYVYKSP-----------------PPP 285
              PPPP    SP       PPPP  Y+  PPPP    SP                 PPP
Sbjct: 483 RATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPP 542

Query: 286 PYVYKSPP 309
           PY+Y SPP
Sbjct: 543 PYIYSSPP 550

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 42/109 (38%), Positives = 50/109 (45%), Gaps = 10/109 (9%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPP--PYVYPSPPPPSPPPPYIYKSPPPPP 168
            PP S V   P + +   PS +   P   SPPPP  P  Y  P  P+  PP  Y+SPPP  
Sbjct: 719  PPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPPKG 778

Query: 169  YVYNSPPPPPYVYNSPPP---PPYVYKSPPPPP---YVYKSPPPPPYVY 297
               N  P   + Y +P P   PP  Y+  P PP     Y SPPPP   Y
Sbjct: 779  --CNDSPSNDHHYQTPTPPSLPPPYYEDTPLPPIRGVSYASPPPPSIPY 825

[77][TOP]
>UniRef100_Q43505 Extensin-like protein Dif54 n=1 Tax=Solanum lycopersicum
           RepID=Q43505_SOLLC
          Length = 436

 Score =  107 bits (266), Expect = 5e-22
 Identities = 62/117 (52%), Positives = 62/117 (52%), Gaps = 39/117 (33%)
 Frame = +1

Query: 79  SPPPPPYVYPSP---PPPSPPPPYI------YKSPPPPPYV------YNSPPPPPYV--- 204
           SPPPPP  Y SP     P PPP Y       YKSP PPPY       Y SPPPPPY    
Sbjct: 315 SPPPPPTYYKSPVYYKSPPPPPTYYEKSPSYYKSPLPPPYYKESMPYYKSPPPPPYYKES 374

Query: 205 ---YNSPPPPPYV------YKSPPPPPYV------YKSPPPPPYV------YKSPPS 312
              Y SPPPPPY       YKSPPPPPY       YKSPPPPPY       YKSPPS
Sbjct: 375 TPYYKSPPPPPYYKESTPSYKSPPPPPYYKESTPYYKSPPPPPYYKESTPSYKSPPS 431

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 56/120 (46%), Positives = 57/120 (47%), Gaps = 42/120 (35%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPS-----PPPPYIYKSP-----PPP--------PYVYNSPPPPPY 201
           +  P P   Y SP P       PPPP  YKSP     PPP        P  Y SP PPPY
Sbjct: 295 YKSPSPSQYYKSPAPSKYYKSPPPPPTYYKSPVYYKSPPPPPTYYEKSPSYYKSPLPPPY 354

Query: 202 ------VYNSPPPPPY------VYKSPPPPPYV------YKSPPPPPY------VYKSPP 309
                  Y SPPPPPY       YKSPPPPPY       YKSPPPPPY       YKSPP
Sbjct: 355 YKESMPYYKSPPPPPYYKESTPYYKSPPPPPYYKESTPSYKSPPPPPYYKESTPYYKSPP 414

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 56/122 (45%), Positives = 58/122 (47%), Gaps = 35/122 (28%)
 Frame = +1

Query: 49  TPSGIGVSPFSPPPPPYVYPSPPPP----SPPPPYIYKSPPPPPYVYNSP-------PPP 195
           +PS +       P   Y Y SP P     SP P   YKSPPPPP  Y SP       PPP
Sbjct: 277 SPSPVKYYKSPAPSKHYYYKSPSPSQYYKSPAPSKYYKSPPPPPTYYKSPVYYKSPPPPP 336

Query: 196 PYV------YNSPPPPPYV------YKSPPPPPYV------YKSPPPPPYV------YKS 303
            Y       Y SP PPPY       YKSPPPPPY       YKSPPPPPY       YKS
Sbjct: 337 TYYEKSPSYYKSPLPPPYYKESMPYYKSPPPPPYYKESTPYYKSPPPPPYYKESTPSYKS 396

Query: 304 PP 309
           PP
Sbjct: 397 PP 398

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 42/85 (49%), Positives = 45/85 (52%), Gaps = 6/85 (7%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP------PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVY 237
           +  P P   Y SP P      P+P   Y YKSP P  Y Y SP P  Y Y SPPPPP  Y
Sbjct: 266 YKSPSPVKYYKSPSPVKYYKSPAPSKHYYYKSPSPSQY-YKSPAPSKY-YKSPPPPPTYY 323

Query: 238 KSPPPPPYVYKSPPPPPYVYKSPPS 312
           KSP      YKSPPPPP  Y+  PS
Sbjct: 324 KSP----VYYKSPPPPPTYYEKSPS 344

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 39/92 (42%), Positives = 41/92 (44%), Gaps = 11/92 (11%)
 Frame = +1

Query: 67  VSPFSPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPP 228
           V  +  P P   Y SP P       SP P   YKSP P  Y Y SP P  + Y   P P 
Sbjct: 243 VKYYKSPSPAKYYKSPAPSKNYYYKSPSPVKYYKSPSPVKY-YKSPAPSKHYYYKSPSPS 301

Query: 229 YVYKSPPPPPYVYKSPPPP-----PYVYKSPP 309
             YKSP P  Y    PPPP     P  YKSPP
Sbjct: 302 QYYKSPAPSKYYKSPPPPPTYYKSPVYYKSPP 333

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/70 (51%), Positives = 37/70 (52%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPP 258
           SPPPPPY   S P         YKSPPPPPY   S P     Y SPPPPPY  +S P   
Sbjct: 380 SPPPPPYYKESTPS--------YKSPPPPPYYKESTP----YYKSPPPPPYYKESTPS-- 425

Query: 259 YVYKSPPPPP 288
             YKSPP  P
Sbjct: 426 --YKSPPSSP 433

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 38/83 (45%), Positives = 41/83 (49%), Gaps = 6/83 (7%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP------PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVY 237
           +  P P   Y SP P      P+P   Y YKSP P  Y Y SP P  Y  +  P   Y Y
Sbjct: 150 YKSPSPSKYYKSPSPAKYYKSPAPSKHYYYKSPSPAKY-YKSPSPAKYYKSPAPSKHYYY 208

Query: 238 KSPPPPPYVYKSPPPPPYVYKSP 306
           KSP P  Y YKSP P  Y YKSP
Sbjct: 209 KSPSPVKY-YKSPSPAKY-YKSP 229

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 38/83 (45%), Positives = 41/83 (49%), Gaps = 6/83 (7%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP------PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVY 237
           +  P P   Y SP P      P+P   Y YKSP P  Y Y SP P  Y  +  P   Y Y
Sbjct: 179 YKSPSPAKYYKSPSPAKYYKSPAPSKHYYYKSPSPVKY-YKSPSPAKYYKSPAPSKNYYY 237

Query: 238 KSPPPPPYVYKSPPPPPYVYKSP 306
           KSP P  Y YKSP P  Y YKSP
Sbjct: 238 KSPSPVKY-YKSPSPAKY-YKSP 258

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 44/101 (43%), Positives = 47/101 (46%), Gaps = 5/101 (4%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP----SPPPPYIYKSPPPPPYVYNSP 186
           S SP+   K +PS         P   Y Y SP P     SP P   YKSP P  + Y   
Sbjct: 152 SPSPSKYYK-SPSPAKYYKSPAPSKHYYYKSPSPAKYYKSPSPAKYYKSPAPSKHYYYKS 210

Query: 187 PPPPYVYNSPPPPPYVYKSPPPPP-YVYKSPPPPPYVYKSP 306
           P P   Y SP P  Y YKSP P   Y YKSP P  Y YKSP
Sbjct: 211 PSPVKYYKSPSPAKY-YKSPAPSKNYYYKSPSPVKY-YKSP 249

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 38/84 (45%), Positives = 40/84 (47%), Gaps = 7/84 (8%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVY 237
           +  P P   Y SP P       SP P   YKSP P  Y Y SP P  + Y   P P   Y
Sbjct: 130 YKSPSPAKYYKSPTPSKHYYYKSPSPSKYYKSPSPAKY-YKSPAPSKHYYYKSPSPAKYY 188

Query: 238 KSPPPPPYVYKSPPPPP-YVYKSP 306
           KSP P  Y YKSP P   Y YKSP
Sbjct: 189 KSPSPAKY-YKSPAPSKHYYYKSP 211

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 38/83 (45%), Positives = 41/83 (49%), Gaps = 6/83 (7%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP------PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVY 237
           +  P P   Y SP P      P+P   Y YKSP P  Y Y SP P  Y  +  P   Y Y
Sbjct: 208 YKSPSPVKYYKSPSPAKYYKSPAPSKNYYYKSPSPVKY-YKSPSPAKYYKSPAPSKNYYY 266

Query: 238 KSPPPPPYVYKSPPPPPYVYKSP 306
           KSP P  Y YKSP P  Y YKSP
Sbjct: 267 KSPSPVKY-YKSPSPVKY-YKSP 287

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 41/114 (35%), Positives = 43/114 (37%), Gaps = 34/114 (29%)
 Frame = +1

Query: 67  VSPFSPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPY------------------- 171
           V  +  P P   Y SP P       SP P   YKSP P  Y                   
Sbjct: 214 VKYYKSPSPAKYYKSPAPSKNYYYKSPSPVKYYKSPSPAKYYKSPAPSKNYYYKSPSPVK 273

Query: 172 ---------VYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
                     Y SP P  + Y   P P   YKSP P  Y YKSPPPPP  YKSP
Sbjct: 274 YYKSPSPVKYYKSPAPSKHYYYKSPSPSQYYKSPAPSKY-YKSPPPPPTYYKSP 326

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 38/79 (48%), Positives = 39/79 (49%), Gaps = 5/79 (6%)
 Frame = +1

Query: 85  PPPPYVYPSPPPP----SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P   Y Y SP P     SP P   YKSP P  + Y   P P   Y SP P  Y YKSP P
Sbjct: 144 PSKHYYYKSPSPSKYYKSPSPAKYYKSPAPSKHYYYKSPSPAKYYKSPSPAKY-YKSPAP 202

Query: 253 PP-YVYKSPPPPPYVYKSP 306
              Y YKSP P  Y YKSP
Sbjct: 203 SKHYYYKSPSPVKY-YKSP 220

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 37/78 (47%), Positives = 39/78 (50%), Gaps = 6/78 (7%)
 Frame = +1

Query: 91  PPYVYPSPPP------PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P   Y SP P      P+P   Y YKSP P  Y Y SP P  Y  +  P   Y YKSP P
Sbjct: 126 PAKYYKSPSPAKYYKSPTPSKHYYYKSPSPSKY-YKSPSPAKYYKSPAPSKHYYYKSPSP 184

Query: 253 PPYVYKSPPPPPYVYKSP 306
             Y YKSP P  Y YKSP
Sbjct: 185 AKY-YKSPSPAKY-YKSP 200

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 38/84 (45%), Positives = 40/84 (47%), Gaps = 7/84 (8%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVY 237
           +  P P   Y SP P       SP P   YKSP P  Y  +  P   Y Y SP P  Y Y
Sbjct: 188 YKSPSPAKYYKSPAPSKHYYYKSPSPVKYYKSPSPAKYYKSPAPSKNYYYKSPSPVKY-Y 246

Query: 238 KSPPPPPYVYKSPPPPP-YVYKSP 306
           KSP P  Y YKSP P   Y YKSP
Sbjct: 247 KSPSPAKY-YKSPAPSKNYYYKSP 269

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 41/80 (51%), Positives = 41/80 (51%), Gaps = 6/80 (7%)
 Frame = +1

Query: 85  PPPPYVYPSPPP----PSPPPPYIYKSPPPPP-YVYNSPPPPPYVYNSPPPPPYVYKSPP 249
           P   Y Y SP P     SP P   YKSP P   Y Y SP P  Y Y SP P  Y YKSP 
Sbjct: 202 PSKHYYYKSPSPVKYYKSPSPAKYYKSPAPSKNYYYKSPSPVKY-YKSPSPAKY-YKSPA 259

Query: 250 PPP-YVYKSPPPPPYVYKSP 306
           P   Y YKSP P  Y YKSP
Sbjct: 260 PSKNYYYKSPSPVKY-YKSP 278

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 33/75 (44%), Positives = 35/75 (46%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPP 258
           SP P PY   S       P + YKSP P  + Y SP    Y Y SP P    YKSP P  
Sbjct: 50  SPSPSPYYKKSEKHAEHSPSHYYKSPTPSKHYYKSPVVVKY-YKSPAPSKKYYKSPSPSK 108

Query: 259 YVYKSPPPPPYVYKS 303
           Y YKS  P    YKS
Sbjct: 109 YYYKSHTPSKKYYKS 123

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 39/91 (42%), Positives = 40/91 (43%), Gaps = 15/91 (16%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP--------------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSP 216
           SP P  Y Y S  P               SP P   YKSP P  + Y   P P   Y SP
Sbjct: 103 SPSPSKYYYKSHTPSKKYYKSLSPAKYYKSPSPAKYYKSPTPSKHYYYKSPSPSKYYKSP 162

Query: 217 PPPPYVYKSPPPPP-YVYKSPPPPPYVYKSP 306
            P  Y YKSP P   Y YKSP P  Y YKSP
Sbjct: 163 SPAKY-YKSPAPSKHYYYKSPSPAKY-YKSP 191

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 42/112 (37%), Positives = 47/112 (41%), Gaps = 12/112 (10%)
 Frame = +1

Query: 7   FSAVSSSPNSSTKITPSGIGVSPF-------SPPPPPYVYPSPPPP-----SPPPPYIYK 150
           +   S SP  +TK        SP+       +   P + Y SP P      SP     YK
Sbjct: 33  YGYTSPSPTYTTKKYYKSPSPSPYYKKSEKHAEHSPSHYYKSPTPSKHYYKSPVVVKYYK 92

Query: 151 SPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
           SP P    Y SP P  Y Y S  P    YKS  P  Y YKSP P  Y YKSP
Sbjct: 93  SPAPSKKYYKSPSPSKYYYKSHTPSKKYYKSLSPAKY-YKSPSPAKY-YKSP 142

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 41/95 (43%), Positives = 43/95 (45%), Gaps = 1/95 (1%)
 Frame = +1

Query: 25  SPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYV 204
           SP  S     S + V  +  P P   Y   P PS    Y YKS  P    Y S  P  Y 
Sbjct: 74  SPTPSKHYYKSPVVVKYYKSPAPSKKYYKSPSPSK---YYYKSHTPSKKYYKSLSPAKY- 129

Query: 205 YNSPPPPPYVYKSPPPPP-YVYKSPPPPPYVYKSP 306
           Y SP P  Y YKSP P   Y YKSP P  Y YKSP
Sbjct: 130 YKSPSPAKY-YKSPTPSKHYYYKSPSPSKY-YKSP 162

[78][TOP]
>UniRef100_O48809 F24O1.18 n=1 Tax=Arabidopsis thaliana RepID=O48809_ARATH
          Length = 786

 Score =  107 bits (266), Expect = 5e-22
 Identities = 62/138 (44%), Positives = 69/138 (50%), Gaps = 36/138 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP-------PPPPYVYPSPPPPSP--PPPYIYKS 153
           PP     S P  S++++PS     P  P       PPPPY+Y SPPPPSP  PPPYIY S
Sbjct: 465 PPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSS 524

Query: 154 PPP---------------------PPYVYNSPPPPPYVYNSPPPPP--YVYKSPPPPP-- 258
           PPP                     P   Y SP PP Y Y S PPPP  Y  +SPPPPP  
Sbjct: 525 PPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPP 584

Query: 259 --YVYKSPPPPPYVYKSP 306
             Y  +SPPPPP VY  P
Sbjct: 585 TYYAVQSPPPPPPVYYPP 602

 Score =  102 bits (255), Expect = 1e-20
 Identities = 65/149 (43%), Positives = 72/149 (48%), Gaps = 46/149 (30%)
 Frame = +1

Query: 1   PPFSAVSSS-----PNSSTKITPSGIGVSPFSPPPPPYVYP------------------- 108
           PP S +S S     P  S+K++PS     P  PPPPP   P                   
Sbjct: 433 PPSSKMSPSFRATPPPPSSKMSPSVKAYPP--PPPPPEYEPSPPPPSSEMSPSVRAYPPP 490

Query: 109 ---SPPPPSPPPPYIYKSP------PPPPYVYNSPPPP---PYVYNSPPPPPY------- 231
              SPPPPSPPPPYIY SP      PPPPY+Y+SPPP    P    SPPPP Y       
Sbjct: 491 PPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPR 550

Query: 232 -VYKSPPPPPYVYKSPPPPP--YVYKSPP 309
             Y SP PP Y Y S PPPP  Y  +SPP
Sbjct: 551 EYYPSPSPPYYQYTSSPPPPTYYATQSPP 579

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 62/146 (42%), Positives = 67/146 (45%), Gaps = 44/146 (30%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP--------FSPPPPPYVYP----SPPPP------- 123
           PP+   +SSP   T          P          PPPPP  YP    SPPPP       
Sbjct: 558 PPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPV 617

Query: 124 --SPPPPYIY-----KSPPPPPYVY-----NSPPPPPYVY----NSPPPPPYVY----KS 243
             SPPPP +Y     +SPPPPP VY      SPPP P  Y     SPPPPP  Y    +S
Sbjct: 618 IQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQS 677

Query: 244 PPPPPYVY-----KSPPPPPYVYKSP 306
           PPPP  VY     KSPPPP  VY  P
Sbjct: 678 PPPPSPVYYPPVAKSPPPPSPVYYPP 703

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 56/128 (43%), Positives = 65/128 (50%), Gaps = 25/128 (19%)
 Frame = +1

Query: 1   PPFSAVSSS-----PNSSTKITPSGIGVSPFSPPPP-----PYVYPSPPPPSP---PPPY 141
           PP S +S +     P  S+K++PS       +PPPP     P    +PPPPS    P   
Sbjct: 403 PPSSKMSPTFRATPPPPSSKMSPSFRA----TPPPPSSKMSPSFRATPPPPSSKMSPSVK 458

Query: 142 IYKSPPPPPYVYNSPPPP-----PYVYNSPPPPPYVYKSP-PPPPYVYKSP------PPP 285
            Y  PPPPP    SPPPP     P V   PPPPP     P PPPPY+Y SP      PPP
Sbjct: 459 AYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPP 518

Query: 286 PYVYKSPP 309
           PY+Y SPP
Sbjct: 519 PYIYSSPP 526

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 50/119 (42%), Positives = 57/119 (47%), Gaps = 16/119 (13%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPPPYVYPSPPPPSPPPPYIY-----KSPP 159
           PP   V  SP + +   P  +   P   SPPP P  YP P   SPPPP +Y     +SPP
Sbjct: 621 PPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYP-PVTQSPPPPPVYYLPVTQSPP 679

Query: 160 PPPYVY-----NSPPPPPYVYNSP----PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PP  VY      SPPPP  VY  P    PPPP       PP    +SPPP    Y+SPP
Sbjct: 680 PPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPE---YQSPP 735

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 50/128 (39%), Positives = 53/128 (41%), Gaps = 50/128 (39%)
 Frame = +1

Query: 76  FSPPPPPY-------VYPSPPPPS---------PPPPYIYKSP-----PPPPYVYNSP-- 186
           FSPPPP +       V P PPP S         PPPP    SP     PPPP    SP  
Sbjct: 383 FSPPPPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSF 442

Query: 187 ---PPPPYVYNSP-------PPPPYVYKSPPPPPYVYKSP-----------------PPP 285
              PPPP    SP       PPPP  Y+  PPPP    SP                 PPP
Sbjct: 443 RATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPP 502

Query: 286 PYVYKSPP 309
           PY+Y SPP
Sbjct: 503 PYIYSSPP 510

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 42/109 (38%), Positives = 50/109 (45%), Gaps = 10/109 (9%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPP--PYVYPSPPPPSPPPPYIYKSPPPPP 168
           PP S V   P + +   PS +   P   SPPPP  P  Y  P  P+  PP  Y+SPPP  
Sbjct: 679 PPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPPKG 738

Query: 169 YVYNSPPPPPYVYNSPPP---PPYVYKSPPPPP---YVYKSPPPPPYVY 297
              N  P   + Y +P P   PP  Y+  P PP     Y SPPPP   Y
Sbjct: 739 --CNDSPSNDHHYQTPTPPSLPPPYYEDTPLPPIRGVSYASPPPPSIPY 785

[79][TOP]
>UniRef100_B9RIB5 Extensin, proline-rich protein, putative n=1 Tax=Ricinus communis
           RepID=B9RIB5_RICCO
          Length = 144

 Score =  106 bits (264), Expect = 9e-22
 Identities = 51/79 (64%), Positives = 53/79 (67%), Gaps = 2/79 (2%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPP--PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           SPPP PY Y SPPP  PSPPPPY Y+SPPPP    +  PPPPY Y SPPPP     SPPP
Sbjct: 32  SPPPLPYKYMSPPPPSPSPPPPYYYQSPPPP----SPSPPPPYYYKSPPPPS---PSPPP 84

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP      PPPPY YKSPP
Sbjct: 85  PP---SPSPPPPYYYKSPP 100

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 47/80 (58%), Positives = 50/80 (62%), Gaps = 2/80 (2%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSP--PPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           P   PPPPY Y SPPPPSP  PPPY YKSPPPP     SPPPPP   +  PPPPY YKSP
Sbjct: 46  PSPSPPPPYYYQSPPPPSPSPPPPYYYKSPPPPS---PSPPPPP---SPSPPPPYYYKSP 99

Query: 247 PPPPYVYKSPPPPPYVYKSP 306
           PPP     SP P   +  +P
Sbjct: 100 PPPSL---SPHPLTTINDTP 116

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 30/50 (60%), Positives = 32/50 (64%), Gaps = 12/50 (24%)
 Frame = +1

Query: 196 PYVYNSPPPPPYVYKSP------PPPPYVYKSP------PPPPYVYKSPP 309
           PY Y+SPPP PY Y SP      PPPPY Y+SP      PPPPY YKSPP
Sbjct: 28  PY-YSSPPPLPYKYMSPPPPSPSPPPPYYYQSPPPPSPSPPPPYYYKSPP 76

[80][TOP]
>UniRef100_A9SB04 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SB04_PHYPA
          Length = 328

 Score =  106 bits (264), Expect = 9e-22
 Identities = 68/138 (49%), Positives = 75/138 (54%), Gaps = 34/138 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITP-SGIGVSPF---------SPPPPPYVYPSPPPP----SPPPP 138
           PP  A S S NS+ ++   S I VS           SPPPPP    SPPPP    SPPPP
Sbjct: 144 PPRLASSHSGNSNAELRKGSRILVSTAAQNSHGVNKSPPPPPPSTSSPPPPLYKSSPPPP 203

Query: 139 Y-------IYKSPPPPPYVYNSPPP-----PPYVYNSPP--------PPPYVYKSPPPPP 258
                   +YKSPPPP Y  + PPP     PPYV +SPP        PPPYV  SPPPP 
Sbjct: 204 VLKSPLPPVYKSPPPPAYKSSPPPPLNKSSPPYVKSSPPLSPVYKSPPPPYVKSSPPPP- 262

Query: 259 YVYKSPPPPPYVYKSPPS 312
            VYKSPPPP Y  KSPP+
Sbjct: 263 -VYKSPPPPSYEKKSPPT 279

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 50/108 (46%), Positives = 53/108 (49%), Gaps = 14/108 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP----PPPPYVYPSPPPP--SPPPPYIYKSPP- 159
           PP S  S  P       P  +  SP  P    PPPP    SPPPP     PPY+  SPP 
Sbjct: 184 PPPSTSSPPPPLYKSSPPPPVLKSPLPPVYKSPPPPAYKSSPPPPLNKSSPPYVKSSPPL 243

Query: 160 -------PPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPP 282
                  PPPYV +SPPPP  VY SPPPP Y  K  PP P    SPPP
Sbjct: 244 SPVYKSPPPPYVKSSPPPP--VYKSPPPPSY-EKKSPPTPVPKSSPPP 288

[81][TOP]
>UniRef100_UPI0001A7B0C1 protein binding / structural constituent of cell wall n=1
            Tax=Arabidopsis thaliana RepID=UPI0001A7B0C1
          Length = 857

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/133 (43%), Positives = 69/133 (51%), Gaps = 32/133 (24%)
 Frame = +1

Query: 4    PFSAVSSSPNSSTKITPSGIGVSPFSPPPPP----------YVYPSPPPP-----SPPP- 135
            P   + S P  ++   P+    S   PPPPP          Y Y SPPPP     SPPP 
Sbjct: 707  PIPYLPSPPQFASPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQ 766

Query: 136  ---PYIYKSPPPPPYVYNSPPPPP-------------YVYNSPPPPPYVYKSPPPPPYVY 267
               P I  SPPPPP V+ +PPPPP             Y YNSPPPPP V+ SPPPPP ++
Sbjct: 767  SHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIH 826

Query: 268  KSPPPPPYVYKSP 306
             S PPPP +Y+ P
Sbjct: 827  HSQPPPPPIYEGP 839

 Score =  103 bits (257), Expect = 6e-21
 Identities = 63/135 (46%), Positives = 69/135 (51%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITP--SGIGVSPF-----SPPPP-PYVYPSPPPPSPP-------- 132
            PP  + S  P S    TP  S I   P      SPPPP PY Y SP PP PP        
Sbjct: 686  PPQPSPSQPPQSPIYGTPPPSPIPYLPSPPQFASPPPPAPYYYSSPQPPPPPHYSLPPPT 745

Query: 133  PPYIYKSPPPPPYVYNSPPP---PPYVYNSPPPPPYVYKSPPPPP-------------YV 264
            P Y Y SPPPPP   +SPPP   PP +  SPPPPP V+ +PPPPP             Y 
Sbjct: 746  PTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYY 805

Query: 265  YKSPPPPPYVYKSPP 309
            Y SPPPPP V+ SPP
Sbjct: 806  YNSPPPPPAVHYSPP 820

 Score =  102 bits (255), Expect = 1e-20
 Identities = 54/107 (50%), Positives = 64/107 (59%), Gaps = 10/107 (9%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP--------PPPYIYKSP 156
            PP + + S P  S    P  I  SP  PPPP   Y  PPPPSP        PP Y Y SP
Sbjct: 755  PPPTPIHSPPPQSH---PPCIEYSP--PPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSP 809

Query: 157  PPPPYVYNSPPPPPYVYNSPPPPPYVYKSP-PPPPYV-YKSPPPPPY 291
            PPPP V+ SPPPPP +++S PPPP +Y+ P PP P + Y SPPPPP+
Sbjct: 810  PPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPPPF 856

 Score =  102 bits (254), Expect = 1e-20
 Identities = 48/81 (59%), Positives = 57/81 (70%), Gaps = 3/81 (3%)
 Frame = +1

Query: 76   FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPP-YVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            +SPPPPP V+ +PPPP  P P  Y  PP PP Y YNSPPPPP V+ SPPPPP ++ S PP
Sbjct: 774  YSPPPPPTVHYNPPPP--PSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPP 831

Query: 253  PPYVYKSP-PPPPYV-YKSPP 309
            PP +Y+ P PP P + Y SPP
Sbjct: 832  PPPIYEGPLPPIPGISYASPP 852

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 55/129 (42%), Positives = 60/129 (46%), Gaps = 26/129 (20%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPY------------- 141
            PPF+  S  P S     P     SP  PPPPP  Y   PPP PPPP              
Sbjct: 638  PPFTGYS--PPSPPPPPPPTFSPSPSIPPPPPQTYSPFPPPPPPPPQTYYPPQPSPSQPP 695

Query: 142  ---IYKSPPPPPYVY--------NSPPPPPYVYNS--PPPPPYVYKSPPPPPYVYKSPPP 282
               IY +PPP P  Y        + PPP PY Y+S  PPPPP+    PP P Y Y SPPP
Sbjct: 696  QSPIYGTPPPSPIPYLPSPPQFASPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPP 755

Query: 283  PPYVYKSPP 309
            PP    SPP
Sbjct: 756  PPTPIHSPP 764

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 53/118 (44%), Positives = 60/118 (50%), Gaps = 14/118 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKI-----TPSGIGVSPFSPPP--PPYVYPSPPPPS----PPPPYIY 147
           PPF+  S   + S  +     +P  +G +P SPPP  P  VY SPPPPS    PPPP+  
Sbjct: 584 PPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTPVY-SPPPPSTGYPPPPPFTG 642

Query: 148 KSPPPPPYVYNSPPPPPYVYNS---PPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            SPP PP     PPPPP    S   PPPPP  Y   PPPP     PPPP   Y   PS
Sbjct: 643 YSPPSPP-----PPPPPTFSPSPSIPPPPPQTYSPFPPPP-----PPPPQTYYPPQPS 690

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 47/122 (38%), Positives = 58/122 (47%), Gaps = 18/122 (14%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFS----PPPPPYVYPSPPPPSPPPPYIYKS----P 156
           PP   V  +P+S    TP+ +   P      PPPPP+   SPP P PPPP  +      P
Sbjct: 606 PPI--VGPTPSSPPPSTPTPVYSPPPPSTGYPPPPPFTGYSPPSPPPPPPPTFSPSPSIP 663

Query: 157 PPPPYVYNS----PPPPPYVYNSPPPPPY------VYKSPPPPPYVYKSPPPPPYVYKSP 306
           PPPP  Y+     PPPPP  Y  P P P       +Y +PPP P  Y  P PP +    P
Sbjct: 664 PPPPQTYSPFPPPPPPPPQTYYPPQPSPSQPPQSPIYGTPPPSPIPYL-PSPPQFASPPP 722

Query: 307 PS 312
           P+
Sbjct: 723 PA 724

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 53/134 (39%), Positives = 58/134 (43%), Gaps = 33/134 (24%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGV-SPFSPPPPPYVYPSPPP-PSPPPPYIYKSPP------ 159
           P S + S P  ST  TP   G  SP   P PP+  PSPP  PSPP P +  SPP      
Sbjct: 554 PSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTP 613

Query: 160 -------------PPPYVYNSPPPPPYVYNS----PPPPPYVYKS----PPPPPYVYK-- 270
                        PPP     PPPPP+   S    PPPPP  +      PPPPP  Y   
Sbjct: 614 SSPPPSTPTPVYSPPPPSTGYPPPPPFTGYSPPSPPPPPPPTFSPSPSIPPPPPQTYSPF 673

Query: 271 --SPPPPPYVYKSP 306
              PPPPP  Y  P
Sbjct: 674 PPPPPPPPQTYYPP 687

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 53/131 (40%), Positives = 60/131 (45%), Gaps = 27/131 (20%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPS-----GIGVSPFSPPPPPYVYPSPPPPSPPP---------P 138
           PP  ++S SP  +    PS     G   SP SP P   + PSPP PS PP         P
Sbjct: 520 PPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPI-PSPPTPSTPPTPISPGQNSP 578

Query: 139 YIYKSPP---PPPYVYNSPPPPPYVYNSP--------PPP--PYVYKSPPPPPYVYKSPP 279
            I  SPP   P P    SPP PP + + P        PPP  P    SPPPP   Y  PP
Sbjct: 579 PIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTPVYSPPPPSTGY--PP 636

Query: 280 PPPYVYKSPPS 312
           PPP+   SPPS
Sbjct: 637 PPPFTGYSPPS 647

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 43/104 (41%), Positives = 49/104 (47%), Gaps = 7/104 (6%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS--PPPPYIYKSPPPPPYVYNSPPPP 195
           S P+S T  TP G   SP S P  P    SPP PS  P PP    SPP  P    SPP P
Sbjct: 493 SPPSSPTTPTPGG---SPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSP 549

Query: 196 PY-VYNSPPPPPYVYKSPPPPPYVYKSPPP----PPYVYKSPPS 312
                +SP P P    +PP P    ++ PP    PP+   SPPS
Sbjct: 550 SSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPS 593

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 7/50 (14%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP------SPPPPYIYKSPPPP-PYVYNSPPPPPYVY 207
           SPPPPP V+ SPPPP       PPPP IY+ P PP P +  + PPPP  Y
Sbjct: 808 SPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPPPFY 857

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 43/126 (34%), Positives = 49/126 (38%), Gaps = 22/126 (17%)
 Frame = +1

Query: 1   PPFSAVSSSP-----NSSTKITPSGIGVSPFSPPPPPYVYPSP--PPPSPPPPYIYKSPP 159
           PP  ++S SP     +  T  +P G   SP   P PP   PSP  PP SP  P    SPP
Sbjct: 423 PPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPP 482

Query: 160 PPPYVYNSPPPPPYVYNSPPP---PPYVYKSPPP------------PPYVYKSPPPPPYV 294
             P        PP    +P P   PP    +P P            PP    SPP  P  
Sbjct: 483 SSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTS 542

Query: 295 YKSPPS 312
             SPPS
Sbjct: 543 PGSPPS 548

[82][TOP]
>UniRef100_Q3ECC3 Putative uncharacterized protein At1g76930.1 n=1 Tax=Arabidopsis
           thaliana RepID=Q3ECC3_ARATH
          Length = 293

 Score =  105 bits (262), Expect = 2e-21
 Identities = 67/128 (52%), Positives = 71/128 (55%), Gaps = 31/128 (24%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPP-----PPYVYPSPPPP----SPPPPYIYKSPPPPPY 171
           SS P      +P  +  SP  PPP     PP VY SPPPP    SPPP  +YKSPPPP  
Sbjct: 28  SSPPPPVKHYSPPPVYKSP--PPPVKHYSPPPVYKSPPPPVKHYSPPP--VYKSPPPPVK 83

Query: 172 VYNSPP----PPPYVYNSPPP------PPYVYKSPPP------PPYVYKSPPP------P 285
            Y+ PP    PPP VY SPPP      PP VYKSPPP      PP VYKSPPP      P
Sbjct: 84  YYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 143

Query: 286 PYVYKSPP 309
           P VYKSPP
Sbjct: 144 PPVYKSPP 151

 Score =  102 bits (255), Expect = 1e-20
 Identities = 59/109 (54%), Positives = 63/109 (57%), Gaps = 31/109 (28%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP----PSPP-----PPYIYKSPPP------PPYVYNSPPPPPYVYN 210
           +S PPPP  + SPPP    P PP     PP +YKSPPP      PP VY SPPPP   Y+
Sbjct: 27  YSSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYS 86

Query: 211 SPP----PPPYVYKSPPP------PPYVYKSPPP------PPYVYKSPP 309
            PP    PPP VYKSPPP      PP VYKSPPP      PP VYKSPP
Sbjct: 87  PPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 135

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 58/99 (58%), Positives = 59/99 (59%), Gaps = 28/99 (28%)
 Frame = +1

Query: 97  YVYPSPPPP----SPPPPYIYKSPPP------PPYVYNSPPP------PPYVYNSPPP-- 222
           Y Y SPPPP    SPPP  +YKSPPP      PP VY SPPP      PP VY SPPP  
Sbjct: 25  YFYSSPPPPVKHYSPPP--VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPV 82

Query: 223 ----PPYVYKSPPPPPYVYKSPPP------PPYVYKSPP 309
               PP VYKSPPPP  VYKSPPP      PP VYKSPP
Sbjct: 83  KYYSPPPVYKSPPPP--VYKSPPPPVKHYSPPPVYKSPP 119

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 53/93 (56%), Positives = 56/93 (60%), Gaps = 14/93 (15%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP--PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPP------PPY 231
           +  PPPP  Y SPPP   SPPPP +YKSPPPP   Y+ PP    VY SPPP      PP 
Sbjct: 75  YKSPPPPVKYYSPPPVYKSPPPP-VYKSPPPPVKHYSPPP----VYKSPPPPVKHYSPPP 129

Query: 232 VYKSPPP------PPYVYKSPPPPPYVYKSPPS 312
           VYKSPPP      PP VYKSPPPP   Y  PPS
Sbjct: 130 VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPS 162

[83][TOP]
>UniRef100_Q304C4 Putative uncharacterized protein At1g76930.2 n=1 Tax=Arabidopsis
           thaliana RepID=Q304C4_ARATH
          Length = 256

 Score =  105 bits (262), Expect = 2e-21
 Identities = 67/128 (52%), Positives = 71/128 (55%), Gaps = 31/128 (24%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPP-----PPYVYPSPPPP----SPPPPYIYKSPPPPPY 171
           SS P      +P  +  SP  PPP     PP VY SPPPP    SPPP  +YKSPPPP  
Sbjct: 28  SSPPPPVKHYSPPPVYKSP--PPPVKHYSPPPVYKSPPPPVKHYSPPP--VYKSPPPPVK 83

Query: 172 VYNSPP----PPPYVYNSPPP------PPYVYKSPPP------PPYVYKSPPP------P 285
            Y+ PP    PPP VY SPPP      PP VYKSPPP      PP VYKSPPP      P
Sbjct: 84  YYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 143

Query: 286 PYVYKSPP 309
           P VYKSPP
Sbjct: 144 PPVYKSPP 151

 Score =  102 bits (255), Expect = 1e-20
 Identities = 59/109 (54%), Positives = 63/109 (57%), Gaps = 31/109 (28%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP----PSPP-----PPYIYKSPPP------PPYVYNSPPPPPYVYN 210
           +S PPPP  + SPPP    P PP     PP +YKSPPP      PP VY SPPPP   Y+
Sbjct: 27  YSSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYS 86

Query: 211 SPP----PPPYVYKSPPP------PPYVYKSPPP------PPYVYKSPP 309
            PP    PPP VYKSPPP      PP VYKSPPP      PP VYKSPP
Sbjct: 87  PPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 135

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 58/99 (58%), Positives = 59/99 (59%), Gaps = 28/99 (28%)
 Frame = +1

Query: 97  YVYPSPPPP----SPPPPYIYKSPPP------PPYVYNSPPP------PPYVYNSPPP-- 222
           Y Y SPPPP    SPPP  +YKSPPP      PP VY SPPP      PP VY SPPP  
Sbjct: 25  YFYSSPPPPVKHYSPPP--VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPV 82

Query: 223 ----PPYVYKSPPPPPYVYKSPPP------PPYVYKSPP 309
               PP VYKSPPPP  VYKSPPP      PP VYKSPP
Sbjct: 83  KYYSPPPVYKSPPPP--VYKSPPPPVKHYSPPPVYKSPP 119

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 53/93 (56%), Positives = 56/93 (60%), Gaps = 14/93 (15%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP--PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPP------PPY 231
           +  PPPP  Y SPPP   SPPPP +YKSPPPP   Y+ PP    VY SPPP      PP 
Sbjct: 75  YKSPPPPVKYYSPPPVYKSPPPP-VYKSPPPPVKHYSPPP----VYKSPPPPVKHYSPPP 129

Query: 232 VYKSPPP------PPYVYKSPPPPPYVYKSPPS 312
           VYKSPPP      PP VYKSPPPP   Y  PPS
Sbjct: 130 VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPS 162

[84][TOP]
>UniRef100_O04216 Extensin (Fragment) n=1 Tax=Bromheadia finlaysoniana
           RepID=O04216_BROFI
          Length = 71

 Score =  105 bits (262), Expect = 2e-21
 Identities = 49/76 (64%), Positives = 51/76 (67%), Gaps = 3/76 (3%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           P   PPPPY Y SPPP  PSPPPPY YKSPPPP    +  PPPPY Y SPPPPP      
Sbjct: 4   PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP----SPSPPPPYYYKSPPPPP----PS 55

Query: 247 PPPPYVYKSPPPP-PY 291
           PPP Y+Y SPPPP PY
Sbjct: 56  PPPTYIYSSPPPPIPY 71

 Score =  101 bits (251), Expect = 3e-20
 Identities = 48/75 (64%), Positives = 50/75 (66%), Gaps = 7/75 (9%)
 Frame = +1

Query: 106 PSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP-PPPPYVYKSPPP 282
           P PP PSPPPPY YKSPPPP    +  PPPPY Y SPPPP     SP PPPPY YKSPPP
Sbjct: 1   PPPPSPSPPPPYYYKSPPPP----SPSPPPPYYYKSPPPP-----SPSPPPPYYYKSPPP 51

Query: 283 PP------YVYKSPP 309
           PP      Y+Y SPP
Sbjct: 52  PPPSPPPTYIYSSPP 66

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/80 (55%), Positives = 47/80 (58%), Gaps = 3/80 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP--PPPYIYKSPPPPPYV 174
           PP  + S  P    K  P      P   PPPPY Y SPPPPSP  PPPY YKSPPPPP  
Sbjct: 1   PPPPSPSPPPPYYYKSPPP-----PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPP-- 53

Query: 175 YNSPPPPPYVYNSPPPP-PY 231
               PPP Y+Y+SPPPP PY
Sbjct: 54  --PSPPPTYIYSSPPPPIPY 71

[85][TOP]
>UniRef100_Q38913-2 Isoform 2 of Extensin-1 n=1 Tax=Arabidopsis thaliana RepID=Q38913-2
          Length = 246

 Score =  105 bits (262), Expect = 2e-21
 Identities = 67/128 (52%), Positives = 71/128 (55%), Gaps = 31/128 (24%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPP-----PPYVYPSPPPP----SPPPPYIYKSPPPPPY 171
           SS P      +P  +  SP  PPP     PP VY SPPPP    SPPP  +YKSPPPP  
Sbjct: 24  SSPPPPVKHYSPPPVYKSP--PPPVKHYSPPPVYKSPPPPVKHYSPPP--VYKSPPPPVK 79

Query: 172 VYNSPP----PPPYVYNSPPP------PPYVYKSPPP------PPYVYKSPPP------P 285
            Y+ PP    PPP VY SPPP      PP VYKSPPP      PP VYKSPPP      P
Sbjct: 80  YYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 139

Query: 286 PYVYKSPP 309
           P VYKSPP
Sbjct: 140 PPVYKSPP 147

 Score =  105 bits (261), Expect = 2e-21
 Identities = 68/138 (49%), Positives = 73/138 (52%), Gaps = 35/138 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPP-----PPYVYPSPPPP----SPPPPYIYKS 153
           PP     S P      +P  +  SP  PPP     PP VY SPPPP    SPPP  +YKS
Sbjct: 90  PPPPVYKSPPPPVKHYSPPPVYKSP--PPPVKHYSPPPVYKSPPPPVKHYSPPP--VYKS 145

Query: 154 PPPP-------PYVYNSPPPP------PYVYNSPPPP------PYVYKSPPPPP--YVYK 270
           PPPP       P VY+SPPPP      P VY+SPPPP      P VY SPPPP   Y YK
Sbjct: 146 PPPPVKHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPKKHYEYK 205

Query: 271 SPPP-----PPYVYKSPP 309
           SPPP     PP VY SPP
Sbjct: 206 SPPPPVHYSPPTVYHSPP 223

 Score =  102 bits (255), Expect = 1e-20
 Identities = 59/109 (54%), Positives = 63/109 (57%), Gaps = 31/109 (28%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP----PSPP-----PPYIYKSPPP------PPYVYNSPPPPPYVYN 210
           +S PPPP  + SPPP    P PP     PP +YKSPPP      PP VY SPPPP   Y+
Sbjct: 23  YSSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYS 82

Query: 211 SPP----PPPYVYKSPPP------PPYVYKSPPP------PPYVYKSPP 309
            PP    PPP VYKSPPP      PP VYKSPPP      PP VYKSPP
Sbjct: 83  PPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 131

 Score =  102 bits (255), Expect = 1e-20
 Identities = 60/121 (49%), Positives = 66/121 (54%), Gaps = 19/121 (15%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSP----PPPPYVYPSPPPP--SPPPPYIYKSPP-- 159
           P     S P      +P  +  SP  P     PPP VY SPPPP    PPP +Y SPP  
Sbjct: 123 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPP 182

Query: 160 ----PPPYVYNSPPPPP--YVYNSPPP-----PPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
               PPP VY+SPPPP   Y Y SPPP     PP VY SPPPP + Y SPP  PY+YKSP
Sbjct: 183 VHYSPPPVVYHSPPPPKKHYEYKSPPPPVHYSPPTVYHSPPPPVHHY-SPPHQPYLYKSP 241

Query: 307 P 309
           P
Sbjct: 242 P 242

 Score =  101 bits (251), Expect = 3e-20
 Identities = 60/111 (54%), Positives = 62/111 (55%), Gaps = 33/111 (29%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP--PSPPPPYIYKSPPP------PPYVYNSPPP------PPYVYNS 213
           +  PPPP  Y SPPP   SPPPP +YKSPPP      PP VY SPPP      PP VY S
Sbjct: 71  YKSPPPPVKYYSPPPVYKSPPPP-VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKS 129

Query: 214 PPP------PPYVYKSPP-------PPPYVYKSPP------PPPYVYKSPP 309
           PPP      PP VYKSPP       PPP VY SPP      PPP VY SPP
Sbjct: 130 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVVYHSPPPPVHYSPPPVVYHSPP 180

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 51/86 (59%), Positives = 55/86 (63%), Gaps = 15/86 (17%)
 Frame = +1

Query: 79  SPPPP------PYVYPSPPPPS--PPPPYIYKSPPPPP--YVYNSPPPP-----PYVYNS 213
           SPPPP      P VY SPPPP    PPP +Y SPPPP   Y Y SPPPP     P VY+S
Sbjct: 162 SPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPKKHYEYKSPPPPVHYSPPTVYHS 221

Query: 214 PPPPPYVYKSPPPPPYVYKSPPPPPY 291
           PPPP + Y SPP  PY+YKSPPPP Y
Sbjct: 222 PPPPVHHY-SPPHQPYLYKSPPPPHY 246

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 58/99 (58%), Positives = 59/99 (59%), Gaps = 28/99 (28%)
 Frame = +1

Query: 97  YVYPSPPPP----SPPPPYIYKSPPP------PPYVYNSPPP------PPYVYNSPPP-- 222
           Y Y SPPPP    SPPP  +YKSPPP      PP VY SPPP      PP VY SPPP  
Sbjct: 21  YFYSSPPPPVKHYSPPP--VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPV 78

Query: 223 ----PPYVYKSPPPPPYVYKSPPP------PPYVYKSPP 309
               PP VYKSPPPP  VYKSPPP      PP VYKSPP
Sbjct: 79  KYYSPPPVYKSPPPP--VYKSPPPPVKHYSPPPVYKSPP 115

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 41/93 (44%), Positives = 46/93 (49%), Gaps = 17/93 (18%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSPP----PPPYVYPSPPPP-------SPPPPY--- 141
           P   V  SP      +P  +      PP    PPP VY SPPPP       SPPPP    
Sbjct: 155 PPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPKKHYEYKSPPPPVHYS 214

Query: 142 ---IYKSPPPPPYVYNSPPPPPYVYNSPPPPPY 231
              +Y SPPPP + Y SPP  PY+Y SPPPP Y
Sbjct: 215 PPTVYHSPPPPVHHY-SPPHQPYLYKSPPPPHY 246

[86][TOP]
>UniRef100_Q38913 Extensin-1 n=1 Tax=Arabidopsis thaliana RepID=EXTN1_ARATH
          Length = 373

 Score =  105 bits (262), Expect = 2e-21
 Identities = 67/128 (52%), Positives = 71/128 (55%), Gaps = 31/128 (24%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPP-----PPYVYPSPPPP----SPPPPYIYKSPPPPPY 171
           SS P      +P  +  SP  PPP     PP VY SPPPP    SPPP  +YKSPPPP  
Sbjct: 24  SSPPPPVKHYSPPPVYKSP--PPPVKHYSPPPVYKSPPPPVKHYSPPP--VYKSPPPPVK 79

Query: 172 VYNSPP----PPPYVYNSPPP------PPYVYKSPPP------PPYVYKSPPP------P 285
            Y+ PP    PPP VY SPPP      PP VYKSPPP      PP VYKSPPP      P
Sbjct: 80  YYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 139

Query: 286 PYVYKSPP 309
           P VYKSPP
Sbjct: 140 PPVYKSPP 147

 Score =  104 bits (260), Expect = 3e-21
 Identities = 62/110 (56%), Positives = 64/110 (58%), Gaps = 32/110 (29%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP--PSPPPPYIYKSPPP------PPYVYNSPPP------PPYVYNS 213
           +  PPPP  Y SPPP   SPPPP +YKSPPP      PP VY SPPP      PP VY S
Sbjct: 71  YKSPPPPVKYYSPPPVYKSPPPP-VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKS 129

Query: 214 PPP------PPYVYKSPPP------PPYVYKSPPP------PPYVYKSPP 309
           PPP      PP VYKSPPP      PP VYKSPPP      PP VYKSPP
Sbjct: 130 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPP 179

 Score =  103 bits (258), Expect = 4e-21
 Identities = 64/132 (48%), Positives = 69/132 (52%), Gaps = 30/132 (22%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPP--SPPPPYIYKSPP--- 159
           P     S P      +P  +  SP  P    PPP VY SPPPP    PPP +Y SPP   
Sbjct: 219 PPPVYKSPPPPVKYYSPPPVYKSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPV 278

Query: 160 ---PPPYVYNSPP------PPPYVYNSPP------PPPYVYKSPPPPP--YVYKSPPP-- 282
              PPP VY+SPP      PPP VY+SPP      PPP VY SPPPP   Y YKSPPP  
Sbjct: 279 HYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPKKHYEYKSPPPPV 338

Query: 283 ---PPYVYKSPP 309
              PP VY SPP
Sbjct: 339 HYSPPTVYHSPP 350

 Score =  103 bits (256), Expect = 8e-21
 Identities = 60/121 (49%), Positives = 66/121 (54%), Gaps = 19/121 (15%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSPP----PPPYVYPSPPPP--SPPPPYIYKSPP-- 159
           P   V  SP      +P  +      PP    PPP VY SPPPP    PPP +Y SPP  
Sbjct: 250 PPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPP 309

Query: 160 ----PPPYVYNSPPPPP--YVYNSPPP-----PPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
               PPP VY+SPPPP   Y Y SPPP     PP VY SPPPP + Y SPP  PY+YKSP
Sbjct: 310 VHYSPPPVVYHSPPPPKKHYEYKSPPPPVHYSPPTVYHSPPPPVHHY-SPPHQPYLYKSP 368

Query: 307 P 309
           P
Sbjct: 369 P 369

 Score =  102 bits (255), Expect = 1e-20
 Identities = 59/109 (54%), Positives = 63/109 (57%), Gaps = 31/109 (28%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP----PSPP-----PPYIYKSPPP------PPYVYNSPPPPPYVYN 210
           +S PPPP  + SPPP    P PP     PP +YKSPPP      PP VY SPPPP   Y+
Sbjct: 23  YSSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYS 82

Query: 211 SPP----PPPYVYKSPPP------PPYVYKSPPP------PPYVYKSPP 309
            PP    PPP VYKSPPP      PP VYKSPPP      PP VYKSPP
Sbjct: 83  PPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 131

 Score =  100 bits (249), Expect = 5e-20
 Identities = 68/141 (48%), Positives = 71/141 (50%), Gaps = 39/141 (27%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSPPP-----PPYVYPSPPPP----SPPPPYIYKSP 156
           P     S P      +P  +  SP  PPP     PP VY SPPPP    SPPP  +YKSP
Sbjct: 139 PPPVYKSPPPPVKHYSPPPVYKSP--PPPVKYYSPPPVYKSPPPPVKHYSPPP--VYKSP 194

Query: 157 PP------PPYVYNSPPP------PPYVYNSPPP------PPYVYKSPP------PPPYV 264
           PP      PP VY SPPP      PP VY SPPP      PP VYKSPP      PPP V
Sbjct: 195 PPPVKYYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVHYSPPPVV 254

Query: 265 YKSPP------PPPYVYKSPP 309
           Y SPP      PPP VY SPP
Sbjct: 255 YHSPPPPVHYSPPPVVYHSPP 275

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 70/155 (45%), Positives = 73/155 (47%), Gaps = 52/155 (33%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP------FSPPP-------------PPYVYPSPPPP 123
           PP     S P      +P  +  SP      +SPPP             PP VY SPPPP
Sbjct: 90  PPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 149

Query: 124 ----SPPPPYIYKSPPP-----PPYVYNSPPP------PPYVYNSPPP------PPYVYK 240
               SPPP Y    PPP     PP VY SPPP      PP VY SPPP      PP VYK
Sbjct: 150 VKHYSPPPVY-KSPPPPVKYYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYK 208

Query: 241 SPPP------PPYVYKSPPP------PPYVYKSPP 309
           SPPP      PP VYKSPPP      PP VYKSPP
Sbjct: 209 SPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPP 243

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 55/109 (50%), Positives = 61/109 (55%), Gaps = 13/109 (11%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSPP----PPPYVYPSPPPPS--PPPPYIYKSPPPP 165
           P   V  SP      +P  +      PP    PPP VY SPPPP    PPP +Y SPPPP
Sbjct: 266 PPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPP 325

Query: 166 P--YVYNSPPPP-----PYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPY 291
              Y Y SPPPP     P VY+SPPPP + Y SPP  PY+YKSPPPP Y
Sbjct: 326 KKHYEYKSPPPPVHYSPPTVYHSPPPPVHHY-SPPHQPYLYKSPPPPHY 373

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 58/99 (58%), Positives = 59/99 (59%), Gaps = 28/99 (28%)
 Frame = +1

Query: 97  YVYPSPPPP----SPPPPYIYKSPPP------PPYVYNSPPP------PPYVYNSPPP-- 222
           Y Y SPPPP    SPPP  +YKSPPP      PP VY SPPP      PP VY SPPP  
Sbjct: 21  YFYSSPPPPVKHYSPPP--VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPV 78

Query: 223 ----PPYVYKSPPPPPYVYKSPPP------PPYVYKSPP 309
               PP VYKSPPPP  VYKSPPP      PP VYKSPP
Sbjct: 79  KYYSPPPVYKSPPPP--VYKSPPPPVKHYSPPPVYKSPP 115

[87][TOP]
>UniRef100_Q9SN46 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9SN46_ARATH
          Length = 839

 Score =  105 bits (261), Expect = 2e-21
 Identities = 49/89 (55%), Positives = 56/89 (62%), Gaps = 13/89 (14%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPP-------------YVYNSPP 219
           SPPPPP    SPPP S PP   Y SPPPPP V+ +PPPPP             Y YNSPP
Sbjct: 734 SPPPPPTPIHSPPPQSHPPCIEY-SPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPP 792

Query: 220 PPPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
           PPP V+ SPPPPP ++ S PPPP +Y+ P
Sbjct: 793 PPPAVHYSPPPPPVIHHSQPPPPPIYEGP 821

 Score =  102 bits (255), Expect = 1e-20
 Identities = 54/107 (50%), Positives = 64/107 (59%), Gaps = 10/107 (9%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP--------PPPYIYKSP 156
            PP + + S P  S    P  I  SP  PPPP   Y  PPPPSP        PP Y Y SP
Sbjct: 737  PPPTPIHSPPPQSH---PPCIEYSP--PPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSP 791

Query: 157  PPPPYVYNSPPPPPYVYNSPPPPPYVYKSP-PPPPYV-YKSPPPPPY 291
            PPPP V+ SPPPPP +++S PPPP +Y+ P PP P + Y SPPPPP+
Sbjct: 792  PPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPPPF 838

 Score =  102 bits (254), Expect = 1e-20
 Identities = 48/81 (59%), Positives = 57/81 (70%), Gaps = 3/81 (3%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPP-YVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           +SPPPPP V+ +PPPP  P P  Y  PP PP Y YNSPPPPP V+ SPPPPP ++ S PP
Sbjct: 756 YSPPPPPTVHYNPPPP--PSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPP 813

Query: 253 PPYVYKSP-PPPPYV-YKSPP 309
           PP +Y+ P PP P + Y SPP
Sbjct: 814 PPPIYEGPLPPIPGISYASPP 834

 Score =  102 bits (253), Expect = 2e-20
 Identities = 51/100 (51%), Positives = 56/100 (56%), Gaps = 24/100 (24%)
 Frame = +1

Query: 82   PPPPPYVYPSPPPPSPP--------PPYIYKSPPPPPYVYNSPPP---PPYVYNSPPPPP 228
            PPP PY Y SP PP PP        P Y Y SPPPPP   +SPPP   PP +  SPPPPP
Sbjct: 703  PPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPP 762

Query: 229  YVYKSPPPPP-------------YVYKSPPPPPYVYKSPP 309
             V+ +PPPPP             Y Y SPPPPP V+ SPP
Sbjct: 763  TVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPP 802

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 40/68 (58%), Positives = 44/68 (64%), Gaps = 5/68 (7%)
 Frame = +1

Query: 121 PSPPPPYIYKSP-PPPPYVYNSPPPPP-YVYNSPPPPPYVYKSPPP---PPYVYKSPPPP 285
           P PP PY Y SP PPPP  Y+ PPP P Y Y SPPPPP    SPPP   PP +  SPPPP
Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPP 761

Query: 286 PYVYKSPP 309
           P V+ +PP
Sbjct: 762 PTVHYNPP 769

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 47/119 (39%), Positives = 51/119 (42%), Gaps = 16/119 (13%)
 Frame = +1

Query: 1   PPFSAVS-----SSPNSSTKITPSGIGVSPFSPPPPPYVYPSPP--------PPSPPPPY 141
           PP S  +     S P+S T  +P G   SP   P PP   PSPP        PPSP  P 
Sbjct: 494 PPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPT 553

Query: 142 IYKSPPPPPYVYNSPPPPPYVYNSP---PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
                P PP     P P     NSP   P PP+   SPP  P    SPP PP V  SPP
Sbjct: 554 PSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSP----SPPLPP-VIPSPP 607

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 43/104 (41%), Positives = 49/104 (47%), Gaps = 7/104 (6%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS--PPPPYIYKSPPPPPYVYNSPPPP 195
           S P+S T  TP G   SP S P  P    SPP PS  P PP    SPP  P    SPP P
Sbjct: 493 SPPSSPTTPTPGG---SPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSP 549

Query: 196 PY-VYNSPPPPPYVYKSPPPPPYVYKSPPP----PPYVYKSPPS 312
                +SP P P    +PP P    ++ PP    PP+   SPPS
Sbjct: 550 SSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPS 593

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 42/109 (38%), Positives = 50/109 (45%), Gaps = 5/109 (4%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPS-----GIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPP 165
           PP  ++S SP  +    PS     G   SP SP P   + PSPP PS PP  I      P
Sbjct: 520 PPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPI-PSPPTPSTPPTPISPGQNSP 578

Query: 166 PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           P +    P PP+   SPP  P    SPP PP +    P PP V  +P S
Sbjct: 579 PII----PSPPFTGPSPPSSP----SPPLPPVI----PSPPIVGPTPSS 615

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 27/46 (58%), Positives = 29/46 (63%), Gaps = 3/46 (6%)
 Frame = +1

Query: 181 SPPPPP-YVYNS--PPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP  Y Y+S  PPPPP+    PP P Y Y SPPPPP    SPP
Sbjct: 701 SPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPP 746

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 7/50 (14%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP------SPPPPYIYKSPPPP-PYVYNSPPPPPYVY 207
           SPPPPP V+ SPPPP       PPPP IY+ P PP P +  + PPPP  Y
Sbjct: 790 SPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPPPFY 839

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 43/126 (34%), Positives = 49/126 (38%), Gaps = 22/126 (17%)
 Frame = +1

Query: 1   PPFSAVSSSP-----NSSTKITPSGIGVSPFSPPPPPYVYPSP--PPPSPPPPYIYKSPP 159
           PP  ++S SP     +  T  +P G   SP   P PP   PSP  PP SP  P    SPP
Sbjct: 423 PPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPP 482

Query: 160 PPPYVYNSPPPPPYVYNSPPP---PPYVYKSPPP------------PPYVYKSPPPPPYV 294
             P        PP    +P P   PP    +P P            PP    SPP  P  
Sbjct: 483 SSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTS 542

Query: 295 YKSPPS 312
             SPPS
Sbjct: 543 PGSPPS 548

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 40/103 (38%), Positives = 46/103 (44%), Gaps = 8/103 (7%)
 Frame = +1

Query: 1   PPFSAVS-SSPNSSTKITPSGIGVSPFSPPPPPYVYPSP-------PPPSPPPPYIYKSP 156
           PP +  S  SP S +  TPS    SP   PP P   P+P       PP  P PP+   SP
Sbjct: 536 PPSTPTSPGSPPSPSSPTPS----SPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSP 591

Query: 157 PPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
           P  P    SPP PP +    P PP V  +P  PP    S P P
Sbjct: 592 PSSP----SPPLPPVI----PSPPIVGPTPSSPP---PSTPTP 623

[88][TOP]
>UniRef100_UPI00019841A9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019841A9
          Length = 525

 Score =  104 bits (259), Expect = 3e-21
 Identities = 58/106 (54%), Positives = 65/106 (61%), Gaps = 4/106 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP   V  SP  +   +P  +    FSPPPP  V  SPPPPSPPPP    SPPPPP VY 
Sbjct: 412 PPSPPVFPSPPPTPVYSPPPV----FSPPPP--VLSSPPPPSPPPPS--PSPPPPP-VY- 461

Query: 181 SPPPPPYVYNSPPPPPYVYKSP----PPPPYVYKSPPPPPYVYKSP 306
           SPPPPP VY+ PPPPP     P    PPPP +Y+SPPPP  VY+ P
Sbjct: 462 SPPPPPPVYSPPPPPPPPPPPPPVXSPPPPIIYESPPPPTPVYEGP 507

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 48/92 (52%), Positives = 53/92 (57%), Gaps = 13/92 (14%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP---------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPP 225
           P  PPP P V+PSPPP          SPPPP +   PPP P   +  PPPP VY SPPPP
Sbjct: 408 PTPPPPSPPVFPSPPPTPVYSPPPVFSPPPPVLSSPPPPSPPPPSPSPPPPPVY-SPPPP 466

Query: 226 PYVYKSPPPPPYVYKSP----PPPPYVYKSPP 309
           P VY  PPPPP     P    PPPP +Y+SPP
Sbjct: 467 PPVYSPPPPPPPPPPPPPVXSPPPPIIYESPP 498

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/89 (50%), Positives = 50/89 (56%), Gaps = 2/89 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P S    +PS      +SPPPPP VY  PPPP PPPP      PPPP +Y 
Sbjct: 436 PPPVLSSPPPPSPPPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPPPPVXSPPPPIIYE 495

Query: 181 SPPPPPYVYNSPPPPPY--VYKSPPPPPY 261
           SPPPP  VY  P PP +   Y SPPPPP+
Sbjct: 496 SPPPPTPVYEGPLPPIFGVSYASPPPPPF 524

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/102 (51%), Positives = 58/102 (56%), Gaps = 5/102 (4%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPY 171
           PP   +SS P       PS    SP SPPPPP VY  PPPP   SPPPP     PPPPP 
Sbjct: 435 PPPPVLSSPP------PPSPPPPSP-SPPPPP-VYSPPPPPPVYSPPPP----PPPPPPP 482

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPPPY--VYKSPPPPPY 291
                PPPP +Y SPPPP  VY+ P PP +   Y SPPPPP+
Sbjct: 483 PPVXSPPPPIIYESPPPPTPVYEGPLPPIFGVSYASPPPPPF 524

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 51/108 (47%), Positives = 59/108 (54%), Gaps = 5/108 (4%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPP---PPSPPPPYIYKSPPPPPY 171
           PP + V S P   +   P      P SPPPP    P PP   PP PPP  +Y  PPPPP 
Sbjct: 421 PPPTPVYSPPPVFSPPPPVLSSPPPPSPPPPSPSPPPPPVYSPPPPPP--VYSPPPPPP- 477

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPY--VYKSPP 309
               PPPPP V +  PPPP +Y+SPPPP  VY+ P PP +   Y SPP
Sbjct: 478 ---PPPPPPPVXS--PPPPIIYESPPPPTPVYEGPLPPIFGVSYASPP 520

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/95 (50%), Positives = 51/95 (53%), Gaps = 4/95 (4%)
 Frame = +1

Query: 37  STKITPSGIGVSPFSPPPPPYVYPSPPP-PSPPPPYIYKSPP---PPPYVYNSPPPPPYV 204
           S  +  S    SPF P  P    PSPP  PSPPP  +Y  PP   PPP V +SPPPP   
Sbjct: 390 SRPVDCSSFRCSPFVPSLPTPPPPSPPVFPSPPPTPVYSPPPVFSPPPPVLSSPPPPSPP 449

Query: 205 YNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             SP PPP    SPPPPP VY  PPPPP     PP
Sbjct: 450 PPSPSPPPPPVYSPPPPPPVYSPPPPPP--PPPPP 482

[89][TOP]
>UniRef100_Q07PB7 Peptidase C14, caspase catalytic subunit p20 n=1 Tax=Rhodopseudomonas
            palustris BisA53 RepID=Q07PB7_RHOP5
          Length = 1067

 Score =  103 bits (257), Expect = 6e-21
 Identities = 45/84 (53%), Positives = 55/84 (65%), Gaps = 7/84 (8%)
 Frame = +1

Query: 79   SPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
            +PPPPP V P PPPP      +PPPP +  +PPPPP V  +PPPPP    +PPPPP V +
Sbjct: 932  APPPPPVVRPPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARPAPPPPPPVVR 991

Query: 241  SPPPPPYVYK-SPPPPPYVYKSPP 309
             PPPPP   + +PPPPP V + PP
Sbjct: 992  PPPPPPPAARPAPPPPPPVVRPPP 1015

 Score =  100 bits (250), Expect = 4e-20
 Identities = 49/120 (40%), Positives = 62/120 (51%), Gaps = 17/120 (14%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPPYIYKSPPPP 165
            P  +  ++ P ++    P    V P  PPPPP  +P+PPPP      PPPP + ++PPPP
Sbjct: 917  PAVTRPAAPPPAARPAPPPPPVVRPPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPP 976

Query: 166  PYVYNSPPPPPYVYNSPPPPP------------YVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            P    +PPPPP V   PPPPP             V   PPPPP    +PPPPP V + PP
Sbjct: 977  PAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPP 1036

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/107 (42%), Positives = 56/107 (52%), Gaps = 4/107 (3%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP----PSPPPPYIYKSPPPPP 168
            PP +       ++ + TP  +   P +PPP     P PPP    P PPPP      PPPP
Sbjct: 899  PPAAERPKPAPAAERQTPPAV-TRPAAPPPAARPAPPPPPVVRPPPPPPPPAAHPAPPPP 957

Query: 169  YVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             V  +PPPPP V  +PPPPP    +PPPPP V + PPPPP   +  P
Sbjct: 958  VVRPAPPPPPVVRQAPPPPPAARPAPPPPPPVVRPPPPPPPAARPAP 1004

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/97 (46%), Positives = 55/97 (56%), Gaps = 1/97 (1%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP +A  + P    +  P    V   +PPPPP   P+PPPP   PP +   PPPPP    
Sbjct: 946  PPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARPAPPPP---PPVVRPPPPPPPAARP 1002

Query: 181  SPPPPPYVYNSPPPPPYVYK-SPPPPPYVYKSPPPPP 288
            +PPPPP V   PPPPP   + +PPPPP V + PPPPP
Sbjct: 1003 APPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPP 1039

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 48/134 (35%), Positives = 59/134 (44%), Gaps = 32/134 (23%)
 Frame = +1

Query: 4    PFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS------------------- 126
            P   V +SP S      S    +P  PPPP     +PPPP+                   
Sbjct: 861  PLPPVPASPPSPAAPAKSPSPTAPPPPPPPAAAREAPPPPAAERPKPAPAAERQTPPAVT 920

Query: 127  -------------PPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVY 267
                         PPPP +   PPPPP   +  PPPP V  +PPPPP V ++PPPPP   
Sbjct: 921  RPAAPPPAARPAPPPPPVVRPPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAAR 980

Query: 268  KSPPPPPYVYKSPP 309
             +PPPPP V + PP
Sbjct: 981  PAPPPPPPVVRPPP 994

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 45/104 (43%), Positives = 53/104 (50%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP    +  P    +  P     +  +PPPPP V    PPP PPP      PPPPP V  
Sbjct: 956  PPVVRPAPPPPPVVRQAPPPPPAARPAPPPPPPVV--RPPPPPPPAARPAPPPPPPVVRP 1013

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
             PPPPP    +PPPPP V + PPPPP     PPPPP    +PP+
Sbjct: 1014 PPPPPPAARPAPPPPPPVVRPPPPPP-----PPPPPAARPAPPA 1052

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 44/139 (31%), Positives = 47/139 (33%), Gaps = 37/139 (26%)
 Frame = +1

Query: 4    PFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYV----------------YPSPP----PP 123
            P  AV  +    T     G    P SPPP P                   P PP    PP
Sbjct: 811  PLPAVPGAQAPGTPPAAGGKSAVPGSPPPAPAAPNAATRPGSPLPGANGQPLPPVPASPP 870

Query: 124  SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPP-----------------P 252
            SP  P    SP  PP     PPPPP      PPPP   +  P                 P
Sbjct: 871  SPAAPAKSPSPTAPP-----PPPPPAAAREAPPPPAAERPKPAPAAERQTPPAVTRPAAP 925

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP    +PPPPP V   PP
Sbjct: 926  PPAARPAPPPPPVVRPPPP 944

[90][TOP]
>UniRef100_P06599 Extensin n=1 Tax=Daucus carota RepID=EXTN_DAUCA
          Length = 306

 Score =  103 bits (256), Expect = 8e-21
 Identities = 61/117 (52%), Positives = 62/117 (52%), Gaps = 38/117 (32%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPP---YIYKSPPPP------PYVYNSPPPPP------- 198
           P   PPPPY Y SPPPP  SPPPP   Y YKSPPPP      PY + SPPPP        
Sbjct: 49  PEHSPPPPYHYESPPPPKHSPPPPTPVYKYKSPPPPMHSPPPPYHFESPPPPKHSPPPPT 108

Query: 199 --YVYNSPPPPP--------YVYKSPPPPP--YVYKSPPPPP--------YVYKSPP 309
             Y Y SPPPP         Y YKSPPPP   Y YKSPPPP         Y YKSPP
Sbjct: 109 PVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYKYKSPPPPKHSPAPEHHYKYKSPP 165

 Score =  100 bits (250), Expect = 4e-20
 Identities = 56/112 (50%), Positives = 59/112 (52%), Gaps = 34/112 (30%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPP---------YVYNSP------PPPPYVYN 210
           +S PPPP   P PP  SPPPPY Y+SPPPP          Y Y SP      PPPPY + 
Sbjct: 36  YSSPPPPEHSPPPPEHSPPPPYHYESPPPPKHSPPPPTPVYKYKSPPPPMHSPPPPYHFE 95

Query: 211 SPPPPP---------YVYKSPPPPP--------YVYKSPPPPP--YVYKSPP 309
           SPPPP          Y YKSPPPP         Y YKSPPPP   Y YKSPP
Sbjct: 96  SPPPPKHSPPPPTPVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYKYKSPP 147

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 51/93 (54%), Positives = 54/93 (58%), Gaps = 17/93 (18%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP-------SPPPP---------YIYKSPPPPPYVYNSPPPPPYVYNS 213
           PP P Y Y SPPPP       SPPPP         Y YKSPPPP  VY SPPPP +   S
Sbjct: 186 PPTPVYKYKSPPPPTPVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYKSPPPPEH---S 242

Query: 214 PPPPPYVYKSPPPPPYVYKSPPPPP-YVYKSPP 309
           PPPP  VYK   PPP ++  PPP P Y YKSPP
Sbjct: 243 PPPPTPVYKYKSPPPPMHSPPPPTPVYKYKSPP 275

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 64/155 (41%), Positives = 69/155 (44%), Gaps = 52/155 (33%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGI-----GVSPFSPPPPPYVYPSPPPP-------------- 123
           PP+   S  P   +   P+ +        P   PPPPY + SPPPP              
Sbjct: 55  PPYHYESPPPPKHSPPPPTPVYKYKSPPPPMHSPPPPYHFESPPPPKHSPPPPTPVYKYK 114

Query: 124 SPPPPY---------IYKSPPPPP--YVYNSPPPPP--------YVYNSPPPP------- 225
           SPPPP           YKSPPPP   Y Y SPPPP         Y Y SPPPP       
Sbjct: 115 SPPPPKHSPAPVHHYKYKSPPPPTPVYKYKSPPPPKHSPAPEHHYKYKSPPPPKHFPAPE 174

Query: 226 ---PYVYKSPPPPP--YVYKSPPPPP--YVYKSPP 309
               Y YKSPPPP   Y YKSPPPP   Y YKSPP
Sbjct: 175 HHYKYKYKSPPPPTPVYKYKSPPPPTPVYKYKSPP 209

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 60/143 (41%), Positives = 66/143 (46%), Gaps = 39/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPP---YVYPSPPPP-------------SPP 132
           PP            K +P+ +    +  PPPP   Y Y SPPPP             SPP
Sbjct: 106 PPTPVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYKYKSPPPPKHSPAPEHHYKYKSPP 165

Query: 133 PP-----------YIYKSPPPPP--YVYNSPPPPP--YVYNSPPPPP--------YVYKS 243
           PP           Y YKSPPPP   Y Y SPPPP   Y Y SPPPP         Y YKS
Sbjct: 166 PPKHFPAPEHHYKYKYKSPPPPTPVYKYKSPPPPTPVYKYKSPPPPKHSPAPVHHYKYKS 225

Query: 244 PPPPPYVYKSPPPPPYVYKSPPS 312
           PPPP  VYKSPPPP +    PP+
Sbjct: 226 PPPPTPVYKSPPPPEH-SPPPPT 247

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 52/85 (61%), Positives = 56/85 (65%), Gaps = 8/85 (9%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP--SPPPP---YIYKSPPPPPYVYNSPPPPP-YVYNSPPPPPYVYK 240
           SPPPP  VY SPPPP  SPPPP   Y YKSPPPP  +++ PPP P Y Y SPPPP +   
Sbjct: 225 SPPPPTPVYKSPPPPEHSPPPPTPVYKYKSPPPP--MHSPPPPTPVYKYKSPPPPMH--- 279

Query: 241 SPPPPPYVYKSPPPPP--YVYKSPP 309
           SPPPP Y   SPPPP   Y Y SPP
Sbjct: 280 SPPPPVY---SPPPPKHHYSYTSPP 301

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 47/92 (51%), Positives = 49/92 (53%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPP---YIYKSPPPP 165
           PP + V  SP       P         PP P Y Y SPPPP  SPPPP   Y YKSPPPP
Sbjct: 227 PPPTPVYKSPPPPEHSPP---------PPTPVYKYKSPPPPMHSPPPPTPVYKYKSPPPP 277

Query: 166 PYVYNSPPPPPYVYNSPPPPP--YVYKSPPPP 255
               +SPPPP Y   SPPPP   Y Y SPPPP
Sbjct: 278 ---MHSPPPPVY---SPPPPKHHYSYTSPPPP 303

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 40/84 (47%), Positives = 43/84 (51%), Gaps = 27/84 (32%)
 Frame = +1

Query: 139 YIYKSPPPPPYVYNSP---PPPPYVYNSPPPPP---------YVYKSP------PPPPYV 264
           Y Y SPPPP +    P   PPPPY Y SPPPP          Y YKSP      PPPPY 
Sbjct: 34  YTYSSPPPPEHSPPPPEHSPPPPYHYESPPPPKHSPPPPTPVYKYKSPPPPMHSPPPPYH 93

Query: 265 YKSPPPPP---------YVYKSPP 309
           ++SPPPP          Y YKSPP
Sbjct: 94  FESPPPPKHSPPPPTPVYKYKSPP 117

[91][TOP]
>UniRef100_Q8LK15 Extensin n=1 Tax=Brassica napus RepID=Q8LK15_BRANA
          Length = 259

 Score =  102 bits (255), Expect = 1e-20
 Identities = 63/117 (53%), Positives = 66/117 (56%), Gaps = 40/117 (34%)
 Frame = +1

Query: 79  SPPPPP--YVYPSPPPP----------SPPPP---YIYKSPPPP------PYVYNSPPPP 195
           SPPPP   YVY SPPPP          S PPP   Y+YKSPPPP      P VY+SPPPP
Sbjct: 138 SPPPPKNQYVYKSPPPPVKHYTPPVYHSGPPPKKHYMYKSPPPPVMHYSLPQVYHSPPPP 197

Query: 196 P--YVYNSPPPPP------YVYKSPPPPP--YVYKSPPPPP---------YVYKSPP 309
              YVY SPPPP        VY SPPPP   YVYKSPPPP          Y+YKSPP
Sbjct: 198 KKHYVYKSPPPPVKHYSPRLVYHSPPPPKKKYVYKSPPPPVRHYFPPHHLYLYKSPP 254

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/130 (49%), Positives = 68/130 (52%), Gaps = 49/130 (37%)
 Frame = +1

Query: 67  VSPFSPPPPP--YVYPSPPPP-----------SPPPP---YIYKSPPPP-----PYVYNS 183
           V  +S PPP   YVY SPPPP           SPPPP   Y+YKSPPPP     P VY+S
Sbjct: 106 VKQYSSPPPNKYYVYQSPPPPVKHYSPPSVYHSPPPPKNQYVYKSPPPPVKHYTPPVYHS 165

Query: 184 PPPPP--YVYNSPPPP------PYVYKSPPPPP--YVYKSPPPP---------------- 285
            PPP   Y+Y SPPPP      P VY SPPPP   YVYKSPPPP                
Sbjct: 166 GPPPKKHYMYKSPPPPVMHYSLPQVYHSPPPPKKHYVYKSPPPPVKHYSPRLVYHSPPPP 225

Query: 286 --PYVYKSPP 309
              YVYKSPP
Sbjct: 226 KKKYVYKSPP 235

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 56/106 (52%), Positives = 59/106 (55%), Gaps = 29/106 (27%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPP---YIYKSPPPPPYVYNSPPPPPY-VYNSPPPP------P 228
           SPPPP   Y  P   SPPPP   Y+YKSPPPP   Y+SPPP  Y VY SPPPP      P
Sbjct: 74  SPPPPVKQYSPPWLRSPPPPRKDYVYKSPPPPVKQYSSPPPNKYYVYQSPPPPVKHYSPP 133

Query: 229 YVYKSPPPPP--YVYKSPPPP-----------------PYVYKSPP 309
            VY SPPPP   YVYKSPPPP                  Y+YKSPP
Sbjct: 134 SVYHSPPPPKNQYVYKSPPPPVKHYTPPVYHSGPPPKKHYMYKSPP 179

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 62/134 (46%), Positives = 68/134 (50%), Gaps = 31/134 (23%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYV-------YPSPPPP-------SPPPP 138
           P  S   S+ N      P  +    +  PPPP +       Y SPPPP       SPPPP
Sbjct: 19  PLTSVYQSTANYFYSSPPPPVKHYEYKSPPPPVMHYSLPQVYHSPPPPKKHTVNKSPPPP 78

Query: 139 YIYKSPP----PPP----YVYNSPPPPPYVYNSPPPPP-YVYKSPPP------PPYVYKS 273
               SPP    PPP    YVY SPPPP   Y+SPPP   YVY+SPPP      PP VY S
Sbjct: 79  VKQYSPPWLRSPPPPRKDYVYKSPPPPVKQYSSPPPNKYYVYQSPPPPVKHYSPPSVYHS 138

Query: 274 PPPP--PYVYKSPP 309
           PPPP   YVYKSPP
Sbjct: 139 PPPPKNQYVYKSPP 152

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/103 (50%), Positives = 58/103 (56%), Gaps = 30/103 (29%)
 Frame = +1

Query: 67  VSPFSPP-----PPP---YVYPSPPPP-----------SPPPP---YIYKSPPPPP---- 168
           V  ++PP     PPP   Y+Y SPPPP           SPPPP   Y+YKSPPPP     
Sbjct: 155 VKHYTPPVYHSGPPPKKHYMYKSPPPPVMHYSLPQVYHSPPPPKKHYVYKSPPPPVKHYS 214

Query: 169 --YVYNSPPPP--PYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
              VY+SPPPP   YVY SPPPP   Y  PP   Y+YKSPPPP
Sbjct: 215 PRLVYHSPPPPKKKYVYKSPPPPVRHY-FPPHHLYLYKSPPPP 256

[92][TOP]
>UniRef100_Q94ES6 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES6_PEA
          Length = 181

 Score =  101 bits (251), Expect = 3e-20
 Identities = 57/109 (52%), Positives = 60/109 (55%), Gaps = 32/109 (29%)
 Frame = +1

Query: 79  SPPPPPYVYP-------SPPPPSP-PPPYIYKSPPPPPY--------VYNSPPPP----- 195
           SPPPP + YP       SPPPP+P   PY Y SPPPPP         VY+SPPPP     
Sbjct: 71  SPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHK 130

Query: 196 -PYVYNSPPPPPY----------VYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PY Y SPPPPP           VY SPPPP Y   SPPPP Y YKSPP
Sbjct: 131 KPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPAY---SPPPPAYYYKSPP 176

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 57/119 (47%), Positives = 61/119 (51%), Gaps = 42/119 (35%)
 Frame = +1

Query: 79  SPPPP--PYVYPSPPPPS----PPPPYIYKSPPPPPY-------VYNSPPPP-----PYV 204
           SPPPP  P+ Y SPPPP     P P  +Y SPPPP +       VY+SPPPP     PY 
Sbjct: 41  SPPPPKDPHHYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPPTPHKKPYK 100

Query: 205 YNSPPPPPY--------VYKSPPPP------PYVYKSPPPPPY----------VYKSPP 309
           Y SPPPPP         VY SPPPP      PY Y SPPPPP           VY SPP
Sbjct: 101 YPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPP 159

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/110 (50%), Positives = 59/110 (53%), Gaps = 39/110 (35%)
 Frame = +1

Query: 97  YVYPSPPPP--SPPPP---YIYKSPPPPPY--------VYNSPPPPPY-------VYNSP 216
           Y Y SPPPP  SPPPP   + Y SPPPPP         VY+SPPPP +       VY+SP
Sbjct: 30  YSYSSPPPPVHSPPPPKDPHHYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSP 89

Query: 217 PPP-----PYVYKSPPPPPY--------VYKSPPPP------PYVYKSPP 309
           PPP     PY Y SPPPPP         VY SPPPP      PY Y SPP
Sbjct: 90  PPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPP 139

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 45/80 (56%), Positives = 47/80 (58%), Gaps = 9/80 (11%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSP------PPPSPPP---PYIYKSPPPPPYVYNSPPPPPYVYNSPPPP 225
           P  PPPP + YP P      PPP P P   PY Y SPPPPP     P  P  VY+SPPPP
Sbjct: 102 PSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPP 161

Query: 226 PYVYKSPPPPPYVYKSPPPP 285
            Y   SPPPP Y YKSPPPP
Sbjct: 162 AY---SPPPPAYYYKSPPPP 178

[93][TOP]
>UniRef100_Q5ZB68 Os01g0594300 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5ZB68_ORYSJ
          Length = 551

 Score =  101 bits (251), Expect = 3e-20
 Identities = 56/110 (50%), Positives = 62/110 (56%), Gaps = 13/110 (11%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPP 198
           S  P S    +PS    SP  PP PP   PSPPPPSPPPP    SPPPP  VY S PPPP
Sbjct: 404 SPPPPSPPPPSPSPPPPSP-PPPSPPPPSPSPPPPSPPPP----SPPPPSPVYYSSPPPP 458

Query: 199 YV-------YNSPPPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           Y        Y SPPPPP  +++PPPP Y       Y SPPPPP   ++PP
Sbjct: 459 YYEVSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPP 508

 Score = 99.8 bits (247), Expect = 8e-20
 Identities = 57/116 (49%), Positives = 63/116 (54%), Gaps = 14/116 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPY-IYKSPPPPPYV- 174
           PP S    SP S    +P      P SP PPP   PSPPPPSPPPP  +Y S PPPPY  
Sbjct: 406 PPPSPPPPSP-SPPPPSPPPPSPPPPSPSPPP---PSPPPPSPPPPSPVYYSSPPPPYYE 461

Query: 175 ------YNSPPPPPYVYNSPPPPPYV------YKSPPPPPYVYKSPPPPPYVYKSP 306
                 Y SPPPPP  + +PPPP Y       Y SPPPPP   ++PPPPP    SP
Sbjct: 462 VSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSP 517

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 46/84 (54%), Positives = 49/84 (58%), Gaps = 7/84 (8%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPP 258
           SPPPP    PSPPPPSP PP     PP PP    SPPPP     SPPPP  VY S PPPP
Sbjct: 399 SPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPP 458

Query: 259 YV-------YKSPPPPPYVYKSPP 309
           Y        Y SPPPPP  +++PP
Sbjct: 459 YYEVSPEDRYLSPPPPPAYHEAPP 482

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/133 (40%), Positives = 57/133 (42%), Gaps = 33/133 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP S    SP   +   P      P  PPP P  Y SPPPP           SPPPP  Y
Sbjct: 418 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPPPAY 477

Query: 148 KSPPPPPYV-------YNSPPPPPYVYNSPPPPPYV-------YKSPPPPP--------Y 261
              PPPPY        Y SPPPPP    +PPPPP         Y SPPPP         Y
Sbjct: 478 HEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPEDRYLSPPPPSPVKWKLPVY 537

Query: 262 VYKSPPPPPYVYK 300
            Y SPPPP   +K
Sbjct: 538 EYSSPPPPAATWK 550

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 58/137 (42%), Positives = 63/137 (45%), Gaps = 34/137 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP------PPPYIYKSP-- 156
           PP  + S  P S    +P     SP  P PPP   PSPPPPSP      PPPY   SP  
Sbjct: 410 PPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPP---PSPPPPSPVYYSSPPPPYYEVSPED 466

Query: 157 ----PPPPYVYNSPPPPPYVYNSP------PPPPYVYKSPPPPPYVYK--------SPPP 282
               PPPP  Y+  PPPPY   SP      PPPP  Y+  PPPP  Y+        SPPP
Sbjct: 467 RYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPEDRYLSPPP 526

Query: 283 PP--------YVYKSPP 309
           P         Y Y SPP
Sbjct: 527 PSPVKWKLPVYEYSSPP 543

[94][TOP]
>UniRef100_Q4PSF3 Proline-rich extensin-like family protein n=1 Tax=Arabidopsis
           thaliana RepID=Q4PSF3_ARATH
          Length = 249

 Score =  101 bits (251), Expect = 3e-20
 Identities = 57/112 (50%), Positives = 65/112 (58%), Gaps = 9/112 (8%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP------FSPPPPPYVYPSPPPP---SPPPPYIYKS 153
           PP +     P  +    P  + +SP       SPPPPP +   PPPP   SPPPP +  S
Sbjct: 56  PPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLS 115

Query: 154 PPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPPPP V  SPPPPP V  SPPPPP V  SPPPPP V  SPPPPP ++  PP
Sbjct: 116 PPPPP-VLLSPPPPP-VLLSPPPPP-VNLSPPPPP-VLLSPPPPPVLFSPPP 163

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 58/123 (47%), Positives = 67/123 (54%), Gaps = 20/123 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPY 171
           PP   + S P     ++P    V+  SPPPPP +   PPPP   SPPPP +  SPPPPP 
Sbjct: 90  PPPPVLLSPPPPPVNLSPPPPPVN-LSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPP- 147

Query: 172 VYNSPPPPPYVYNS--------PPPPPYVYKSPPPP-----PYVYKSPPPPPY----VYK 300
           V  SPPPPP V  S        PPPPP + +SPPPP      Y  K+PPPPPY    VY 
Sbjct: 148 VLLSPPPPP-VLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYP 206

Query: 301 SPP 309
            PP
Sbjct: 207 PPP 209

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 54/106 (50%), Positives = 61/106 (57%), Gaps = 13/106 (12%)
 Frame = +1

Query: 31  NSSTKITPSGIGVSPF---SPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPYVYNSPPP 192
           N++ K+  S    +P    SPPPPP    SPPPP   SPPPP +  SPPPPP   + PPP
Sbjct: 24  NNNRKLLTSAPEPAPLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPP 83

Query: 193 P-------PYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P       P V  SPPPPP V  SPPPPP V  SPPPPP +   PP
Sbjct: 84  PVNLSPPPPPVLLSPPPPP-VNLSPPPPP-VNLSPPPPPVLLSPPP 127

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 53/119 (44%), Positives = 63/119 (52%), Gaps = 23/119 (19%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP------FSPPPPPYVYPSPPPP---SPPPPYIYKS 153
           PP   V+ SP       P  + +SP       SPPPPP +   PPPP   SPPPP +  S
Sbjct: 98  PPPPPVNLSP------PPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLS 151

Query: 154 PPPPPYVYNSPPP-------PPYVYNSPPPP-----PYVYKSPPPPPYVYKS--PPPPP 288
           PPPPP +++ PPP       PP +  SPPPP      Y  K+PPPPPY Y    PPPPP
Sbjct: 152 PPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPP 210

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 57/124 (45%), Positives = 66/124 (53%), Gaps = 21/124 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPY 171
           PP   + S P     ++P    V+  SPPPPP +   PPPP   SPPPP + + PPPPP 
Sbjct: 117 PPPPVLLSPPPPPVLLSPPPPPVN-LSPPPPPVLLSPPPPPVLFSPPPPTVTR-PPPPPT 174

Query: 172 VYNSPPPP-----PYVYNSPPPPPY----VYKSPPPPPYV---YK-SPPPPP-----YVY 297
           +  SPPPP      Y   +PPPPPY    VY  PPPPP     YK SPPPPP      VY
Sbjct: 175 ITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVY 234

Query: 298 KSPP 309
             PP
Sbjct: 235 SPPP 238

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 53/116 (45%), Positives = 62/116 (53%), Gaps = 21/116 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS----PPPPYIYKSPPPP- 165
           PP   + S P     ++P    V   SPPPPP ++ SPPPP+    PPPP I +SPPPP 
Sbjct: 126 PPPPVLLSPPPPPVNLSPPPPPVL-LSPPPPPVLF-SPPPPTVTRPPPPPTITRSPPPPR 183

Query: 166 ----PYVYNSPPPPPY----VYNSPPPPPYVYKS-----PPPPPYVY---KSPPPP 285
                Y   +PPPPPY    VY  PPPPP   +S     PPPPP  Y    SPPPP
Sbjct: 184 PQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVYSPPPP 239

[95][TOP]
>UniRef100_B9SSV0 Cleavage and polyadenylation specificity factor, putative n=1
           Tax=Ricinus communis RepID=B9SSV0_RICCO
          Length = 210

 Score =  101 bits (251), Expect = 3e-20
 Identities = 56/110 (50%), Positives = 59/110 (53%), Gaps = 35/110 (31%)
 Frame = +1

Query: 82  PPP------PPYVYPSPPPP--SPPPPYIYKSPPPP----------PYVYNSPPPP---- 195
           PPP      PPY Y SPPPP  SPPPPY Y SPPP           PY Y+SPPPP    
Sbjct: 40  PPPHKKVYYPPYYYKSPPPPSPSPPPPYYYTSPPPRKKYPSPSPLLPYHYHSPPPPKKST 99

Query: 196 -PYVYNSPPPPPYVYKSPPPPP------YVYKSPPP------PPYVYKSP 306
            P  Y + PPPPY Y SPPPP       Y Y SPPP      PPY Y+SP
Sbjct: 100 HPTYYYNSPPPPYYYNSPPPPSSSPPPLYYYDSPPPPKKSLSPPYHYQSP 149

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 59/108 (54%), Positives = 61/108 (56%), Gaps = 30/108 (27%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP----PSPPP--PYIYKSPPPPP------YVYNSPPPPPYVYNSP 216
           P   PPPPY Y SPPP    PSP P  PY Y SPPPP       Y YNSPPPP Y YNSP
Sbjct: 59  PSPSPPPPYYYTSPPPRKKYPSPSPLLPYHYHSPPPPKKSTHPTYYYNSPPPP-YYYNSP 117

Query: 217 PPP----PYVYK--SPPP------PPYVYKSP------PPPPYVYKSP 306
           PPP    P +Y   SPPP      PPY Y+SP      PPPPY Y SP
Sbjct: 118 PPPSSSPPPLYYYDSPPPPKKSLSPPYHYQSPSPLSPSPPPPYYYASP 165

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/105 (51%), Positives = 57/105 (54%), Gaps = 27/105 (25%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP--SPPPPYIYKSPPP------PPYVYNSP------PPPPYVYNS 213
           ++ PPPPY Y SPPPP  SPPP Y Y SPPP      PPY Y SP      PPPPY Y S
Sbjct: 105 YNSPPPPYYYNSPPPPSSSPPPLYYYDSPPPPKKSLSPPYHYQSPSPLSPSPPPPYYYAS 164

Query: 214 PPPPP-------YVYKSPPPP------PYVYKSPPPPPYVYKSPP 309
           P P P         YKSPPPP       Y Y+S PPP Y   SPP
Sbjct: 165 PSPTPKKSPSPLSYYKSPPPPSLSPPLSYYYQSLPPPNYF--SPP 207

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 60/139 (43%), Positives = 65/139 (46%), Gaps = 36/139 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP----FSPPPP--PYVYPSPPPP-----------SP 129
           PP+   S  P S +   P      P    +  P P  PY Y SPPPP           SP
Sbjct: 49  PPYYYKSPPPPSPSPPPPYYYTSPPPRKKYPSPSPLLPYHYHSPPPPKKSTHPTYYYNSP 108

Query: 130 PPPYIYKSPPPPPYVYNSPPPPPYVYNSPPP------PPYVYKSP------PPPPYVYKS 273
           PPPY Y SPPPP     S PPP Y Y+SPPP      PPY Y+SP      PPPPY Y S
Sbjct: 109 PPPYYYNSPPPPS----SSPPPLYYYDSPPPPKKSLSPPYHYQSPSPLSPSPPPPYYYAS 164

Query: 274 PPPPP-------YVYKSPP 309
           P P P         YKSPP
Sbjct: 165 PSPTPKKSPSPLSYYKSPP 183

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/102 (48%), Positives = 51/102 (50%), Gaps = 29/102 (28%)
 Frame = +1

Query: 91  PPYVYPSPPPPSPP--PPYIYKSP------PPPPYVYNSPPPP----------PYVYNSP 216
           P Y Y  PPP      PPY YKSP      PPPPY Y SPPP           PY Y+SP
Sbjct: 33  PSYEYKLPPPHKKVYYPPYYYKSPPPPSPSPPPPYYYTSPPPRKKYPSPSPLLPYHYHSP 92

Query: 217 PPP-----PYVYKSPPPPPYVYKSPPPPP------YVYKSPP 309
           PPP     P  Y + PPPPY Y SPPPP       Y Y SPP
Sbjct: 93  PPPKKSTHPTYYYNSPPPPYYYNSPPPPSSSPPPLYYYDSPP 134

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 46/104 (44%), Positives = 49/104 (47%), Gaps = 20/104 (19%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPP-----PPYVYPSPPP--PSPPPPYIYKSPP 159
           PP+   S  P SS+   P  +      PPP     PPY Y SP P  PSPPPPY Y SP 
Sbjct: 110 PPYYYNSPPPPSSS---PPPLYYYDSPPPPKKSLSPPYHYQSPSPLSPSPPPPYYYASPS 166

Query: 160 PPPY-------VYNSPPPPP------YVYNSPPPPPYVYKSPPP 252
           P P         Y SPPPP       Y Y S PPP Y   SPPP
Sbjct: 167 PTPKKSPSPLSYYKSPPPPSLSPPLSYYYQSLPPPNYF--SPPP 208

[96][TOP]
>UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B501E
          Length = 406

 Score =  100 bits (249), Expect = 5e-20
 Identities = 54/117 (46%), Positives = 57/117 (48%), Gaps = 14/117 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPP--------YVYPSPPPPSPPPPYIY 147
           PP  A S  P       P+  G  P   + PPPPP        Y Y  PPPP PPPP   
Sbjct: 239 PPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPA 298

Query: 148 KSPPPPPYVYNSPPPPPYVYNSPPPPPY---VYKSPPPPPYVYKSPPPPPYVYKSPP 309
            SPPPPP     PPPPP  Y  PPPP Y       PPPPP  Y +PPPPP  Y  PP
Sbjct: 299 YSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAY-APPPPPPAYAPPP 354

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 47/91 (51%), Positives = 48/91 (52%), Gaps = 11/91 (12%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPP-----YVYNSPPPPPY-- 231
           P  PPPPP   P PPPP PPPP  Y  PPPP Y    PPPPP     Y Y  PPPPP   
Sbjct: 235 PPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPP 294

Query: 232 ---VYKSPPPPPYVYKSPPPPP-YVYKSPPS 312
               Y  PPPP Y    PPPPP Y    PP+
Sbjct: 295 PPPAYSPPPPPAYGPPPPPPPPAYAPPPPPA 325

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 49/106 (46%), Positives = 51/106 (48%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPY 171
           PP  A    P       P   G  P   + PPPPP   P PP   PPPP  Y  PPPPP 
Sbjct: 178 PPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPP- 236

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
               PPPPP  Y+ PPPPP     PPPPP  Y  PPPP Y    PP
Sbjct: 237 ----PPPPPPAYSPPPPPP-----PPPPPAAYGPPPPPAYGPPPPP 273

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 52/113 (46%), Positives = 52/113 (46%), Gaps = 10/113 (8%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP  A    P       P   G     PPPP Y  P PPPP PPPP  Y  PPPPP    
Sbjct: 201 PPPPAYGPPPPPPPPPPPPAYG----PPPPPAYGPPPPPPPPPPPP-AYSPPPPPP---- 251

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPP-----YVY-----KSPPPPPYVYKSPP 309
            PPPPP  Y  PPPP Y    PPPPP     Y Y       PPPPP  Y  PP
Sbjct: 252 -PPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPP 303

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 44/81 (54%), Positives = 45/81 (55%), Gaps = 3/81 (3%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPP 255
           + PPPPP   P PPPP PPPP  Y  PPPP   Y  PPPPP     PPPPP  Y  PPPP
Sbjct: 175 YGPPPPPAYGPPPPPPPPPPPPAYGPPPPP--AYGPPPPPP-----PPPPPPAYGPPPPP 227

Query: 256 PY---VYKSPPPPPYVYKSPP 309
            Y       PPPPP  Y  PP
Sbjct: 228 AYGPPPPPPPPPPPPAYSPPP 248

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 44/81 (54%), Positives = 45/81 (55%), Gaps = 3/81 (3%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPP 255
           + PPPPP   P PPPP PPPP  Y  PPPP   Y  PPPPP     PPPPP  Y  PPPP
Sbjct: 152 YGPPPPPAYGPPPPPPPPPPPPAYGPPPPP--AYGPPPPPP-----PPPPPPAYGPPPPP 204

Query: 256 PY---VYKSPPPPPYVYKSPP 309
            Y       PPPPP  Y  PP
Sbjct: 205 AYGPPPPPPPPPPPPAYGPPP 225

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 44/89 (49%), Positives = 46/89 (51%), Gaps = 11/89 (12%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPY-----------VYNSPPP 222
           ++PPPPP   P PPPP PPPP  Y  PPPP Y    PPPPP             Y  PPP
Sbjct: 106 YAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPP 165

Query: 223 PPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP  Y  PPPP Y    PP
Sbjct: 166 PP-----PPPPPPAYGPPPPPAYGPPPPP 189

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 51/111 (45%), Positives = 55/111 (49%), Gaps = 8/111 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPP-----YVYPSPP---PPSPPPPYIYKSP 156
           PP  A    P       P+     P  PPPPP     Y  P PP   PP PPPP  Y  P
Sbjct: 262 PPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPPPPPPPAYAPP 321

Query: 157 PPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPP Y   +PPPPP     PPPP Y   +PPPPP  Y +PPPPP  Y  PP
Sbjct: 322 PPPAYGPPAPPPPP-----PPPPAY---APPPPPPAY-APPPPPPAYAPPP 363

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 44/81 (54%), Positives = 47/81 (58%), Gaps = 3/81 (3%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           ++PPPPP  Y  PPPP   +PPPP  Y  PPPPP     PPPPP  Y  PPPP Y    P
Sbjct: 88  YAPPPPPPAYAPPPPPPAYAPPPPPAYAPPPPPP-----PPPPPPSYGPPPPPAY---GP 139

Query: 247 PPPPYVYKSPPPPPYVYKSPP 309
           PPPP     PPPPP  Y  PP
Sbjct: 140 PPPP----PPPPPPPAYGPPP 156

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 44/89 (49%), Positives = 45/89 (50%), Gaps = 11/89 (12%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPY-----------VYNSPPP 222
           + PPPPP   P PPPP PPPP  Y  PPPP Y    PPPPP             Y  PPP
Sbjct: 129 YGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPP 188

Query: 223 PPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP  Y  PPPP Y    PP
Sbjct: 189 PP-----PPPPPPAYGPPPPPAYGPPPPP 212

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 49/106 (46%), Positives = 50/106 (47%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP  A    P  +    P      P   PPPP  Y  PPPP PPPP     PPPPP  Y 
Sbjct: 103 PPAYAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPP-AYG 161

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPY---VYKSPPPPPYVYKSPP 309
            PPPPP     PPPPP  Y  PPPP Y       PPPPP  Y  PP
Sbjct: 162 PPPPPP-----PPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPP 202

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 45/90 (50%), Positives = 47/90 (52%), Gaps = 12/90 (13%)
 Frame = +1

Query: 76  FSPPPPPYVY---------PSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPP 228
           ++PPPPP  Y         P PPPP PPPP  Y  PPPP   Y  PPPPP     PPPPP
Sbjct: 97  YAPPPPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPPPPP--AYGPPPPPP-----PPPPP 149

Query: 229 YVYKSPPPPPY---VYKSPPPPPYVYKSPP 309
             Y  PPPP Y       PPPPP  Y  PP
Sbjct: 150 PAYGPPPPPAYGPPPPPPPPPPPPAYGPPP 179

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 43/82 (52%), Positives = 47/82 (57%), Gaps = 5/82 (6%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP-----SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           +SPPPPP  Y  PPPP     +PPPP  Y  P PPP     PPPPP  Y  PPPPP    
Sbjct: 299 YSPPPPP-AYGPPPPPPPPAYAPPPPPAYGPPAPPP-----PPPPPPAYAPPPPPPAY-- 350

Query: 241 SPPPPPYVYKSPPPPPYVYKSP 306
           +PPPPP  Y  PPPPP    +P
Sbjct: 351 APPPPPPAYAPPPPPPKYSPAP 372

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/80 (53%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP-SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPP 249
           P  PPPPP   P PPP   PPPP     PPPPP  Y  PPPP   Y  PPPPP     PP
Sbjct: 166 PPPPPPPPAYGPPPPPAYGPPPP---PPPPPPPPAYGPPPPP--AYGPPPPPP-----PP 215

Query: 250 PPPYVYKSPPPPPYVYKSPP 309
           PPP  Y  PPPP Y    PP
Sbjct: 216 PPPPAYGPPPPPAYGPPPPP 235

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 49/114 (42%), Positives = 54/114 (47%), Gaps = 18/114 (15%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIY-----KSP 156
           PP +A +  P       P     SP  PPPP Y  P PPPP   +PPPP  Y       P
Sbjct: 277 PPPAAYAYGPPPPPPPPPPPPAYSP--PPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPP 334

Query: 157 PPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYK----------SPPPPP 288
           PPPP  Y  PPPPP     PPPP Y   +PPPPP  Y           +PPPPP
Sbjct: 335 PPPPPAYAPPPPPPAYAPPPPPPAY---APPPPPPKYSPAPIVVYGPPAPPPPP 385

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 42/89 (47%), Positives = 47/89 (52%), Gaps = 12/89 (13%)
 Frame = +1

Query: 82  PPPPPYVY------------PSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPP 225
           PPPPP  Y            P+PP  +PPPP +Y  PPPPP    +PPPPP  Y  PPPP
Sbjct: 56  PPPPPPAYDDCDEIVLVPGKPAPPAYAPPPP-VYAPPPPPPAY--APPPPPPAYAPPPPP 112

Query: 226 PYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            Y    PPPPP     PPPP Y    PP+
Sbjct: 113 AYAPPPPPPPP-----PPPPSYGPPPPPA 136

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 41/79 (51%), Positives = 44/79 (55%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  P PP Y  P PP  +PPPP    +PPPPP  Y  PPPP Y   +PPPPP     PPP
Sbjct: 73  PGKPAPPAYA-PPPPVYAPPPPPPAYAPPPPPPAYAPPPPPAY---APPPPP----PPPP 124

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP  Y  PPPP Y    PP
Sbjct: 125 PPPSYGPPPPPAYGPPPPP 143

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 42/102 (41%), Positives = 45/102 (44%), Gaps = 15/102 (14%)
 Frame = +1

Query: 52  PSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIY------------KSPP---PPPYVYNSP 186
           P  I +    P   P     P P  PPPP  Y             +PP   PPP VY  P
Sbjct: 32  PYKIELPAARPAYSPVYAVVPAPQPPPPPPAYDDCDEIVLVPGKPAPPAYAPPPPVYAPP 91

Query: 187 PPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           PPPP    +PPPPP  Y  PPPP Y    PPPPP     PPS
Sbjct: 92  PPPPAY--APPPPPPAYAPPPPPAYAPPPPPPPP---PPPPS 128

[97][TOP]
>UniRef100_Q94ES4 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES4_PEA
          Length = 120

 Score =  100 bits (249), Expect = 5e-20
 Identities = 57/109 (52%), Positives = 59/109 (54%), Gaps = 30/109 (27%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPP----YIYKSPPPPPY--------VYNSPPPP----- 195
           P  PPPP + YP P P   SPPPP    Y Y SPPPPP         VY+SPPPP     
Sbjct: 10  PSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPPTPHK 69

Query: 196 -PYVYNSPPPPPY----------VYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PY Y SPPPPP           VY SPPPP Y   SPPPP Y YKSPP
Sbjct: 70  KPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVY---SPPPPAYYYKSPP 115

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 46/79 (58%), Positives = 47/79 (59%), Gaps = 10/79 (12%)
 Frame = +1

Query: 79  SPPPPPY--------VYPSPPPPSPP--PPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPP 228
           SPPPPP         VY SPPPP  P   PY Y SPPPPP     P  P  VY+SPPPP 
Sbjct: 42  SPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPV 101

Query: 229 YVYKSPPPPPYVYKSPPPP 285
           Y   SPPPP Y YKSPPPP
Sbjct: 102 Y---SPPPPAYYYKSPPPP 117

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 47/86 (54%), Positives = 52/86 (60%), Gaps = 9/86 (10%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPP---PYVYNSPPPPPYVYKSPP 249
           +P   PY YPSPPPP   P + Y  P P   VY+SPPPP   PY Y+SPPPPP V+  P 
Sbjct: 1   TPHKKPYKYPSPPPP---PVHTYPHPHP---VYHSPPPPHKKPYKYSSPPPPP-VHTYPH 53

Query: 250 PPPYVYKSPPPP------PYVYKSPP 309
           P P VY SPPPP      PY Y SPP
Sbjct: 54  PHP-VYHSPPPPPTPHKKPYKYPSPP 78

[98][TOP]
>UniRef100_C3VPW8 Extensin n=1 Tax=Lithospermum erythrorhizon RepID=C3VPW8_LITER
          Length = 247

 Score =  100 bits (249), Expect = 5e-20
 Identities = 60/109 (55%), Positives = 67/109 (61%), Gaps = 13/109 (11%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPYVYNSPP- 189
           SSP    K +P        SPPPP  VY SPPPP   SPPPP +YKSPPPP +    PP 
Sbjct: 38  SSPPPPKKYSPPPHHYHHKSPPPP--VYKSPPPPMHKSPPPP-VYKSPPPPMHKSPPPPK 94

Query: 190 ---PPPYVYNSPPPPPYVYKSPP------PPPYVYKSPPPPPYVYKSPP 309
              PPP VY SPPPP  ++KSPP      PPP VYKSPPPP  ++KSPP
Sbjct: 95  KYSPPPPVYKSPPPP--MHKSPPPPKKYSPPPPVYKSPPPP--MHKSPP 139

 Score = 99.8 bits (247), Expect = 8e-20
 Identities = 64/126 (50%), Positives = 70/126 (55%), Gaps = 23/126 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP----PPPPYVYPSPPPP---SPPPPYIYKSPP 159
           PP     S P    K  P  +  SP  P    PPPP  Y SPPPP   SPPPP ++KSPP
Sbjct: 58  PPPPVYKSPPPPMHKSPPPPVYKSPPPPMHKSPPPPKKY-SPPPPVYKSPPPP-MHKSPP 115

Query: 160 PP------PYVYNSPPPPPYVYNSPP----PPPYVYKSPPPPPYVYKSPP------PPPY 291
           PP      P VY SPPPP +    PP    PPP VYKSPPPP  ++KSPP      PPP 
Sbjct: 116 PPKKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYKSPPPP--MHKSPPPPKKYSPPPP 173

Query: 292 VYKSPP 309
           VYKSPP
Sbjct: 174 VYKSPP 179

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 56/99 (56%), Positives = 61/99 (61%), Gaps = 21/99 (21%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP-----PSPPPPYIYKSPP------PPPYVYNSPPPPPYVYNSPP- 219
           +S PPPP  Y SPPP      SPPPP +YKSPP      PPP VY SPPPP +    PP 
Sbjct: 37  YSSPPPPKKY-SPPPHHYHHKSPPPP-VYKSPPPPMHKSPPPPVYKSPPPPMHKSPPPPK 94

Query: 220 ---PPPYVYKSPPPPPYVYKSPP------PPPYVYKSPP 309
              PPP VYKSPPPP  ++KSPP      PPP VYKSPP
Sbjct: 95  KYSPPPPVYKSPPPP--MHKSPPPPKKYSPPPPVYKSPP 131

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 47/79 (59%), Positives = 52/79 (65%), Gaps = 8/79 (10%)
 Frame = +1

Query: 97  YVYPSPPPPSP--PPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYK 270
           Y Y SPPPP    PPP+ Y    PPP VY SPPPP  ++ SPPPP  VYKSPPPP  ++K
Sbjct: 35  YKYSSPPPPKKYSPPPHHYHHKSPPPPVYKSPPPP--MHKSPPPP--VYKSPPPP--MHK 88

Query: 271 SPP------PPPYVYKSPP 309
           SPP      PPP VYKSPP
Sbjct: 89  SPPPPKKYSPPPPVYKSPP 107

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 59/118 (50%), Positives = 65/118 (55%), Gaps = 15/118 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP-----FSPPPPPYVYPSPPPP---SPPPPYIYKSP 156
           PP     S P    K  P  +  SP     +SPPPP  VY SPPPP   SPPPP  Y SP
Sbjct: 114 PPPPKKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPP--VYKSPPPPMHKSPPPPKKY-SP 170

Query: 157 PPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPP-------PPPYVYKSPP 309
           PPP  VY SPPPP  ++ SPPPP    K   PPP V+K PP       PPP V+KSPP
Sbjct: 171 PPP--VYKSPPPP--MHKSPPPP----KKYSPPPPVHKPPPHWSHKYSPPPPVHKSPP 220

[99][TOP]
>UniRef100_B9ILJ5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9ILJ5_POPTR
          Length = 509

 Score =  100 bits (248), Expect = 6e-20
 Identities = 51/87 (58%), Positives = 54/87 (62%), Gaps = 16/87 (18%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP---SPPPPYIYK-----SPPPPPYVYN------SPPPPPYVYNSP 216
           SPPPPP VY  PPPP   SPPPP  YK     SPPPPP VY       SPPPPP +Y SP
Sbjct: 422 SPPPPPPVYSPPPPPPSSSPPPPIHYKPPPSPSPPPPPAVYYHSPPPLSPPPPPVIYGSP 481

Query: 217 PPPPYVYKSPPPP--PYVYKSPPPPPY 291
           PPP  VY+ P PP     Y SPPPPP+
Sbjct: 482 PPPTPVYEGPLPPITGVSYASPPPPPF 508

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 55/111 (49%), Positives = 61/111 (54%), Gaps = 11/111 (9%)
 Frame = +1

Query: 10  SAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPP 189
           SA   +   S  +  S    +PF P  PP     PPPPSPP P    SPPPPP VY+ PP
Sbjct: 382 SAAQCNAFLSRPVDCSSFRCAPFVPSLPP-----PPPPSPPMPV--PSPPPPPPVYSPPP 434

Query: 190 PPPYVYNSPPPPPYVYK-----SPPPPPYVY------KSPPPPPYVYKSPP 309
           PPP   +S PPPP  YK     SPPPPP VY       SPPPPP +Y SPP
Sbjct: 435 PPP---SSSPPPPIHYKPPPSPSPPPPPAVYYHSPPPLSPPPPPVIYGSPP 482

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 42/80 (52%), Positives = 43/80 (53%), Gaps = 3/80 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPP-YIYKSPPPPPYVY 177
           PP    SSSP       P     SP  PPPP   Y SPPP SPPPP  IY SPPPP  VY
Sbjct: 432 PPPPPPSSSPPPPIHYKPPP---SPSPPPPPAVYYHSPPPLSPPPPPVIYGSPPPPTPVY 488

Query: 178 NSPPPP--PYVYNSPPPPPY 231
             P PP     Y SPPPPP+
Sbjct: 489 EGPLPPITGVSYASPPPPPF 508

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 31/59 (52%), Positives = 33/59 (55%)
 Frame = +1

Query: 136 PYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           P++   PPPPP      P PP    SPPPPP    SPPPPP    S PPPP  YK PPS
Sbjct: 403 PFVPSLPPPPP------PSPPMPVPSPPPPP-PVYSPPPPP--PSSSPPPPIHYKPPPS 452

[100][TOP]
>UniRef100_B9EXV1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9EXV1_ORYSJ
          Length = 532

 Score = 99.8 bits (247), Expect = 8e-20
 Identities = 57/116 (49%), Positives = 63/116 (54%), Gaps = 14/116 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPY-IYKSPPPPPYV- 174
           PP S    SP S    +P      P SP PPP   PSPPPPSPPPP  +Y S PPPPY  
Sbjct: 387 PPPSPPPPSP-SPPPPSPPPPSPPPPSPSPPP---PSPPPPSPPPPSPVYYSSPPPPYYE 442

Query: 175 ------YNSPPPPPYVYNSPPPPPYV------YKSPPPPPYVYKSPPPPPYVYKSP 306
                 Y SPPPPP  + +PPPP Y       Y SPPPPP   ++PPPPP    SP
Sbjct: 443 VSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSP 498

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 55/112 (49%), Positives = 61/112 (54%), Gaps = 15/112 (13%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPP-PPYVYPSPPPPSPPPPY-IYKSPPPPPYVYNSPPP 192
           S SP   +   PS    SP  PPP PP   P PP PSPPPP     SPPPP  VY S PP
Sbjct: 378 SPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPP 437

Query: 193 PPYV-------YNSPPPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           PPY        Y SPPPPP  +++PPPP Y       Y SPPPPP   ++PP
Sbjct: 438 PPYYEVSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPP 489

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 56/110 (50%), Positives = 60/110 (54%), Gaps = 7/110 (6%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P S    +PS    SP  PP PP   PSPPPPSPPPP    SPPPP     
Sbjct: 362 PPPPPPSPPPPSPPPPSPSPPPPSP-PPPSPPPPSPSPPPPSPPPP----SPPPPS---P 413

Query: 181 SPPPPPYVYNSPPPP-PYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           SPPPP     SPPPP P  Y SPPPP Y       Y SPPPPP  +++PP
Sbjct: 414 SPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPPPAYHEAPP 463

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/133 (40%), Positives = 57/133 (42%), Gaps = 33/133 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP S    SP   +   P      P  PPP P  Y SPPPP           SPPPP  Y
Sbjct: 399 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPPPAY 458

Query: 148 KSPPPPPYV-------YNSPPPPPYVYNSPPPPPYV-------YKSPPPPP--------Y 261
              PPPPY        Y SPPPPP    +PPPPP         Y SPPPP         Y
Sbjct: 459 HEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPEDRYLSPPPPSPVKWKLPVY 518

Query: 262 VYKSPPPPPYVYK 300
            Y SPPPP   +K
Sbjct: 519 EYSSPPPPAATWK 531

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 58/137 (42%), Positives = 63/137 (45%), Gaps = 34/137 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP------PPPYIYKSP-- 156
           PP  + S  P S    +P     SP  P PPP   PSPPPPSP      PPPY   SP  
Sbjct: 391 PPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPP---PSPPPPSPVYYSSPPPPYYEVSPED 447

Query: 157 ----PPPPYVYNSPPPPPYVYNSP------PPPPYVYKSPPPPPYVYK--------SPPP 282
               PPPP  Y+  PPPPY   SP      PPPP  Y+  PPPP  Y+        SPPP
Sbjct: 448 RYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPEDRYLSPPP 507

Query: 283 PP--------YVYKSPP 309
           P         Y Y SPP
Sbjct: 508 PSPVKWKLPVYEYSSPP 524

[101][TOP]
>UniRef100_Q8L3T8 cDNA clone:001-201-A04, full insert sequence n=2 Tax=Oryza sativa
           RepID=Q8L3T8_ORYSJ
          Length = 570

 Score = 99.8 bits (247), Expect = 8e-20
 Identities = 57/116 (49%), Positives = 63/116 (54%), Gaps = 14/116 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPY-IYKSPPPPPYV- 174
           PP S    SP S    +P      P SP PPP   PSPPPPSPPPP  +Y S PPPPY  
Sbjct: 425 PPPSPPPPSP-SPPPPSPPPPSPPPPSPSPPP---PSPPPPSPPPPSPVYYSSPPPPYYE 480

Query: 175 ------YNSPPPPPYVYNSPPPPPYV------YKSPPPPPYVYKSPPPPPYVYKSP 306
                 Y SPPPPP  + +PPPP Y       Y SPPPPP   ++PPPPP    SP
Sbjct: 481 VSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSP 536

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 55/112 (49%), Positives = 61/112 (54%), Gaps = 15/112 (13%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPP-PPYVYPSPPPPSPPPPY-IYKSPPPPPYVYNSPPP 192
           S SP   +   PS    SP  PPP PP   P PP PSPPPP     SPPPP  VY S PP
Sbjct: 416 SPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPP 475

Query: 193 PPYV-------YNSPPPPPYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           PPY        Y SPPPPP  +++PPPP Y       Y SPPPPP   ++PP
Sbjct: 476 PPYYEVSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPP 527

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 56/110 (50%), Positives = 60/110 (54%), Gaps = 7/110 (6%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P S    +PS    SP  PP PP   PSPPPPSPPPP    SPPPP     
Sbjct: 400 PPPPPPSPPPPSPPPPSPSPPPPSP-PPPSPPPPSPSPPPPSPPPP----SPPPPS---P 451

Query: 181 SPPPPPYVYNSPPPP-PYVYKSPPPPPYV------YKSPPPPPYVYKSPP 309
           SPPPP     SPPPP P  Y SPPPP Y       Y SPPPPP  +++PP
Sbjct: 452 SPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPPPAYHEAPP 501

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/133 (40%), Positives = 57/133 (42%), Gaps = 33/133 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----------SPPPPYIY 147
           PP S    SP   +   P      P  PPP P  Y SPPPP           SPPPP  Y
Sbjct: 437 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPPPAY 496

Query: 148 KSPPPPPYV-------YNSPPPPPYVYNSPPPPPYV-------YKSPPPPP--------Y 261
              PPPPY        Y SPPPPP    +PPPPP         Y SPPPP         Y
Sbjct: 497 HEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPEDRYLSPPPPSPVKWKLPVY 556

Query: 262 VYKSPPPPPYVYK 300
            Y SPPPP   +K
Sbjct: 557 EYSSPPPPAATWK 569

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 58/137 (42%), Positives = 63/137 (45%), Gaps = 34/137 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP------PPPYIYKSP-- 156
           PP  + S  P S    +P     SP  P PPP   PSPPPPSP      PPPY   SP  
Sbjct: 429 PPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPP---PSPPPPSPVYYSSPPPPYYEVSPED 485

Query: 157 ----PPPPYVYNSPPPPPYVYNSP------PPPPYVYKSPPPPPYVYK--------SPPP 282
               PPPP  Y+  PPPPY   SP      PPPP  Y+  PPPP  Y+        SPPP
Sbjct: 486 RYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPEDRYLSPPP 545

Query: 283 PP--------YVYKSPP 309
           P         Y Y SPP
Sbjct: 546 PSPVKWKLPVYEYSSPP 562

[102][TOP]
>UniRef100_Q9S9A4 Extensin (Fragment) n=1 Tax=Vicia faba RepID=Q9S9A4_VICFA
          Length = 116

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 56/111 (50%), Positives = 59/111 (53%), Gaps = 33/111 (29%)
 Frame = +1

Query: 76  FSPPPPPYVYPSP------PPPSPPP---PYIYKSPPPPPY--------VYNSPPPP--- 195
           +S PPP + YP P      PPP P P   PY Y SPPPPP         VY+SPPPP   
Sbjct: 4   YSSPPPVHTYPHPHPFYHSPPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTP 63

Query: 196 ---PYVYNSPPPPPY----------VYKSPPPPPYVYKSPPPPPYVYKSPP 309
              PY Y SPPPPP           VY SPPPP Y   SPPPP Y YKSPP
Sbjct: 64  HKKPYKYPSPPPPPVHTYPPHVPHPVYHSPPPPVY---SPPPPHYYYKSPP 111

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 39/65 (60%), Positives = 41/65 (63%), Gaps = 6/65 (9%)
 Frame = +1

Query: 79  SPPPPP------YVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPPPPP      Y YPS  PP PPP + Y    P P VY+SPPPP Y   SPPPP Y YK
Sbjct: 56  SPPPPPTPHKKPYKYPS--PP-PPPVHTYPPHVPHP-VYHSPPPPVY---SPPPPHYYYK 108

Query: 241 SPPPP 255
           SPPPP
Sbjct: 109 SPPPP 113

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 39/85 (45%), Positives = 45/85 (52%), Gaps = 14/85 (16%)
 Frame = +1

Query: 97  YVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPP-Y---- 261
           Y Y SPPP       ++  P P P+ Y+SPPPPP    +P   PY Y SPPPPP +    
Sbjct: 2   YSYSSPPP-------VHTYPHPHPF-YHSPPPPP----TPHKKPYKYPSPPPPPVHTYPH 49

Query: 262 ---VYKSPPPP------PYVYKSPP 309
              VY SPPPP      PY Y SPP
Sbjct: 50  PHPVYHSPPPPPTPHKKPYKYPSPP 74

[103][TOP]
>UniRef100_Q94ES8 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES8_PEA
          Length = 195

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 58/117 (49%), Positives = 63/117 (53%), Gaps = 40/117 (34%)
 Frame = +1

Query: 79  SPPPPPYVYP-------SPPPPSP-PPPYIYKSPPPPPY--------VYNSPPPP---PY 201
           SPPPP + YP       SPPPP+P   PY Y SPPPPP         VY+SPPPP   PY
Sbjct: 71  SPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPY 130

Query: 202 VYNSPPPPPY--------VYKSPPPPPY-------VYKSPPPP------PYVYKSPP 309
            Y+SPPPPP         VY SPPPP +       VY SPPPP      PY Y SPP
Sbjct: 131 KYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPP 187

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 58/114 (50%), Positives = 61/114 (53%), Gaps = 37/114 (32%)
 Frame = +1

Query: 79  SPPPP--PYVYPSPPPPS----PPPPYIYKSPPPPPY-------VYNSPPPP-----PYV 204
           SPPPP  PY Y SPPPP     P P  +Y SPPPP +       VY+SPPPP     PY 
Sbjct: 41  SPPPPKDPYHYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPPTPHKKPYK 100

Query: 205 YNSPPPPPY--------VYKSPPPP---PYVYKSPPPPPY--------VYKSPP 309
           Y SPPPPP         VY SPPPP   PY Y SPPPPP         VY SPP
Sbjct: 101 YPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPP 154

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 54/103 (52%), Positives = 58/103 (56%), Gaps = 33/103 (32%)
 Frame = +1

Query: 79  SPPPP-----PYVYPSPPPPS----PPPPYIYKSPPPP---PYVYNSPPPPPY------- 201
           SPPPP     PY YPSPPPP     P P  +Y SPPPP   PY Y+SPPPPP        
Sbjct: 88  SPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPH 147

Query: 202 -VYNSPPPPPY-------VYKSPPPP------PYVYKSPPPPP 288
            VY+SPPPP +       VY SPPPP      PY Y SPPPPP
Sbjct: 148 PVYHSPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPP 190

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 56/107 (52%), Positives = 59/107 (55%), Gaps = 36/107 (33%)
 Frame = +1

Query: 97  YVYPSPPPP--SPPPP---YIYKSPPPPPY--------VYNSPPPPPY-------VYNSP 216
           Y Y SPPPP  SPPPP   Y Y SPPPPP         VY+SPPPP +       VY+SP
Sbjct: 30  YSYSSPPPPVHSPPPPKDPYHYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSP 89

Query: 217 PPP-----PYVYKSPPPPPY--------VYKSPPPP---PYVYKSPP 309
           PPP     PY Y SPPPPP         VY SPPPP   PY Y SPP
Sbjct: 90  PPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPP 136

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 58/131 (44%), Positives = 63/131 (48%), Gaps = 36/131 (27%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSPFSPPPPP--YVYPSPPP--PSPPPPY--------IYKSPPPP 165
           SSP       P       +S PPPP  + YP P P   SPPPP         +Y SPPPP
Sbjct: 33  SSPPPPVHSPPPPKDPYHYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPP 92

Query: 166 -----PYVYNSPPPPPY--------VYNSPPPP---PYVYKSPPPPPY--------VYKS 273
                PY Y SPPPPP         VY+SPPPP   PY Y SPPPPP         VY S
Sbjct: 93  TPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHS 152

Query: 274 PPPPPYVYKSP 306
           PPPP + Y  P
Sbjct: 153 PPPPVHTYPHP 163

[104][TOP]
>UniRef100_Q94ES9 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES9_PEA
          Length = 183

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 57/109 (52%), Positives = 61/109 (55%), Gaps = 32/109 (29%)
 Frame = +1

Query: 79  SPPPPPYVYP-------SPPPPSP-PPPYIYKSPPPPP-Y-------VYNSPPPP----- 195
           SPPPP + YP       SPPPP+P   PY Y SPPPPP +       VY+SPPPP     
Sbjct: 73  SPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHK 132

Query: 196 -PYVYNSPPPPPY----------VYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PY Y SPPPPP           VY SPPPP Y   SPPPP Y YKSPP
Sbjct: 133 KPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPAY---SPPPPAYYYKSPP 178

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/105 (51%), Positives = 59/105 (56%), Gaps = 28/105 (26%)
 Frame = +1

Query: 79  SPPPP--PYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPY-------VYNSPPPP-- 225
           SPPPP  P+ Y SPPPP PPP + Y  P P   VY+SPPPP +       VY+SPPPP  
Sbjct: 41  SPPPPKDPHHYSSPPPP-PPPVHTYPHPHP---VYHSPPPPVHTYPHPHPVYHSPPPPTP 96

Query: 226 ---PYVYKSPPPPPY--------VYKSPPPP------PYVYKSPP 309
              PY Y SPPPPP         VY SPPPP      PY Y SPP
Sbjct: 97  HKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPP 141

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 57/130 (43%), Positives = 61/130 (46%), Gaps = 52/130 (40%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPP--------PPSPPPPY--------IYKSPPPPPY-------VYNSP 186
           +S PPPP   P PP        PP PPPP         +Y SPPPP +       VY+SP
Sbjct: 32  YSSPPPPVHSPPPPKDPHHYSSPPPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSP 91

Query: 187 PPP-----PYVYNSPPPPPY--------VYKSPPPP------PYVYKSPPPPPY------ 291
           PPP     PY Y SPPPPP         VY SPPPP      PY Y SPPPPP       
Sbjct: 92  PPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPH 151

Query: 292 ----VYKSPP 309
               VY SPP
Sbjct: 152 VPTPVYHSPP 161

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 45/80 (56%), Positives = 47/80 (58%), Gaps = 9/80 (11%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSP------PPPSPPP---PYIYKSPPPPPYVYNSPPPPPYVYNSPPPP 225
           P  PPPP + YP P      PPP P P   PY Y SPPPPP     P  P  VY+SPPPP
Sbjct: 104 PSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPP 163

Query: 226 PYVYKSPPPPPYVYKSPPPP 285
            Y   SPPPP Y YKSPPPP
Sbjct: 164 AY---SPPPPAYYYKSPPPP 180

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/101 (46%), Positives = 51/101 (50%), Gaps = 30/101 (29%)
 Frame = +1

Query: 97  YVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPP----------YVYNSPPPPPY----- 231
           Y Y SPPPP   PP     PP  P+ Y+SPPPPP           VY+SPPPP +     
Sbjct: 30  YSYSSPPPPVHSPP-----PPKDPHHYSSPPPPPPPVHTYPHPHPVYHSPPPPVHTYPHP 84

Query: 232 --VYKSPPPP-----PYVYKSPPPPPY--------VYKSPP 309
             VY SPPPP     PY Y SPPPPP         VY SPP
Sbjct: 85  HPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPP 125

[105][TOP]
>UniRef100_Q94ES5 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES5_PEA
          Length = 144

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 60/121 (49%), Positives = 65/121 (53%), Gaps = 35/121 (28%)
 Frame = +1

Query: 52  PSGIGVSPFS---PPPPPYVYP-------SPPPPSP-PPPYIYKSPPPPPY--------V 174
           PS I  + +S   PPPP + YP       SPPPP+P   PY Y SPPPPP         V
Sbjct: 22  PSEISANQYSYSSPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPV 81

Query: 175 YNSPPPPP------YVYNSPPPPPY----------VYKSPPPPPYVYKSPPPPPYVYKSP 306
           Y+SPPPPP      Y Y SPPPPP           VY SPPPP   Y SPPPP Y YKSP
Sbjct: 82  YHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPP--AY-SPPPPAYYYKSP 138

Query: 307 P 309
           P
Sbjct: 139 P 139

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 36/61 (59%), Positives = 37/61 (60%), Gaps = 12/61 (19%)
 Frame = +1

Query: 79  SPPPPP------YVYPSPPPPS----PP--PPYIYKSPPPPPYVYNSPPPPPYVYNSPPP 222
           SPPPPP      Y YPSPPPP     PP  P  +Y SPPPP   Y SPPPP Y Y SPPP
Sbjct: 84  SPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPP--AY-SPPPPAYYYKSPPP 140

Query: 223 P 225
           P
Sbjct: 141 P 141

[106][TOP]
>UniRef100_O81765 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=O81765_ARATH
          Length = 699

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 51/91 (56%), Positives = 57/91 (62%), Gaps = 15/91 (16%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYVYNSPP----PPPYVYNSPP----PPPY 231
           PPPPP V+ SPPPP  SPPPP +Y  PPPPP V++ PP    PPP VY+ PP    PPP 
Sbjct: 534 PPPPPPVH-SPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPP 592

Query: 232 VYKSPPP-----PPYVYKSPPPPPYVYKSPP 309
           V+  PPP     PP    SPPPPP VY  PP
Sbjct: 593 VHSPPPPAPVHSPPPPVHSPPPPPPVYSPPP 623

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 50/86 (58%), Positives = 54/86 (62%), Gaps = 9/86 (10%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPP----PPPYVYK 240
           SPPPP Y  P PPPP  SPPPP    SPPPPP VY+ PPPPP V++ PP    PPP VY 
Sbjct: 525 SPPPPVYSPPPPPPPVHSPPPPV--HSPPPPP-VYSPPPPPPPVHSPPPPVFSPPPPVYS 581

Query: 241 SPPP---PPYVYKSPPPPPYVYKSPP 309
            PPP   PP    SPPPP  V+  PP
Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHSPPP 607

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 56/143 (39%), Positives = 64/143 (44%), Gaps = 41/143 (28%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSP----FSPPPPPYVYPSPPPP--SPPPPYIYKSPPPP 165
           P      SP +  +  P     SP    +SPPPPP    SPPPP  SPPPP +Y  PPPP
Sbjct: 503 PDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPP 562

Query: 166 PYVYNSPPP--------------------------PPYVYNSPPPPPYVYKSPPPPPYVY 267
           P V++ PPP                          PP   +SPPPP +   SPPPPP VY
Sbjct: 563 PPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVH---SPPPPPPVY 619

Query: 268 KSPPP---------PPYVYKSPP 309
             PPP         PP VY  PP
Sbjct: 620 SPPPPVFSPPPSQSPPVVYSPPP 642

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 52/114 (45%), Positives = 59/114 (51%), Gaps = 19/114 (16%)
 Frame = +1

Query: 25  SPNSSTKIT-PSGIGVSPFSPPPPPYVYPSPPPP---SP------PPPYIYKSPPPPPYV 174
           SP  +T +  PS +   P   P PP   P P  P   SP      PPP    SPPPP  V
Sbjct: 473 SPVLATPVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPP--V 530

Query: 175 YNSPPPPPYVYNSP-----PPPPYVYKSPPPPPYVYKSPP----PPPYVYKSPP 309
           Y+ PPPPP V++ P     PPPP VY  PPPPP V+  PP    PPP VY  PP
Sbjct: 531 YSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPP 584

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 54/117 (46%), Positives = 60/117 (51%), Gaps = 14/117 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP--SPPPPYIYKSPPPP 165
           PP  +    P  S    P  +   P   FSPPPP Y   SPPPP  SPPPP    SPPPP
Sbjct: 545 PPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVY---SPPPPVHSPPPP--VHSPPPP 599

Query: 166 PYVYNSPPPPPYVYNSPPPPPYVYKSPPP---------PPYVYKSPPPPPYVYKSPP 309
             V++ PPP     +SPPPPP VY  PPP         PP VY  PP PP +  SPP
Sbjct: 600 APVHSPPPP----VHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKI-NSPP 651

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 52/113 (46%), Positives = 59/113 (52%), Gaps = 10/113 (8%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP---PPPYIYKSPPPPPY 171
           PP   V S P       P      P    PPP V+ SPPPP+P   PPP ++ SPPPPP 
Sbjct: 560 PPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVH-SPPPPAPVHSPPPPVH-SPPPPPP 617

Query: 172 VYNSPPPPPYVYNSPPP---PPYVYKSPPPPPYV----YKSPPPPPYVYKSPP 309
           VY SPPPP +   SPPP   PP VY  PP PP +     +SPPP P   K  P
Sbjct: 618 VY-SPPPPVF---SPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPVEKKETP 666

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 51/128 (39%), Positives = 58/128 (45%), Gaps = 25/128 (19%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
           PP    S  P   +   P      P   PPPP    SPPPP  SPPPP    SPPPP + 
Sbjct: 568 PPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVF- 626

Query: 175 YNSPPP---PPYVYNSPPPPPYV----YKSPPPPPYVYKSPPP-------------PPYV 294
             SPPP   PP VY+ PP PP +     +SPPP P   K  PP             PP++
Sbjct: 627 --SPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPVEKKETPPAHAPAPSDDEFIIPPFI 684

Query: 295 ---YKSPP 309
              Y SPP
Sbjct: 685 GHQYASPP 692

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 41/115 (35%), Positives = 50/115 (43%), Gaps = 28/115 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPP-----PSPPPPYIYKSP 156
           PP    S  P   +   P+ +   P    SPPPPP VY  PPP     PS  PP +Y  P
Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPP 641

Query: 157 PPPPYVYN----SPPPPPYVYNSPPP-------------PPYV---YKSPPPPPY 261
           P PP + +    SPPP P      PP             PP++   Y SPPPP +
Sbjct: 642 PRPPKINSPPVQSPPPAPVEKKETPPAHAPAPSDDEFIIPPFIGHQYASPPPPMF 696

[107][TOP]
>UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis
           thaliana RepID=Q9XIL9_ARATH
          Length = 727

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 53/87 (60%), Positives = 57/87 (65%), Gaps = 10/87 (11%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPP- 249
           SPPPPP   P PP P  SPPPP +Y SPPPPP VY SPPPPP VY SPPPPP V+  PP 
Sbjct: 492 SPPPPPVHSPPPPSPIHSPPPPPVY-SPPPPPPVY-SPPPPPPVY-SPPPPPPVHSPPPP 548

Query: 250 ---PPPYVYKSPP----PPPYVYKSPP 309
              PPP V+  PP    PPP V+  PP
Sbjct: 549 VHSPPPPVHSPPPPVHSPPPPVHSPPP 575

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 56/117 (47%), Positives = 64/117 (54%), Gaps = 20/117 (17%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSP-----FSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPYV 174
           S  PN     +P     SP      SPPPP  ++  PPPP    PPPP +Y SPPPPP V
Sbjct: 475 SPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVY-SPPPPPPV 533

Query: 175 YNSPPPPPYVYNSPP----PPPYVYKSPP----PPPYVYKSPP----PPPYVYKSPP 309
           Y SPPPPP V++ PP    PPP V+  PP    PPP V+  PP    PPP VY  PP
Sbjct: 534 Y-SPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPP 589

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 60/128 (46%), Positives = 67/128 (52%), Gaps = 25/128 (19%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPP---- 159
           PP   V S P  S   +P    V  +SPPPPP VY  PPPP   SPPPP    SPP    
Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPV--YSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVH 550

Query: 160 -PPPYVYNSPP----PPPYVYNSPP----PPPYVYKSPP-----PPPYVYKSPP----PP 285
            PPP V++ PP    PPP V++ PP    PPP VY  PP     PPP V+  PP    PP
Sbjct: 551 SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPP 610

Query: 286 PYVYKSPP 309
           P VY  PP
Sbjct: 611 PPVYSPPP 618

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 59/118 (50%), Positives = 65/118 (55%), Gaps = 15/118 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYP--------SPPPP---SPPPPYIY 147
           PP S+  +SP   +  +P      P   P P   Y         SPPPP   SPPPP   
Sbjct: 448 PPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPI 507

Query: 148 KSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPP----PPPYVYKSPP 309
            SPPPPP VY SPPPPP VY SPPPPP VY SPPPPP V+  PP    PPP V+  PP
Sbjct: 508 HSPPPPP-VY-SPPPPPPVY-SPPPPPPVY-SPPPPPPVHSPPPPVHSPPPPVHSPPP 561

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 54/120 (45%), Positives = 60/120 (50%), Gaps = 17/120 (14%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPP-----PP 165
           PP    S  P   +   P      P   PPPP   P PP  SPPPP +Y  PP     PP
Sbjct: 538 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP-VYSPPPPPVHSPP 596

Query: 166 PYVYNSPP----PPPYVYNSPPPPPYVYKSPP----PPPYVYKSPP----PPPYVYKSPP 309
           P V++ PP    PPP VY SPPPPP V+  PP    PPP V+  PP    PPP VY  PP
Sbjct: 597 PPVHSPPPPVHSPPPPVY-SPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPP 655

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 51/115 (44%), Positives = 57/115 (49%), Gaps = 12/115 (10%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPP----PP 168
           PP    S  P   +   P      P   PPPP   P PPP   PPP ++  PPP    PP
Sbjct: 552 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPP 611

Query: 169 YVYNSPPPPPYVYNSPPPPPYVYKSPP----PPPYVYKSPP----PPPYVYKSPP 309
            VY+ PPPPP   +SPPPP  V+  PP    PPP VY  PP    PPP   KSPP
Sbjct: 612 PVYSPPPPPP--VHSPPPP--VFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPP 662

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 48/80 (60%), Positives = 49/80 (61%), Gaps = 2/80 (2%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           P   PPPP   P PPPP  SPPPP    SPPPP    +SPPPP Y   SPPPP Y   SP
Sbjct: 605 PVHSPPPPVYSPPPPPPVHSPPPPVF--SPPPP---VHSPPPPVY---SPPPPVY---SP 653

Query: 247 PPPPYVYKSPPPPPYVYKSP 306
           PPPP   KSPPPPP VY  P
Sbjct: 654 PPPP--VKSPPPPP-VYSPP 670

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 57/108 (52%), Positives = 59/108 (54%), Gaps = 4/108 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP--FSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPP 168
           PP   V S P       P      P  +SPPPPP    SPPPP  SPPPP    SPPPP 
Sbjct: 587 PPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP-PVHSPPPPVFSPPPP--VHSPPPPV 643

Query: 169 YVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           Y   SPPPP Y   SPPPPP   KSPPPPP VY SPP  P    SPP+
Sbjct: 644 Y---SPPPPVY---SPPPPP--VKSPPPPP-VY-SPPLLPPKMSSPPT 681

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 49/121 (40%), Positives = 56/121 (46%), Gaps = 24/121 (19%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP-----PYVYPSPPPPSPPPPYIYKSPPPP 165
           PP    S  P       P  +    FSPPPP     P VY  PPP   PPP   KSPPPP
Sbjct: 609 PPPPVYSPPPPPPVHSPPPPV----FSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664

Query: 166 PYVYNSP--------PPPPYVYNSPPP--PPYVYKSPPP------PPYV---YKSPPPPP 288
           P VY+ P        PP     NSPPP  P    ++PPP      PP++   Y SPPPP 
Sbjct: 665 P-VYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPSEEFIIPPFIGHQYASPPPPM 723

Query: 289 Y 291
           +
Sbjct: 724 F 724

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 45/101 (44%), Positives = 49/101 (48%), Gaps = 24/101 (23%)
 Frame = +1

Query: 79  SPPPPP----YVYPSPPPPSPPP--PYIYKSPPP---PPYVYNSPPP-------PPYVYN 210
           SPPPP     +V  SPPP S PP  P ++ +P P   P     SP P       P     
Sbjct: 432 SPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRR 491

Query: 211 SPPPPPYVYKSP--------PPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP    SP        PPPP VY SPPPPP VY  PP
Sbjct: 492 SPPPPPV--HSPPPPSPIHSPPPPPVY-SPPPPPPVYSPPP 529

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 40/136 (29%), Positives = 53/136 (38%), Gaps = 41/136 (30%)
 Frame = +1

Query: 25  SPNSSTKITPSGIGVSPFSPPPPPYVYP---------------SPPPPSPPPPYIYKSPP 159
           S  ++   +PS +   P   P PP   P               SPPPP  P  ++  SPP
Sbjct: 389 SSQATPSKSPSPVPTRPVHKPQPPKESPQPNDPYNQSPVKFRRSPPPPQQPHHHVVHSPP 448

Query: 160 PPPYVYNSPPPPPYVYNSPPP-------------------PPYVYKSPPPPPYVYKSP-- 276
           P     +SPP  P V+++P P                    P  ++  PPPP V+  P  
Sbjct: 449 PA----SSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPP 504

Query: 277 -----PPPPYVYKSPP 309
                PPPP VY  PP
Sbjct: 505 SPIHSPPPPPVYSPPP 520

[108][TOP]
>UniRef100_Q94ES3 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES3_PEA
          Length = 137

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 56/107 (52%), Positives = 59/107 (55%), Gaps = 30/107 (28%)
 Frame = +1

Query: 79  SPPPP---PYVYPSPPPPS----PPPPYIYKSPPPPPY-------VYNSPPPP------P 198
           SPPPP   PY Y SPPPP     P P  +Y SPPPP +       VY+SPPPP      P
Sbjct: 29  SPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPPPTPHKKP 88

Query: 199 YVYNSPPPPPY----------VYKSPPPPPYVYKSPPPPPYVYKSPP 309
           Y Y SPPPPP           VY SPPPP Y   SPPPP Y YKSPP
Sbjct: 89  YKYPSPPPPPAHTYPPHVPTPVYHSPPPPVY---SPPPPAYYYKSPP 132

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 45/78 (57%), Positives = 47/78 (60%), Gaps = 9/78 (11%)
 Frame = +1

Query: 79  SPPPPPYVYPSP------PPPSPPP---PYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPY 231
           SPPPP + YP P      PPP P P   PY Y SPPPPP     P  P  VY+SPPPP Y
Sbjct: 60  SPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVY 119

Query: 232 VYKSPPPPPYVYKSPPPP 285
              SPPPP Y YKSPPPP
Sbjct: 120 ---SPPPPAYYYKSPPPP 134

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 51/97 (52%), Positives = 56/97 (57%), Gaps = 20/97 (20%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPS----PPPPYIYKSPPPP---PYVYNSPPPPPYVYNSPPPPPYVY 237
           +P   PY YPSPPPP     P P  +Y SPPPP   PY Y+SPPPPP V+  P P P VY
Sbjct: 1   TPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPP-VHTYPHPHP-VY 58

Query: 238 KSPPPPPY-------VYKSPPPP------PYVYKSPP 309
            SPPPP +       VY SPPPP      PY Y SPP
Sbjct: 59  HSPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPP 95

[109][TOP]
>UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J4Y2_HUMAN
          Length = 253

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 52/107 (48%), Positives = 56/107 (52%), Gaps = 4/107 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P+  + + PS     P SPPPPP   P PPP SPPPP    SPPPPP    
Sbjct: 29  PPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSP 88

Query: 181 SP----PPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            P    PPPP    SPPPPP +  SPPPPP    SPPPPP     PP
Sbjct: 89  PPPLPSPPPPPPLPSPPPPPPLPSSPPPPP---PSPPPPPLSPPPPP 132

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 54/103 (52%), Positives = 58/103 (56%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S     P+S     P      P SPPPPP   P PP PSPPPP    SPPPPP + +
Sbjct: 59  PPPSQPPPPPSSPPPPPP------PPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPS 112

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP    SPPPPP    SPPPPP    SPPPPP +   PP
Sbjct: 113 SPPPPP---PSPPPPPL---SPPPPP---PSPPPPPLLSPPPP 146

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/106 (49%), Positives = 55/106 (51%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S     P+      PS     P SPPPPP   P PPPPS PPP     PPPPP    
Sbjct: 21  PPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSP 80

Query: 181 SPPPPPY---VYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP       SPPPPP +  SPPPPP +  SPPPPP     PP
Sbjct: 81  PPPPPPSPPPPLPSPPPPPPL-PSPPPPPPLPSSPPPPPPSPPPPP 125

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 50/102 (49%), Positives = 53/102 (51%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNS 183
           P S     P S     PS     P SPPPPP     PPPP P PP    SPPPPP + + 
Sbjct: 45  PPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSP 104

Query: 184 PPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPPPP   + PPPPP    SPPPPP    SPPPPP     PP
Sbjct: 105 PPPPPLPSSPPPPPP----SPPPPPL---SPPPPPPSPPPPP 139

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/108 (48%), Positives = 55/108 (50%), Gaps = 5/108 (4%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP  +    P  S    P      P SPPPPP + P PPPPSPPPP     PPPPP    
Sbjct: 108 PPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPP---- 163

Query: 181 SPPPP-PYVYNSPPPPPY----VYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP P     PPPPP     +  SPPPPP     PPPPP    SPP
Sbjct: 164 SPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPP----SPP 207

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/107 (48%), Positives = 56/107 (52%), Gaps = 4/107 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP-PYVYPSPPPPSPPPPYIYKSPPPPPYVY 177
           PP S     P S     PS     P SPP P P   P PPPPSPPPP   + PPPP    
Sbjct: 13  PPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPP---- 68

Query: 178 NSPPPPPYVYNSPPPPPYVYKSP---PPPPYVYKSPPPPPYVYKSPP 309
           +SPPPPP   + PPPPP     P   PPPP    SPPPPP +  SPP
Sbjct: 69  SSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPP 115

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 54/108 (50%), Positives = 55/108 (50%), Gaps = 5/108 (4%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPPYIYKSPPPP 165
           PP S     P  S    P      P   PPPP   PSPPPP     SPPPP    SPPPP
Sbjct: 67  PPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPP--PPSPPPP 124

Query: 166 PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P    SPPPPP    SPPPPP +  SPPPPP    SPPPPP     PP
Sbjct: 125 PL---SPPPPP---PSPPPPPLL--SPPPPP---PSPPPPPPPSPPPP 161

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 55/106 (51%), Positives = 58/106 (54%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPS---PPPPSPPPPYIYKSPPPPPY 171
           PP S     P S     PS     P   PPPP   PS   PPPPSPPPP +  SPPPPP 
Sbjct: 76  PPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPL--SPPPPP- 132

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              SPPPPP + + PPPPP    SPPPPP    SPPPPP    SPP
Sbjct: 133 --PSPPPPP-LLSPPPPPP----SPPPPP--PPSPPPPP---PSPP 166

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 46/84 (54%), Positives = 47/84 (55%), Gaps = 4/84 (4%)
 Frame = +1

Query: 70  SPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPY----VYNSPPPPPYVYNSPPPPPYVY 237
           SP  PPPPP   P PPPPSPPPP     PPPPP     +  SPPPPP    SPPPPP   
Sbjct: 6   SPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPP--PPSPPPPP--P 61

Query: 238 KSPPPPPYVYKSPPPPPYVYKSPP 309
             PPPPP     PPPPP     PP
Sbjct: 62  SQPPPPPSSPPPPPPPPSPPPPPP 85

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 51/105 (48%), Positives = 53/105 (50%), Gaps = 2/105 (1%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP     SSP      +P     SP  PPPPP   PSP PPSPPPP     PPPPP    
Sbjct: 8   PPPPPPPSSPPPPPPPSPPPPPPSP--PPPPPPSPPSPLPPSPPPPPPPSPPPPPP---- 61

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPP--PPYVYKSPPPPPYVYKSPP 309
           S PPPP     PPPPP     PPP  PP    SPPPPP +   PP
Sbjct: 62  SQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPP 106

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 46/81 (56%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPY-VYNSPPPPPYVYKSPP 249
           P SPPPPP   P PPPPSPPPP    SP PPP     PP PP+ +  SPPPPP     PP
Sbjct: 147 PPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPP-----PPSPPHPLPPSPPPPPPPSPPPP 201

Query: 250 PPPYVYKSPPPPPYVYKSPPS 312
           PPP    SPPPPP    SPP+
Sbjct: 202 PPP----SPPPPP--LPSPPA 216

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 42/77 (54%), Positives = 42/77 (54%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPY 261
           PPPPP   P PPPPS PPP    SPPPPP    SPPPPP     PP PP      PPPP 
Sbjct: 1   PPPPPSPPPPPPPPSSPPPPPPPSPPPPP---PSPPPPP-----PPSPPSPLPPSPPPPP 52

Query: 262 VYKSPPPPPYVYKSPPS 312
               PPPPP     PPS
Sbjct: 53  PPSPPPPPPSQPPPPPS 69

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 48/104 (46%), Positives = 51/104 (49%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S     P+    + P     SP  PPPP   +P PP P PPPP    SPPPPP    
Sbjct: 154 PPPSPPPPPPSPPPPLPPP----SPLPPPPPSPPHPLPPSPPPPPP---PSPPPPP--PP 204

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPPP      P PP     PPPPP    SPPPPP     PPS
Sbjct: 205 SPPPPPLPSPPAPSPPSPPLPPPPPP--PPSPPPPPPPSPPPPS 246

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 44/89 (49%), Positives = 47/89 (52%), Gaps = 3/89 (3%)
 Frame = +1

Query: 52  PSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPY 231
           PS     P SPPPPP   PSPPPP PPP  +   PP PP+     PPPP   + PPPPP 
Sbjct: 148 PSPPPPPPPSPPPPP---PSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPP- 203

Query: 232 VYKSPPPPPY---VYKSPPPPPYVYKSPP 309
              SPPPPP       SPP PP     PP
Sbjct: 204 --PSPPPPPLPSPPAPSPPSPPLPPPPPP 230

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 41/73 (56%), Positives = 43/73 (58%), Gaps = 1/73 (1%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP-SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPP 249
           P SPPPPP   P PPPP SPPPP +   P P P     PPPPP   + PPPPP    SPP
Sbjct: 187 PPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPP---PSPP 243

Query: 250 PPPYVYKSPPPPP 288
           PP     SPPPPP
Sbjct: 244 PP-----SPPPPP 251

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 47/106 (44%), Positives = 51/106 (48%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP-PPPPYVYPSPPPPSPP-PPY-IYKSPPPPPY 171
           PP   +S  P   +   P      P  P PPPP   PSP PP PP PP+ +  SPPPPP 
Sbjct: 136 PPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPP 195

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
               PPPPP    SPPPPP      P PP     PPPPP     PP
Sbjct: 196 PSPPPPPPP----SPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPP 237

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 45/104 (43%), Positives = 45/104 (43%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S     P  S    P      P  P PPP   P PP P PPPP    SPPPPP    
Sbjct: 161 PPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPP---PPPPSPPPPPP---PSPPPPPLPSP 214

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
             P PP     PPPPP     PPPPP      PPPP     PPS
Sbjct: 215 PAPSPPSPPLPPPPPPPPSPPPPPPP-----SPPPPSPPPPPPS 253

[110][TOP]
>UniRef100_Q1PDU7 Proline-rich extensin-like family protein n=1 Tax=Arabidopsis
           thaliana RepID=Q1PDU7_ARATH
          Length = 168

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 50/108 (46%), Positives = 62/108 (57%), Gaps = 15/108 (13%)
 Frame = +1

Query: 31  NSSTKITPSGIGVSPF---SPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPYVYNSPPP 192
           N++ K+  S    +P    SPPPPP +   PPPP   SPPPP +  SPPPPP +++ PPP
Sbjct: 24  NNNRKLLTSAPEPAPLVDLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPP 83

Query: 193 PPYVYNSPPPPPYVYKSPPPP-----PYVYKSPPPPPY----VYKSPP 309
                  PPPPP + +SPPPP      Y  K+PPPPPY    VY  PP
Sbjct: 84  ---TVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPP 128

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 46/87 (52%), Positives = 50/87 (57%), Gaps = 12/87 (13%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPP-----PYV 234
           SPPPPP     PPPP   SPPPP +  SPPPP      PPPPP +  SPPPP      Y 
Sbjct: 52  SPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPP--TVTRPPPPPTITRSPPPPRPQAAAYY 109

Query: 235 YKSPPPPPY----VYKSPPPPPYVYKS 303
            K+PPPPPY    VY  PPPPP   +S
Sbjct: 110 KKTPPPPPYKYGRVYPPPPPPPQAARS 136

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 57/123 (46%), Positives = 64/123 (52%), Gaps = 20/123 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
           PP   V  SP       P  + +SP  PPPP  + P PPP   SPPPP + + PPPPP +
Sbjct: 44  PPPPPVLLSP------PPPPVNLSP--PPPPVLLSPPPPPVLFSPPPPTVTR-PPPPPTI 94

Query: 175 YNSPPPP-----PYVYNSPPPPPY----VYKSPPPPPYV---YK-SPPPPP-----YVYK 300
             SPPPP      Y   +PPPPPY    VY  PPPPP     YK SPPPPP      VY 
Sbjct: 95  TRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVYS 154

Query: 301 SPP 309
            PP
Sbjct: 155 PPP 157

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 53/116 (45%), Positives = 62/116 (53%), Gaps = 21/116 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS----PPPPYIYKSPPPP- 165
           PP   + S P     ++P    V   SPPPPP ++ SPPPP+    PPPP I +SPPPP 
Sbjct: 45  PPPPVLLSPPPPPVNLSPPPPPVL-LSPPPPPVLF-SPPPPTVTRPPPPPTITRSPPPPR 102

Query: 166 ----PYVYNSPPPPPY----VYNSPPPPPYVYKS-----PPPPPYVY---KSPPPP 285
                Y   +PPPPPY    VY  PPPPP   +S     PPPPP  Y    SPPPP
Sbjct: 103 PQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVYSPPPP 158

[111][TOP]
>UniRef100_UPI0001985257 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001985257
          Length = 448

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 51/111 (45%), Positives = 62/111 (55%), Gaps = 7/111 (6%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP---PSPPPPYIYKSPPPPPY 171
           PPFS     P+      P  I     +PPPPP+  P PPP   P PPPP+I  +PPPPP+
Sbjct: 12  PPFSPPPPPPHRRPPPPPPHI-----NPPPPPHTRPPPPPHTRPPPPPPHI--NPPPPPH 64

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPP----PPYVYKSPPPPPYVYKSPPS 312
               PPPPP+    PPPPP++   PPP    PP  +  PPPPP+V   PPS
Sbjct: 65  T--RPPPPPH-RRPPPPPPHINPPPPPHTRPPPPPHTRPPPPPHVLPPPPS 112

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 35/69 (50%), Positives = 45/69 (65%)
 Frame = +1

Query: 103 YPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPP 282
           Y + PP SPPPP  ++ PPPPP   N PPPP   +  PPPPP+  + PPPPP++  +PPP
Sbjct: 8   YYNFPPFSPPPPPPHRRPPPPPPHINPPPPP---HTRPPPPPHT-RPPPPPPHI--NPPP 61

Query: 283 PPYVYKSPP 309
           PP+    PP
Sbjct: 62  PPHTRPPPP 70

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/88 (39%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPY 171
           PP +     P++     P  I   P     PPPPP+  P PPPP       + +PPPPP 
Sbjct: 37  PPHTRPPPPPHTRPPPPPPHINPPPPPHTRPPPPPHRRPPPPPP-------HINPPPPP- 88

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPP 255
            +  PPPPP  +  PPPPP+V   PP P
Sbjct: 89  -HTRPPPPP--HTRPPPPPHVLPPPPSP 113

[112][TOP]
>UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B541C
          Length = 661

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 55/115 (47%), Positives = 58/115 (50%), Gaps = 20/115 (17%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPP-------------YIYKSPPP 162
           S P S+  + PS    SP  PPPPP   P  PPP PPPP             Y Y SPPP
Sbjct: 468 SRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPP 527

Query: 163 PPYVYNSPPPPPYVYN--SPPPPP-----YVYKSPPPPPYVYKSPPPPPYVYKSP 306
           PP     PPPPP  YN  SPPPPP     Y Y SPPPP      PPPP Y Y +P
Sbjct: 528 PP----PPPPPPVTYNYPSPPPPPSLPVTYNYPSPPPP------PPPPSYNYPAP 572

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 59/126 (46%), Positives = 62/126 (49%), Gaps = 23/126 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP--PSPPPPYIYKSPPPPPYV 174
           PP S  SS+P+ S    PS     P  PP  P + PS PP  PSPPPP     PPPPP  
Sbjct: 447 PPPSPPSSTPSPS----PSTPSPPPSRPPSTPSLPPSRPPSSPSPPPP-----PPPPPPP 497

Query: 175 YNSPPPPP--------------YVYNSPPPPPYVYKSPPPPP--YVYKSPPPPP-----Y 291
              PPPPP              Y Y SPPPPP     PPPPP  Y Y SPPPPP     Y
Sbjct: 498 RPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPP----PPPPPPVTYNYPSPPPPPSLPVTY 553

Query: 292 VYKSPP 309
            Y SPP
Sbjct: 554 NYPSPP 559

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 50/111 (45%), Positives = 51/111 (45%), Gaps = 8/111 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPP-------YVYPS-PPPPSPPPPYIYKSP 156
           PP      S    T +TP      P  PPPPP       Y YPS PPPPS P  Y Y SP
Sbjct: 499 PPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPPVTYNYPSPPPPPSLPVTYNYPSP 558

Query: 157 PPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPP      PPPP Y Y   P P Y Y SP P P     PPPPP    S P
Sbjct: 559 PPP------PPPPSYNY---PAPTYYYPSPSPRP-----PPPPPRPRPSRP 595

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 38/79 (48%), Positives = 42/79 (53%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPP 255
           +  P  P+  PS  PPSPPPP     PPP  Y Y +PPPPP     PPPPP     PPPP
Sbjct: 47  YDKPKVPFGLPSHQPPSPPPP-----PPPVTYNYPAPPPPP-----PPPPP-----PPPP 91

Query: 256 PYVYKSPPPPPYVYKSPPS 312
           P     PPPPP V    P+
Sbjct: 92  P-----PPPPPRVSTPAPT 105

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 41/80 (51%), Positives = 44/80 (55%), Gaps = 6/80 (7%)
 Frame = +1

Query: 91  PPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYK 270
           P +  PSPPPP PP  Y Y +PPPPP     PPPPP     PPPPP     PPPPP V  
Sbjct: 57  PSHQPPSPPPPPPPVTYNYPAPPPPP-----PPPPP-----PPPPP-----PPPPPRV-S 100

Query: 271 SPPP---PPYV---YKSPPS 312
           +P P   PPY    Y S PS
Sbjct: 101 TPAPTYLPPYTGVNYGSSPS 120

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 58/195 (29%), Positives = 62/195 (31%), Gaps = 93/195 (47%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPP-----------------------YVYPS 111
            PP S   S+P+      PS     P  PPPPP                       Y YPS
Sbjct: 465  PPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPS 524

Query: 112  PPPPSPPPP----YIYKSPPPPP-----YVYNSPPPPP-----------YVYNSP----- 216
            PPPP PPPP    Y Y SPPPPP     Y Y SPPPPP           Y Y SP     
Sbjct: 525  PPPPPPPPPPPVTYNYPSPPPPPSLPVTYNYPSPPPPPPPPSYNYPAPTYYYPSPSPRPP 584

Query: 217  PPPP---------------------------------------------YVYKSPPPPPY 261
            PPPP                                             + Y  PP P  
Sbjct: 585  PPPPRPRPSRPRPIITPKPIPPRATYLPPPRLTPQPRTYLPPPTPTPQTFTYSQPPAPQS 644

Query: 262  VYKSPPPPPYVYKSP 306
                PP P  +Y  P
Sbjct: 645  RLYLPPRPAPMYLPP 659

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 38/73 (52%), Positives = 40/73 (54%), Gaps = 4/73 (5%)
 Frame = +1

Query: 73  PFSPPPPP----YVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           P SPPPPP    Y YP+PPPP PPPP     PPPPP     PPPPP V  S P P Y+  
Sbjct: 61  PPSPPPPPPPVTYNYPAPPPPPPPPP-----PPPPP----PPPPPPRV--STPAPTYL-- 107

Query: 241 SPPPPPYVYKSPP 279
            PP     Y S P
Sbjct: 108 -PPYTGVNYGSSP 119

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 41/117 (35%), Positives = 47/117 (40%), Gaps = 14/117 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPP--------YVYPSPPPPSPPPPYIYKSP 156
           PP +    SP     +  +    SP  PPPPP        Y YPSP P  PPPP   +  
Sbjct: 534 PPVTYNYPSPPPPPSLPVTYNYPSPPPPPPPPSYNYPAPTYYYPSPSPRPPPPPPRPRPS 593

Query: 157 PPPPYVYNSPPPPPYVYNSPP---PPPYVYKSPP---PPPYVYKSPPPPPYVYKSPP 309
            P P +   P PP   Y  PP   P P  Y  PP   P  + Y  PP P      PP
Sbjct: 594 RPRPIITPKPIPPRATYLPPPRLTPQPRTYLPPPTPTPQTFTYSQPPAPQSRLYLPP 650

[113][TOP]
>UniRef100_Q9LHF1 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9LHF1_ARATH
          Length = 494

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 45/84 (53%), Positives = 50/84 (59%), Gaps = 1/84 (1%)
 Frame = +1

Query: 58  GIGVSPFSPPPPPYVYPSPPPPSPP-PPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYV 234
           G G S   P PP    P PPPPSPP PP +Y  PP PP    SPPP P VY+ PPPP   
Sbjct: 395 GCGRSVVKPSPPIVALPPPPPPSPPLPPPVYSPPPSPPVF--SPPPSPPVYSPPPPPSIH 452

Query: 235 YKSPPPPPYVYKSPPPPPYVYKSP 306
           Y SPPPPP  + SPPPP   ++ P
Sbjct: 453 YSSPPPPPVHHSSPPPPSPEFEGP 476

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 44/79 (55%), Positives = 51/79 (64%), Gaps = 6/79 (7%)
 Frame = +1

Query: 73  PFSPPPPPYVY---PSPPPPSPPP-PYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           P SPP PP VY   PSPP  SPPP P +Y  PPPP   Y+SPPPPP  ++SPPPP   ++
Sbjct: 415 PPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEFE 474

Query: 241 SPPPP--PYVYKSPPPPPY 291
            P PP     Y SPPPPP+
Sbjct: 475 GPLPPVIGVSYASPPPPPF 493

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 42/93 (45%), Positives = 48/93 (51%), Gaps = 6/93 (6%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP----FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPP 168
           PP  A+   P  S  + P      P    FSPPP P VY  PPPPS      Y SPPPPP
Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPS----IHYSSPPPPP 460

Query: 169 YVYNSPPPPPYVYNSPPPP--PYVYKSPPPPPY 261
             ++SPPPP   +  P PP     Y SPPPPP+
Sbjct: 461 VHHSSPPPPSPEFEGPLPPVIGVSYASPPPPPF 493

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 8/69 (11%)
 Frame = +1

Query: 127 PPPPYIYKSPPPPPYVYNSPPPPPYVYN--------SPPPPPYVYKSPPPPPYVYKSPPP 282
           P PP +   PPPPP    SPP PP VY+        SPPP P VY  PPPP   Y SPPP
Sbjct: 403 PSPPIVALPPPPPP----SPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPP 458

Query: 283 PPYVYKSPP 309
           PP  + SPP
Sbjct: 459 PPVHHSSPP 467

[114][TOP]
>UniRef100_Q40793 Tyrosine-rich hydroxyproline-rich glycoprotein (Fragment) n=1
           Tax=Petroselinum crispum RepID=Q40793_PETCR
          Length = 259

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 46/78 (58%), Positives = 47/78 (60%), Gaps = 2/78 (2%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           P   PPPPY Y SPPPP  SPPPPY Y SPPPP       PPPPY Y SPPPP    KSP
Sbjct: 7   PVKSPPPPYYYSSPPPPVKSPPPPYYYTSPPPPV----KSPPPPYYYTSPPPP---MKSP 59

Query: 247 PPPPYVYKSPPPPPYVYK 300
           PPP Y +  P P  Y  K
Sbjct: 60  PPPYYPHPHPHPHSYTVK 77

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 45/76 (59%), Positives = 46/76 (60%), Gaps = 8/76 (10%)
 Frame = +1

Query: 103 YPSPPPP--SPPPPYIYKSPPPP------PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPP 258
           Y SPPPP  SPPPPY Y SPPPP      PY Y SPPPP       PPPPY Y SPPPP 
Sbjct: 1   YHSPPPPVKSPPPPYYYSSPPPPVKSPPPPYYYTSPPPPV----KSPPPPYYYTSPPPP- 55

Query: 259 YVYKSPPPPPYVYKSP 306
              KSPPPP Y +  P
Sbjct: 56  --MKSPPPPYYPHPHP 69

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/62 (61%), Positives = 39/62 (62%)
 Frame = +1

Query: 124 SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKS 303
           SPPPP      PPPPY Y+SPPPP       PPPPY Y SPPPP    KS PPPPY Y S
Sbjct: 3   SPPPPV---KSPPPPYYYSSPPPPV----KSPPPPYYYTSPPPP---VKS-PPPPYYYTS 51

Query: 304 PP 309
           PP
Sbjct: 52  PP 53

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 39/77 (50%), Positives = 43/77 (55%), Gaps = 5/77 (6%)
 Frame = +1

Query: 61  IGVSPFS-PPPPPY--VYPSPPPPSPP--PPYIYKSPPPPPYVYNSPPPPPYVYNSPPPP 225
           +   PF+  P  PY   Y   P P+ P  PPY Y+SPPPP     SP P PY Y SPPPP
Sbjct: 188 LSAKPFAYAPKTPYKKCYKPVPTPAAPLTPPYYYQSPPPPS---KSPAPTPYYYKSPPPP 244

Query: 226 PYVYKSPPPPPYVYKSP 276
               KSP P PY YKSP
Sbjct: 245 T---KSPAPTPYYYKSP 258

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/78 (47%), Positives = 39/78 (50%), Gaps = 7/78 (8%)
 Frame = +1

Query: 94  PYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKS 273
           P+ Y     P  P    YK  P P     +P  PPY Y SPPPP    KSP P PY YKS
Sbjct: 192 PFAYA----PKTPYKKCYKPVPTPA----APLTPPYYYQSPPPPS---KSPAPTPYYYKS 240

Query: 274 PPPP-------PYVYKSP 306
           PPPP       PY YKSP
Sbjct: 241 PPPPTKSPAPTPYYYKSP 258

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 27/45 (60%), Positives = 28/45 (62%)
 Frame = +1

Query: 175 YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           Y+SPPPP       PPPPY Y SPPPP  V    PPPPY Y SPP
Sbjct: 1   YHSPPPPV----KSPPPPYYYSSPPPP--VKS--PPPPYYYTSPP 37

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 27/58 (46%), Positives = 30/58 (51%)
 Frame = +1

Query: 136 PYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P+ Y    P    Y   P P     +P  PPY Y+SPPPP    KSP P PY YKSPP
Sbjct: 192 PFAYAPKTPYKKCYKPVPTPA----APLTPPYYYQSPPPPS---KSPAPTPYYYKSPP 242

[115][TOP]
>UniRef100_B9RQU4 Putative uncharacterized protein n=1 Tax=Ricinus communis
           RepID=B9RQU4_RICCO
          Length = 154

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 64/145 (44%), Positives = 75/145 (51%), Gaps = 42/145 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP-PYVYPSPPPP---------SPPPPYIYK 150
           P F A  +S +SS     S + ++  SPPPP  Y Y SP PP         +P P Y YK
Sbjct: 12  PNFEAAKTSFSSS-----SALWLTYRSPPPPFHYKYESPSPPHHKCKHTPLAPLPFYTYK 66

Query: 151 SPPPPP----YVYNSPPPPPYVYN--SPPPPP-YVYKSPPPP----------------PY 261
           SPPPPP    Y + SPPPPP+VY   SPPPPP Y Y+ PPPP                PY
Sbjct: 67  SPPPPPSPPVYEHKSPPPPPFVYKYWSPPPPPVYRYEPPPPPKHHHHHHHHKHKWSPYPY 126

Query: 262 V-YKSPPPPP--------YVYKSPP 309
           V YKSPPPPP        Y+  +PP
Sbjct: 127 VTYKSPPPPPKQEYPVYHYISPAPP 151

[116][TOP]
>UniRef100_Q94ES7 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES7_PEA
          Length = 145

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/103 (52%), Positives = 57/103 (55%), Gaps = 30/103 (29%)
 Frame = +1

Query: 79  SPPPP--PYVYPSPPPPS----PPPPYIYKSPPPP-----PYVYNSPPPPPY-------- 201
           SPPPP  PY Y SPPPP     P P  +Y SPPPP     PY Y SPPPPP         
Sbjct: 41  SPPPPKDPYHYSSPPPPPAHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPAHTYPHPHP 100

Query: 202 VYNSPPPP---PYVYKSPPPPPY--------VYKSPPPPPYVY 297
           VY+SPPPP   PY Y SPPPPP         VY SPPPP + Y
Sbjct: 101 VYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPAHTY 143

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 57/108 (52%), Positives = 58/108 (53%), Gaps = 37/108 (34%)
 Frame = +1

Query: 97  YVYPSPPPP--SPPPP---YIYKSPPPPPY--------VYNSPPPP-----PYVYNSPPP 222
           Y Y SPPPP  SPPPP   Y Y SPPPPP         VY+SPPPP     PY Y SPPP
Sbjct: 30  YSYSSPPPPVHSPPPPKDPYHYSSPPPPPAHTYPHPHPVYHSPPPPTPHKKPYKYPSPPP 89

Query: 223 PPY--------VYKSPPPP---PYVYKSPPPPPY--------VYKSPP 309
           PP         VY SPPPP   PY Y SPPPPP         VY SPP
Sbjct: 90  PPAHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPP 137

[117][TOP]
>UniRef100_Q41645 Extensin (Fragment) n=1 Tax=Volvox carteri RepID=Q41645_VOLCA
          Length = 464

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 55/120 (45%), Positives = 61/120 (50%), Gaps = 17/120 (14%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF------------SPPPPPYVYPSPPPP-----SP 129
           PP + VSSSP  +T+  P     SP             SPPPPP V PSPPPP      P
Sbjct: 233 PPPARVSSSPPPATRSPPPRRITSPSPVLTASPPLPKTSPPPPPRVPPSPPPPVASPPPP 292

Query: 130 PPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPP +  SPPPP  V + PPPPP   +  PPPP    SPPPP     SPPPP      PP
Sbjct: 293 PPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPP 352

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 51/110 (46%), Positives = 54/110 (49%), Gaps = 6/110 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPP------ 162
           PP  + S  P       P      P   PPPP   PSPPPPSPPPP    SPPP      
Sbjct: 294 PPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPP----SPPPPRPSPS 349

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           PP   +SP PPP V + PPPPP    SPPPPP     PPP P     PPS
Sbjct: 350 PPPPRSSPSPPPPVVSPPPPPPRA--SPPPPPASSPPPPPRPPPPSPPPS 397

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 54/115 (46%), Positives = 56/115 (48%), Gaps = 12/115 (10%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP----SPPPPYIYK-SP-PP 162
           PP    S  P      +P     SP  PPPPP V PSPPPP    SPPPP   + SP PP
Sbjct: 265 PPLPKTSPPPPPRVPPSPPPPVASP-PPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPP 323

Query: 163 PPYVYNSPPPPPYVYNSPPP------PPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PP    SPPPP     SPPP      PP    SP PPP V   PPPPP     PP
Sbjct: 324 PPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPP 378

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 54/114 (47%), Positives = 56/114 (49%), Gaps = 10/114 (8%)
 Frame = +1

Query: 1   PPFSAVSSSP-----NSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPP 159
           PP   VSS P       S    P     SP  P PPP   PSPPPP  SP PP    SP 
Sbjct: 302 PPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPP---PSPPPPRPSPSPPPPRSSPS 358

Query: 160 PPPYVYNSPPPPPYVYNSPPPPPYVYKSP---PPPPYVYKSPPPPPYVYKSPPS 312
           PPP V + PPPPP    SPPPPP     P   PPPP    SPPPP     +PPS
Sbjct: 359 PPPPVVSPPPPPPRA--SPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANPPS 410

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 54/125 (43%), Positives = 59/125 (47%), Gaps = 28/125 (22%)
 Frame = +1

Query: 16  VSSSPNSSTKITPSGIGVSPF-SPPPPPYVYPSPPPP------------SPPP------- 135
           V+ S N+   +T + + V    SPPPPP V  SPPPP            SPPP       
Sbjct: 199 VADSKNTVALVTAAAVVVQTTPSPPPPPRVSTSPPPPARVSSSPPPATRSPPPRRITSPS 258

Query: 136 -------PYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP-PPPPYVYKSPPPPPY 291
                  P    SPPPPP V  SPPPP     SPPPPP    SP PPPP    SPPPPP 
Sbjct: 259 PVLTASPPLPKTSPPPPPRVPPSPPPP---VASPPPPPPPRVSPSPPPPQPVSSPPPPPP 315

Query: 292 VYKSP 306
              SP
Sbjct: 316 PRPSP 320

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 50/117 (42%), Positives = 54/117 (46%), Gaps = 14/117 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
           PP    S SP   +   PS     P   PPPP   PSPPPP  SPPPP    SPPPPP  
Sbjct: 322 PPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPAS 381

Query: 175 YNSPPP---PPYVYNSPPPPPYVYKSPPPP---------PYVYKSPPPPPYVYKSPP 309
              PPP   PP    SPPPP     +PP P         P +   PPPPP    +PP
Sbjct: 382 SPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPLGTRPPPPPPEDDAPP 438

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 52/129 (40%), Positives = 57/129 (44%), Gaps = 26/129 (20%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPP-------PPYVYPSPPPP--SPPPPYIYKS 153
           PP S+ S  P S    +P     SP  PPP       PP V P PPPP  SPPPP     
Sbjct: 324 PPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSP 383

Query: 154 PPPP----PYVYNSPPPPPYVYNSPPPP---------PYVYKSPPPPPYVYKSPPP---- 282
           PPPP    P    SPPPP     +PP P         P +   PPPPP    +PPP    
Sbjct: 384 PPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPLGTRPPPPPPEDDAPPPDYYF 443

Query: 283 PPYVYKSPP 309
           PP    SPP
Sbjct: 444 PPPQDMSPP 452

 Score = 73.2 bits (178), Expect = 8e-12
 Identities = 48/114 (42%), Positives = 54/114 (47%), Gaps = 19/114 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP------FSPPPPPYVYPSPPPPSPPPPYIYKSPPP 162
           PP  + S  P  S+   P  + VSP       SPPPPP   P PPPP PPPP    SPPP
Sbjct: 343 PPRPSPSPPPPRSSPSPPPPV-VSPPPPPPRASPPPPPASSP-PPPPRPPPPSPPPSPPP 400

Query: 163 PPYVYNSPPPP---------PYVYNSPPPPPYVYKSPPP----PPYVYKSPPPP 285
           P     +PP P         P +   PPPPP    +PPP    PP    SPPPP
Sbjct: 401 PATAAANPPSPAPSRSRAGGPPLGTRPPPPPPEDDAPPPDYYFPPPQDMSPPPP 454

[118][TOP]
>UniRef100_C6T6W7 Putative uncharacterized protein (Fragment) n=1 Tax=Glycine max
           RepID=C6T6W7_SOYBN
          Length = 69

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 44/73 (60%), Positives = 47/73 (64%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P S PPPPY Y SPPPPSP PP        PPY Y SPPPP    +  P P Y+YKSPPP
Sbjct: 8   PTSYPPPPYHYVSPPPPSPSPP--------PPYHYTSPPPP----SPAPAPKYIYKSPPP 55

Query: 253 PPYVYKSPPPPPY 291
           P Y+Y SPPPP Y
Sbjct: 56  PVYIYASPPPPIY 68

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 40/67 (59%), Positives = 42/67 (62%), Gaps = 12/67 (17%)
 Frame = +1

Query: 145 YKSPPPPPYVYNSPPPPPYVYNSP------PPPPYVYKSPPP------PPYVYKSPPPPP 288
           YKSPPPP   Y   PPPPY Y SP      PPPPY Y SPPP      P Y+YKSPPPP 
Sbjct: 2   YKSPPPPTS-Y---PPPPYHYVSPPPPSPSPPPPYHYTSPPPPSPAPAPKYIYKSPPPPV 57

Query: 289 YVYKSPP 309
           Y+Y SPP
Sbjct: 58  YIYASPP 64

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 2/69 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPP--YIYKSPPPPPYV 174
           PP+  VS  P              P   PPPPY Y SPPPPSP P   YIYKSPPPP Y+
Sbjct: 14  PPYHYVSPPP--------------PSPSPPPPYHYTSPPPPSPAPAPKYIYKSPPPPVYI 59

Query: 175 YNSPPPPPY 201
           Y SPPPP Y
Sbjct: 60  YASPPPPIY 68

[119][TOP]
>UniRef100_Q76KW4 Hydroxyproline-rich glycoprotein-1 (Fragment) n=1 Tax=Pisum sativum
           RepID=Q76KW4_PEA
          Length = 152

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/108 (51%), Positives = 60/108 (55%), Gaps = 32/108 (29%)
 Frame = +1

Query: 79  SPPPP--PYVYPSPPPPS----PPPPYIYKSPPPPPY-------VYNSPPPP-----PYV 204
           SPPPP  PY Y SPPPP     P P  +Y SPPPP +       VY+SPPPP     PY 
Sbjct: 44  SPPPPKDPYHYSSPPPPPAHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPPTPHKKPYK 103

Query: 205 YNSPPPPPY--------VYKSPPPP---PYVYKSPPPPP---YVYKSP 306
           Y SPPPPP         VY SPPPP   PY Y SPPPPP   Y + SP
Sbjct: 104 YPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPSP 151

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 56/107 (52%), Positives = 59/107 (55%), Gaps = 36/107 (33%)
 Frame = +1

Query: 97  YVYPSPPPP--SPPPP---YIYKSPPPPPY--------VYNSPPPPPY-------VYNSP 216
           Y Y SPPPP  SPPPP   Y Y SPPPPP         VY+SPPPP +       VY+SP
Sbjct: 33  YSYSSPPPPVHSPPPPKDPYHYSSPPPPPAHTYPHPHPVYHSPPPPVHTYPHPHPVYHSP 92

Query: 217 PPP-----PYVYKSPPPPPY--------VYKSPPPP---PYVYKSPP 309
           PPP     PY Y SPPPPP         VY SPPPP   PY Y SPP
Sbjct: 93  PPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPP 139

[120][TOP]
>UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK5_CHLRE
          Length = 853

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 55/104 (52%), Positives = 56/104 (53%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP    SPPPPP    
Sbjct: 208 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP----SPPPPP--PP 261

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPP     SPPPPP     PPPPP    SPPPPP     PPS
Sbjct: 262 SPPPPSPPPPSPPPPPPPSPPPPPPP----SPPPPPPPSPPPPS 301

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 55/104 (52%), Positives = 56/104 (53%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP      +P      P SPPPPP   PSPPPPSPPPP    SPPPPP    
Sbjct: 228 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP--PSPPPPSPPPP----SPPPPPPPSP 281

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            PPPPP    SPPPPP    SPPPP     SPPPPP     PPS
Sbjct: 282 PPPPPP----SPPPPP--PPSPPPPSPPPPSPPPPPPPSPPPPS 319

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 54/104 (51%), Positives = 55/104 (52%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S     P S    +P      P SPPPP    PSPPPPSPPPP    SPPPPP    
Sbjct: 386 PPPSPPPPPPPSPPPPSPP-----PPSPPPPSPPPPSPPPPSPPPP----SPPPPPPPSP 436

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            PPPPP    SPPPPP     PPPPP    SPPPPP     PPS
Sbjct: 437 PPPPPP----SPPPPPPPSPPPPPPP----SPPPPPPPSPPPPS 472

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 52/103 (50%), Positives = 54/103 (52%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  PPPP    PSPPPPSPPPP     PPP P   +
Sbjct: 213 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPS 272

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP    SPPPPP     PPPPP    SPPPP     SPP
Sbjct: 273 PPPPPP---PSPPPPPPPSPPPPPPP----SPPPPSPPPPSPP 308

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/104 (49%), Positives = 52/104 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S     P S    +P      P SPPPPP   P PPPP  PPP    SPPPP     
Sbjct: 303 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 362

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPP     SPPPPP     PPPPP    SPPPPP     PPS
Sbjct: 363 SPPPPSPPPPSPPPPPPPSPPPPPPP----SPPPPPPPSPPPPS 402

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/103 (49%), Positives = 52/103 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P+      PS     P SPPPP    PSPPPPSPPPP    SPPPP     
Sbjct: 371 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPP 426

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP     PPPPP    SPPPPP     PPPPP     PP
Sbjct: 427 SPPPPPPPSPPPPPPP----SPPPPPPPSPPPPPPPSPPPPPP 465

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/103 (49%), Positives = 52/103 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS     P SPPPPP   P PPPP  PPP    SPPPPP    
Sbjct: 409 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP--PP 466

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPPP     PPPPP     PP
Sbjct: 467 SPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 52/104 (50%), Positives = 53/104 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P+      PS     P SPPPPP   PSPPPPSPPPP    SPPPP     
Sbjct: 433 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP--PSPPPPSPPPP----SPPPPSPPPP 486

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPPP     PPPPP    SPPPPP     PP PP     PPS
Sbjct: 487 SPPPPPPPSPPPPPPP----SPPPPPPPSPPPPSPPPPSPPPPS 526

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/110 (49%), Positives = 55/110 (50%), Gaps = 6/110 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYP------SPPPPSPPPPYIYKSPPP 162
           PP S    SP   +   PS     P SPPPPP   P      SPPPPSPPPP    SPPP
Sbjct: 311 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP----SPPP 366

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           P     SPPPPP     PPPPP    SPPPPP     PP PP     PPS
Sbjct: 367 PSPPPPSPPPPPPPSPPPPPPP----SPPPPPPPSPPPPSPPPPSPPPPS 412

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/109 (49%), Positives = 55/109 (50%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYP------SPPPPSPPPPYIYKSPPP 162
           PP S    SP   +   PS     P SPPPPP   P      SPPPPSPPPP    SPPP
Sbjct: 355 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP----SPPP 410

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P     SPPPP     SPPPPP     PPPPP    SPPPPP     PP
Sbjct: 411 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP----SPPPPPPPSPPPP 455

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 49/103 (47%), Positives = 50/103 (48%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P S    +P      P SPPPPP   P PPPP  PPP    SPPPP     
Sbjct: 347 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 406

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPPP     PPPPP     PP
Sbjct: 407 SPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 449

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/103 (50%), Positives = 53/103 (51%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP    SPPPPP    
Sbjct: 193 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPP----SPPPPPPPSP 245

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PP PP     PPPPP    SPPPP     SPPPPP     PP
Sbjct: 246 PPPSPPPPSPPPPPPP----SPPPPSPPPPSPPPPPPPSPPPP 284

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/107 (49%), Positives = 53/107 (49%), Gaps = 3/107 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVY- 177
           PP     S P  S    P      P  P PPP   PSPPPPSPPPP    SPPPPP    
Sbjct: 260 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP----SPPPPPPPSP 315

Query: 178 --NSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
              SPPPP     SPPPPP     PPPPP    SPPPPP     PPS
Sbjct: 316 PPPSPPPPSPPPPSPPPPPPPSPPPPPPP----SPPPPPPPSPPPPS 358

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/103 (50%), Positives = 53/103 (51%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P+      PS     P SPPPP    PSPPPPSPPPP    SPPPPP    
Sbjct: 327 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPPPPSP 382

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP    SPPPPP    SPPPP     SPPPP     SPP
Sbjct: 383 PPPPPP----SPPPPP--PPSPPPPSPPPPSPPPPSPPPPSPP 419

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/103 (50%), Positives = 53/103 (51%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P+      PS     P SPPPP    PSPPPPSPPPP    SPPPPP    
Sbjct: 441 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPPPPSP 496

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP    SPPPPP    SPPPP     SPPPP     SPP
Sbjct: 497 PPPPPP----SPPPPP--PPSPPPPSPPPPSPPPPSPPPPSPP 533

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/104 (50%), Positives = 52/104 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP       PS     P SPPPPP   P PPPP  PPP    SPPPP     
Sbjct: 419 PPPSPPPPSPPPPPP--PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 476

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPP     SPPPPP     PPPPP    SPPPPP     PPS
Sbjct: 477 SPPPPSPPPPSPPPPPPPSPPPPPPP----SPPPPPPPSPPPPS 516

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 45/80 (56%), Positives = 45/80 (56%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P SPPPP    PSPPPPSPPPP     PPPPP     PPPP     SPPPP     SPPP
Sbjct: 470 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 529

Query: 253 PPYVYKSPPPPPYVYKSPPS 312
           P     SPPPPP     PPS
Sbjct: 530 PSPPPPSPPPPPPPSPPPPS 549

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 51/104 (49%), Positives = 52/104 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P+      PS    SP  P PPP   PSPPPPSPPPP    SPPPP     
Sbjct: 278 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP----SPPPP----- 328

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPPP     PPPPP    SPPPPP     PP PP     PPS
Sbjct: 329 SPPPPPPPSPPPPPPP----SPPPPPPPSPPPPSPPPPSPPPPS 368

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 52/105 (49%), Positives = 53/105 (50%), Gaps = 2/105 (1%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP--PPPYIYKSPPPPPYV 174
           PP S    SP   +   PS    SP  P PPP   PSPPPP P  PPP    SPPPPP  
Sbjct: 399 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 458

Query: 175 YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              PPPPP    SPPPP     SPPPP     SPPPPP     PP
Sbjct: 459 SPPPPPPP----SPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 499

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 52/103 (50%), Positives = 53/103 (51%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P   +   PS    SP  PPPP    PSPPPPSPPPP    SPPPPP    
Sbjct: 283 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP----SPPPPPPPSP 338

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP    SPPPPP    SPPPP     SPPPP     SPP
Sbjct: 339 PPPPPP----SPPPPP--PPSPPPPSPPPPSPPPPSPPPPSPP 375

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 50/106 (47%), Positives = 51/106 (48%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP      +P      P SPPPPP   P PPPP  PPP    SPPPP     
Sbjct: 246 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 305

Query: 181 SPPPPPYVY---NSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP       SPPPP     SPPPPP     PPPPP     PP
Sbjct: 306 SPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 351

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 51/106 (48%), Positives = 52/106 (49%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPY 171
           PP S    SP   +   P      P SPPPP    PSPPPP   SPPPP     PPPPP 
Sbjct: 293 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP- 351

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              SPPPP     SPPPP     SPPPPP     PPPPP     PP
Sbjct: 352 --PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 52/104 (50%), Positives = 55/104 (52%), Gaps = 3/104 (2%)
 Frame = +1

Query: 10  SAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPP 189
           +A+  S N    I+  GI     SPPPP    PSPPPPSPPPP    SPPPP     SPP
Sbjct: 172 AALFDSQNDCCPISTPGIP----SPPPPSPPPPSPPPPSPPPP----SPPPPSPPPPSPP 223

Query: 190 PPPYVYNSPP---PPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           PP     SPP   PPP    SPPPP     SPPPPP     PPS
Sbjct: 224 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPS 267

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 49/103 (47%), Positives = 50/103 (48%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P   +   PS    SP  P PPP   P PPPPSPPPP     PPPPP    
Sbjct: 340 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP---P 396

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPPP     PP
Sbjct: 397 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 439

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 52/106 (49%), Positives = 53/106 (50%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPY 171
           PP    S  P S    +P      P SPPPP    PSPPPP   SPPPP     PPPPP 
Sbjct: 391 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP- 449

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              SPPPPP     PPPPP    SPPPP     SPPPP     SPP
Sbjct: 450 --PSPPPPPPPSPPPPPPP----SPPPPSPPPPSPPPPSPPPPSPP 489

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 50/103 (48%), Positives = 51/103 (49%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   P P PP PPPP    SPPPP     
Sbjct: 198 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP----SPPPPSPPPP 253

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP    SPPPP     SPPPPP     PPPPP     PP
Sbjct: 254 SPPPPP--PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 50/103 (48%), Positives = 51/103 (49%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P S    +P      P SPPPPP   P PPPP  PPP    SPPPP     
Sbjct: 461 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP----- 515

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPPP    SPPPP     SPP
Sbjct: 516 SPPPPSPPPPSPPPPSPPPPSPPPPP--PPSPPPPSPPPPSPP 556

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 48/103 (46%), Positives = 49/103 (47%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   P      P SPPPP    P PPPPSPPPP     PPPPP    
Sbjct: 241 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP--PPPPPPSPPPPPPPSPPPPPPPSPP 298

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            P PPP     PPPP     SPPPP     SPPPPP     PP
Sbjct: 299 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 341

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/104 (46%), Positives = 49/104 (47%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S     P S    +P      P  PP PP   P PP P PPPP    SPPPPP    
Sbjct: 233 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP---PSPPPPPPPSP 289

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            PPPPP    SPPPP     SPPPPP     PP PP     PPS
Sbjct: 290 PPPPPP----SPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPS 329

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 49/104 (47%), Positives = 50/104 (48%), Gaps = 1/104 (0%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP-PPPYIYKSPPPPPYVY 177
           PP       P   +   PS    SP  P PPP   P P PP P PPP    SPPPPP   
Sbjct: 384 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 443

Query: 178 NSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             PPPPP    SPPPPP     PPPPP    SPPPP     SPP
Sbjct: 444 PPPPPPP----SPPPPPPPSPPPPPPP----SPPPPSPPPPSPP 479

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/95 (49%), Positives = 48/95 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS     P SPPPPP   P  PPP PPP     SPPPP     
Sbjct: 469 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP---PPSPPPPPPPSPPPPSPPPPSPPPP 525

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
           SPPPP     SPPPPP    SPPPP     SPPPP
Sbjct: 526 SPPPPSPPPPSPPPPP--PPSPPPPSPPPPSPPPP 558

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 47/98 (47%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYVYNSPPPP 195
           S+P   +   PS    SP  P PPP   P P PP  SPPPP    SPPPP     SPPPP
Sbjct: 185 STPGIPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPPSPPPP 240

Query: 196 PYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P     PP PP     PPPPP    SPPPP     SPP
Sbjct: 241 PPPSPPPPSPPPPSPPPPPPP----SPPPPSPPPPSPP 274

[121][TOP]
>UniRef100_B9RLU7 Putative uncharacterized protein n=1 Tax=Ricinus communis
            RepID=B9RLU7_RICCO
          Length = 1550

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 51/113 (45%), Positives = 63/113 (55%), Gaps = 10/113 (8%)
 Frame = +1

Query: 1    PPFSA---VSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPY 171
            PPFS+     ++P+SS + TP     +P  PPPP    P PPPP PPPP       PPP 
Sbjct: 867  PPFSSGIPPPTTPSSSARGTPPPPRAAP--PPPPSRAAPPPPPPPPPPPPPPLRATPPPP 924

Query: 172  VYNSPPPPP---YVYNSPPPPPYVYKS----PPPPPYVYKSPPPPPYVYKSPP 309
            +  SPPPPP    +  +PPPPP  + S    PPPPP+    PPPPP  Y +PP
Sbjct: 925  LQGSPPPPPPPPQLRGAPPPPPPPHLSSIPPPPPPPFRGAPPPPPPPFYGAPP 977

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/100 (43%), Positives = 49/100 (49%), Gaps = 4/100 (4%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP       P       P  +  SP  PPPPP +  +PPPP PP       PPPPP+   
Sbjct: 905  PPPPPPPPPPPPLRATPPPPLQGSPPPPPPPPQLRGAPPPPPPPHLSSIPPPPPPPFRGA 964

Query: 181  SPPPPPYVYNSPPPPP----YVYKSPPPPPYVYKSPPPPP 288
             PPPPP  Y +PPPPP         PPPPP    +PPPPP
Sbjct: 965  PPPPPPPFYGAPPPPPPPPGRGAPPPPPPPPGRGAPPPPP 1004

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 38/73 (52%), Positives = 42/73 (57%), Gaps = 4/73 (5%)
 Frame = +1

Query: 82   PPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYN----SPPPPPYVYKSPP 249
            PPPPP  Y +PPPP PPP      PPPPP    +PPPPP         PPPPP    +PP
Sbjct: 966  PPPPPPFYGAPPPPPPPPGRGAPPPPPPPPGRGAPPPPPPPPGRGAPPPPPPPPGRGAPP 1025

Query: 250  PPPYVYKSPPPPP 288
            PPP   + PPPPP
Sbjct: 1026 PPPPPGRGPPPPP 1038

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 49/126 (38%), Positives = 58/126 (46%), Gaps = 23/126 (18%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYV---------YPSPPPPSPPPPYIYKS 153
            PP    S+ P    K+    I  +P  PPPPP +          P PPPP PPP Y Y+ 
Sbjct: 804  PPLVNASTVP----KVGGIKIPTAPPPPPPPPPMGGTMLPPRPPPPPPPPPPPPSYPYQG 859

Query: 154  ----PPPPPYVYNSPPP----------PPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPY 291
                PPPPP+    PPP          PP    +PPPPP     PPPPP     PPPPP 
Sbjct: 860  VHSPPPPPPFSSGIPPPTTPSSSARGTPPPPRAAPPPPPSRAAPPPPPP---PPPPPPPP 916

Query: 292  VYKSPP 309
            +  +PP
Sbjct: 917  LRATPP 922

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 45/111 (40%), Positives = 52/111 (46%), Gaps = 8/111 (7%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP  A    P   +   P        +PPPPP  + S  PP PPPP+    PPPPP  Y 
Sbjct: 915  PPLRATPPPPLQGSPPPPPPPPQLRGAPPPPPPPHLSSIPPPPPPPFRGAPPPPPPPFYG 974

Query: 181  SPPPPPYVYNS-----PPPPPYVYKSPPPPPYVYKS---PPPPPYVYKSPP 309
            +PPPPP          PPPPP     PPPPP   +    PPPPP    +PP
Sbjct: 975  APPPPPPPPGRGAPPPPPPPPGRGAPPPPPPPPGRGAPPPPPPPPGRGAPP 1025

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 45/99 (45%), Positives = 49/99 (49%), Gaps = 3/99 (3%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PPF      P       P G G  P  PPPPP    +PPPP PPP      PPPPP    
Sbjct: 970  PPFYGAPPPPPP-----PPGRGAPP--PPPPPPGRGAPPPPPPPPGRGAPPPPPPPPGRG 1022

Query: 181  SPPPPPYVYNSPPPPPYV--YKSPPP-PPYVYKSPPPPP 288
            +PPPPP     PPPPP      +PPP PP    +PPPPP
Sbjct: 1023 APPPPPPPGRGPPPPPPPPGRGAPPPLPPPGRGAPPPPP 1061

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 41/81 (50%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +1

Query: 52   PSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPP--PP 225
            P G G  P  PPPPP    +PPPP PPP      PPPPP     PPPPP    +PP  PP
Sbjct: 994  PPGRGAPP--PPPPPPGRGAPPPPPPPPGRGAPPPPPPPGRGPPPPPPPPGRGAPPPLPP 1051

Query: 226  PYVYKSPPPPPYVYKSPPPPP 288
            P     PPPPP     PPPPP
Sbjct: 1052 PGRGAPPPPPPPGGGGPPPPP 1072

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 43/109 (39%), Positives = 48/109 (44%), Gaps = 22/109 (20%)
 Frame = +1

Query: 28   PNSSTKITPSGIGVSPFSPPPPPYVY-----PSPPPP-----------------SPPPPY 141
            P   T + P      P  PPPP Y Y     P PPPP                 +PPPP 
Sbjct: 832  PMGGTMLPPRPPPPPPPPPPPPSYPYQGVHSPPPPPPFSSGIPPPTTPSSSARGTPPPPR 891

Query: 142  IYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPP 288
               +PPPPP     PPPPP     PPPPP   ++ PPPP     PPPPP
Sbjct: 892  A--APPPPPSRAAPPPPPP----PPPPPPPPLRATPPPPLQGSPPPPPP 934

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/81 (49%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +1

Query: 52   PSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPP--PPPYVYNSPPPP 225
            P G G  P  PPPPP    +PPP  PPPP     PPPPP    +PP  PPP     PPPP
Sbjct: 1006 PPGRGAPP--PPPPPPGRGAPPP--PPPPGRGPPPPPPPPGRGAPPPLPPPGRGAPPPPP 1061

Query: 226  PYVYKSPPPPPYVYKSPPPPP 288
            P     PPPPP   +  PPPP
Sbjct: 1062 PPGGGGPPPPPPPGRGGPPPP 1082

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 45/134 (33%), Positives = 53/134 (39%), Gaps = 43/134 (32%)
 Frame = +1

Query: 37   STKITPSGIGVSPFSPPPPPYVYP-----------------SPPPPSPPPP----YIYKS 153
            S+ +  S     P  PPPPP   P                 +PPPP PPPP     +   
Sbjct: 782  SSSVPASVSSAPPLPPPPPPPPPPLVNASTVPKVGGIKIPTAPPPPPPPPPMGGTMLPPR 841

Query: 154  PPPPP------------YVYNSPPPPPYVYNSPPP----------PPYVYKSPPPPPYVY 267
            PPPPP             V++ PPPPP+    PPP          PP    +PPPPP   
Sbjct: 842  PPPPPPPPPPPPSYPYQGVHSPPPPPPFSSGIPPPTTPSSSARGTPPPPRAAPPPPPSRA 901

Query: 268  KSPPPPPYVYKSPP 309
              PPPPP     PP
Sbjct: 902  APPPPPPPPPPPPP 915

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 41/90 (45%), Positives = 41/90 (45%), Gaps = 11/90 (12%)
 Frame = +1

Query: 52   PSGIGVSPFSPPP---PPYVYPSP----PPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYN 210
            P G G  P  PPP   PP   P P    PPP PPP      PPPPP     PPPPP    
Sbjct: 1018 PPGRGAPPPPPPPGRGPPPPPPPPGRGAPPPLPPPGRGAPPPPPPPGGGGPPPPPPPGRG 1077

Query: 211  SPPPPP----YVYKSPPPPPYVYKSPPPPP 288
             PPPPP     V   P PP      PPPPP
Sbjct: 1078 GPPPPPPPGGRVPGPPAPPRPPGAGPPPPP 1107

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 35/78 (44%), Positives = 38/78 (48%)
 Frame = +1

Query: 79   SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPP 258
            +PPPPP     PPPP PPP      P PPP     PPPPP     PPPPP   +  PPP 
Sbjct: 1023 APPPPPPPGRGPPPPPPPPGRGAPPPLPPPGRGAPPPPPPPGGGGPPPPPPPGRGGPPP- 1081

Query: 259  YVYKSPPPPPYVYKSPPS 312
                 PPPP      PP+
Sbjct: 1082 -----PPPPGGRVPGPPA 1094

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 42/114 (36%), Positives = 48/114 (42%), Gaps = 33/114 (28%)
 Frame = +1

Query: 67   VSPFSPPPPPYVY--------------PSPPPPSPPPP--------------YIYKSPPP 162
            V P +PPP P+ +              P PPPP PPPP               I  +PPP
Sbjct: 767  VLPPAPPPTPWKFVYSSSVPASVSSAPPLPPPPPPPPPPLVNASTVPKVGGIKIPTAPPP 826

Query: 163  PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPY-----VYKSPPPPPYVYKSPP 309
            PP     PPPP      PP PP     PPPPP      V+  PPPPP+    PP
Sbjct: 827  PP-----PPPPMGGTMLPPRPPPPPPPPPPPPSYPYQGVHSPPPPPPFSSGIPP 875

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 51/153 (33%), Positives = 60/153 (39%), Gaps = 58/153 (37%)
 Frame = +1

Query: 28   PNSSTKITPSGIGVSPFSPPPPPY-------------VYPSPPPPSPPPPYIYK------ 150
            P SS+   P  +G +P  PPPPP               + SPP P PPPP +        
Sbjct: 707  PLSSSTFLPKILGKAPPPPPPPPPPPLSSRQNIEIIPYHASPPAPPPPPPPLSNRQNIGM 766

Query: 151  ----SPPPPP--YVYNS------------PPPPPYVYNSPPPPPYVYKS----------- 243
                +PPP P  +VY+S            PPPPP     PPPPP V  S           
Sbjct: 767  VLPPAPPPTPWKFVYSSSVPASVSSAPPLPPPPP-----PPPPPLVNASTVPKVGGIKIP 821

Query: 244  ------PPPPPY----VYKSPPPPPYVYKSPPS 312
                  PPPPP     +   PPPPP     PPS
Sbjct: 822  TAPPPPPPPPPMGGTMLPPRPPPPPPPPPPPPS 854

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 42/122 (34%), Positives = 50/122 (40%), Gaps = 26/122 (21%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPY------VYPSPPPPSPPPPYIYKSPPP 162
           P   A   +P+ +T +  S  G     P   P       + P PPP  PPPP     PPP
Sbjct: 645 PNVDAPVKAPSYTTTLADSASGEVTSHPAISPTCTSLKTIPPCPPPAPPPPPPSPPPPPP 704

Query: 163 PPYVYNS----------PPPPPYVYNSPPPPPY----------VYKSPPPPPYVYKSPPP 282
           PP + +S          PPPPP     PPPPP            + SPP PP     PPP
Sbjct: 705 PPPLSSSTFLPKILGKAPPPPP----PPPPPPLSSRQNIEIIPYHASPPAPP-----PPP 755

Query: 283 PP 288
           PP
Sbjct: 756 PP 757

[122][TOP]
>UniRef100_A7RNZ0 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7RNZ0_NEMVE
          Length = 370

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 44/81 (54%), Positives = 47/81 (58%), Gaps = 3/81 (3%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNS---PPPPPYVYKS 243
           P+ PPPPPY  P P PP PPPP     P P P  Y  PPPPPY   +   PPPPPY  + 
Sbjct: 261 PYPPPPPPYPNPYPQPPYPPPPAPCSGPGPCP--YPGPPPPPYPAPTPYPPPPPPYPEQV 318

Query: 244 PPPPPYVYKSPPPPPYVYKSP 306
           PPPPP     PPPPPY Y  P
Sbjct: 319 PPPPPPPPPPPPPPPYPYPYP 339

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/115 (43%), Positives = 59/115 (51%), Gaps = 12/115 (10%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP-PPPPYVYPSPPPPSPPPPYIYKSP-PPPPYV 174
           PP+   +++P       P      P++P PPPPY  P P PP PPPP  Y +P P PPY 
Sbjct: 226 PPYPYPTAAPY------PYQYSPYPYTPYPPPPYPNPYPQPPYPPPPPPYPNPYPQPPY- 278

Query: 175 YNSPPPP-------PYVYNSPPPPPYVYKS---PPPPPYVYKSPPPPPYVYKSPP 309
              PPPP       P  Y  PPPPPY   +   PPPPPY  + PPPPP     PP
Sbjct: 279 ---PPPPAPCSGPGPCPYPGPPPPPYPAPTPYPPPPPPYPEQVPPPPPPPPPPPP 330

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/86 (48%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITP-SGIGVSPF-SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYV 174
           PP+      P       P SG G  P+  PPPPPY  P+P PP PPPPY  + PPPPP  
Sbjct: 267 PPYPNPYPQPPYPPPPAPCSGPGPCPYPGPPPPPYPAPTPYPP-PPPPYPEQVPPPPP-- 323

Query: 175 YNSPPPPPYVYNSPPPPPYVYKSPPP 252
              PPPPP     PPPPPY Y  P P
Sbjct: 324 ---PPPPP-----PPPPPYPYPYPYP 341

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 42/102 (41%), Positives = 46/102 (45%), Gaps = 22/102 (21%)
 Frame = +1

Query: 70  SPFSPPPPPYVYPSPPP-PSPPPPYIYKSPPPPPYVY------NSPPPPPYVYNSPPPP- 225
           +P   P PPY YP+  P P    PY Y   PPPPY          PPPPPY    P PP 
Sbjct: 219 APGPAPYPPYPYPTAAPYPYQYSPYPYTPYPPPPYPNPYPQPPYPPPPPPYPNPYPQPPY 278

Query: 226 -----------PYVYKSPPPPPYVYKS---PPPPPYVYKSPP 309
                      P  Y  PPPPPY   +   PPPPPY  + PP
Sbjct: 279 PPPPAPCSGPGPCPYPGPPPPPYPAPTPYPPPPPPYPEQVPP 320

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 37/99 (37%), Positives = 42/99 (42%), Gaps = 22/99 (22%)
 Frame = +1

Query: 85  PPPPYVYPSP-------------PPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPP 225
           P  PY YP+              P P+P PPY Y +  P PY Y+  P  PY    PPPP
Sbjct: 197 PKGPYPYPTESLYPYQYWQLYPAPGPAPYPPYPYPTAAPYPYQYSPYPYTPY----PPPP 252

Query: 226 ---PYVYKSPPPPPYVYKSP------PPPPYVYKSPPSC 315
              PY     PPPP  Y +P      PPPP     P  C
Sbjct: 253 YPNPYPQPPYPPPPPPYPNPYPQPPYPPPPAPCSGPGPC 291

[123][TOP]
>UniRef100_Q5W1I2 Putative extensin (Fragment) n=1 Tax=Nicotiana glauca
           RepID=Q5W1I2_NICGL
          Length = 85

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 51/84 (60%), Positives = 53/84 (63%), Gaps = 8/84 (9%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPP-- 255
           PPP    +PSP P  P P  +YKSPPPPP     PP  P VY SPPPP  VYKSPPPP  
Sbjct: 1   PPPMKPYHPSPTPYHPAP--VYKSPPPPPKKPYYPPHTP-VYKSPPPPTPVYKSPPPPKK 57

Query: 256 PY------VYKSPPPPPYVYKSPP 309
           PY      VYKSPPPP  VYKSPP
Sbjct: 58  PYYPPHTPVYKSPPPPTPVYKSPP 81

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 47/82 (57%), Positives = 50/82 (60%), Gaps = 9/82 (10%)
 Frame = +1

Query: 67  VSPFSPPPPPY----VYPSPPPPSPPPPY-----IYKSPPPPPYVYNSPPPPPYVYNSPP 219
           + P+ P P PY    VY SPPPP   P Y     +YKSPPPP  VY SPPPP   Y  P 
Sbjct: 4   MKPYHPSPTPYHPAPVYKSPPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPH 63

Query: 220 PPPYVYKSPPPPPYVYKSPPPP 285
            P  VYKSPPPP  VYKSPPPP
Sbjct: 64  TP--VYKSPPPPTPVYKSPPPP 83

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 45/91 (49%), Positives = 49/91 (53%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPY------VYPSPPPPSPPPPYIYKSPPP 162
           PP      SP   T   P+ +  SP  PP  PY      VY SPPPP+P    +YKSPPP
Sbjct: 2   PPMKPYHPSP---TPYHPAPVYKSPPPPPKKPYYPPHTPVYKSPPPPTP----VYKSPPP 54

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPP 255
           P   Y  P  P  VY SPPPP  VYKSPPPP
Sbjct: 55  PKKPYYPPHTP--VYKSPPPPTPVYKSPPPP 83

[124][TOP]
>UniRef100_A3KD22 Leucine-rich repeat/extensin 1 n=1 Tax=Nicotiana tabacum
           RepID=A3KD22_TOBAC
          Length = 723

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/131 (39%), Positives = 60/131 (45%), Gaps = 28/131 (21%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSP-------P 159
           PP       P  + +  P  + V+P SPPPP Y +P PP P+P PP  Y  P       P
Sbjct: 554 PPPPVHYEPPTYTPQSPPPPVYVTPSSPPPPVYEHPKPPTPTPSPPAGYTPPQEPSHPAP 613

Query: 160 PPPYVYNSPPPPP--------------------YVYNSPPPPP-YVYKSPPPPPYVYKSP 276
           P P    +PPPPP                    Y  + PPPPP Y Y SPPPP     SP
Sbjct: 614 PTPPCNETPPPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPS---SSP 670

Query: 277 PPPPYVYKSPP 309
           PPP Y Y SPP
Sbjct: 671 PPPTYYYSSPP 681

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 45/85 (52%), Positives = 49/85 (57%), Gaps = 7/85 (8%)
 Frame = +1

Query: 79  SPPPPPYV-----YPSPPPPSPPPPYIYKSPPPPP--YVYNSPPPPPYVYNSPPPPPYVY 237
           +PPPPP        PSPPP   P P   +SPPPPP  Y Y+SPPPP    +SPPPP Y Y
Sbjct: 621 TPPPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPS---SSPPPPTYYY 677

Query: 238 KSPPPPPYVYKSPPPPPYVYKSPPS 312
            SPPPPP      PPPP     PPS
Sbjct: 678 SSPPPPP----PSPPPPSPSPPPPS 698

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 49/107 (45%), Positives = 54/107 (50%), Gaps = 4/107 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPP----PPSPPPPYIYKSPPPPP 168
           P   A  + P + T   P         P PPP   PSP     PP PPP Y Y SPPPP 
Sbjct: 608 PSHPAPPTPPCNETPPPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPS 667

Query: 169 YVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              +SPPPP Y Y+SPPPPP    SPPPP     SPPPP Y +   P
Sbjct: 668 ---SSPPPPTYYYSSPPPPP---PSPPPPS---PSPPPPSYEHVPLP 705

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 53/144 (36%), Positives = 60/144 (41%), Gaps = 42/144 (29%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPS----------------------- 111
           PP  +  SS +   +  P      P SPPPPP VY S                       
Sbjct: 422 PPPPSSKSSGSHFKRSPPPPQSTPPPSPPPPPPVYSSSPSHQHRSPPPPTHKISPVTRHA 481

Query: 112 -PPPPSPPPPYIYKSPPPPP---------YVYNSPPPPP---------YVYNSPPPPPYV 234
            PPPP P P Y +   PPPP         Y   SPPPPP         Y   SPPPPP V
Sbjct: 482 PPPPPPPSPVYYHHPSPPPPQPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPV 541

Query: 235 YKSPPPPPYVYKSPPPPPYVYKSP 306
           +    PPPY  +SPPPPP  Y+ P
Sbjct: 542 HYE--PPPYTPQSPPPPPVHYEPP 563

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 53/107 (49%), Positives = 54/107 (50%), Gaps = 8/107 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKIT--PSGIGVSPFSPPPPPYVYPSPPPPS---PPPPYIYKSPPPP 165
           PP S     P  S   T  PS        PPPP Y Y SPPPPS   PPP Y Y SPPPP
Sbjct: 624 PPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPSSSPPPPTYYYSSPPPP 683

Query: 166 PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYV---YKSPPPPPYVY 297
           P    SPPPP     SPPPP   Y+  P PP V   Y SPPPP   Y
Sbjct: 684 P---PSPPPPS---PSPPPPS--YEHVPLPPIVGVSYASPPPPVIPY 722

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/94 (50%), Positives = 50/94 (53%), Gaps = 14/94 (14%)
 Frame = +1

Query: 73  PFSPPPPP---------YVYPSPPPPSP----PPPYIYKSPPPPPYVYNSPPPPPYVYNS 213
           P SPPPPP         Y   SPPPP P    PPPY  +SPPPPP  Y    PP Y   S
Sbjct: 513 PQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPPYTPQSPPPPPVHYE---PPTYTPQS 569

Query: 214 PPPPPYVYKSPPPPP-YVYKSPPPPPYVYKSPPS 312
           PPPP YV  S PPPP Y +  PP P     SPP+
Sbjct: 570 PPPPVYVTPSSPPPPVYEHPKPPTPT---PSPPA 600

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 52/132 (39%), Positives = 64/132 (48%), Gaps = 30/132 (22%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPP---- 165
           P   + S P  S+K + S    SP  P   P   P PPPP  S  P + ++SPPPP    
Sbjct: 415 PIVPIESPPPPSSKSSGSHFKRSPPPPQSTPPPSPPPPPPVYSSSPSHQHRSPPPPTHKI 474

Query: 166 -PYVYNSPPPPP------YVYNSPPPPPYVY--------KSPPPPP---------YVYKS 273
            P   ++PPPPP      Y + SPPPP  VY        +SPPPPP         Y  +S
Sbjct: 475 SPVTRHAPPPPPPPSPVYYHHPSPPPPQPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQS 534

Query: 274 PPPPPYVYKSPP 309
           PPPPP V+  PP
Sbjct: 535 PPPPPPVHYEPP 546

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 49/111 (44%), Positives = 55/111 (49%), Gaps = 8/111 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPPYIYKSPPPP 165
           PP +     P S+    P       ++P P     P PPPP     SPPPP    SPPPP
Sbjct: 616 PPCNETPPPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPSS--SPPPP 673

Query: 166 PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYV---YKSPP 309
            Y Y+SPPPPP    SPPPP     SP PPP  Y+  P PP V   Y SPP
Sbjct: 674 TYYYSSPPPPP---PSPPPP-----SPSPPPPSYEHVPLPPIVGVSYASPP 716

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 55/158 (34%), Positives = 61/158 (38%), Gaps = 55/158 (34%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP---PSPPPP--------YIY 147
           PP     S P     +       +P SPPPPP V+  PPP    SPPPP        Y  
Sbjct: 508 PPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPPYTPQSPPPPPVHYEPPTYTP 567

Query: 148 KSPPPPPYVYNSPPPPPYVYNSP-----------------------PPPPYVYKSPPPPP 258
           +SPPPP YV  S PPPP VY  P                       PP P   ++PPPPP
Sbjct: 568 QSPPPPVYVTPSSPPPP-VYEHPKPPTPTPSPPAGYTPPQEPSHPAPPTPPCNETPPPPP 626

Query: 259 --------------------YVYKSPPPPP-YVYKSPP 309
                               Y    PPPPP Y Y SPP
Sbjct: 627 STPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPP 664

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 53/147 (36%), Positives = 63/147 (42%), Gaps = 44/147 (29%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSPPPP----PYVYPSPPPP-------------SPP 132
           P+    S   S + I+P    V P   P P    P V   PP P             SPP
Sbjct: 367 PYDCRKSQCFSRSAISPV---VKPRPKPTPKPKRPPVQNKPPAPKPSPPTKPIVPIESPP 423

Query: 133 PP-------YIYKSPPPPPYV-YNSPPPPPYVYN--------SPPPP-----PYVYKSPP 249
           PP       +  +SPPPP      SPPPPP VY+        SPPPP     P    +PP
Sbjct: 424 PPSSKSSGSHFKRSPPPPQSTPPPSPPPPPPVYSSSPSHQHRSPPPPTHKISPVTRHAPP 483

Query: 250 PPP------YVYKSPPPPPYVYKSPPS 312
           PPP      Y + SPPPP  VY +PP+
Sbjct: 484 PPPPPSPVYYHHPSPPPPQPVYYAPPT 510

[125][TOP]
>UniRef100_UPI0001A7B3CA lipid binding / structural constituent of cell wall n=1
           Tax=Arabidopsis thaliana RepID=UPI0001A7B3CA
          Length = 275

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 45/77 (58%), Positives = 46/77 (59%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPY 261
           PPPPPYV P PPP   PPP  Y  PPPPP V   PPPPP  Y  PPP PY     PPPP 
Sbjct: 89  PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTV--KPPPPPTPYTPPPPTPYT----PPPPT 142

Query: 262 VYKSPPPPPYVYKSPPS 312
           V   PPPPP V   PP+
Sbjct: 143 V--KPPPPPVVTPPPPT 157

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/94 (54%), Positives = 53/94 (56%)
 Frame = +1

Query: 28  PNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVY 207
           P   T   P+     P   PPPPY+ P PPPP  P P   K PPPPPYV   PPPPP V 
Sbjct: 49  PKPPTVKPPTHTPKPPTVKPPPPYI-PCPPPPYTPKPPTVK-PPPPPYV--KPPPPPTV- 103

Query: 208 NSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             PPPPPYV   PPPPP V   PPPPP  Y  PP
Sbjct: 104 -KPPPPPYV--KPPPPPTV--KPPPPPTPYTPPP 132

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 47/93 (50%), Positives = 50/93 (53%)
 Frame = +1

Query: 28  PNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVY 207
           P + T   P+     P+ P PPP   P PP   PPPP  Y  PPPPP V   PPPPPYV 
Sbjct: 56  PPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPP-PYVKPPPPPTV--KPPPPPYV- 111

Query: 208 NSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
             PPPPP V   PPPPP  Y  PPP PY    P
Sbjct: 112 -KPPPPPTV--KPPPPPTPYTPPPPTPYTPPPP 141

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/88 (55%), Positives = 49/88 (55%), Gaps = 9/88 (10%)
 Frame = +1

Query: 73  PFSPPPPPYVYP-----SPPPPSPPPPYIYKSPPP----PPYVYNSPPPPPYVYNSPPPP 225
           P  PP PP V P      PP   PPPPYI   PPP    PP V   PPPPPYV   PPPP
Sbjct: 45  PAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTV--KPPPPPYV--KPPPP 100

Query: 226 PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P V   PPPPPYV   PPPPP V   PP
Sbjct: 101 PTV--KPPPPPYV--KPPPPPTVKPPPP 124

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 44/79 (55%), Positives = 45/79 (56%), Gaps = 3/79 (3%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPS---PPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           PPPPPYV P PPPP+   PPPP  Y  PPP PY     PPPP V   PPPPP V   PP 
Sbjct: 105 PPPPPYVKP-PPPPTVKPPPPPTPYTPPPPTPYT----PPPPTV--KPPPPPVVTPPPPT 157

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           P      PPPPP  Y  PP
Sbjct: 158 PTPEAPCPPPPPTPYPPPP 176

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 39/90 (43%), Positives = 41/90 (45%), Gaps = 13/90 (14%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPP---------- 219
           S PP P  +P  PP     PP P   K P   P      PPPPY+   PP          
Sbjct: 29  SDPPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVK 88

Query: 220 PPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPP  Y  PPPPP V   PPPPPYV   PP
Sbjct: 89  PPPPPYVKPPPPPTV--KPPPPPYVKPPPP 116

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 33/85 (38%), Positives = 39/85 (45%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP   V   P  + K  P     +P++PPPP    P PP   PPPP +   PPP P    
Sbjct: 106 PPPPYVKPPPPPTVKPPPPP---TPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP---- 158

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPP 255
           +P  P      PPPPP  Y  PP P
Sbjct: 159 TPEAP-----CPPPPPTPYPPPPKP 178

[126][TOP]
>UniRef100_UPI0001A7B0BB lipid binding / structural constituent of cell wall n=1
           Tax=Arabidopsis thaliana RepID=UPI0001A7B0BB
          Length = 370

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 45/77 (58%), Positives = 46/77 (59%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPY 261
           PPPPPYV P PPP   PPP  Y  PPPPP V   PPPPP  Y  PPP PY     PPPP 
Sbjct: 89  PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTV--KPPPPPTPYTPPPPTPYT----PPPPT 142

Query: 262 VYKSPPPPPYVYKSPPS 312
           V   PPPPP V   PP+
Sbjct: 143 V--KPPPPPVVTPPPPT 157

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/94 (54%), Positives = 53/94 (56%)
 Frame = +1

Query: 28  PNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVY 207
           P   T   P+     P   PPPPY+ P PPPP  P P   K PPPPPYV   PPPPP V 
Sbjct: 49  PKPPTVKPPTHTPKPPTVKPPPPYI-PCPPPPYTPKPPTVK-PPPPPYV--KPPPPPTV- 103

Query: 208 NSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             PPPPPYV   PPPPP V   PPPPP  Y  PP
Sbjct: 104 -KPPPPPYV--KPPPPPTV--KPPPPPTPYTPPP 132

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 47/93 (50%), Positives = 50/93 (53%)
 Frame = +1

Query: 28  PNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVY 207
           P + T   P+     P+ P PPP   P PP   PPPP  Y  PPPPP V   PPPPPYV 
Sbjct: 56  PPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPP-PYVKPPPPPTV--KPPPPPYV- 111

Query: 208 NSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
             PPPPP V   PPPPP  Y  PPP PY    P
Sbjct: 112 -KPPPPPTV--KPPPPPTPYTPPPPTPYTPPPP 141

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/88 (55%), Positives = 49/88 (55%), Gaps = 9/88 (10%)
 Frame = +1

Query: 73  PFSPPPPPYVYP-----SPPPPSPPPPYIYKSPPP----PPYVYNSPPPPPYVYNSPPPP 225
           P  PP PP V P      PP   PPPPYI   PPP    PP V   PPPPPYV   PPPP
Sbjct: 45  PAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTV--KPPPPPYV--KPPPP 100

Query: 226 PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P V   PPPPPYV   PPPPP V   PP
Sbjct: 101 PTV--KPPPPPYV--KPPPPPTVKPPPP 124

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 44/79 (55%), Positives = 45/79 (56%), Gaps = 3/79 (3%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPS---PPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           PPPPPYV P PPPP+   PPPP  Y  PPP PY     PPPP V   PPPPP V   PP 
Sbjct: 105 PPPPPYVKP-PPPPTVKPPPPPTPYTPPPPTPYT----PPPPTV--KPPPPPVVTPPPPT 157

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           P      PPPPP  Y  PP
Sbjct: 158 PTPEAPCPPPPPTPYPPPP 176

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 39/90 (43%), Positives = 41/90 (45%), Gaps = 13/90 (14%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPP---------- 219
           S PP P  +P  PP     PP P   K P   P      PPPPY+   PP          
Sbjct: 29  SDPPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVK 88

Query: 220 PPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPP  Y  PPPPP V   PPPPPYV   PP
Sbjct: 89  PPPPPYVKPPPPPTV--KPPPPPYVKPPPP 116

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 33/85 (38%), Positives = 39/85 (45%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP   V   P  + K  P     +P++PPPP    P PP   PPPP +   PPP P    
Sbjct: 106 PPPPYVKPPPPPTVKPPPPP---TPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP---- 158

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPP 255
           +P  P      PPPPP  Y  PP P
Sbjct: 159 TPEAP-----CPPPPPTPYPPPPKP 178

[127][TOP]
>UniRef100_Q9SQF5 Putative uncharacterized protein (Fragment) n=1 Tax=Glycine max
           RepID=Q9SQF5_SOYBN
          Length = 102

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 46/70 (65%), Positives = 47/70 (67%), Gaps = 3/70 (4%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPP---PYVYNSPPPPPYVYKSPPP 252
           P   PY YPSPPPP     + YKS PPPPY Y  PPPP   PY Y SPPPP Y YKSPPP
Sbjct: 2   PRKKPYKYPSPPPPV----HKYKS-PPPPYKYPFPPPPPKKPYKYPSPPPPVYKYKSPPP 56

Query: 253 PPYVYKSPPP 282
           P Y YKSPPP
Sbjct: 57  PVYKYKSPPP 66

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 43/66 (65%), Positives = 44/66 (66%), Gaps = 3/66 (4%)
 Frame = +1

Query: 121 PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPP---PYVYKSPPPPPYVYKSPPPPPY 291
           P    PY Y SPPPP + Y S PPPPY Y  PPPP   PY Y SPPPP Y YKSPPPP Y
Sbjct: 1   PPRKKPYKYPSPPPPVHKYKS-PPPPYKYPFPPPPPKKPYKYPSPPPPVYKYKSPPPPVY 59

Query: 292 VYKSPP 309
            YKSPP
Sbjct: 60  KYKSPP 65

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 34/52 (65%), Positives = 35/52 (67%)
 Frame = +1

Query: 67  VSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPP 222
           V  +  PPPPY YP PPPP P  PY Y SPPPP Y Y SPPPP Y Y SPPP
Sbjct: 16  VHKYKSPPPPYKYPFPPPP-PKKPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 66

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 37/62 (59%), Positives = 38/62 (61%), Gaps = 3/62 (4%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPSPPPPYIYKSPPPP---PYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           +  PPPP         SPPPPY Y  PPPP   PY Y SPPPP Y Y SPPPP Y YKSP
Sbjct: 9   YPSPPPPVH----KYKSPPPPYKYPFPPPPPKKPYKYPSPPPPVYKYKSPPPPVYKYKSP 64

Query: 247 PP 252
           PP
Sbjct: 65  PP 66

[128][TOP]
>UniRef100_O23370 Cell wall protein like n=1 Tax=Arabidopsis thaliana
           RepID=O23370_ARATH
          Length = 428

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 45/77 (58%), Positives = 46/77 (59%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPY 261
           PPPPPYV P PPP   PPP  Y  PPPPP V   PPPPP  Y  PPP PY     PPPP 
Sbjct: 89  PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTV--KPPPPPTPYTPPPPTPYT----PPPPT 142

Query: 262 VYKSPPPPPYVYKSPPS 312
           V   PPPPP V   PP+
Sbjct: 143 V--KPPPPPVVTPPPPT 157

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/94 (54%), Positives = 53/94 (56%)
 Frame = +1

Query: 28  PNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVY 207
           P   T   P+     P   PPPPY+ P PPPP  P P   K PPPPPYV   PPPPP V 
Sbjct: 49  PKPPTVKPPTHTPKPPTVKPPPPYI-PCPPPPYTPKPPTVK-PPPPPYV--KPPPPPTV- 103

Query: 208 NSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             PPPPPYV   PPPPP V   PPPPP  Y  PP
Sbjct: 104 -KPPPPPYV--KPPPPPTV--KPPPPPTPYTPPP 132

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 47/93 (50%), Positives = 50/93 (53%)
 Frame = +1

Query: 28  PNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVY 207
           P + T   P+     P+ P PPP   P PP   PPPP  Y  PPPPP V   PPPPPYV 
Sbjct: 56  PPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPP-PYVKPPPPPTV--KPPPPPYV- 111

Query: 208 NSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
             PPPPP V   PPPPP  Y  PPP PY    P
Sbjct: 112 -KPPPPPTV--KPPPPPTPYTPPPPTPYTPPPP 141

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/88 (55%), Positives = 49/88 (55%), Gaps = 9/88 (10%)
 Frame = +1

Query: 73  PFSPPPPPYVYP-----SPPPPSPPPPYIYKSPPP----PPYVYNSPPPPPYVYNSPPPP 225
           P  PP PP V P      PP   PPPPYI   PPP    PP V   PPPPPYV   PPPP
Sbjct: 45  PAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTV--KPPPPPYV--KPPPP 100

Query: 226 PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P V   PPPPPYV   PPPPP V   PP
Sbjct: 101 PTV--KPPPPPYV--KPPPPPTVKPPPP 124

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 44/79 (55%), Positives = 45/79 (56%), Gaps = 3/79 (3%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPS---PPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           PPPPPYV P PPPP+   PPPP  Y  PPP PY     PPPP V   PPPPP V   PP 
Sbjct: 105 PPPPPYVKP-PPPPTVKPPPPPTPYTPPPPTPYT----PPPPTV--KPPPPPVVTPPPPT 157

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           P      PPPPP  Y  PP
Sbjct: 158 PTPEAPCPPPPPTPYPPPP 176

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 39/90 (43%), Positives = 41/90 (45%), Gaps = 13/90 (14%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPP---------- 219
           S PP P  +P  PP     PP P   K P   P      PPPPY+   PP          
Sbjct: 29  SDPPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVK 88

Query: 220 PPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPP  Y  PPPPP V   PPPPPYV   PP
Sbjct: 89  PPPPPYVKPPPPPTV--KPPPPPYVKPPPP 116

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 33/85 (38%), Positives = 39/85 (45%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP   V   P  + K  P     +P++PPPP    P PP   PPPP +   PPP P    
Sbjct: 106 PPPPYVKPPPPPTVKPPPPP---TPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP---- 158

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPP 255
           +P  P      PPPPP  Y  PP P
Sbjct: 159 TPEAP-----CPPPPPTPYPPPPKP 178

[129][TOP]
>UniRef100_Q01946 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q01946_SOLLC
          Length = 67

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 46/72 (63%), Positives = 47/72 (65%), Gaps = 2/72 (2%)
 Frame = +1

Query: 97  YVYPSPPP--PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYK 270
           Y Y SPPP  PSPPPPY YKSPPPP    +  PPPPY Y SPPPP       PPPPY YK
Sbjct: 1   YYYKSPPPPSPSPPPPYYYKSPPPP----SPSPPPPYYYKSPPPP----SPSPPPPYYYK 52

Query: 271 SPPPPPYVYKSP 306
           SPPPP    KSP
Sbjct: 53  SPPPP---VKSP 61

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 39/60 (65%), Positives = 40/60 (66%), Gaps = 2/60 (3%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPP--PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           P   PPPPY Y SPPP  PSPPPPY YKSPPPP    +  PPPPY Y SPPPP    KSP
Sbjct: 9   PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP----SPSPPPPYYYKSPPPP---VKSP 61

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 38/64 (59%), Positives = 39/64 (60%), Gaps = 7/64 (10%)
 Frame = +1

Query: 139 YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVY-KSP------PPPPYVY 297
           Y YKSPPPP    +  PPPPY Y SPPPP     SP PPP  Y KSP      PPPPY Y
Sbjct: 1   YYYKSPPPP----SPSPPPPYYYKSPPPP-----SPSPPPPYYYKSPPPPSPSPPPPYYY 51

Query: 298 KSPP 309
           KSPP
Sbjct: 52  KSPP 55

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 2/57 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP--PPPYIYKSPPPP 165
           PP  + S  P    K  P      P   PPPPY Y SPPPPSP  PPPY YKSPPPP
Sbjct: 6   PPPPSPSPPPPYYYKSPPP-----PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 57

[130][TOP]
>UniRef100_B9RS81 Serine-threonine protein kinase, plant-type, putative n=1
           Tax=Ricinus communis RepID=B9RS81_RICCO
          Length = 516

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 47/81 (58%), Positives = 50/81 (61%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           PFSPPPPP    SPPPP PPPP     PPP P     PPPPP+   SPPPPP  Y+SPPP
Sbjct: 419 PFSPPPPPSPPLSPPPPPPPPP-----PPPSPSPLPPPPPPPFY--SPPPPP-TYQSPPP 470

Query: 253 PPYVYKSPPPPPYVYKSPPSC 315
            P    +PPPPP    SPP C
Sbjct: 471 SPPPCVNPPPPP----SPPPC 487

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 46/103 (44%), Positives = 53/103 (51%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S+    P S        +   P  PPPPP   PSP PP PPPP+   SPPPPP  Y 
Sbjct: 410 PPLSSPPPPPFSPPPPPSPPLSPPPPPPPPPPPPSPSPLPPPPPPPFY--SPPPPP-TYQ 466

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPP P    +PPPP      P PPP + + PP P Y +  PP
Sbjct: 467 SPPPSPPPCVNPPPP------PSPPPCLEQPPPAPTYNHIFPP 503

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 41/68 (60%), Positives = 43/68 (63%)
 Frame = +1

Query: 106 PSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
           PSPP  SPPPP    SPPPPP    SPPPPP     PPPPP     PPPPP  + SPPPP
Sbjct: 408 PSPPLSSPPPPPF--SPPPPPSPPLSPPPPP---PPPPPPPSPSPLPPPPPPPFYSPPPP 462

Query: 286 PYVYKSPP 309
           P  Y+SPP
Sbjct: 463 P-TYQSPP 469

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 43/80 (53%), Positives = 46/80 (57%), Gaps = 4/80 (5%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPP 255
           P P P +   PPPP   PPPP    SPPPPP     PPPPP     PPPPP  + SPPPP
Sbjct: 406 PNPSPPLSSPPPPPFSPPPPPSPPLSPPPPP---PPPPPPPSPSPLPPPPPPPFYSPPPP 462

Query: 256 PYVYKSPP--PPPYVYKSPP 309
           P  Y+SPP  PPP V   PP
Sbjct: 463 P-TYQSPPPSPPPCVNPPPP 481

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 47/105 (44%), Positives = 51/105 (48%), Gaps = 8/105 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPPPYIYKSPPP- 162
           PP    S  P  S  ++P      P  PPPPP   P PPPP     SPPPP  Y+SPPP 
Sbjct: 415 PPPPPFSPPPPPSPPLSPPP---PPPPPPPPPSPSPLPPPPPPPFYSPPPPPTYQSPPPS 471

Query: 163 -PPYVYNSPPP-PPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPY 291
            PP V   PPP PP     PPP P      PP   V  +PPPP Y
Sbjct: 472 PPPCVNPPPPPSPPPCLEQPPPAPTYNHIFPPVMGVPYAPPPPFY 516

[131][TOP]
>UniRef100_Q5N8V9 Os01g0899700 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5N8V9_ORYSJ
          Length = 412

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 56/138 (40%), Positives = 66/138 (47%), Gaps = 35/138 (25%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSP-PPPPYVYPSPPPPS--PPPPYIYKSP------ 156
           P+   S   N  +   P+     PF+  PPP + YPSPP  S   PPPY Y  P      
Sbjct: 193 PYQYPSPPFNYKSPPLPNQFSPPPFNKFPPPSHQYPSPPQSSYHSPPPYQYTPPNSYQAP 252

Query: 157 ------PPPPYVYNSP-------PPPPYVYNSPPP-------------PPYVYKSPPPPP 258
                 PPPPY YNSP        PPPY +NSPPP             PP  ++ PPPP 
Sbjct: 253 PTSYNHPPPPYGYNSPIPPTNKYLPPPYYFNSPPPQYQHSPPANSYVSPPLAHQYPPPP- 311

Query: 259 YVYKSPPPPPYVYKSPPS 312
             YKSPP PPY + SPP+
Sbjct: 312 --YKSPPIPPYYFNSPPA 327

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 52/125 (41%), Positives = 56/125 (44%), Gaps = 22/125 (17%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP----SPPPPYIYKSPPPPP 168
           PP     S P SS    P      P S   PP  Y  PPPP    SP PP       PPP
Sbjct: 222 PPSHQYPSPPQSSYHSPPPYQYTPPNSYQAPPTSYNHPPPPYGYNSPIPP--TNKYLPPP 279

Query: 169 YVYNSPPP-------------PPYVYNSPPPPPYVYKSPPPPPYVYKSPP-----PPPYV 294
           Y +NSPPP             PP  +  PPPP   YKSPP PPY + SPP     PPPY 
Sbjct: 280 YYFNSPPPQYQHSPPANSYVSPPLAHQYPPPP---YKSPPIPPYYFNSPPANHYSPPPYN 336

Query: 295 YKSPP 309
           + S P
Sbjct: 337 FGSSP 341

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 53/134 (39%), Positives = 63/134 (47%), Gaps = 39/134 (29%)
 Frame = +1

Query: 25  SPNSSTKITPSGIGVSPFSPP-----PPPYVYPSPPPP-----------SPP-----PPY 141
           +P +S    P   G +   PP     PPPY + SPPP            SPP     PP 
Sbjct: 251 APPTSYNHPPPPYGYNSPIPPTNKYLPPPYYFNSPPPQYQHSPPANSYVSPPLAHQYPPP 310

Query: 142 IYKSPPPPPYVYNSPP-----PPPYVYNSPPP-----PPYVYKSP---PPPPYVYKSPP- 279
            YKSPP PPY +NSPP     PPPY + S PP     PP + K+P   PP   +  SPP 
Sbjct: 311 PYKSPPIPPYYFNSPPANHYSPPPYNFGSSPPTYQYSPPLLPKTPKYLPPKVPLEMSPPA 370

Query: 280 ----PPPYVYKSPP 309
               P P V+ SPP
Sbjct: 371 HATSPQPLVHYSPP 384

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 53/143 (37%), Positives = 63/143 (44%), Gaps = 39/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPPSP---PPPYIYKSPPP 162
           PP S+  S P    + TP     +P   ++ PPPPY Y SP PP+    PPPY + SPPP
Sbjct: 230 PPQSSYHSPP--PYQYTPPNSYQAPPTSYNHPPPPYGYNSPIPPTNKYLPPPYYFNSPPP 287

Query: 163 --------------------PPYVYNSPPPPPYVYNSPP-----PPPY--------VYKS 243
                               PP  Y SPP PPY +NSPP     PPPY           S
Sbjct: 288 QYQHSPPANSYVSPPLAHQYPPPPYKSPPIPPYYFNSPPANHYSPPPYNFGSSPPTYQYS 347

Query: 244 PPPPPYVYKSPPPPPYVYKSPPS 312
           PP  P   K  PP   +  SPP+
Sbjct: 348 PPLLPKTPKYLPPKVPLEMSPPA 370

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 39/94 (41%), Positives = 42/94 (44%), Gaps = 31/94 (32%)
 Frame = +1

Query: 118 PPSPPPPYIYKSPPPPPYVYNSPP-------------PPPYVYNSPPPPPYVYKSPP--- 249
           P   PP + Y SPPP PY Y SPP             PPP  +N  PPP + Y SPP   
Sbjct: 177 PHIQPPIFPYNSPPPSPYQYPSPPFNYKSPPLPNQFSPPP--FNKFPPPSHQYPSPPQSS 234

Query: 250 ---PPPYVYKSP------------PPPPYVYKSP 306
              PPPY Y  P            PPPPY Y SP
Sbjct: 235 YHSPPPYQYTPPNSYQAPPTSYNHPPPPYGYNSP 268

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 32/71 (45%), Positives = 35/71 (49%), Gaps = 20/71 (28%)
 Frame = +1

Query: 160 PPPYVYNSPPPPPYVYNSPPPPPYVYKSP--------------PPPPYVYKSPP------ 279
           PP + YNSPPP PY Y   P PP+ YKSP              PPP + Y SPP      
Sbjct: 181 PPIFPYNSPPPSPYQY---PSPPFNYKSPPLPNQFSPPPFNKFPPPSHQYPSPPQSSYHS 237

Query: 280 PPPYVYKSPPS 312
           PPPY Y  P S
Sbjct: 238 PPPYQYTPPNS 248

[132][TOP]
>UniRef100_Q4LB97 Putative extensin (Fragment) n=1 Tax=Nicotiana tabacum
           RepID=Q4LB97_TOBAC
          Length = 57

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 42/56 (75%), Positives = 43/56 (76%), Gaps = 1/56 (1%)
 Frame = +1

Query: 127 PPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPP-PYVYKSPPPPPY 291
           PPPP +YKSPPPP Y Y SPPPPP VY SPPPP  VYKSPPPP  Y Y SPPPP Y
Sbjct: 4   PPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPP--VYKSPPPPYHYYYTSPPPPHY 57

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 43/55 (78%), Positives = 43/55 (78%), Gaps = 1/55 (1%)
 Frame = +1

Query: 148 KSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP-PYVYKSPP 309
           KSPPPPP VY SPPPP Y Y SPPPPP VYKSPPPP  VYKSPPPP  Y Y SPP
Sbjct: 1   KSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPP--VYKSPPPPYHYYYTSPP 53

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/62 (70%), Positives = 44/62 (70%), Gaps = 1/62 (1%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPP-PYVYKSPPPP 255
           SPPPPP VY SPPPP     Y YKSPPPPP VY SPPPP  VY SPPPP  Y Y SPPPP
Sbjct: 2   SPPPPPPVYKSPPPPV----YKYKSPPPPPPVYKSPPPP--VYKSPPPPYHYYYTSPPPP 55

Query: 256 PY 261
            Y
Sbjct: 56  HY 57

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 33/54 (61%), Positives = 35/54 (64%), Gaps = 2/54 (3%)
 Frame = +1

Query: 76  FSPPPPPYV-YPSPPPPSPPPPYIYKSPPPPPYVYNSPPPP-PYVYNSPPPPPY 231
           +  PPPP   Y SPPPP P    +YKSPPPP  VY SPPPP  Y Y SPPPP Y
Sbjct: 10  YKSPPPPVYKYKSPPPPPP----VYKSPPPP--VYKSPPPPYHYYYTSPPPPHY 57

[133][TOP]
>UniRef100_A2WXZ6 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2WXZ6_ORYSI
          Length = 412

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 56/138 (40%), Positives = 66/138 (47%), Gaps = 35/138 (25%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSP-PPPPYVYPSPPPPS--PPPPYIYKSP------ 156
           P+   S   N  +   P+     PF+  PPP + YPSPP  S   PPPY Y  P      
Sbjct: 193 PYQYPSPPFNYKSPPLPNQFSPPPFNKFPPPSHQYPSPPQSSYHSPPPYQYTPPNSYQAP 252

Query: 157 ------PPPPYVYNSP-------PPPPYVYNSPPP-------------PPYVYKSPPPPP 258
                 PPPPY YNSP        PPPY +NSPPP             PP  ++ PPPP 
Sbjct: 253 PTSYNHPPPPYGYNSPIPPTNKYLPPPYYFNSPPPQYQHSPPANSYVSPPLAHQYPPPP- 311

Query: 259 YVYKSPPPPPYVYKSPPS 312
             YKSPP PPY + SPP+
Sbjct: 312 --YKSPPIPPYYFNSPPA 327

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 52/125 (41%), Positives = 56/125 (44%), Gaps = 22/125 (17%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP----SPPPPYIYKSPPPPP 168
           PP     S P SS    P      P S   PP  Y  PPPP    SP PP       PPP
Sbjct: 222 PPSHQYPSPPQSSYHSPPPYQYTPPNSYQAPPTSYNHPPPPYGYNSPIPP--TNKYLPPP 279

Query: 169 YVYNSPPP-------------PPYVYNSPPPPPYVYKSPPPPPYVYKSPP-----PPPYV 294
           Y +NSPPP             PP  +  PPPP   YKSPP PPY + SPP     PPPY 
Sbjct: 280 YYFNSPPPQYQHSPPANSYVSPPLAHQYPPPP---YKSPPIPPYYFNSPPANHYSPPPYN 336

Query: 295 YKSPP 309
           + S P
Sbjct: 337 FGSSP 341

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 53/134 (39%), Positives = 63/134 (47%), Gaps = 39/134 (29%)
 Frame = +1

Query: 25  SPNSSTKITPSGIGVSPFSPP-----PPPYVYPSPPPP-----------SPP-----PPY 141
           +P +S    P   G +   PP     PPPY + SPPP            SPP     PP 
Sbjct: 251 APPTSYNHPPPPYGYNSPIPPTNKYLPPPYYFNSPPPQYQHSPPANSYVSPPLAHQYPPP 310

Query: 142 IYKSPPPPPYVYNSPP-----PPPYVYNSPPP-----PPYVYKSP---PPPPYVYKSPP- 279
            YKSPP PPY +NSPP     PPPY + S PP     PP + K+P   PP   +  SPP 
Sbjct: 311 PYKSPPIPPYYFNSPPANHYSPPPYNFGSSPPTYQYSPPLLPKTPKYLPPKVPLEMSPPA 370

Query: 280 ----PPPYVYKSPP 309
               P P V+ SPP
Sbjct: 371 HATSPQPLVHYSPP 384

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 53/143 (37%), Positives = 63/143 (44%), Gaps = 39/143 (27%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPPSP---PPPYIYKSPPP 162
           PP S+  S P    + TP     +P   ++ PPPPY Y SP PP+    PPPY + SPPP
Sbjct: 230 PPQSSYHSPP--PYQYTPPNSYQAPPTSYNHPPPPYGYNSPIPPTNKYLPPPYYFNSPPP 287

Query: 163 --------------------PPYVYNSPPPPPYVYNSPP-----PPPY--------VYKS 243
                               PP  Y SPP PPY +NSPP     PPPY           S
Sbjct: 288 QYQHSPPANSYVSPPLAHQYPPPPYKSPPIPPYYFNSPPANHYSPPPYNFGSSPPTYQYS 347

Query: 244 PPPPPYVYKSPPPPPYVYKSPPS 312
           PP  P   K  PP   +  SPP+
Sbjct: 348 PPLLPKTPKYLPPKVPLEMSPPA 370

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 39/94 (41%), Positives = 42/94 (44%), Gaps = 31/94 (32%)
 Frame = +1

Query: 118 PPSPPPPYIYKSPPPPPYVYNSPP-------------PPPYVYNSPPPPPYVYKSPP--- 249
           P   PP + Y SPPP PY Y SPP             PPP  +N  PPP + Y SPP   
Sbjct: 177 PHIQPPIFPYNSPPPSPYQYPSPPFNYKSPPLPNQFSPPP--FNKFPPPSHQYPSPPQSS 234

Query: 250 ---PPPYVYKSP------------PPPPYVYKSP 306
              PPPY Y  P            PPPPY Y SP
Sbjct: 235 YHSPPPYQYTPPNSYQAPPTSYNHPPPPYGYNSP 268

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 32/71 (45%), Positives = 35/71 (49%), Gaps = 20/71 (28%)
 Frame = +1

Query: 160 PPPYVYNSPPPPPYVYNSPPPPPYVYKSP--------------PPPPYVYKSPP------ 279
           PP + YNSPPP PY Y   P PP+ YKSP              PPP + Y SPP      
Sbjct: 181 PPIFPYNSPPPSPYQY---PSPPFNYKSPPLPNQFSPPPFNKFPPPSHQYPSPPQSSYHS 237

Query: 280 PPPYVYKSPPS 312
           PPPY Y  P S
Sbjct: 238 PPPYQYTPPNS 248

[134][TOP]
>UniRef100_Q43504 Extensin-like protein Dif10 (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q43504_SOLLC
          Length = 396

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 55/111 (49%), Positives = 56/111 (50%), Gaps = 33/111 (29%)
 Frame = +1

Query: 79  SPPPP-------PYVYPSPPPP---SPPPPYIYKSPPPPPYV---YNSPPPPPYV----- 204
           SPPPP       P  Y SPPPP       PY YKSPPP PY    Y SPPPPPY      
Sbjct: 261 SPPPPTTYYEKSPSYYKSPPPPPYYKESTPY-YKSPPPSPYYKESYKSPPPPPYYEEFTP 319

Query: 205 -YNSPPPPPYV------YKSPPPPPYVY--------KSPPPPPYVYKSPPS 312
            Y SPPPPPY       YKSPPPPP  Y          PPPPP  YK  P+
Sbjct: 320 SYKSPPPPPYYKESTPSYKSPPPPPKHYDQSPTSYNSPPPPPPAYYKQTPT 370

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 54/113 (47%), Positives = 54/113 (47%), Gaps = 36/113 (31%)
 Frame = +1

Query: 79  SPPPPPYV-----YPSPPPPSPPPPYIYKSPPPPPYV------YNSPPPPPYV------Y 207
           SPPPPPY      Y   PPPSP     YKSPPPPPY       Y SPPPPPY       Y
Sbjct: 278 SPPPPPYYKESTPYYKSPPPSPYYKESYKSPPPPPYYEEFTPSYKSPPPPPYYKESTPSY 337

Query: 208 NSPPPP-------PYVYKSPPPPP-------YVYKSPPPP-----PYVYKSPP 309
            SPPPP       P  Y SPPPPP         Y SPPPP        Y SPP
Sbjct: 338 KSPPPPPKHYDQSPTSYNSPPPPPPAYYKQTPTYASPPPPQKYEQSVTYASPP 390

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 55/116 (47%), Positives = 56/116 (48%), Gaps = 38/116 (32%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP----PSPPPPYIYKSP-----PPPPYV--------YNSPPPPPY- 201
           +  P P   Y SP P     SP P   YKSP     PPPP          Y SPPPPPY 
Sbjct: 226 YKSPSPSKYYKSPAPYKYYKSPAPQKYYKSPVYYKSPPPPTTYYEKSPSYYKSPPPPPYY 285

Query: 202 -----VYNSPPPPPYV---YKSPPPPPYV------YKSPPPPPYV------YKSPP 309
                 Y SPPP PY    YKSPPPPPY       YKSPPPPPY       YKSPP
Sbjct: 286 KESTPYYKSPPPSPYYKESYKSPPPPPYYEEFTPSYKSPPPPPYYKESTPSYKSPP 341

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 51/107 (47%), Positives = 51/107 (47%), Gaps = 34/107 (31%)
 Frame = +1

Query: 79  SPPPPPYV---YPSPPPPSPPPPYI------YKSPPPPPYV------YNSPPPP------ 195
           SPPP PY    Y SP    PPPPY       YKSPPPPPY       Y SPPPP      
Sbjct: 294 SPPPSPYYKESYKSP----PPPPYYEEFTPSYKSPPPPPYYKESTPSYKSPPPPPKHYDQ 349

Query: 196 -PYVYNSPPPPP-------YVYKSPPPP-----PYVYKSPPPPPYVY 297
            P  YNSPPPPP         Y SPPPP        Y SPPPP   Y
Sbjct: 350 SPTSYNSPPPPPPAYYKQTPTYASPPPPQKYEQSVTYASPPPPSTNY 396

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 50/141 (35%), Positives = 51/141 (36%), Gaps = 64/141 (45%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-----SPPPPYIYKSPPPPPYVYNSPPP----------------- 192
           +P P  Y Y SP P      SP P   YKSP P  Y Y SP P                 
Sbjct: 169 APTPSKYYYKSPAPSKYYYKSPSPAKYYKSPAPSKYYYKSPSPRKYYKSPAPSKHYYYKS 228

Query: 193 --------------------------PPYVYNSPPPP-------PYVYKSPPPPPY---- 261
                                      P  Y SPPPP       P  YKSPPPPPY    
Sbjct: 229 PSPSKYYKSPAPYKYYKSPAPQKYYKSPVYYKSPPPPTTYYEKSPSYYKSPPPPPYYKES 288

Query: 262 --VYKSPPPPPYV---YKSPP 309
              YKSPPP PY    YKSPP
Sbjct: 289 TPYYKSPPPSPYYKESYKSPP 309

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 44/103 (42%), Positives = 49/103 (47%), Gaps = 1/103 (0%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           P  +    SP  S +   + + V  +  P P   Y   P PS    Y YKSP P  Y Y 
Sbjct: 132 PVVAKYYKSPAPSKQYYKAPVVVKYYKSPAPSKNYYKAPTPSK---YYYKSPAPSKYYYK 188

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPP-YVYKSP 306
           SP P  Y Y SP P  Y YKSP P  Y YKSP P   Y YKSP
Sbjct: 189 SPSPAKY-YKSPAPSKYYYKSPSPRKY-YKSPAPSKHYYYKSP 229

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/82 (43%), Positives = 39/82 (47%), Gaps = 5/82 (6%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP-----SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           +  P     Y SP P      +P     YKSP P    Y +P P  Y Y SP P  Y YK
Sbjct: 129 YKAPVVAKYYKSPAPSKQYYKAPVVVKYYKSPAPSKNYYKAPTPSKYYYKSPAPSKYYYK 188

Query: 241 SPPPPPYVYKSPPPPPYVYKSP 306
           SP P  Y YKSP P  Y YKSP
Sbjct: 189 SPSPAKY-YKSPAPSKYYYKSP 209

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 35/82 (42%), Positives = 40/82 (48%), Gaps = 6/82 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSP------PPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           S  P  + Y +P        P+P   Y YK+P    Y Y SP P    Y +P P  Y YK
Sbjct: 121 SHAPSKHYYKAPVVAKYYKSPAPSKQY-YKAPVVVKY-YKSPAPSKNYYKAPTPSKYYYK 178

Query: 241 SPPPPPYVYKSPPPPPYVYKSP 306
           SP P  Y YKSP P  Y YKSP
Sbjct: 179 SPAPSKYYYKSPSPAKY-YKSP 199

[135][TOP]
>UniRef100_C4LZJ6 Putative uncharacterized protein n=1 Tax=Entamoeba histolytica
            HM-1:IMSS RepID=C4LZJ6_ENTHI
          Length = 1575

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 43/91 (47%), Positives = 52/91 (57%), Gaps = 5/91 (5%)
 Frame = +1

Query: 31   NSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS-----PPPPYIYKSPPPPPYVYNSPPPP 195
            +S+   +PS I   P  PPPP    P PPPP+     PPPP +   PPPPP +   PPPP
Sbjct: 1408 SSAKTSSPSSIATPP--PPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPP 1465

Query: 196  PYVYNSPPPPPYVYKSPPPPPYVYKSPPPPP 288
            P +   PPPPP +   PPPPP +   PPPPP
Sbjct: 1466 PTLSMPPPPPPTLSMPPPPPPTLSMPPPPPP 1496

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 47/100 (47%), Positives = 56/100 (56%)
 Frame = +1

Query: 10   SAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPP 189
            SA +SSP+S    TP         PPPPP +  S PP  PPPP +   PPPPP +   PP
Sbjct: 1409 SAKTSSPSSIA--TP---------PPPPPTL--SMPP--PPPPTLSMPPPPPPTLSMPPP 1453

Query: 190  PPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPP +   PPPPP +   PPPPP +   PPPPP +   PP
Sbjct: 1454 PPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPP 1493

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 32/84 (38%), Positives = 42/84 (50%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP  ++   P  +  + P         PPPPP +  S PP  PPPP +   PPPPP +  
Sbjct: 1425 PPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTL--SMPP--PPPPTLSMPPPPPPTLSM 1480

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPP 252
             PPPPP +   PPPPP +  +  P
Sbjct: 1481 PPPPPPTLSMPPPPPPTLNVTSSP 1504

[136][TOP]
>UniRef100_UPI000198409E PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI000198409E
          Length = 478

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 53/119 (44%), Positives = 64/119 (53%), Gaps = 15/119 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPN----------SSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYK 150
           PP + VS  P           S   + PS    SP  P PPP   PSPPPPSPPPP +  
Sbjct: 177 PPPTVVSPPPTVVPPPVLPTPSPPVVVPSPPPPSPPPPSPPP---PSPPPPSPPPPPLIP 233

Query: 151 SPPPPPYVYNSPPPPPYV-YNSPPPPPYVYKSPPPPPYVYKSP----PPPPYVYKSPPS 312
           SPPPP  +  SPPPP ++   SPPPPP V   PPP  + + SP    PPP + + SPP+
Sbjct: 234 SPPPPSPLSPSPPPPAFLPPPSPPPPPLVPSPPPPAIFPWLSPPADNPPPVFPWLSPPA 292

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 47/111 (42%), Positives = 51/111 (45%), Gaps = 8/111 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPP----PPP 168
           PP   +  S  S   I PS     P  P PP  + PSPP    PPP +   PP    PPP
Sbjct: 131 PPSQPLPPSVPSLPPIVPS----PPLLPFPPTPLVPSPPAVVQPPPLLPFPPPTVVSPPP 186

Query: 169 YVYNSP----PPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            V   P    P PP V  SPPPP     SPPPP     SPPPPP +   PP
Sbjct: 187 TVVPPPVLPTPSPPVVVPSPPPPSPPPPSPPPPSPPPPSPPPPPLIPSPPP 237

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 54/130 (41%), Positives = 64/130 (49%), Gaps = 27/130 (20%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVY---PSPPPP----SPPPPYIYK--S 153
           PP S    SP     I PS    SP SP PPP  +   PSPPPP    SPPPP I+   S
Sbjct: 217 PPPSPPPPSPPPPPLI-PSPPPPSPLSPSPPPPAFLPPPSPPPPPLVPSPPPPAIFPWLS 275

Query: 154 P----PPPPYVYNSP----PPPPYVYNSPP--PPPYVYK--SPP----PPPY--VYKSPP 279
           P    PPP + + SP    PPP + + SPP   PP V+   SPP    P P+   +  PP
Sbjct: 276 PPADNPPPVFPWLSPPADTPPPVFPWLSPPADTPPAVFPWLSPPDEFTPTPFFPTFSPPP 335

Query: 280 PPPYVYKSPP 309
            PP   + PP
Sbjct: 336 EPPQFPQLPP 345

[137][TOP]
>UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q8L685_VOLCA
          Length = 1009

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 45/82 (54%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP   + PPPPP     PPPPP     PPP
Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP----PPPPPPPPPPPPPP 698

Query: 253 PPYVYKSPP-PPPYVYKSPPSC 315
           PP  +  PP PPP V   PPSC
Sbjct: 699 PPPPHPPPPSPPPLVPALPPSC 720

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 46/87 (52%), Positives = 47/87 (54%)
 Frame = +1

Query: 49  TPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPP 228
           T  G    P SPPPPP + PSPPPPSPPPP     PP PP     PPPPP     PPPPP
Sbjct: 203 TVIGYNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPP 262

Query: 229 YVYKSPPPPPYVYKSPPPPPYVYKSPP 309
                PPPPP     PPPPP     PP
Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPP 289

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 47/103 (45%), Positives = 49/103 (47%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP   +  SP   +   P      P  PPPPP   P PPPP PPPP     PPPPP    
Sbjct: 215 PPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP     PPPPP     PPPPP     PPPPP     PP
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 44/80 (55%), Positives = 46/80 (57%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP +  SPPPPP     PPP
Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP---PPPPP 688

Query: 253 PPYVYKSPPPPPYVYKSPPS 312
           PP     PPPPP  +  PPS
Sbjct: 689 PPPPPPPPPPPPPPHPPPPS 708

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 49/103 (47%), Positives = 49/103 (47%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P S     PS     P  PPPPP   P PPPP PPPP     PPPPP    
Sbjct: 217 PPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP     PPPPP     PPPPP     PPPPP     PP
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 47/103 (45%), Positives = 49/103 (47%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S     P+    + P      P  PPPPP   P PPPP PPPP     PPPPP    
Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP     PPPPP     PPPPP     PPPPP     PP
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 43/79 (54%), Positives = 44/79 (55%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP +  SPP
Sbjct: 662 PPPPPPPPPPPPPLPPSPP 680

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 43/79 (54%), Positives = 44/79 (55%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP +  SPPPPP     PP
Sbjct: 672 PPPLPPSPPPPPPPPPPPP 690

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 43/79 (54%), Positives = 44/79 (55%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP +  SPPP
Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 682 PPPPPPPPPPPPPPPPPPP 700

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 47/102 (46%), Positives = 48/102 (47%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNS 183
           P S    SP       P  +   P  PPPPP   P PPPP PPPP     PPPPP     
Sbjct: 221 PPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280

Query: 184 PPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPPPP     PPPPP     PPPPP     PPPPP     PP
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 47/103 (45%), Positives = 48/103 (46%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP  +    P S     P      P  PPPPP   P PPPP PPPP     PPPPP    
Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP     PPPPP     PPPPP     PPPPP     PP
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 43/80 (53%), Positives = 43/80 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658

Query: 253 PPYVYKSPPPPPYVYKSPPS 312
           PP     PPPPP     PPS
Sbjct: 659 PPPPPPPPPPPPPPPPLPPS 678

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 663 PPPPPPPPPPPPLPPSPPP 681

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 673 PPLPPSPPPPPPPPPPPPP 691

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 683 PPPPPPPPPPPPPPPPPPP 701

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 310 PPPPPPPPPPPPPPPPPPP 328

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 311 PPPPPPPPPPPPPPPPPPP 329

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 312 PPPPPPPPPPPPPPPPPPP 330

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 313 PPPPPPPPPPPPPPPPPPP 331

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 314 PPPPPPPPPPPPPPPPPPP 332

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 315 PPPPPPPPPPPPPPPPPPP 333

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 316 PPPPPPPPPPPPPPPPPPP 334

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 317 PPPPPPPPPPPPPPPPPPP 335

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 318 PPPPPPPPPPPPPPPPPPP 336

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 319 PPPPPPPPPPPPPPPPPPP 337

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 320 PPPPPPPPPPPPPPPPPPP 338

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 321 PPPPPPPPPPPPPPPPPPP 339

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 322 PPPPPPPPPPPPPPPPPPP 340

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 323 PPPPPPPPPPPPPPPPPPP 341

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 324 PPPPPPPPPPPPPPPPPPP 342

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 325 PPPPPPPPPPPPPPPPPPP 343

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 326 PPPPPPPPPPPPPPPPPPP 344

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 327 PPPPPPPPPPPPPPPPPPP 345

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 328 PPPPPPPPPPPPPPPPPPP 346

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 329 PPPPPPPPPPPPPPPPPPP 347

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 330 PPPPPPPPPPPPPPPPPPP 348

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 331 PPPPPPPPPPPPPPPPPPP 349

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 332 PPPPPPPPPPPPPPPPPPP 350

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 333 PPPPPPPPPPPPPPPPPPP 351

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 334 PPPPPPPPPPPPPPPPPPP 352

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 335 PPPPPPPPPPPPPPPPPPP 353

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 336 PPPPPPPPPPPPPPPPPPP 354

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 337 PPPPPPPPPPPPPPPPPPP 355

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 338 PPPPPPPPPPPPPPPPPPP 356

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 339 PPPPPPPPPPPPPPPPPPP 357

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 340 PPPPPPPPPPPPPPPPPPP 358

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 341 PPPPPPPPPPPPPPPPPPP 359

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 342 PPPPPPPPPPPPPPPPPPP 360

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 343 PPPPPPPPPPPPPPPPPPP 361

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 344 PPPPPPPPPPPPPPPPPPP 362

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 345 PPPPPPPPPPPPPPPPPPP 363

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 346 PPPPPPPPPPPPPPPPPPP 364

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 347 PPPPPPPPPPPPPPPPPPP 365

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 348 PPPPPPPPPPPPPPPPPPP 366

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 349 PPPPPPPPPPPPPPPPPPP 367

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 350 PPPPPPPPPPPPPPPPPPP 368

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 351 PPPPPPPPPPPPPPPPPPP 369

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 352 PPPPPPPPPPPPPPPPPPP 370

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 353 PPPPPPPPPPPPPPPPPPP 371

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 354 PPPPPPPPPPPPPPPPPPP 372

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 355 PPPPPPPPPPPPPPPPPPP 373

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 356 PPPPPPPPPPPPPPPPPPP 374

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 357 PPPPPPPPPPPPPPPPPPP 375

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 358 PPPPPPPPPPPPPPPPPPP 376

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 359 PPPPPPPPPPPPPPPPPPP 377

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 360 PPPPPPPPPPPPPPPPPPP 378

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 361 PPPPPPPPPPPPPPPPPPP 379

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 362 PPPPPPPPPPPPPPPPPPP 380

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 363 PPPPPPPPPPPPPPPPPPP 381

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 364 PPPPPPPPPPPPPPPPPPP 382

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 365 PPPPPPPPPPPPPPPPPPP 383

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 366 PPPPPPPPPPPPPPPPPPP 384

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 367 PPPPPPPPPPPPPPPPPPP 385

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 368 PPPPPPPPPPPPPPPPPPP 386

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 369 PPPPPPPPPPPPPPPPPPP 387

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 370 PPPPPPPPPPPPPPPPPPP 388

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 371 PPPPPPPPPPPPPPPPPPP 389

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 372 PPPPPPPPPPPPPPPPPPP 390

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 373 PPPPPPPPPPPPPPPPPPP 391

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 374 PPPPPPPPPPPPPPPPPPP 392

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 375 PPPPPPPPPPPPPPPPPPP 393

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 376 PPPPPPPPPPPPPPPPPPP 394

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 377 PPPPPPPPPPPPPPPPPPP 395

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 378 PPPPPPPPPPPPPPPPPPP 396

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 379 PPPPPPPPPPPPPPPPPPP 397

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 380 PPPPPPPPPPPPPPPPPPP 398

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 381 PPPPPPPPPPPPPPPPPPP 399

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 382 PPPPPPPPPPPPPPPPPPP 400

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 383 PPPPPPPPPPPPPPPPPPP 401

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 384 PPPPPPPPPPPPPPPPPPP 402

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 385 PPPPPPPPPPPPPPPPPPP 403

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 386 PPPPPPPPPPPPPPPPPPP 404

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 387 PPPPPPPPPPPPPPPPPPP 405

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 388 PPPPPPPPPPPPPPPPPPP 406

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 389 PPPPPPPPPPPPPPPPPPP 407

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 390 PPPPPPPPPPPPPPPPPPP 408

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 391 PPPPPPPPPPPPPPPPPPP 409

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 392 PPPPPPPPPPPPPPPPPPP 410

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 393 PPPPPPPPPPPPPPPPPPP 411

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 394 PPPPPPPPPPPPPPPPPPP 412

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 395 PPPPPPPPPPPPPPPPPPP 413

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 396 PPPPPPPPPPPPPPPPPPP 414

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 397 PPPPPPPPPPPPPPPPPPP 415

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 398 PPPPPPPPPPPPPPPPPPP 416

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 399 PPPPPPPPPPPPPPPPPPP 417

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 400 PPPPPPPPPPPPPPPPPPP 418

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 401 PPPPPPPPPPPPPPPPPPP 419

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 402 PPPPPPPPPPPPPPPPPPP 420

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 403 PPPPPPPPPPPPPPPPPPP 421

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 404 PPPPPPPPPPPPPPPPPPP 422

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 405 PPPPPPPPPPPPPPPPPPP 423

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 406 PPPPPPPPPPPPPPPPPPP 424

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 407 PPPPPPPPPPPPPPPPPPP 425

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 408 PPPPPPPPPPPPPPPPPPP 426

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 409 PPPPPPPPPPPPPPPPPPP 427

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 410 PPPPPPPPPPPPPPPPPPP 428

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 411 PPPPPPPPPPPPPPPPPPP 429

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 412 PPPPPPPPPPPPPPPPPPP 430

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 413 PPPPPPPPPPPPPPPPPPP 431

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 414 PPPPPPPPPPPPPPPPPPP 432

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 415 PPPPPPPPPPPPPPPPPPP 433

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 416 PPPPPPPPPPPPPPPPPPP 434

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 417 PPPPPPPPPPPPPPPPPPP 435

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 418 PPPPPPPPPPPPPPPPPPP 436

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 419 PPPPPPPPPPPPPPPPPPP 437

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 420 PPPPPPPPPPPPPPPPPPP 438

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 421 PPPPPPPPPPPPPPPPPPP 439

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 422 PPPPPPPPPPPPPPPPPPP 440

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 423 PPPPPPPPPPPPPPPPPPP 441

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 424 PPPPPPPPPPPPPPPPPPP 442

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 425 PPPPPPPPPPPPPPPPPPP 443

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 426 PPPPPPPPPPPPPPPPPPP 444

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 427 PPPPPPPPPPPPPPPPPPP 445

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 428 PPPPPPPPPPPPPPPPPPP 446

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 429 PPPPPPPPPPPPPPPPPPP 447

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 430 PPPPPPPPPPPPPPPPPPP 448

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 431 PPPPPPPPPPPPPPPPPPP 449

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 432 PPPPPPPPPPPPPPPPPPP 450

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 433 PPPPPPPPPPPPPPPPPPP 451

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 434 PPPPPPPPPPPPPPPPPPP 452

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 435 PPPPPPPPPPPPPPPPPPP 453

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 436 PPPPPPPPPPPPPPPPPPP 454

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 437 PPPPPPPPPPPPPPPPPPP 455

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 438 PPPPPPPPPPPPPPPPPPP 456

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 439 PPPPPPPPPPPPPPPPPPP 457

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 440 PPPPPPPPPPPPPPPPPPP 458

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 441 PPPPPPPPPPPPPPPPPPP 459

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 442 PPPPPPPPPPPPPPPPPPP 460

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 443 PPPPPPPPPPPPPPPPPPP 461

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 444 PPPPPPPPPPPPPPPPPPP 462

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 445 PPPPPPPPPPPPPPPPPPP 463

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 446 PPPPPPPPPPPPPPPPPPP 464

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 447 PPPPPPPPPPPPPPPPPPP 465

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 448 PPPPPPPPPPPPPPPPPPP 466

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 449 PPPPPPPPPPPPPPPPPPP 467

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 450 PPPPPPPPPPPPPPPPPPP 468

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 451 PPPPPPPPPPPPPPPPPPP 469

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 452 PPPPPPPPPPPPPPPPPPP 470

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 453 PPPPPPPPPPPPPPPPPPP 471

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 454 PPPPPPPPPPPPPPPPPPP 472

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 455 PPPPPPPPPPPPPPPPPPP 473

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 456 PPPPPPPPPPPPPPPPPPP 474

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 457 PPPPPPPPPPPPPPPPPPP 475

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 458 PPPPPPPPPPPPPPPPPPP 476

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 459 PPPPPPPPPPPPPPPPPPP 477

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 460 PPPPPPPPPPPPPPPPPPP 478

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 461 PPPPPPPPPPPPPPPPPPP 479

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 462 PPPPPPPPPPPPPPPPPPP 480

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 463 PPPPPPPPPPPPPPPPPPP 481

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 464 PPPPPPPPPPPPPPPPPPP 482

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 465 PPPPPPPPPPPPPPPPPPP 483

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 466 PPPPPPPPPPPPPPPPPPP 484

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 467 PPPPPPPPPPPPPPPPPPP 485

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 468 PPPPPPPPPPPPPPPPPPP 486

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 469 PPPPPPPPPPPPPPPPPPP 487

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 470 PPPPPPPPPPPPPPPPPPP 488

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 471 PPPPPPPPPPPPPPPPPPP 489

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 472 PPPPPPPPPPPPPPPPPPP 490

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 473 PPPPPPPPPPPPPPPPPPP 491

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 474 PPPPPPPPPPPPPPPPPPP 492

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 475 PPPPPPPPPPPPPPPPPPP 493

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 476 PPPPPPPPPPPPPPPPPPP 494

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 477 PPPPPPPPPPPPPPPPPPP 495

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 478 PPPPPPPPPPPPPPPPPPP 496

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 479 PPPPPPPPPPPPPPPPPPP 497

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 480 PPPPPPPPPPPPPPPPPPP 498

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 481 PPPPPPPPPPPPPPPPPPP 499

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 482 PPPPPPPPPPPPPPPPPPP 500

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 483 PPPPPPPPPPPPPPPPPPP 501

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 484 PPPPPPPPPPPPPPPPPPP 502

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 485 PPPPPPPPPPPPPPPPPPP 503

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 486 PPPPPPPPPPPPPPPPPPP 504

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 487 PPPPPPPPPPPPPPPPPPP 505

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 488 PPPPPPPPPPPPPPPPPPP 506

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 489 PPPPPPPPPPPPPPPPPPP 507

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 490 PPPPPPPPPPPPPPPPPPP 508

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 491 PPPPPPPPPPPPPPPPPPP 509

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 492 PPPPPPPPPPPPPPPPPPP 510

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 493 PPPPPPPPPPPPPPPPPPP 511

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 494 PPPPPPPPPPPPPPPPPPP 512

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 495 PPPPPPPPPPPPPPPPPPP 513

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 496 PPPPPPPPPPPPPPPPPPP 514

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 497 PPPPPPPPPPPPPPPPPPP 515

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 498 PPPPPPPPPPPPPPPPPPP 516

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 499 PPPPPPPPPPPPPPPPPPP 517

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 500 PPPPPPPPPPPPPPPPPPP 518

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 501 PPPPPPPPPPPPPPPPPPP 519

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 502 PPPPPPPPPPPPPPPPPPP 520

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 503 PPPPPPPPPPPPPPPPPPP 521

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 504 PPPPPPPPPPPPPPPPPPP 522

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 505 PPPPPPPPPPPPPPPPPPP 523

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 506 PPPPPPPPPPPPPPPPPPP 524

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 507 PPPPPPPPPPPPPPPPPPP 525

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 508 PPPPPPPPPPPPPPPPPPP 526

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 509 PPPPPPPPPPPPPPPPPPP 527

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 510 PPPPPPPPPPPPPPPPPPP 528

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 511 PPPPPPPPPPPPPPPPPPP 529

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 512 PPPPPPPPPPPPPPPPPPP 530

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 513 PPPPPPPPPPPPPPPPPPP 531

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 514 PPPPPPPPPPPPPPPPPPP 532

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 515 PPPPPPPPPPPPPPPPPPP 533

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 516 PPPPPPPPPPPPPPPPPPP 534

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 517 PPPPPPPPPPPPPPPPPPP 535

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 518 PPPPPPPPPPPPPPPPPPP 536

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 519 PPPPPPPPPPPPPPPPPPP 537

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 520 PPPPPPPPPPPPPPPPPPP 538

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 521 PPPPPPPPPPPPPPPPPPP 539

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 522 PPPPPPPPPPPPPPPPPPP 540

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 523 PPPPPPPPPPPPPPPPPPP 541

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 524 PPPPPPPPPPPPPPPPPPP 542

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 525 PPPPPPPPPPPPPPPPPPP 543

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 526 PPPPPPPPPPPPPPPPPPP 544

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 527 PPPPPPPPPPPPPPPPPPP 545

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 528 PPPPPPPPPPPPPPPPPPP 546

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 529 PPPPPPPPPPPPPPPPPPP 547

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 530 PPPPPPPPPPPPPPPPPPP 548

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 531 PPPPPPPPPPPPPPPPPPP 549

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 532 PPPPPPPPPPPPPPPPPPP 550

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 533 PPPPPPPPPPPPPPPPPPP 551

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 534 PPPPPPPPPPPPPPPPPPP 552

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 535 PPPPPPPPPPPPPPPPPPP 553

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 536 PPPPPPPPPPPPPPPPPPP 554

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 537 PPPPPPPPPPPPPPPPPPP 555

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 538 PPPPPPPPPPPPPPPPPPP 556

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 539 PPPPPPPPPPPPPPPPPPP 557

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 540 PPPPPPPPPPPPPPPPPPP 558

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 541 PPPPPPPPPPPPPPPPPPP 559

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 542 PPPPPPPPPPPPPPPPPPP 560

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 543 PPPPPPPPPPPPPPPPPPP 561

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 544 PPPPPPPPPPPPPPPPPPP 562

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 545 PPPPPPPPPPPPPPPPPPP 563

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 546 PPPPPPPPPPPPPPPPPPP 564

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 547 PPPPPPPPPPPPPPPPPPP 565

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 548 PPPPPPPPPPPPPPPPPPP 566

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 549 PPPPPPPPPPPPPPPPPPP 567

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 550 PPPPPPPPPPPPPPPPPPP 568

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 551 PPPPPPPPPPPPPPPPPPP 569

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 552 PPPPPPPPPPPPPPPPPPP 570

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 553 PPPPPPPPPPPPPPPPPPP 571

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 554 PPPPPPPPPPPPPPPPPPP 572

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 555 PPPPPPPPPPPPPPPPPPP 573

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 556 PPPPPPPPPPPPPPPPPPP 574

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 557 PPPPPPPPPPPPPPPPPPP 575

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 558 PPPPPPPPPPPPPPPPPPP 576

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 559 PPPPPPPPPPPPPPPPPPP 577

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 560 PPPPPPPPPPPPPPPPPPP 578

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 561 PPPPPPPPPPPPPPPPPPP 579

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 562 PPPPPPPPPPPPPPPPPPP 580

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 563 PPPPPPPPPPPPPPPPPPP 581

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 564 PPPPPPPPPPPPPPPPPPP 582

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 565 PPPPPPPPPPPPPPPPPPP 583

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 566 PPPPPPPPPPPPPPPPPPP 584

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 567 PPPPPPPPPPPPPPPPPPP 585

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 568 PPPPPPPPPPPPPPPPPPP 586

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 569 PPPPPPPPPPPPPPPPPPP 587

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 570 PPPPPPPPPPPPPPPPPPP 588

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 571 PPPPPPPPPPPPPPPPPPP 589

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 572 PPPPPPPPPPPPPPPPPPP 590

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 573 PPPPPPPPPPPPPPPPPPP 591

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 574 PPPPPPPPPPPPPPPPPPP 592

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 575 PPPPPPPPPPPPPPPPPPP 593

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 576 PPPPPPPPPPPPPPPPPPP 594

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 577 PPPPPPPPPPPPPPPPPPP 595

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 578 PPPPPPPPPPPPPPPPPPP 596

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 579 PPPPPPPPPPPPPPPPPPP 597

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 580 PPPPPPPPPPPPPPPPPPP 598

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 581 PPPPPPPPPPPPPPPPPPP 599

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 582 PPPPPPPPPPPPPPPPPPP 600

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 583 PPPPPPPPPPPPPPPPPPP 601

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 584 PPPPPPPPPPPPPPPPPPP 602

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 585 PPPPPPPPPPPPPPPPPPP 603

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 586 PPPPPPPPPPPPPPPPPPP 604

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 587 PPPPPPPPPPPPPPPPPPP 605

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 588 PPPPPPPPPPPPPPPPPPP 606

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 589 PPPPPPPPPPPPPPPPPPP 607

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 590 PPPPPPPPPPPPPPPPPPP 608

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 591 PPPPPPPPPPPPPPPPPPP 609

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 592 PPPPPPPPPPPPPPPPPPP 610

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 593 PPPPPPPPPPPPPPPPPPP 611

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 594 PPPPPPPPPPPPPPPPPPP 612

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 595 PPPPPPPPPPPPPPPPPPP 613

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 596 PPPPPPPPPPPPPPPPPPP 614

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 597 PPPPPPPPPPPPPPPPPPP 615

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 598 PPPPPPPPPPPPPPPPPPP 616

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 599 PPPPPPPPPPPPPPPPPPP 617

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 600 PPPPPPPPPPPPPPPPPPP 618

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 601 PPPPPPPPPPPPPPPPPPP 619

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 602 PPPPPPPPPPPPPPPPPPP 620

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 603 PPPPPPPPPPPPPPPPPPP 621

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 604 PPPPPPPPPPPPPPPPPPP 622

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 605 PPPPPPPPPPPPPPPPPPP 623

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 606 PPPPPPPPPPPPPPPPPPP 624

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 607 PPPPPPPPPPPPPPPPPPP 625

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 608 PPPPPPPPPPPPPPPPPPP 626

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 609 PPPPPPPPPPPPPPPPPPP 627

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 610 PPPPPPPPPPPPPPPPPPP 628

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 611 PPPPPPPPPPPPPPPPPPP 629

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 612 PPPPPPPPPPPPPPPPPPP 630

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 613 PPPPPPPPPPPPPPPPPPP 631

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 614 PPPPPPPPPPPPPPPPPPP 632

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 615 PPPPPPPPPPPPPPPPPPP 633

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 616 PPPPPPPPPPPPPPPPPPP 634

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 617 PPPPPPPPPPPPPPPPPPP 635

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 618 PPPPPPPPPPPPPPPPPPP 636

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 619 PPPPPPPPPPPPPPPPPPP 637

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 620 PPPPPPPPPPPPPPPPPPP 638

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 621 PPPPPPPPPPPPPPPPPPP 639

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 622 PPPPPPPPPPPPPPPPPPP 640

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 623 PPPPPPPPPPPPPPPPPPP 641

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 624 PPPPPPPPPPPPPPPPPPP 642

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 625 PPPPPPPPPPPPPPPPPPP 643

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 626 PPPPPPPPPPPPPPPPPPP 644

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 627 PPPPPPPPPPPPPPPPPPP 645

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 628 PPPPPPPPPPPPPPPPPPP 646

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 629 PPPPPPPPPPPPPPPPPPP 647

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 630 PPPPPPPPPPPPPPPPPPP 648

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 631 PPPPPPPPPPPPPPPPPPP 649

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 632 PPPPPPPPPPPPPPPPPPP 650

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 633 PPPPPPPPPPPPPPPPPPP 651

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 634 PPPPPPPPPPPPPPPPPPP 652

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 635 PPPPPPPPPPPPPPPPPPP 653

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 636 PPPPPPPPPPPPPPPPPPP 654

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 637 PPPPPPPPPPPPPPPPPPP 655

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 638 PPPPPPPPPPPPPPPPPPP 656

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 639 PPPPPPPPPPPPPPPPPPP 657

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 640 PPPPPPPPPPPPPPPPPPP 658

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 641 PPPPPPPPPPPPPPPPPPP 659

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 642 PPPPPPPPPPPPPPPPPPP 660

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 643 PPPPPPPPPPPPPPPPPPP 661

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 644 PPPPPPPPPPPPPPPPPPP 662

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 645 PPPPPPPPPPPPPPPPPPP 663

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 646 PPPPPPPPPPPPPPPPPPP 664

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 647 PPPPPPPPPPPPPPPPPPP 665

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 648 PPPPPPPPPPPPPPPPPPP 666

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 649 PPPPPPPPPPPPPPPPPPP 667

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 650 PPPPPPPPPPPPPPPPPPP 668

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 651 PPPPPPPPPPPPPPPPPPP 669

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 652 PPPPPPPPPPPPPPPPPPP 670

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 653 PPPPPPPPPPPPPPPPPPP 671

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 654 PPPPPPPPPPPPPPPPPPP 672

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 655 PPPPPPPPPPPPPPPPPPP 673

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 656 PPPPPPPPPPPPPPPPPPP 674

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 47/103 (45%), Positives = 48/103 (46%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S     P   +   PS     P  PPP P   P PPPP PPPP     PPPPP    
Sbjct: 210 PPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP     PPPPP     PPPPP     PPPPP     PP
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 28/56 (50%), Positives = 29/56 (51%)
 Frame = +1

Query: 52  PSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPP 219
           P  +  SP  PPPPP   P PPPP PPPP     PP PP     P PPP V   PP
Sbjct: 672 PPPLPPSPPPPPPPPPPPPPPPPPPPPPP-----PPHPP----PPSPPPLVPALPP 718

[138][TOP]
>UniRef100_Q43586 PAP8 product (Fragment) n=1 Tax=Nicotiana tabacum
           RepID=Q43586_TOBAC
          Length = 99

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 50/91 (54%), Positives = 52/91 (57%), Gaps = 23/91 (25%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPSPP---------PPYIYKSPPPP---------PY----VYNSPPPP 195
           PPPP  VY SPPPP  P         P  +YKSPPPP         PY    VY SPPPP
Sbjct: 6   PPPPAPVYKSPPPPKKPYHPSPTPYHPAPVYKSPPPPLKPYHPSPTPYHPAPVYMSPPPP 65

Query: 196 PYVYNSPPPPPYVYKSPPP-PPYVYKSPPPP 285
             VY SPPPP  VYKSP P  PY+Y SPPPP
Sbjct: 66  TPVYKSPPPPTPVYKSPAPHHPYLYASPPPP 96

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/90 (56%), Positives = 54/90 (60%), Gaps = 14/90 (15%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPSPP---------PPYIYKSPPPPPYVYNSPPPPPY----VYNSPPP 222
           PPP P  Y SPPPP  P         P  +YKSPPPP   Y+ P P PY    VY SPPP
Sbjct: 7   PPPAPV-YKSPPPPKKPYHPSPTPYHPAPVYKSPPPPLKPYH-PSPTPYHPAPVYMSPPP 64

Query: 223 PPYVYKSPPPPPYVYKSPPP-PPYVYKSPP 309
           P  VYKSPPPP  VYKSP P  PY+Y SPP
Sbjct: 65  PTPVYKSPPPPTPVYKSPAPHHPYLYASPP 94

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 46/82 (56%), Positives = 49/82 (59%), Gaps = 17/82 (20%)
 Frame = +1

Query: 112 PPPPSPPPPYIYKSPPPPPYVYNSPPPPPY----VYNSPPPP--PY-----------VYK 240
           PPPP+P    +YKSPPPP   Y+ P P PY    VY SPPPP  PY           VY 
Sbjct: 6   PPPPAP----VYKSPPPPKKPYH-PSPTPYHPAPVYKSPPPPLKPYHPSPTPYHPAPVYM 60

Query: 241 SPPPPPYVYKSPPPPPYVYKSP 306
           SPPPP  VYKSPPPP  VYKSP
Sbjct: 61  SPPPPTPVYKSPPPPTPVYKSP 82

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 46/99 (46%), Positives = 50/99 (50%), Gaps = 14/99 (14%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPY----VYPSPPPPSPP---------PPY 141
           PP + V  SP    K         P+ P P PY    VY SPPPP  P         P  
Sbjct: 7   PPPAPVYKSPPPPKK---------PYHPSPTPYHPAPVYKSPPPPLKPYHPSPTPYHPAP 57

Query: 142 IYKSPPPPPYVYNSPPPPPYVYNSPPP-PPYVYKSPPPP 255
           +Y SPPPP  VY SPPPP  VY SP P  PY+Y SPPPP
Sbjct: 58  VYMSPPPPTPVYKSPPPPTPVYKSPAPHHPYLYASPPPP 96

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/72 (51%), Positives = 38/72 (52%), Gaps = 27/72 (37%)
 Frame = +1

Query: 175 YNSPPPPPY-VYNSPPPP--PY-----------VYKSPPPP--PY-----------VYKS 273
           + S PPPP  VY SPPPP  PY           VYKSPPPP  PY           VY S
Sbjct: 2   FTSRPPPPAPVYKSPPPPKKPYHPSPTPYHPAPVYKSPPPPLKPYHPSPTPYHPAPVYMS 61

Query: 274 PPPPPYVYKSPP 309
           PPPP  VYKSPP
Sbjct: 62  PPPPTPVYKSPP 73

[139][TOP]
>UniRef100_A9V3V4 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V3V4_MONBE
          Length = 2296

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 50/103 (48%), Positives = 54/103 (52%), Gaps = 3/103 (2%)
 Frame = +1

Query: 13   AVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKS---PPPPPYVYNS 183
            AVS +P    +   + +     SPPPP    P PPPP PPPP    S   PPPPP    S
Sbjct: 2081 AVSQTPVERQEERATTLASGTSSPPPPAATSPPPPPPPPPPPPAAASPPPPPPPPPAAAS 2140

Query: 184  PPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            PPPPP     PPPPP V  SPPPPP     PPPPP V    PS
Sbjct: 2141 PPPPP-----PPPPPLVAASPPPPP---PPPPPPPPVAAPAPS 2175

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 50/95 (52%), Positives = 51/95 (53%), Gaps = 3/95 (3%)
 Frame = +1

Query: 34   SSTKITPSGIGVSPFSPPPPPYVYP---SPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYV 204
            S T   P     SP  PPPPP   P   SPPPP PPPP    SPPPPP     PPPPP V
Sbjct: 2099 SGTSSPPPPAATSPPPPPPPPPPPPAAASPPPPPPPPPAA-ASPPPPP-----PPPPPLV 2152

Query: 205  YNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              SPPPPP     PPPPP    +P PPP    SPP
Sbjct: 2153 AASPPPPP--PPPPPPPPVAAPAPSPPP----SPP 2181

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 42/93 (45%), Positives = 46/93 (49%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP  A +S P       P     SP  PPPPP    SPPPP PPPP +  + PPPP    
Sbjct: 2104 PPPPAATSPPPPPPPPPPPPAAASPPPPPPPPPAAASPPPPPPPPPPLVAASPPPP---- 2159

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPP 279
             PPPP      PPPPP    +P PPP    SPP
Sbjct: 2160 -PPPP------PPPPPVAAPAPSPPP----SPP 2181

[140][TOP]
>UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2B5_EHV86
          Length = 2332

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/116 (45%), Positives = 58/116 (50%), Gaps = 13/116 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPP-------PPYVYPSPPPPS----PPPPYIY 147
           PP S   S P  S   +P    +SP  PPP       PP V PSPPPPS    PPPP + 
Sbjct: 227 PPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLS 286

Query: 148 KSPPPPPYVYNSP--PPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            SPPPP    + P  PPPP    SPPP P    SP PPP      PPPP +  SPP
Sbjct: 287 PSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPP 342

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 52/112 (46%), Positives = 56/112 (50%), Gaps = 9/112 (8%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP----PSPPPPYIYKSPPPPP 168
            PP S   S P  ST  +P     SP   PPPP   PSPPP    PSPPPP    SPPPPP
Sbjct: 1760 PPPSLSPSPPPPSTSPSPPPPSASP--SPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPP 1817

Query: 169  YVYNSPPP-----PPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
               + PPP     PP   +SP PPP      PPPP +  SPPP P     PP
Sbjct: 1818 ASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPPPPSLSPSPPPSPPPSSPPP 1869

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/111 (47%), Positives = 59/111 (53%), Gaps = 8/111 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS----PPPPYIYKSPPPPP 168
           PP SA  S P  S   +P    +SP   PPPP + PSPPPPS    PPPP +  SPPPP 
Sbjct: 218 PPPSASPSPPPPSLSPSPPPPSLSP--SPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPS 275

Query: 169 YVYNSPPPPPYVYNSPPPPPYVYKSP--PPPPYVYKSPP--PPPYVYKSPP 309
              +  PPPP +  SPPPP      P  PPPP    SPP  PPP    SPP
Sbjct: 276 L--SPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPP 324

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 52/118 (44%), Positives = 58/118 (49%), Gaps = 15/118 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPP-------PPYVYPSPPPP--------SPPP 135
           PP S   S P  S   +P    VSP  PPP       PP + PSPPPP        SPPP
Sbjct: 245 PPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPP 304

Query: 136 PYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P    SPPP P    SP PPP   +  PPPP +  SPPPP  +  SPPPP +    PP
Sbjct: 305 PSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPS-LSPSPPPPSFSPSPPP 361

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 47/94 (50%), Positives = 49/94 (52%), Gaps = 8/94 (8%)
 Frame = +1

Query: 52   PSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPY 231
            PS    SP  P PPP   PSPPPPSPPPP +  SPPPP     SP PPP   +  PPPP 
Sbjct: 1734 PSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPS---TSPSPPPPSASPSPPPPS 1790

Query: 232  VYKSP--------PPPPYVYKSPPPPPYVYKSPP 309
               SP        PPPP    SPPPPP     PP
Sbjct: 1791 ASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPP 1824

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 50/105 (47%), Positives = 53/105 (50%), Gaps = 2/105 (1%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
            PP S   S P S    +P    +SP   PPPP   PSPPPP  SP PP    SP PPP  
Sbjct: 1742 PPPSPPPSPPPSPPPPSPPPPSLSP--SPPPPSTSPSPPPPSASPSPPPPSASPSPPPPS 1799

Query: 175  YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             +  PPPP    SPPPPP    SP PPP      PPPP    SPP
Sbjct: 1800 LSPSPPPPSTSPSPPPPP---ASPSPPPPSASPSPPPPSSSPSPP 1841

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/109 (44%), Positives = 56/109 (51%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP----PSPPPPYIYKSPPPPP 168
           P   +  S P  S   +P    +SP   PPPP + PSPPP    PSPPPP +  SPPPP 
Sbjct: 209 PSLPSPPSLPPPSASPSPPPPSLSP--SPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPS 266

Query: 169 YVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSP--PPPPYVYKSPP 309
               SP PPP   +  PPPP +  SPPPP      P  PPPP    SPP
Sbjct: 267 V---SPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPP 312

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 46/103 (44%), Positives = 52/103 (50%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP SA  S P  S   +P    +SP  PPP     P PPP SP PP    SP PPP   +
Sbjct: 1778 PPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPP-PSS 1836

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            SP PPP   +  PPPP +  SPPP P     PPP P    +PP
Sbjct: 1837 SPSPPPPSSSPSPPPPSLSPSPPPSPPPSSPPPPSPPTPPAPP 1879

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/103 (46%), Positives = 55/103 (53%), Gaps = 5/103 (4%)
 Frame = +1

Query: 16  VSSSPNSSTKITPSGIGVSPFSP-PPPPYVYPSPPP----PSPPPPYIYKSPPPPPYVYN 180
           + S P   +  +P  +     SP PPPP + PSPPP    PSPPPP I  SPPPP    +
Sbjct: 202 IPSPPYPPSLPSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPS--LS 259

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             PPPP V  SPPPP     SP PPP      PPPP +  SPP
Sbjct: 260 PSPPPPSVSPSPPPPSL---SPSPPPPSLSPSPPPPSLSPSPP 299

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 52/117 (44%), Positives = 58/117 (49%), Gaps = 14/117 (11%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPP-------PPYVYPSPPPPSPPPPYIYKSPP 159
            PP +A S S    ++  P  +   P  PPP       PP   PSPPPPSPPPP    SPP
Sbjct: 1692 PPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPP 1751

Query: 160  P------PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSP-PPPPYVYKSPP 309
            P      PP    SP PPP   +  PPPP    SPPPP     SP PPPP +  SPP
Sbjct: 1752 PSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPS---ASPSPPPPSLSPSPP 1805

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 46/92 (50%), Positives = 49/92 (53%), Gaps = 14/92 (15%)
 Frame = +1

Query: 79  SPP--PPPYVYPSPPPPS----PPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
           SPP  PPP   PSPPPPS    PPPP +  SPPPP     SP PPP   +  PPPP V  
Sbjct: 213 SPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSI---SPSPPPPSLSPSPPPPSVSP 269

Query: 241 SP--------PPPPYVYKSPPPPPYVYKSPPS 312
           SP        PPPP +  SPPPP      PPS
Sbjct: 270 SPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPS 301

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 50/110 (45%), Positives = 54/110 (49%), Gaps = 6/110 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP----PSPPPPYIYKSPPPPP 168
           PP ++ S  P      +PS    S    PPPP + PSPPP    PSPPPP    SPPPP 
Sbjct: 304 PPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPS 363

Query: 169 YVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPP--PPYVYKSPPS 312
               SP PPP      PPPP    SPPPP     SPPP  PP     PPS
Sbjct: 364 L---SPSPPPATPPPSPPPP----SPPPPLPPPPSPPPPLPPPPIPPPPS 406

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 51/106 (48%), Positives = 55/106 (51%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
            PP S    SP  S   +P      P   PPPP + PSPPPP  SP PP    SP PPP  
Sbjct: 1737 PPPSPPPPSPPPSPPPSP------PPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPS 1790

Query: 175  YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSP-PPPPYVYKSPP 309
             +  PPPP +  SPPPP     SPPPPP    SP PPPP    SPP
Sbjct: 1791 ASPSPPPPSLSPSPPPPS-TSPSPPPPP---ASPSPPPPSASPSPP 1832

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 50/102 (49%), Positives = 52/102 (50%), Gaps = 3/102 (2%)
 Frame = +1

Query: 13  AVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPP- 189
           A S SP   +   PS    SP   PPPP   PSPPPPSPPPP      PPPP    SPP 
Sbjct: 675 APSPSPPPPSPPPPSP---SPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPP 731

Query: 190 -PPPYVYNSPPPPPYVYKSPPPP-PYVYKSPPPPPYVYKSPP 309
            PPP    SPPPP     +PPPP P     P PPP    SPP
Sbjct: 732 SPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPP 773

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 45/104 (43%), Positives = 51/104 (49%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP     S P S     P     SP  P PPP   P+PPPP+PPPP    SPPPP  +  
Sbjct: 957  PPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPP---PAPPPPNPPPP----SPPPPLPLPP 1009

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
             P PPP +   P PPP +   P PPP    SPPP P     PP+
Sbjct: 1010 PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPT 1053

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 46/105 (43%), Positives = 50/105 (47%), Gaps = 1/105 (0%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP S   S P S     P      P +PPPP    P+PPPPSPPPP     PP PP    
Sbjct: 965  PPPSPPPSPPPSPPPSPP------PPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLP 1018

Query: 181  SPP-PPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
             PP PPP +   P PPP    SPPP P     PP PP     PP+
Sbjct: 1019 PPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPA 1063

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 51/110 (46%), Positives = 57/110 (51%), Gaps = 6/110 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPP-PPPYVYPSPPPP----SPPPPYIYKSPPPP 165
           PP  ++S SP  S    P     SP  PP PPP   PSPPPP    SPPPP +  SPPPP
Sbjct: 289 PPPPSLSPSPPPS----PPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPP 344

Query: 166 PYVYNSPPPPPYVYNSPPPPPYVYKSPPP-PPYVYKSPPPPPYVYKSPPS 312
                SP PPP  ++  PPPP +  SPPP  P     PP PP     PPS
Sbjct: 345 SL---SPSPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPSPPPPLPPPPS 391

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 51/111 (45%), Positives = 59/111 (53%), Gaps = 6/111 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP----SPPPPYIYKSPPP-- 162
           PP SA  S P  S   +P    +SP   PPPP + PSPPPP    SPPPP +  SPPP  
Sbjct: 315 PPPSASPSPPPPSLSPSPPPPSLSP--SPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPAT 372

Query: 163 PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPSC 315
           PP     P PPP +   P PPP +   P PPP    SPPPPP    +P +C
Sbjct: 373 PPPSPPPPSPPPPLPPPPSPPPPLPPPPIPPP---PSPPPPPPPPLAPFTC 420

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 44/104 (42%), Positives = 52/104 (50%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP S    +P       P+     P SPPPP    P+PPPP+PPPP    SPPPP  +  
Sbjct: 776  PPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPP----SPPPPLPLPP 831

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
             P PPP +   P PPP +   P PPP    SPPP P     PP+
Sbjct: 832  PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPT 875

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 44/104 (42%), Positives = 52/104 (50%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP S    +P       P+     P SPPPP    P+PPPP+PPPP    SPPPP  +  
Sbjct: 1045 PPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP----SPPPPLPLPP 1100

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
             P PPP +   P PPP +   P PPP    SPPP P     PP+
Sbjct: 1101 PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPT 1144

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 47/105 (44%), Positives = 51/105 (48%), Gaps = 2/105 (1%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP +   S P S    TP      P +PPPP    P PPPPSPPPP     PP PP    
Sbjct: 1151 PPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPP--LPPPPLPPPPVP 1208

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPP--PPPYVYKSPP 309
             PP PP +   P PPP +   P PPP    SPP  PPP    SPP
Sbjct: 1209 PPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPP 1253

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 45/106 (42%), Positives = 49/106 (46%), Gaps = 2/106 (1%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTK--ITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYV 174
            PP S   S P  S    + P  +   P  PP PP   P  PPPSPPPP      PPPP  
Sbjct: 697  PPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAP 756

Query: 175  YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
              +PPP P     P PPP    SPPPP     +PPPP      PPS
Sbjct: 757  PPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPS 802

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 44/107 (41%), Positives = 48/107 (44%), Gaps = 3/107 (2%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP     + P +     P     SP   PPP    P+PPPP+PPPP    SPPP P    
Sbjct: 748  PPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPT 807

Query: 181  SPPPPPYVYNSP---PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
             PPP P   N P   PPPP     PP PP     PP PP     PPS
Sbjct: 808  PPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPS 854

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 44/104 (42%), Positives = 47/104 (45%), Gaps = 1/104 (0%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP    S  P+      PS    +P  P PPP   P  PPPSPPPP      PPPP    
Sbjct: 761  PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPP 820

Query: 181  SPPPPPYVYNSPPPPPYVYKSPP-PPPYVYKSPPPPPYVYKSPP 309
              PPPP     PP PP     PP PPP +   P PPP    SPP
Sbjct: 821  PSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPP 864

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 43/103 (41%), Positives = 50/103 (48%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP +    +P  S   +P      P +PPPP    P+PPPPSPPPP     PP PP    
Sbjct: 877  PPPAPPPPAPPPSPPPSPP-----PPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLP 931

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             PP PP     PP PP +   P PPP +   P PPP    SPP
Sbjct: 932  PPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPP 974

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 44/104 (42%), Positives = 47/104 (45%), Gaps = 1/104 (0%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP    S  P+      PS    +P  P PPP   P  PPPSPPPP      PPPP    
Sbjct: 1030 PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPP 1089

Query: 181  SPPPPPYVYNSPPPPPYVYKSPP-PPPYVYKSPPPPPYVYKSPP 309
              PPPP     PP PP     PP PPP +   P PPP    SPP
Sbjct: 1090 PSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPP 1133

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/103 (44%), Positives = 50/103 (48%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP S    +  S + + PS     P  PPP P   P+PPPP PPPP    SPPPP     
Sbjct: 1687 PPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPP-PNPPPPLPPPP-SPPSPPPPSPPPP 1744

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            SPPP P     PP PP    SP PPP      PPPP    SPP
Sbjct: 1745 SPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPP 1787

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/105 (41%), Positives = 51/105 (48%), Gaps = 1/105 (0%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP +    +P  S   +P      P +PPPP    P+PPPPSPPPP     PP PP    
Sbjct: 786  PPPAPPPPTPPPSPPPSPP-----PPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLP 840

Query: 181  SPP-PPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
             PP PPP +   P PPP    SPPP P     PP PP     PP+
Sbjct: 841  PPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPA 885

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/105 (41%), Positives = 51/105 (48%), Gaps = 1/105 (0%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP +    +P  S   +P      P +PPPP    P+PPPPSPPPP     PP PP    
Sbjct: 1055 PPPAPPPPAPPPSPPPSPP-----PPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLP 1109

Query: 181  SPP-PPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
             PP PPP +   P PPP    SPPP P     PP PP     PP+
Sbjct: 1110 PPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPA 1154

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/105 (43%), Positives = 48/105 (45%), Gaps = 1/105 (0%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP     S P S     P      P  PP PP   P+PPPP+PPPP    SPPP P    
Sbjct: 1116 PPLPPPPSPPPSPPPSPP------PSPPPSPPP--PTPPPPAPPPPAPPPSPPPSPPPPT 1167

Query: 181  SPPPPPYVYNSPPP-PPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
             PPP P   N PPP PP     PP PP     PP PP     PPS
Sbjct: 1168 PPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPS 1212

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 48/96 (50%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = +1

Query: 37   STKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPP---PYVY 207
            S    PS     P  PPP P   PSPPPPSPPP     SPPPP     SPPPP   P V 
Sbjct: 1527 SVDCVPSPSPPPPSPPPPSPSPPPSPPPPSPPP-----SPPPP-----SPPPPLPPPPVP 1576

Query: 208  NSPPPPPYVYKSPPPPPYVYKSP-PPPPYVYKSPPS 312
             SP PPP    SPPP P     P PPPP     PPS
Sbjct: 1577 PSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPS 1612

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 52/118 (44%), Positives = 55/118 (46%), Gaps = 14/118 (11%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTK--ITPSGIGVSPFSPP-PPPYVYPSPPP---PSPPPPYIYKSPP- 159
            PP S   S P  S    + P  +  SP  PP PPP   PSPPP   PSPPPP     PP 
Sbjct: 1553 PPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPS 1612

Query: 160  -----PPPYVYNSPPPPPYVYNSPPPPPYVYKSPP--PPPYVYKSPPPPPYVYKSPPS 312
                 PPP V   P PPP      PPPP    SPP  PPP    SPPP P     PP+
Sbjct: 1613 PPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPT 1670

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 43/103 (41%), Positives = 46/103 (44%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP    S  P+      PS    +P  P PPP   P  PPPSPPP      PP PP    
Sbjct: 722  PPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPP 781

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             P PPP     P PPP    SPPPP     +PPPP     SPP
Sbjct: 782  PPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 824

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 45/106 (42%), Positives = 48/106 (45%), Gaps = 2/106 (1%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP S   S P S    TP      P +PPP P   P P PP  PPP    SPPPP     
Sbjct: 729  PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPP 788

Query: 181  SPPPPPYVYNSP--PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            +PPPP    + P  PPPP      PPPP      PPPP     PPS
Sbjct: 789  APPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPS 834

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 49/112 (43%), Positives = 52/112 (46%), Gaps = 9/112 (8%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP--PYVYPSPPPPSPPPPYIYKSPPPPPYV 174
            PP S   S P S    TP      P +PPPP  P   P PPPPSPPPP +   P PPP +
Sbjct: 969  PPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPP-LPPPPLPPPPL 1027

Query: 175  YNSPPPPPYVYNSPPPPPYVYKSPP-------PPPYVYKSPPPPPYVYKSPP 309
               P PPP    SPPP P     PP       PPP    SPPP P     PP
Sbjct: 1028 PPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPP 1079

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 47/108 (43%), Positives = 50/108 (46%), Gaps = 5/108 (4%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP    S  P +     P      P SPPPP    PSPPPP PPPP      PPPP    
Sbjct: 1156 PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPP 1215

Query: 181  SPP---PPPYVYNSPPPPPYVYKSPP--PPPYVYKSPPPPPYVYKSPP 309
             PP   PPP +   P PPP    SPP  PPP    SPPPP     +PP
Sbjct: 1216 LPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPP 1263

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 47/98 (47%), Positives = 48/98 (48%), Gaps = 1/98 (1%)
 Frame = +1

Query: 19   SSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPP 198
            S SP   +   PS    SP   PPPP   PSPPPPSPPPP       PPP V  SP PPP
Sbjct: 1533 SPSPPPPSPPPPSP---SPPPSPPPPSPPPSPPPPSPPPPL------PPPPVPPSPLPPP 1583

Query: 199  YVYNSPPPPPYVYKSP-PPPPYVYKSPPPPPYVYKSPP 309
                SPPP P     P PPPP     PP PP     PP
Sbjct: 1584 SPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPP 1621

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 45/95 (47%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = +1

Query: 37  STKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPP---PPPYVYNSPPPPPYVY 207
           S    PS     P  PPP P   PSPPPPSPPP     SPP   PPP +   P PPP   
Sbjct: 671 SVDCAPSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPP 730

Query: 208 NSPPPPPYVYKSPP-PPPYVYKSPPPPPYVYKSPP 309
            SPPP P     PP PPP     P PPP    SPP
Sbjct: 731 PSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPP 765

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 46/110 (41%), Positives = 52/110 (47%), Gaps = 7/110 (6%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP S    +P       P+     P SPPPP    P+PPPP+PPPP    SPPPP     
Sbjct: 1136 PPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP----SPPPPLPPPP 1191

Query: 181  SPPP-------PPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            SPPP       PP     PP PP +   P PPP +   P PPP    SPP
Sbjct: 1192 SPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPP 1241

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 48/112 (42%), Positives = 52/112 (46%), Gaps = 9/112 (8%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP--PYVYPSPPPPSPPPPYIYKSPPPPPYV 174
            PP +   S P S    TP      P +PPPP  P   P PPPPSPPPP +   P PPP +
Sbjct: 791  PPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPP-LPPPPLPPPPL 849

Query: 175  YNSPPPPPYVYNSPPPPPYVYKSPP-------PPPYVYKSPPPPPYVYKSPP 309
               P PPP    SPPP P     PP       PPP    SPPP P     PP
Sbjct: 850  PPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPP 901

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 46/106 (43%), Positives = 49/106 (46%), Gaps = 2/106 (1%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPP--PPPYV 174
            PP +    SP     + P      P SPPPP    P PPPP PPPP    SPP  PPP  
Sbjct: 814  PPPNPPPPSPPPPLPLPP------PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSP 867

Query: 175  YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
              SPPPP     +PPPP      PP PP     PP PP     PPS
Sbjct: 868  PPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPS 913

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 42/97 (43%), Positives = 44/97 (45%), Gaps = 1/97 (1%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP    S  P+      PS    +P  P PPP   P  PPPSPPPP      PPPP    
Sbjct: 852  PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPP 911

Query: 181  SPPPPPYVYNSPPPPPYVYKSPP-PPPYVYKSPPPPP 288
              PPPP     PP PP     PP PPP V   P PPP
Sbjct: 912  PSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPP 948

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 48/112 (42%), Positives = 51/112 (45%), Gaps = 9/112 (8%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYP---SPPPPSPPPPYIYKSPPPPPY 171
            PP S   S P S    TP      P +PPP P   P   +PPPP+PPPP      PPPP 
Sbjct: 859  PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPL 918

Query: 172  VYNSPPPPPYVYNSPP-PPPYVYKSP-----PPPPYVYKSPPPPPYVYKSPP 309
                PP PP     PP PPP V   P     PPPP      PPPP    SPP
Sbjct: 919  PLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPP 970

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 46/106 (43%), Positives = 49/106 (46%), Gaps = 2/106 (1%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPP--PPPYV 174
            PP +    SP     + P      P SPPPP    P PPPP PPPP    SPP  PPP  
Sbjct: 992  PPPNPPPPSPPPPLPLPP------PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSP 1045

Query: 175  YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
              SPPPP     +PPPP      PP PP     PP PP     PPS
Sbjct: 1046 PPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPS 1091

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 48/112 (42%), Positives = 52/112 (46%), Gaps = 9/112 (8%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP--PYVYPSPPPPSPPPPYIYKSPPPPPYV 174
            PP +   S P S    TP      P +PPPP  P   P PPPPSPPPP +   P PPP +
Sbjct: 1060 PPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPP-LPPPPLPPPPL 1118

Query: 175  YNSPPPPPYVYNSPPPPPYVYKSPP-------PPPYVYKSPPPPPYVYKSPP 309
               P PPP    SPPP P     PP       PPP    SPPP P     PP
Sbjct: 1119 PPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPP 1170

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 45/102 (44%), Positives = 48/102 (47%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP S   S P+SS    P        SPP PP   P PPPP PPPP    SPPP P    
Sbjct: 2089 PPPSPPPSLPSSSPSPPPP-------SPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPT 2141

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
             PP PP +   P PPP     P PPP    +PPP P    SP
Sbjct: 2142 PPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSP 2183

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 50/114 (43%), Positives = 53/114 (46%), Gaps = 11/114 (9%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPP--PPYV 174
            PP S    SP+      P     SP  P PPP   P PPPP PPPP    SPPP  PP  
Sbjct: 681  PPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPP---PLPPPPLPPPPLPPPSPPPSPPPSP 737

Query: 175  YNSPPPPPYVYNSPPPP-------PYVYKSPPP--PPYVYKSPPPPPYVYKSPP 309
              SPPPP     +PPPP       P    SPPP  PP    SPPPP     +PP
Sbjct: 738  PPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPP 791

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 52/121 (42%), Positives = 57/121 (47%), Gaps = 18/121 (14%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYI--------YKSP 156
            PP S   S P S + + P      P SPP P    P+PPPPSPPPP           +SP
Sbjct: 1650 PPPSPPPSPPPSPSPLPPPPTPPPP-SPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSP 1708

Query: 157  PPP------PYVYNSPP--PPPYVYNSPPPPPYVYKSPP--PPPYVYKSPPPPPYVYKSP 306
            PPP      P   N PP  PPP    SPPPP     SPP  PPP      PPPP +  SP
Sbjct: 1709 PPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSP 1768

Query: 307  P 309
            P
Sbjct: 1769 P 1769

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 45/111 (40%), Positives = 49/111 (44%), Gaps = 8/111 (7%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPP--PPYVYPSPPP---PSPPPPYIYKSPPPP 165
            PP   +   P+    + P  +   P  PPP  PP   PSPPP   PSPPPP      PPP
Sbjct: 824  PPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPP 883

Query: 166  PYVYNSPPPPPYVYNSP---PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            P    SPPP P     P   PPPP      PPPP     PP PP     PP
Sbjct: 884  PAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPP 934

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 44/100 (44%), Positives = 47/100 (47%), Gaps = 6/100 (6%)
 Frame = +1

Query: 28   PNSSTKITPSGIGVSPFSPPP--PPYVYPSPPP---PSPPPPYIYKSPPPPPYVYNSPPP 192
            P S   + P  +   P  PPP  PP   PSPPP   PSPPPP      PPPP      PP
Sbjct: 943  PPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 1002

Query: 193  PPYVYNSPPPPPYVYKSPP-PPPYVYKSPPPPPYVYKSPP 309
            PP     PP PP     PP PPP +   P PPP    SPP
Sbjct: 1003 PPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPP 1042

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 45/111 (40%), Positives = 49/111 (44%), Gaps = 8/111 (7%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPP--PPYVYPSPPP---PSPPPPYIYKSPPPP 165
            PP   +   P+    + P  +   P  PPP  PP   PSPPP   PSPPPP      PPP
Sbjct: 1002 PPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPP 1061

Query: 166  PYVYNSPPPPPYVYNSP---PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            P    SPPP P     P   PPPP      PPPP     PP PP     PP
Sbjct: 1062 PAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPP 1112

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 45/109 (41%), Positives = 49/109 (44%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPP--PPYVYPSPPP---PSPPPPYIYKSPPPP 165
            PP   +   P+    + P  +   P  PPP  PP   PSPPP   PSPPPP      PPP
Sbjct: 1093 PPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPP 1152

Query: 166  PYVYNSPPPPPYVYNSPPP-PPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            P    SPPP P     PPP PP     PP PP     PP PP     PP
Sbjct: 1153 PAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPP 1201

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 43/98 (43%), Positives = 47/98 (47%), Gaps = 2/98 (2%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP    S  P+      PS    +P  P PPP   P  PPPSPPPP     PPP P   N
Sbjct: 1121 PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPP---TPPPPAPPPPN 1177

Query: 181  SPP--PPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPP 288
             PP  PPP +   P PPP +   P PPP V   P PPP
Sbjct: 1178 PPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPP 1215

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 45/106 (42%), Positives = 49/106 (46%), Gaps = 9/106 (8%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPP--PPYVYPSPPPPSPPPPYIYKSPP----- 159
            PP S  SSSP+      P      P  PPP  PP   P  PPP PPPP    SPP     
Sbjct: 2093 PPPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPPLPPP 2152

Query: 160  --PPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPY 291
              PPP     P PPP    +PPP P    SP PPP +   P PPP+
Sbjct: 2153 PTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPPPH 2198

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 45/105 (42%), Positives = 48/105 (45%), Gaps = 1/105 (0%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP-PPPYIYKSPPPPPYVY 177
            PP S    SP+      P     SP  P PPP + P P PPSP PPP    SPPP P   
Sbjct: 1537 PPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPS 1596

Query: 178  NSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
              P PPP +   PPP P     PPP P     PP PP     PPS
Sbjct: 1597 PPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPS 1641

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 43/103 (41%), Positives = 46/103 (44%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP S   S P S     P  + + P   PPPP   P  PPP  PPP      PPPP    
Sbjct: 1585 PPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPP 1644

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            SPPP P     P PPP     PPPP     +PPPP     SPP
Sbjct: 1645 SPPPSPPPSPPPSPPPSPSPLPPPP-----TPPPPSPPLPSPP 1682

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 46/108 (42%), Positives = 48/108 (44%), Gaps = 4/108 (3%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPP--PPYVYPSP-PPPSPPPPYIYKSPPPPPY 171
            PP +    SP     + P      P  PPP  PP V P P PPP PPPP      PPPP 
Sbjct: 905  PPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPS 964

Query: 172  VYNSPPPPPYVYNSPPPPPYVYKSP-PPPPYVYKSPPPPPYVYKSPPS 312
               SPPP P     P PPP     P PPPP      PPPP     PPS
Sbjct: 965  PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPS 1012

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 44/106 (41%), Positives = 45/106 (42%), Gaps = 2/106 (1%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPP--PPPYV 174
            PP       P S     P     SP  P PPP   P P PP  PPP    SPP  PPP  
Sbjct: 717  PPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSP 776

Query: 175  YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
              SPPPP     +PPPP      PP PP     PP PP     PPS
Sbjct: 777  PPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPS 822

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 51/122 (41%), Positives = 55/122 (45%), Gaps = 19/122 (15%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP--PYVYPSPPPPSPPPPYIYKSPPPPPYV 174
            PP +   S P S    TP      P +PPPP  P   P PPPPSPPPP +   P PPP V
Sbjct: 882  PPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPP-LPPPPLPPPPV 940

Query: 175  YNSP---------------PPPPYVYNSPPP--PPYVYKSPPPPPYVYKSPPPPPYVYKS 303
               P               PPPP    SPPP  PP    SPPPP     +PPPP     S
Sbjct: 941  PPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPS 1000

Query: 304  PP 309
            PP
Sbjct: 1001 PP 1002

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 49/110 (44%), Positives = 49/110 (44%), Gaps = 7/110 (6%)
 Frame = +1

Query: 4    PFSAVSSSPNSSTKITPSGIGVSPFSPPP-PPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            P   V  SP       PS     P SPPP PP   P PPPPSPPPP      PPPP    
Sbjct: 1571 PPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPP 1630

Query: 181  SPPPPPYVYNSPPP------PPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
             PPPP     SPPP      PP    SPPP P     PP PP     PPS
Sbjct: 1631 LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPP-----PPS 1675

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 42/107 (39%), Positives = 46/107 (42%), Gaps = 4/107 (3%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPP---PPSPPPPYIYKSPPPPPY 171
            PP   +   P+    + P  +   P  PPP P   P PP   PP PPPP    SPPP P 
Sbjct: 915  PPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPP 974

Query: 172  VYNSPPPPPYVYNSP-PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
                P PPP     P PPPP      PPPP     PP PP     PP
Sbjct: 975  PSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPP 1021

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 46/99 (46%), Positives = 50/99 (50%), Gaps = 2/99 (2%)
 Frame = +1

Query: 19   SSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPP--P 192
            S  P S    +PS     P   PPP    PSPPPP PPPP +  SP PPP    SPP  P
Sbjct: 1535 SPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPP-VPPSPLPPPSPPPSPPPSP 1593

Query: 193  PPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PP    SPPPP  +   P PPP +   P PPP    SPP
Sbjct: 1594 PPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPP---PSPP 1629

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 42/104 (40%), Positives = 46/104 (44%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP     + P S   + P      P +PPP     PSPPPPSPP P     P P P    
Sbjct: 2134 PPLPPPPTPPPSPPPLPP------PPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPP 2187

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
              PPPP     PPP   +  SPPPPP     PPPP      PPS
Sbjct: 2188 PIPPPPSPPPHPPPQSPLPPSPPPPPPPPPLPPPPSPPPSQPPS 2231

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 47/109 (43%), Positives = 48/109 (44%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSP------PPPPYVYPSPPPPSPPPPYIYKSPPP 162
            PP S   S P S     P     SP  P      PPPP   P PPPP PPPP    SPPP
Sbjct: 1589 PPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPP 1648

Query: 163  PPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             P     P PPP     PPPP     +PPPP     SPP P     SPP
Sbjct: 1649 SPPPSPPPSPPPSPSPLPPPP-----TPPPPSPPLPSPPLPAPPPPSPP 1692

 Score = 73.2 bits (178), Expect = 8e-12
 Identities = 45/104 (43%), Positives = 48/104 (46%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP     S P S     P     SP   PPPP   P  PPP  PPP    SPPPP     
Sbjct: 847  PPLPPPPSPPPSPPPSPPP----SPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPP 902

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            +PPPP     SPPPP  +   P PPP +   P PPP V   PPS
Sbjct: 903  APPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPV-PPPPS 945

 Score = 73.2 bits (178), Expect = 8e-12
 Identities = 46/110 (41%), Positives = 49/110 (44%), Gaps = 7/110 (6%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPP--PPPYV 174
            PP S   S P S    TP      P +PPP P   P PP P PP P     PP  PPP +
Sbjct: 1128 PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPL 1187

Query: 175  YNSPPPPPYVYNSPPPPPYVYKSP-----PPPPYVYKSPPPPPYVYKSPP 309
               P PPP +   P PPP V   P     PPPP      PPPP    SPP
Sbjct: 1188 PPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPP 1237

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 41/97 (42%), Positives = 45/97 (46%), Gaps = 3/97 (3%)
 Frame = +1

Query: 28   PNSSTKITPSGIGVSPFSPPP--PPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPY 201
            PN      P  +   P  PPP  PP + P P PP P PP +   P PPP +   P PPP 
Sbjct: 1176 PNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPS 1235

Query: 202  VYNSPPPPPYVYKSPPPPPYVYKSP-PPPPYVYKSPP 309
               SPPP P     P PPP     P PPPP    SPP
Sbjct: 1236 PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPP 1272

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 39/94 (41%), Positives = 43/94 (45%)
 Frame = +1

Query: 28   PNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVY 207
            P+    + P  +   P  PPP P   P PPPP PPPP +   P PPP    SPPP P   
Sbjct: 1191 PSPPPPLPPPPLPPPPVPPPPSPP--PLPPPPLPPPP-LPPPPSPPPSPPPSPPPSPPPS 1247

Query: 208  NSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              P PPP     P PPP      PPPP     PP
Sbjct: 1248 PPPSPPPPTPPPPAPPPPTPPPSPPPPTPPPPPP 1281

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 41/80 (51%), Positives = 44/80 (55%), Gaps = 2/80 (2%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPP--PPYVYKSPPP 252
           SP PPP   PSPPPPSP PP    SPPPP     SPPP P   + PPP  PP +   P P
Sbjct: 677 SPSPPP---PSPPPPSPSPP---PSPPPP-----SPPPSPPPPSPPPPLPPPPLPPPPLP 725

Query: 253 PPYVYKSPPPPPYVYKSPPS 312
           PP    SPPP P     PP+
Sbjct: 726 PPSPPPSPPPSPPPSPPPPT 745

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 44/103 (42%), Positives = 46/103 (44%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP +    SP       PS     P  P PPP   P PPPPSPPP      PPPP     
Sbjct: 1174 PPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPP---PVPPPPSPPPLPPPPLPPPPLPPPP 1230

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            SPPP P     P PPP    SPPPP     +PPPP      PP
Sbjct: 1231 SPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPP 1273

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 41/105 (39%), Positives = 46/105 (43%), Gaps = 1/105 (0%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPP-PPYVYPSPPPPSPPPPYIYKSPPPPPYVY 177
            PP +    +P   +   P  +   P  PPP PP   P PP P PP P     P PPP   
Sbjct: 1078 PPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPP 1137

Query: 178  NSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
             SPPPP     +PPPP      PP PP     PP PP     PPS
Sbjct: 1138 PSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPS 1182

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 44/107 (41%), Positives = 49/107 (45%), Gaps = 3/107 (2%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP-PPPYIYKSPPPPPYVY 177
            PP   +   P+    + P  +   P  PP PP   P PP P P PPP    SPPP P   
Sbjct: 1602 PPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPS 1661

Query: 178  NSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP--PYVYKSPPS 312
             SP PPP    +PPPP     SPP P     SPPPP  P     PPS
Sbjct: 1662 PSPLPPP---PTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPS 1705

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 44/112 (39%), Positives = 48/112 (42%), Gaps = 9/112 (8%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP--------PPPYIYKSP 156
            PP    S  P+      PS    +P  P PPP   P P PP P        PPP +   P
Sbjct: 962  PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPP 1021

Query: 157  PPPPYVYNSPPPPPYVYNSPPPPPYVYKSPP-PPPYVYKSPPPPPYVYKSPP 309
             PPP +   P PPP    SPPP P     PP PPP     P PPP    SPP
Sbjct: 1022 LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPP 1073

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 46/104 (44%), Positives = 48/104 (46%), Gaps = 1/104 (0%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP-PYVYPSPPPPSPPPPYIYKSPPPPPYVY 177
            PP  A SS         P      P SPPP  P   PSPPPPSPP P     P PPP   
Sbjct: 2071 PPGGAYSSIGGLQLMSVPP-----PPSPPPSLPSSSPSPPPPSPPLP-----PSPPPLPP 2120

Query: 178  NSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
               PPPP    SPPP P     PP PP +   P PPP   +SPP
Sbjct: 2121 PPVPPPPTPPPSPPPLPPPPTPPPSPPPLPPPPTPPP---QSPP 2161

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 44/108 (40%), Positives = 46/108 (42%), Gaps = 5/108 (4%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP----PYVYPSPPP-PSPPPPYIYKSPPPP 165
            P  S   S P  S   +P      P  PPPP    P   PSPPP P P PP      PPP
Sbjct: 1544 PSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPP 1603

Query: 166  PYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            P     PP PP     PP PP     P PPP +   P PPP    SPP
Sbjct: 1604 PLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPP 1651

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 46/109 (42%), Positives = 49/109 (44%), Gaps = 5/109 (4%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPP-PPPYVYPSPPPPSPPPPYIYKSPP-PPPYV 174
            PP     S P S     P      P  PP PPP   P PPPP+PPPP    SPP P P +
Sbjct: 1634 PPLPPPPSPPPSPPPSPP------PSPPPSPPPSPSPLPPPPTPPPP----SPPLPSPPL 1683

Query: 175  YNSPPPPPYVYNSPPP---PPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
               PPP P   N+P P   PP     PP PP     PP PP     PPS
Sbjct: 1684 PAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPS 1732

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 44/104 (42%), Positives = 48/104 (46%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP S   S P S     P     SP SP PPP   P P PP P PP +   PPP P   N
Sbjct: 1638 PPPSPPPSPPPSPPPSPPPSPPPSP-SPLPPPPTPPPPSPPLPSPP-LPAPPPPSPPPPN 1695

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            +P P     +  PPPP      PPPP    +PPPP     SPPS
Sbjct: 1696 APSPSSMPPSQSPPPPLPPPPLPPPP----NPPPPLPPPPSPPS 1735

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 46/108 (42%), Positives = 48/108 (44%), Gaps = 5/108 (4%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPP--PYV 174
            PP S   S P S     P      P  P PPP   P P PP P PP    SPPPP  P  
Sbjct: 1642 PPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPP--PPSPPPPNAPSP 1699

Query: 175  YNSPP---PPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             + PP   PPP +   P PPP     P PPP    SPPPP     SPP
Sbjct: 1700 SSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPP 1747

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 40/84 (47%), Positives = 40/84 (47%), Gaps = 4/84 (4%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPP-PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSP---PPPPYVYK 240
            P  PPPP    PSPPP P P PP    SPPP P     PPP P   N P   PPPP    
Sbjct: 952  PPLPPPPLPPPPSPPPSPPPSPP---PSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLP 1008

Query: 241  SPPPPPYVYKSPPPPPYVYKSPPS 312
             PP PP     PP PP     PPS
Sbjct: 1009 PPPSPPPPLPPPPLPPPPLPPPPS 1032

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 36/77 (46%), Positives = 38/77 (49%)
 Frame = +1

Query: 79   SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPP 258
            SP PPP   PSPP P  PPP      PPPP    SPPP P     PP PP +   P PPP
Sbjct: 2101 SPSPPP---PSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPPLPPPPTPPP 2157

Query: 259  YVYKSPPPPPYVYKSPP 309
                 P PPP    +PP
Sbjct: 2158 QSPPLPSPPPPSPPTPP 2174

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 31/66 (46%), Positives = 34/66 (51%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP S   S P S     P     SP  P PPP   P+PPPP+PPP     SPPPP     
Sbjct: 1228 PPPSPPPSPPPSPPPSPPPSPPPSPPPPTPPP---PAPPPPTPPP-----SPPPP----- 1274

Query: 181  SPPPPP 198
            +PPPPP
Sbjct: 1275 TPPPPP 1280

[141][TOP]
>UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK6_CHLRE
          Length = 738

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 54/103 (52%), Positives = 55/103 (53%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP    SPPPPP    
Sbjct: 216 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPP----SPPPPPPPSP 268

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP    SPPPPP     PPPPP    SPPPP     SPP
Sbjct: 269 PPPPPP----SPPPPPPPRPPPPPPP----SPPPPSPPPPSPP 303

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 54/103 (52%), Positives = 55/103 (53%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP    SPPPP     
Sbjct: 206 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPP----SPPPPSPPPP 258

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP     PPPPP    SPPPPP     PPPPP    SPP
Sbjct: 259 SPPPPPPPSPPPPPPP----SPPPPPPPRPPPPPPP----SPP 293

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/104 (50%), Positives = 54/104 (51%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   P PPPPSPPPP    SPPPPP    
Sbjct: 226 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP-PPPSPPPPPPPRP 284

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            PPPPP    SPPPP     SPPPP     SPPPPP     PPS
Sbjct: 285 PPPPPP----SPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPS 324

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 53/103 (51%), Positives = 54/103 (52%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP    SPPPP     
Sbjct: 196 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPP----SPPPPSPPPP 248

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPPP     PPPPP    SPPPPP     PP
Sbjct: 249 SPPPPSPPPPSPPPPPPPSPPPPPPP----SPPPPPPPRPPPP 287

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 51/103 (49%), Positives = 53/103 (51%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  PPPPP   P PPPPSPPPP   + PPPPP    
Sbjct: 236 PPPSPPPPSPPPPSPPPPSPPPPSP--PPPPPPSPPPPPPPSPPPPPPPRPPPPPP---P 290

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPPP     PP PP     PP
Sbjct: 291 SPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPP 333

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 51/104 (49%), Positives = 52/104 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P+      P      P SPPPP    PSPPPPSPPPP    SPPPPP    
Sbjct: 265 PPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPPPPRP 320

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            PP PP     PPPPP    SPPPPP    SPPPPP     PPS
Sbjct: 321 PPPSPPPPSPPPPPPP----SPPPPP----SPPPPPPPRPPPPS 356

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 49/97 (50%), Positives = 50/97 (51%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPP 198
           S  P S    +P      P SPPPP    PSPPPPSPPPP    SPPPP     SPPPP 
Sbjct: 189 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPPSPPPPS 244

Query: 199 YVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
               SPPPP     SPPPPP     PPPPP     PP
Sbjct: 245 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 281

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 53/105 (50%), Positives = 54/105 (51%), Gaps = 1/105 (0%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP  +    P  S    PS     P  PPPP    PSPPPPSPPPP    SPPPPP    
Sbjct: 325 PPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPP----SPPPPPPPSP 380

Query: 181 SPPPPPY-VYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            PPPPP     SPPPP     SPPPPP    SPPPPP     PPS
Sbjct: 381 PPPPPPRPPPPSPPPPSPPPPSPPPPP--PPSPPPPPPPRPPPPS 423

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 53/103 (51%), Positives = 54/103 (52%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  PPPP    PSPPPPSPPPP    SPPPPP    
Sbjct: 288 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPP-PPPSPPPPP---- 342

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP     PP PP    SPPPP     SPPPPP     PP
Sbjct: 343 SPPPPPPPRPPPPSPP--PPSPPPPSPPPPSPPPPPPPSPPPP 383

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 50/103 (48%), Positives = 51/103 (49%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS     P SPPPPP   P PPPP  PPP    SPPPP     
Sbjct: 241 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPP 300

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPPP     PP PP     PPPPP    SPP
Sbjct: 301 SPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPP----SPP 339

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/103 (48%), Positives = 51/103 (49%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P+      PS     P  PPPPP   PSPPPPSPPPP    SPPPP     
Sbjct: 257 PPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPP--PSPPPPSPPPP----SPPPPSPPPP 310

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP     PP PP     PPPPP    SPPPPP     PP
Sbjct: 311 SPPPPPPPRPPPPSPPPPSPPPPPPP----SPPPPPSPPPPPP 349

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 49/104 (47%), Positives = 50/104 (48%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS     P  PPPP    PSPPPP PP P    SPPPPP    
Sbjct: 293 PPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRP 352

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            PP PP     PP PP     PPPPP    SPPPPP     PPS
Sbjct: 353 PPPSPPPPSPPPPSPPPPSPPPPPPP----SPPPPPPPRPPPPS 392

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 49/104 (47%), Positives = 52/104 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP       P      P SPPPPP   P PPPPSPPPP   + PPP P   +
Sbjct: 303 PPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSP-PPPPSPPPPPPPRPPPPSPPPPS 361

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            PPP P   + PPPPP    SPPPPP     PP PP     PPS
Sbjct: 362 PPPPSPPPPSPPPPPP---PSPPPPPPPRPPPPSPPPPSPPPPS 402

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 48/104 (46%), Positives = 49/104 (47%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP     S P   +   P      P SPPPP    PSPPPPSPPPP     PPPPP    
Sbjct: 330 PPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPP 389

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            P PPP     P PPP    SPPPPP     PP PP     PPS
Sbjct: 390 PPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPS 433

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/103 (49%), Positives = 52/103 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   P P PP PPPP    SPPPPP    
Sbjct: 221 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP----SPPPPP--PP 274

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP     PPPPP    SPPPP     SPPPP     SPP
Sbjct: 275 SPPPPPPPRPPPPPPP----SPPPPSPPPPSPPPPSPPPPSPP 313

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 50/104 (48%), Positives = 51/104 (49%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P   +   PS    SP  P PPP   P PPPP PPPP    SPPPP     
Sbjct: 278 PPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPP----SPPPP----- 328

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPPP    SPPPPP    SPPPPP     PP PP     PPS
Sbjct: 329 SPPPPP--PPSPPPPP----SPPPPPPPRPPPPSPPPPSPPPPS 366

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 49/104 (47%), Positives = 51/104 (49%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P S    +P      P SPPPPP   PSPPPP PP P    SPPPP     
Sbjct: 345 PPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPP--PSPPPPPPPRP-PPPSPPPPSPPPP 401

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPPP     PPPPP      PPPP    SPPPP     SPP+
Sbjct: 402 SPPPPPPPSPPPPPPPRPPPPSPPPP----SPPPPSPPPPSPPA 441

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 45/106 (42%), Positives = 51/106 (48%), Gaps = 6/106 (5%)
 Frame = +1

Query: 10  SAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPY 171
           +A+  S N    ++ + +   P   PPPP   P  PPP      SPPPP    SPPPP  
Sbjct: 170 AALFDSQNDCCPLSQANVPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSP 225

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              SPPPP     SPPPP     SPPPP     SPPPPP     PP
Sbjct: 226 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 271

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 47/103 (45%), Positives = 48/103 (46%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P S    +P      P SPPPP    P PP P PP P     PPPPP    
Sbjct: 280 PPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPP---P 336

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP    SPPPPP     PP PP    SPPPP     SPP
Sbjct: 337 SPPPPP----SPPPPPPPRPPPPSPP--PPSPPPPSPPPPSPP 373

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 42/79 (53%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPP-SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPP 255
           SPPPP    PSPPPP  PPP     SPPPP     SPPPP     SPPPP     SPPPP
Sbjct: 189 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 248

Query: 256 PYVYKSPPPPPYVYKSPPS 312
                SPPPP      PPS
Sbjct: 249 SPPPPSPPPPSPPPPPPPS 267

[142][TOP]
>UniRef100_Q09084 Extensin (Class II) n=1 Tax=Solanum lycopersicum RepID=Q09084_SOLLC
          Length = 322

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/115 (44%), Positives = 59/115 (51%), Gaps = 16/115 (13%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP----------PYVYPSPPPPSPPPP---Y 141
           PP +     P + +  TP     +   PPPP          PY Y SPPPPSP PP   Y
Sbjct: 212 PPPTPSYEHPKTPSHPTPPTPPCNEPPPPPPNSHWEPKPSPPYTYSSPPPPSPSPPPPTY 271

Query: 142 IYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYV---YKSPPPPPYVY 297
            Y SPPPP     SP PPP  Y+SPPPPP  Y++ P PP +   Y SPPPP   Y
Sbjct: 272 YYSSPPPP-----SPSPPPPTYSSPPPPPPFYENIPLPPVIGVSYASPPPPVIPY 321

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/107 (47%), Positives = 57/107 (53%), Gaps = 20/107 (18%)
 Frame = +1

Query: 49  TPSGIGVSPFSPPPPPYV---------YPSPPPP-----SPPPPYIYKSP-PPPPYVYNS 183
           TPS     P SPPPPP           +P+PP P      PPPP  +  P P PPY Y+S
Sbjct: 199 TPSYEHPQPQSPPPPPTPSYEHPKTPSHPTPPTPPCNEPPPPPPNSHWEPKPSPPYTYSS 258

Query: 184 PPPPPYVYNSPPPPPYVYKSPP-----PPPYVYKSPPPPPYVYKSPP 309
           PPPP     SPPPP Y Y SPP     PPP  Y SPPPPP  Y++ P
Sbjct: 259 PPPPS---PSPPPPTYYYSSPPPPSPSPPPPTYSSPPPPPPFYENIP 302

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 48/104 (46%), Positives = 52/104 (50%), Gaps = 10/104 (9%)
 Frame = +1

Query: 28  PNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYI--YKSP-------PPPPYVYN 180
           P + +  TPS       SPPPP   Y  P P SPPPP    Y+ P       PP P    
Sbjct: 177 PKTPSPPTPSYEHPKTPSPPPPTPSYEHPQPQSPPPPPTPSYEHPKTPSHPTPPTPPCNE 236

Query: 181 SPPPPPYVYNSP-PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP  +  P P PPY Y SPPPP     SPPPP Y Y SPP
Sbjct: 237 PPPPPPNSHWEPKPSPPYTYSSPPPPS---PSPPPPTYYYSSPP 277

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 53/132 (40%), Positives = 60/132 (45%), Gaps = 38/132 (28%)
 Frame = +1

Query: 28  PNSSTKITPSGIGVSPFSPPPPPYVYP-SPPPPSPPPPYIY---KSPPPPPY-VY----- 177
           P + +  TPS       SPP P Y +P +P PP P P Y +   +SPPPPP   Y     
Sbjct: 164 PKTPSPPTPSYEHPKTPSPPTPSYEHPKTPSPPPPTPSYEHPQPQSPPPPPTPSYEHPKT 223

Query: 178 -----------NSPPP------------PPYVYNSPPPPPYVYKSPPPPPYVYKSPP--- 279
                      N PPP            PPY Y+SPPPP     SPPPP Y Y SPP   
Sbjct: 224 PSHPTPPTPPCNEPPPPPPNSHWEPKPSPPYTYSSPPPPS---PSPPPPTYYYSSPPPPS 280

Query: 280 --PPPYVYKSPP 309
             PPP  Y SPP
Sbjct: 281 PSPPPPTYSSPP 292

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 49/113 (43%), Positives = 57/113 (50%), Gaps = 9/113 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP--PPPPYVYPSPPPPSPP-PPYIYKSPPPPPY 171
           PP    S S N  +   P    + P +P    P Y + SPPPP+    P  + SPPPP  
Sbjct: 35  PPTWKSSGSHNKRSPPPPKSTPLPPPAPYKKSPTYQHRSPPPPTHKISPVTHHSPPPPSP 94

Query: 172 VYNSP---PPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPP---YVYKSPPS 312
           VY+ P    PPP VY SPPPP Y     PPP Y  KSPPPPP   Y +   PS
Sbjct: 95  VYDHPSPSSPPPPVYYSPPPPVY---HEPPPTYKPKSPPPPPTPSYEHPKTPS 144

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 48/101 (47%), Positives = 55/101 (54%), Gaps = 4/101 (3%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPY 201
           S P  + KI+P    V+  SPPPP  VY  P P SPPPP +Y SPPPP Y     PPP Y
Sbjct: 73  SPPPPTHKISP----VTHHSPPPPSPVYDHPSPSSPPPP-VYYSPPPPVY---HEPPPTY 124

Query: 202 VYNSPPPPP---YVYKSPPPPPYVYKSPPPPPYVY-KSPPS 312
              SPPPPP   Y +   P P      PP P Y + K+PPS
Sbjct: 125 KPKSPPPPPTPSYEHPKTPSP-----LPPTPSYEHPKTPPS 160

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 45/103 (43%), Positives = 48/103 (46%), Gaps = 25/103 (24%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPP-----------SPPPPYIYKSPPP------PPYVYNSPPPP--- 195
           F  P P      PPPP           SPPPP     PPP      P Y + SPPPP   
Sbjct: 21  FEKPKPKPKPRGPPPPTWKSSGSHNKRSPPPPKSTPLPPPAPYKKSPTYQHRSPPPPTHK 80

Query: 196 --PYVYNSPPPPPYVYKSP---PPPPYVYKSPPPPPYVYKSPP 309
             P  ++SPPPP  VY  P    PPP VY SPPPP  VY  PP
Sbjct: 81  ISPVTHHSPPPPSPVYDHPSPSSPPPPVYYSPPPP--VYHEPP 121

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 44/97 (45%), Positives = 49/97 (50%), Gaps = 16/97 (16%)
 Frame = +1

Query: 70  SPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPP---YVYNS-----PPPPPYVYNSP 216
           SP SPPPP Y Y SPPPP    PPP Y  KSPPPPP   Y +       PP P Y +   
Sbjct: 100 SPSSPPPPVY-Y-SPPPPVYHEPPPTYKPKSPPPPPTPSYEHPKTPSPLPPTPSYEHPKT 157

Query: 217 PPPPYVYKSPPPPPYVYK-----SPPPPPYVYKSPPS 312
           PP     K+P PP   Y+     SPP P Y +   PS
Sbjct: 158 PPSHEHPKTPSPPTPSYEHPKTPSPPTPSYEHPKTPS 194

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 43/101 (42%), Positives = 50/101 (49%), Gaps = 21/101 (20%)
 Frame = +1

Query: 73  PFSPPPPP---YVYPSPPPPSPPPPYIYKSPPPPPYVYN----SPPPPPYVY---NSPPP 222
           P SPPPPP   Y +P  P P PP P  Y+ P  PP   +    SPP P Y +    SPP 
Sbjct: 126 PKSPPPPPTPSYEHPKTPSPLPPTP-SYEHPKTPPSHEHPKTPSPPTPSYEHPKTPSPPT 184

Query: 223 PPYVY---KSPPPPPYVY-----KSPPPPP---YVYKSPPS 312
           P Y +    SPPPP   Y     +SPPPPP   Y +   PS
Sbjct: 185 PSYEHPKTPSPPPPTPSYEHPQPQSPPPPPTPSYEHPKTPS 225

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 51/141 (36%), Positives = 55/141 (39%), Gaps = 38/141 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP-------PSPPPPYIYK--- 150
           PP     S P   T         SP  PP P Y +P  PP       PSPP P       
Sbjct: 121 PPTYKPKSPPPPPTPSYEHPKTPSPL-PPTPSYEHPKTPPSHEHPKTPSPPTPSYEHPKT 179

Query: 151 -SPPPPPYVYN---SPPPPPYVYN-----SPPPPPY-VY-----------------KSPP 249
            SPP P Y +    SPPPP   Y      SPPPPP   Y                 + PP
Sbjct: 180 PSPPTPSYEHPKTPSPPPPTPSYEHPQPQSPPPPPTPSYEHPKTPSHPTPPTPPCNEPPP 239

Query: 250 PPPYVYKSP-PPPPYVYKSPP 309
           PPP  +  P P PPY Y SPP
Sbjct: 240 PPPNSHWEPKPSPPYTYSSPP 260

[143][TOP]
>UniRef100_Q9FLQ7 Formin-like protein 20 n=1 Tax=Arabidopsis thaliana RepID=FH20_ARATH
          Length = 1615

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/115 (46%), Positives = 58/115 (50%), Gaps = 13/115 (11%)
 Frame = +1

Query: 4    PFSAVSSSPNSSTKITPSGIGVSPFS-------PPPPPYVYPSPPPPSPPPPYIYKSPPP 162
            P   +SS+P+   K  P      PFS       PPPP Y  P PPPP PP       PPP
Sbjct: 902  PLHGISSAPSPPVKTAPPPPPPPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPP 961

Query: 163  PPYVYNSPPPPPYV---YNSPPPPPYVYKSPPPPPYVYKSPPPPP-YVYKS--PP 309
            PP  Y SPPPPP     Y SPPPPP     PPPP Y    PPPPP + + S  PP
Sbjct: 962  PPPSYGSPPPPPPPPPGYGSPPPPP-----PPPPSYGSPPPPPPPPFSHVSSIPP 1011

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 57/119 (47%), Positives = 61/119 (51%), Gaps = 16/119 (13%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSP---------PPPYIYKS 153
            PP    S +P+ S KI P   G+S  +P PP    P PPPP P         PPP  Y S
Sbjct: 885  PPLPYTSIAPSPSVKILPLH-GISS-APSPPVKTAPPPPPPPPFSNAHSVLSPPPPSYGS 942

Query: 154  PPPPPYVYNSPPPPPYVYNSPPPPPY-VYKSPPPPPYV---YKS---PPPPPYVYKSPP 309
            PPPPP     PPPP Y    PPPPP   Y SPPPPP     Y S   PPPPP  Y SPP
Sbjct: 943  PPPPP-----PPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYGSPP 996

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 47/87 (54%), Positives = 50/87 (57%), Gaps = 14/87 (16%)
 Frame = +1

Query: 70   SPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPY---VYNSPPPPP-----YVYNSPPPP 225
            SP  PPPPP  Y SPPPP PPPP  Y SPPPPP     Y SPPPPP     +V + PPPP
Sbjct: 955  SPPPPPPPPPSYGSPPPPPPPPPG-YGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPPP 1013

Query: 226  P------YVYKSPPPPPYVYKSPPPPP 288
            P           PPPPP    +PPPPP
Sbjct: 1014 PPPPMHGGAPPPPPPPPMHGGAPPPPP 1040

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 40/79 (50%), Positives = 45/79 (56%), Gaps = 6/79 (7%)
 Frame = +1

Query: 70   SPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN------SPPPPPYVYNSPPPPPY 231
            SP  PPPPP  Y SPPPP PPPP     PPPPP  ++       PPPPP ++   PPPP 
Sbjct: 968  SPPPPPPPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPP- 1026

Query: 232  VYKSPPPPPYVYKSPPPPP 288
                PPPP +    PPPPP
Sbjct: 1027 ----PPPPMHGGAPPPPPP 1041

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 48/114 (42%), Positives = 56/114 (49%), Gaps = 18/114 (15%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSG-----------IGVSPFSPPPPPYVYPSPPPPSPPPPYIY 147
            PPFS VSS P         G            G +P  PPPPP    +PPPP PPP +  
Sbjct: 1001 PPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGG 1060

Query: 148  KSPPPPPYVYNS---PPPPPYVYNSPPPPPYVYKS----PPPPPYVYKSPPPPP 288
              PPPPP ++     PPPPP    +PPPPP   +     PPPPP    +PPPPP
Sbjct: 1061 APPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPP 1114

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 44/86 (51%), Positives = 51/86 (59%), Gaps = 7/86 (8%)
 Frame = +1

Query: 52   PSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKS----PPPPPYVYNS---PPPPPYVYN 210
            P G G SP  PPPPP  Y SPPPP PPPP+ + S    PPPPP ++     PPPPP ++ 
Sbjct: 976  PPGYG-SPPPPPPPPPSYGSPPPP-PPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHG 1033

Query: 211  SPPPPPYVYKSPPPPPYVYKSPPPPP 288
              PPPP     PPPP +    PPPPP
Sbjct: 1034 GAPPPP-----PPPPMHGGAPPPPPP 1054

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 42/94 (44%), Positives = 52/94 (55%), Gaps = 14/94 (14%)
 Frame = +1

Query: 70   SPFSPPPPPYVYPS--PPPPSPPPPYIYKSPPPPPYVYNS-----PPPPPYVYNSPPPPP 228
            SP  PPPPP+ + S  PPPP PPP +    PPPPP   +      PPPPP    +PPPPP
Sbjct: 994  SPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPP 1053

Query: 229  ----YVYKSPPPPPYVY---KSPPPPPYVYKSPP 309
                +    PPPPP ++   + PPPPP    +PP
Sbjct: 1054 PPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPP 1087

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 38/82 (46%), Positives = 46/82 (56%), Gaps = 7/82 (8%)
 Frame = +1

Query: 64   GVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNS---PPPPPYVYNSPPPPPYV 234
            G +P  PPPPP ++   PPP PPP +    PPPPP +      PPPPP    +PPPPP  
Sbjct: 1046 GGAPPPPPPPP-MHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPP 1104

Query: 235  YKS----PPPPPYVYKSPPPPP 288
             +     PPPPP    +PPPPP
Sbjct: 1105 MRGGAPPPPPPPMHGGAPPPPP 1126

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 56/163 (34%), Positives = 63/163 (38%), Gaps = 60/163 (36%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPY---------------VYPSPPPPSPPP 135
            PPF++V    NS T + P         PPPPP+                  SPPPP PPP
Sbjct: 818  PPFASVRR--NSETLLPPP--------PPPPPWKSLYASTFETHEACSTSSSPPPPPPPP 867

Query: 136  PYI---------YKSPPPP-------------------------PYVYNSPPPPP----- 198
            P+          Y  PPPP                         P V  +PPPPP     
Sbjct: 868  PFSPLNTTKANDYILPPPPLPYTSIAPSPSVKILPLHGISSAPSPPVKTAPPPPPPPPFS 927

Query: 199  --YVYNSPPPPPY-VYKSPPPPPYVYKS---PPPPPYVYKSPP 309
              +   SPPPP Y     PPPPP  Y S   PPPPP  Y SPP
Sbjct: 928  NAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPP 970

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 38/84 (45%), Positives = 44/84 (52%), Gaps = 8/84 (9%)
 Frame = +1

Query: 82   PPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNS---PPPPPYVYNSPPPPP-----YVY 237
            PPPPP    +PPPP PPP      PPPPP ++     PPPPP    +PPPPP        
Sbjct: 1088 PPPPPMRGGAPPPP-PPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPG 1146

Query: 238  KSPPPPPYVYKSPPPPPYVYKSPP 309
              PPPPP   ++P PPP     PP
Sbjct: 1147 APPPPPPPGGRAPGPPPPPGPRPP 1170

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 58/175 (33%), Positives = 64/175 (36%), Gaps = 74/175 (42%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFS------------PPPPPYVYPS---------PP 117
            PPFS  S  PNS T + P      PFS            PPPPP  + S         PP
Sbjct: 675  PPFS--SERPNSGTVLPPPPPPPPPFSSERPNSGTVLPPPPPPPLPFSSERPNSGTVLPP 732

Query: 118  PPSPPPPYIYKS-------------------PPPPPYVYNS-----------------PP 189
            PPSPP   +Y S                   PPPPP  Y S                 PP
Sbjct: 733  PPSPPWKSVYASALAIPAICSTSQAPTSSPTPPPPPPAYYSVGQKSSDLQTSQLPSPPPP 792

Query: 190  PPPYVYNS---------PPPPPYVYKSPPPPPY--------VYKSPPPPPYVYKS 303
            PPP  + S         PPPPP     PPPPP+            PPPPP  +KS
Sbjct: 793  PPPPPFASVRRNSETLLPPPPP-----PPPPPFASVRRNSETLLPPPPPPPPWKS 842

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 36/78 (46%), Positives = 42/78 (53%), Gaps = 9/78 (11%)
 Frame = +1

Query: 82   PPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNS--PPPPPYVYNS---PPPPPYVYKSP 246
            PPPPP +    PPP PPP      PPPPP +     PPPPP ++     PPPPP    +P
Sbjct: 1075 PPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAP 1134

Query: 247  PPPP----YVYKSPPPPP 288
            PPPP        +PPPPP
Sbjct: 1135 PPPPPPGGRGPGAPPPPP 1152

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 46/120 (38%), Positives = 54/120 (45%), Gaps = 21/120 (17%)
 Frame = +1

Query: 16  VSSSPNSSTKITPSGIG-VSPFSPPPP--------------PYVYPSPPPPSPPPPYIYK 150
           + SSP+SS K TPS +   SP   PPP                   SPPPP PPPP    
Sbjct: 600 ICSSPDSSPKETPSSLPPASPHQAPPPLPSLTSEAKTVLHSSQAVASPPPPPPPPPL--- 656

Query: 151 SPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP------PPPPYVYKSPPPPPYVYKSPPS 312
            P    Y  +  PPPP     PPPPP+  + P      PPPP     PPPPP+  + P S
Sbjct: 657 -PTYSHYQTSQLPPPP-----PPPPPFSSERPNSGTVLPPPP-----PPPPPFSSERPNS 705

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 48/129 (37%), Positives = 60/129 (46%), Gaps = 26/129 (20%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYV-----YPS---PPPPSPPPPYIYKSP 156
           PP  +++S   + T +  S    SP  PPPPP +     Y +   PPPP PPPP+  + P
Sbjct: 625 PPLPSLTSE--AKTVLHSSQAVASPPPPPPPPPLPTYSHYQTSQLPPPPPPPPPFSSERP 682

Query: 157 ------PPPPYVYNSPPPPPYVYNSP------PPPPYVYKSPPPPPYVYKSP------PP 282
                 PPPP     PPPPP+    P      PPPP     PPP P+  + P      PP
Sbjct: 683 NSGTVLPPPP-----PPPPPFSSERPNSGTVLPPPP-----PPPLPFSSERPNSGTVLPP 732

Query: 283 PPYVYKSPP 309
           PP    SPP
Sbjct: 733 PP----SPP 737

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 34/78 (43%), Positives = 37/78 (47%), Gaps = 3/78 (3%)
 Frame = +1

Query: 64   GVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKS 243
            G +P  PPPP  ++   PPP PPP      PPPPP     P  PP     PPPP      
Sbjct: 1107 GGAPPPPPPP--MHGGAPPPPPPPMRGGAPPPPPPPGGRGPGAPP----PPPPPGGRAPG 1160

Query: 244  PPPPPYVYK---SPPPPP 288
            PPPPP        PPPPP
Sbjct: 1161 PPPPPGPRPPGGGPPPPP 1178

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 43/133 (32%), Positives = 50/133 (37%), Gaps = 63/133 (47%)
 Frame = +1

Query: 82   PPPPPYVYPS---------PPPPSPPPPY---------IYKSPPPPPYVYNS-------- 183
            PPPPP  + S         PPPP PPPP+         +   PPPPP  ++S        
Sbjct: 670  PPPPPPPFSSERPNSGTVLPPPPPPPPPFSSERPNSGTVLPPPPPPPLPFSSERPNSGTV 729

Query: 184  ---PPPPPY--VYNS-------------------PPPPPYVYKS-------------PPP 252
               PP PP+  VY S                   PPPPP  Y S             P P
Sbjct: 730  LPPPPSPPWKSVYASALAIPAICSTSQAPTSSPTPPPPPPAYYSVGQKSSDLQTSQLPSP 789

Query: 253  PPYVYKSPPPPPY 291
            PP     PPPPP+
Sbjct: 790  PP----PPPPPPF 798

[144][TOP]
>UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium
           modesticaldum Ice1 RepID=B0TGJ1_HELMI
          Length = 256

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/105 (45%), Positives = 52/105 (49%), Gaps = 2/105 (1%)
 Frame = +1

Query: 1   PP--FSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYV 174
           PP  +  V  +P +  +I P      P  PPPPP   P PPPP PPPP     PPPPP  
Sbjct: 5   PPTGYPKVPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 175 YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              PPPPP     PPPPP     PPPPP     PPPPP     PP
Sbjct: 65  RPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPP 109

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 42/81 (51%), Positives = 43/81 (53%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 42  PPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPP----PPPPPPPPPPPPPPPPPPPPPPPP 97

Query: 253 PPYVYKSPPPPPYVYKSPPSC 315
           PP   +  PPPP     PP C
Sbjct: 98  PPPPPRPCPPPPPARPCPPPC 118

 Score = 73.2 bits (178), Expect = 8e-12
 Identities = 38/69 (55%), Positives = 38/69 (55%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPY 261
           PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPPPP 
Sbjct: 68  PPPPP---PPPPPPPPPPP-----PPPPP----PPPPPP----PPPPPPPPRPCPPPPPA 111

Query: 262 VYKSPPPPP 288
               PP PP
Sbjct: 112 RPCPPPCPP 120

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 36/74 (48%), Positives = 37/74 (50%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPP      P P
Sbjct: 70  PPPPPPPPPPPPPPPPPPPPPP-----PPPPP-----PPPPPPRPCPPPPPARPCPPPCP 119

Query: 253 PPYVYKSPPPPPYV 294
           P +    P P P V
Sbjct: 120 PKHECGLPEPCPQV 133

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 34/75 (45%), Positives = 34/75 (45%)
 Frame = +1

Query: 91  PPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYK 270
           PP  YP  P     P  I   PPPPP     PPPPP     PPPPP     PPPPP    
Sbjct: 5   PPTGYPKVPYTPIAPERII--PPPPP-----PPPPP-----PPPPPPPPPPPPPPPPPPP 52

Query: 271 SPPPPPYVYKSPPSC 315
            PPPPP     P  C
Sbjct: 53  PPPPPPPPPPPPRPC 67

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 32/75 (42%), Positives = 33/75 (44%), Gaps = 3/75 (4%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK---S 243
           P  PPPPP   P PPPP PPPP     PPPP      P PP +    P P P V      
Sbjct: 80  PPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPCPPKHECGLPEPCPQVEPIAGE 139

Query: 244 PPPPPYVYKSPPPPP 288
           P P P     P P P
Sbjct: 140 PMPIPPCAPMPMPMP 154

[145][TOP]
>UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f.
           nagariensis RepID=Q9SBM1_VOLCA
          Length = 409

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 52/105 (49%), Positives = 53/105 (50%), Gaps = 2/105 (1%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P+ S    P      P  PPPPP   PSPPPP PPPP    SPPPPP    
Sbjct: 74  PPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPP---- 129

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPP--PPPYVYKSPP 309
            PPPPP   N PPPPP    SP PPP    SPP  PPP    SPP
Sbjct: 130 -PPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPP 173

 Score = 89.7 bits (221), Expect(2) = 5e-17
 Identities = 44/81 (54%), Positives = 44/81 (54%)
 Frame = +1

Query: 70  SPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPP 249
           SP  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PP
Sbjct: 84  SPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPP-----PPPPPPPSPPPPPPP----PPP 134

Query: 250 PPPYVYKSPPPPPYVYKSPPS 312
           PPP     PPPPP     PPS
Sbjct: 135 PPPNPPPPPPPPPPSPSPPPS 155

 Score = 21.2 bits (43), Expect(2) = 5e-17
 Identities = 9/20 (45%), Positives = 10/20 (50%)
 Frame = +2

Query: 2   HRSPPSHLHPTPPQK*HPPA 61
           H  PP    P PPQ   PP+
Sbjct: 65  HPPPPPPPPPPPPQPPLPPS 84

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 47/92 (51%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +1

Query: 49  TPSGIGVSPFSPPPPPY-----VYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNS 213
           TPSG    P  PPPPP      + PSP PP PPPP +   PPPPP     PPPPP     
Sbjct: 59  TPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPP----PPPPPPSPPPP 114

Query: 214 PPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPPPP    SPPPPP     PPPPP     PP
Sbjct: 115 PPPPPPPPPSPPPPP-----PPPPPPPPNPPP 141

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 42/79 (53%), Positives = 43/79 (54%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   PSPPPP PPPP    +PPPPP     PPPPP     P PPP    SPPP
Sbjct: 112 PPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPP-----PPPPPSPSPPPSPPPSPPPSPPP 166

Query: 253 PPYVYKSPPPPPYVYKSPP 309
            P     P PPP    SPP
Sbjct: 167 SPPPSPPPSPPPSPPPSPP 185

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 46/103 (44%), Positives = 46/103 (44%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP     S P       P      P  PPPP    P PPPP PPP      PPPPP   N
Sbjct: 79  PPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPN 138

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP    SP PPP    SPPP P     P PPP    SPP
Sbjct: 139 PPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 181

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 41/79 (51%), Positives = 41/79 (51%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP    SPPP P     P PPP    SPPP
Sbjct: 115 PPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPP 174

Query: 253 PPYVYKSPPPPPYVYKSPP 309
            P     P PPP    SPP
Sbjct: 175 SPPPSPPPSPPPRPPPSPP 193

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 47/99 (47%), Positives = 49/99 (49%), Gaps = 5/99 (5%)
 Frame = +1

Query: 28  PNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPP-----PPYIYKSPPPPPYVYNSPPP 192
           P S    TP   GV P +P  P +  P PPPP PP     PP     PPPPP V   PPP
Sbjct: 43  PGSPPPGTPPP-GVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPP 101

Query: 193 PPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PPPPP    SPPPPP     PP
Sbjct: 102 PP----PPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPP 136

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 45/103 (43%), Positives = 45/103 (43%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P S     P      P  PPPPP   P PP P PPPP    SP PPP    
Sbjct: 99  PPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPP 158

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPP P     P PPP    SPPP P     P PPP    SPP
Sbjct: 159 SPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPP 201

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 47/105 (44%), Positives = 47/105 (44%), Gaps = 2/105 (1%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P  S    P      P SPPPPP   P PPP  PPPP     PPPPP    
Sbjct: 98  PPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPP-----PPPPPSPSP 152

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPP--PPPYVYKSPP 309
            P PPP    SPPP P     P PPP    SPP  PPP    SPP
Sbjct: 153 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPP 197

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 45/104 (43%), Positives = 46/104 (44%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P S     P      P  PPPPP   PSP PP  PPP    SPPP P    
Sbjct: 113 PPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSP 172

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            P PPP    SPPP P     P PPP    SPPP P    +PPS
Sbjct: 173 PPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPS 216

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 47/95 (49%), Positives = 51/95 (53%), Gaps = 1/95 (1%)
 Frame = +1

Query: 25  SPNSSTKITPSGIGVSPFSPPP-PPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPY 201
           SPN  +   PS    SP  PP  PP+  PSPPPP PPPP    +PPPP     SPPPP  
Sbjct: 211 SPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPP----APPPPRPPPPSPPPPLP 266

Query: 202 VYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
              SPPPP     SPPPP     SPPPP  +  SP
Sbjct: 267 PPPSPPPPLPPPPSPPPP-----SPPPPSPLPPSP 296

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/103 (42%), Positives = 50/103 (48%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   + + PS     P  P PP   +P PPPP+PPPP   + PPP P    
Sbjct: 277 PPPSPPPPSPPPPSPLPPSP---RPPKPSPPNNPFPRPPPPNPPPP---RPPPPSPNPPR 330

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPP P     PPP P   + PPP P   K PPPPP     PP
Sbjct: 331 PPPPSPPPPRPPPPSPNPPRPPPPSPSPPK-PPPPPSPPPRPP 372

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 44/103 (42%), Positives = 44/103 (42%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP     S P       P      P  PPPPP     PPPP PPPP     P PPP    
Sbjct: 103 PPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPP 162

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPP P     P PPP    SPPP P     P PPP    SPP
Sbjct: 163 SPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPP 205

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 47/104 (45%), Positives = 49/104 (47%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PPF   S  P       P      P SPPPP    PSPPPP PPPP    SPPPP     
Sbjct: 234 PPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPP----SPPPP----- 284

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPP  +  SP PP     SPP  P+    PP PP     PPS
Sbjct: 285 SPPPPSPLPPSPRPPK---PSPPNNPFPRPPPPNPPPPRPPPPS 325

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 46/106 (43%), Positives = 49/106 (46%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPP---PPSPPPPYIYKSPPPPPY 171
           PP    S  P       PS     P SPPP P   P+PP   PPSP PP     P  PP+
Sbjct: 177 PPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPF 236

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              SPPPP     +PPPP     SPPPP     SPPPP     SPP
Sbjct: 237 PPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPP 282

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 47/104 (45%), Positives = 51/104 (49%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP     S    S +  P      P SPPPP    P+PPPP PPPP    SPPPP     
Sbjct: 214 PPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPP----SPPPPLPPPP 269

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPP     SPPPP     SPPPP  +  SP PP     SPP+
Sbjct: 270 SPPPPLPPPPSPPPP-----SPPPPSPLPPSPRPPK---PSPPN 305

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 39/80 (48%), Positives = 40/80 (50%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P SP PPP   PSPPP  PP P     P PPP    SPPP P     P PPP    SPPP
Sbjct: 147 PPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPP 206

Query: 253 PPYVYKSPPPPPYVYKSPPS 312
            P    +PP P     SPPS
Sbjct: 207 RPPPSPNPPSPRPPSPSPPS 226

 Score = 73.2 bits (178), Expect = 8e-12
 Identities = 40/96 (41%), Positives = 43/96 (44%), Gaps = 17/96 (17%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPY-----------------IYKSPPPPPYVYNSPPPPPY 201
           P SPPPP    PSPPPPSPPPP                    + PPP P     PPP P 
Sbjct: 268 PPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPN 327

Query: 202 VYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
               PPP P   + PPP P   + PPP P   K PP
Sbjct: 328 PPRPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPP 363

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 47/108 (43%), Positives = 50/108 (46%), Gaps = 4/108 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPP--PPYVYPSPPPPSPPPPYIYK-SPPPPPY 171
           PP    S  P+   +  PS     P SPPP  PP   PSP PPSP PP     SP PPP 
Sbjct: 173 PPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPR 232

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPP-PPYVYKSPPPPPYVYKSPPS 312
               PPP P     PPP P   + PPP PP     PP PP     PPS
Sbjct: 233 RPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPS 280

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 48/106 (45%), Positives = 51/106 (48%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPP---PPYIYKSPPPPPY 171
           PP S   S P S     P     SP +PP P    PSPP P PP   PP+   SPPPP  
Sbjct: 188 PPPSPPPSPPPSPPPSPPPRPPPSP-NPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRP 246

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              +PPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 247 PPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPP-----SPP 287

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 43/106 (40%), Positives = 47/106 (44%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P+      PS     P SPPP P   P P PP  PPP    SPPP P    
Sbjct: 153 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSP 212

Query: 181 SPPPPPYVYNSPP---PPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           +PP P     SPP   PPP     PPP P   + PPP P   + PP
Sbjct: 213 NPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPP 258

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 45/108 (41%), Positives = 48/108 (44%), Gaps = 5/108 (4%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPP--PPPYV 174
           PP      SP+      PS     P SPPP P   P P PP  PPP    SPP  PPP  
Sbjct: 141 PPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSP 200

Query: 175 YNSPPPPPYVYNSPPPPPYVYKSPP---PPPYVYKSPPPPPYVYKSPP 309
             SPPP P    +PP P     SPP   PPP     PPP P   + PP
Sbjct: 201 PPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPP 248

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 42/106 (39%), Positives = 47/106 (44%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P+      PS     P SPPP P   P P PP  PPP     PPP P   +
Sbjct: 157 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPS 216

Query: 181 SPPPPPYVYNSPPP---PPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             PP P   +  PP   PP+   SPPPP     +PPPP     SPP
Sbjct: 217 PRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPP 262

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 41/96 (42%), Positives = 48/96 (50%)
 Frame = +1

Query: 25  SPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYV 204
           SP ++    P      P  PPPP    P PPPPSPPPP   + PPP P   N P PPP  
Sbjct: 302 SPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPP---RPPPPSP---NPPRPPPPS 355

Query: 205 YNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            + P PPP     P PPP   + PP PP   + PP+
Sbjct: 356 PSPPKPPP----PPSPPPRPPRRPPRPP---RRPPT 384

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 45/108 (41%), Positives = 49/108 (45%), Gaps = 5/108 (4%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPP--PPYVYPSPPPPSPPPPYIYKSPPPPPYV 174
           PP    S  P+      PS     P SPPP  PP   PSPPP  PP P      PP P  
Sbjct: 165 PPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSP 224

Query: 175 YNSPPP---PPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            +  PP   PP+   SPPPP     +PPPP     SPPPP     SPP
Sbjct: 225 PSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPP 272

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 39/101 (38%), Positives = 42/101 (41%), Gaps = 13/101 (12%)
 Frame = +1

Query: 49  TPSGIGVSPFSPPP-----------PPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPP 195
           +P  +G     PPP           P    P  PPP  PPP +   PPP P     PPPP
Sbjct: 13  SPHALGAPARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGV---PPPTPSGPEHPPPP 69

Query: 196 PYVYNSPPPPPYVYKS--PPPPPYVYKSPPPPPYVYKSPPS 312
           P     PP PP       PPPPP     PPPPP     PPS
Sbjct: 70  PPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPS 110

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 43/98 (43%), Positives = 45/98 (45%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP      SPN      PS     P  P PPP   PSP PP PPPP    SP PP     
Sbjct: 317 PPPRPPPPSPNPPRPPPPS-----PPPPRPPP---PSPNPPRPPPP----SPSPP----- 359

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYV 294
            PPPPP    SPPP P   + PP PP   + PP  P V
Sbjct: 360 KPPPPP----SPPPRP--PRRPPRPP---RRPPTAPGV 388

[146][TOP]
>UniRef100_Q2R360 C2 domain containing protein, expressed n=1 Tax=Oryza sativa
           Japonica Group RepID=Q2R360_ORYSJ
          Length = 347

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/123 (41%), Positives = 60/123 (48%), Gaps = 18/123 (14%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKS-------PP 159
           PP +  S  P  S   TPS    +   PPPPP  YP PPPP PPPP++ +S       PP
Sbjct: 177 PPPAMASYPPLPSLSATPS----ASLYPPPPPSSYPPPPPPPPPPPHVTQSFAPNSSYPP 232

Query: 160 PPP---YVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPP--------PPYVYKSP 306
           PPP   Y+   PPPPP  +  PPP  Y   S P P   Y  PPP        PP + +S 
Sbjct: 233 PPPPSQYIAGYPPPPPSNFYPPPPAGYPAPSFPSPTSTYPPPPPPESASSQYPPPLPRSA 292

Query: 307 PSC 315
           P C
Sbjct: 293 PCC 295

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 48/116 (41%), Positives = 58/116 (50%), Gaps = 13/116 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS---PPPPYIYKSPPPPPY 171
           P  S+  + P +ST  T SG      +P PPP +   PP PS    P   +Y  PPPPP 
Sbjct: 154 PISSSCCAPPPTSTTTTTSG------APYPPPAMASYPPLPSLSATPSASLY--PPPPPS 205

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKS--------PPPPP--YVYKSPPPPPYVYKSPP 309
            Y  PPPPP      PPPP+V +S        PPPPP  Y+   PPPPP  +  PP
Sbjct: 206 SYPPPPPPP------PPPPHVTQSFAPNSSYPPPPPPSQYIAGYPPPPPSNFYPPP 255

[147][TOP]
>UniRef100_Q01947 Extensin (Class II) n=1 Tax=Solanum lycopersicum RepID=Q01947_SOLLC
          Length = 82

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 44/77 (57%), Positives = 48/77 (62%), Gaps = 6/77 (7%)
 Frame = +1

Query: 85  PPPPYVYPSPPPPSPPPP---YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPP 255
           P PPY Y SPPPPSP PP   Y Y SPPPP     SP PPP  Y+SPPPPP  Y++ P P
Sbjct: 10  PSPPYTYSSPPPPSPSPPPPTYYYSSPPPP-----SPSPPPPTYSSPPPPPPFYENIPLP 64

Query: 256 PYV---YKSPPPPPYVY 297
           P +   Y SPPPP   Y
Sbjct: 65  PVIGVSYASPPPPVIPY 81

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 37/63 (58%), Positives = 40/63 (63%)
 Frame = +1

Query: 121 PSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYK 300
           P P PPY Y SPPPP     SPPPP Y Y+SPPPP     SP PPP  Y SPPPPP  Y+
Sbjct: 8   PKPSPPYTYSSPPPPS---PSPPPPTYYYSSPPPP-----SPSPPPPTYSSPPPPPPFYE 59

Query: 301 SPP 309
           + P
Sbjct: 60  NIP 62

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 35/57 (61%), Positives = 37/57 (64%), Gaps = 4/57 (7%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSP-PPPYIYKSPPPPPYVYNSPPPPPYV---YNSPPPPPYVY 237
           SPPPP Y Y SPPPPSP PPP  Y SPPPPP  Y + P PP +   Y SPPPP   Y
Sbjct: 25  SPPPPTYYYSSPPPPSPSPPPPTYSSPPPPPPFYENIPLPPVIGVSYASPPPPVIPY 81

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 29/55 (52%), Positives = 31/55 (56%), Gaps = 5/55 (9%)
 Frame = +1

Query: 160 PPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPP-----PPPYVYKSPP 309
           PP   +   P PPY Y+SPPPP     SPPPP Y Y SPP     PPP  Y SPP
Sbjct: 1   PPNSHWEPKPSPPYTYSSPPPPS---PSPPPPTYYYSSPPPPSPSPPPPTYSSPP 52

[148][TOP]
>UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum
           bicolor RepID=C5XPK9_SORBI
          Length = 613

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 61/140 (43%), Positives = 64/140 (45%), Gaps = 43/140 (30%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPP-PPYVYPSPPPPSPPPPYI-------YKSPPPPPYV 174
           S SP   +   PS    SP  PPP PP   P PP PSPPPPY        Y SPPPP Y 
Sbjct: 467 SPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAYT 526

Query: 175 ---------------YNSPPPPPYVYNSPPPPPYV-------YKSPPPPP------YVYK 270
                          Y SPPPPP V++ PPPPPY        Y SPPPP       Y Y 
Sbjct: 527 EVPPPPYYEVSPEDRYLSPPPPP-VHHDPPPPPYYEVSPEDRYLSPPPPSPASLPKYDYS 585

Query: 271 SPPP-------PPYVYKSPP 309
           SPPP       P Y Y SPP
Sbjct: 586 SPPPPRALPKLPVYDYSSPP 605

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/115 (46%), Positives = 56/115 (48%), Gaps = 12/115 (10%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYV 174
           PP  + S  P S    +P     SP   SPPPP    PSPPPPSPPPP    SPPPP   
Sbjct: 419 PPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPP--SPSPPPPSPP 476

Query: 175 YNSPPPP---PYVYNSPPPPPYVYKSPPPPPYV-------YKSPPPPPYVYKSPP 309
             SPPPP   P   + PPP P      PPPPY        Y SPPPP Y    PP
Sbjct: 477 PPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPP 531

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 55/132 (41%), Positives = 59/132 (44%), Gaps = 37/132 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYV-------YPSPPPPS----PPPPYIY 147
           PP S    SP+      P      P   PPPPY        Y SPPPP+    PPPPY  
Sbjct: 476 PPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPPPYYE 535

Query: 148 KSP------PPPPYVYNSPPPPPYV-------YNSPPPP-----PYVYKSPPPPP----- 258
            SP      PPPP V++ PPPPPY        Y SPPPP     P    S PPPP     
Sbjct: 536 VSPEDRYLSPPPPPVHHDPPPPPYYEVSPEDRYLSPPPPSPASLPKYDYSSPPPPRALPK 595

Query: 259 ---YVYKSPPPP 285
              Y Y SPPPP
Sbjct: 596 LPVYDYSSPPPP 607

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 53/112 (47%), Positives = 54/112 (48%), Gaps = 10/112 (8%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P S    +PS    SP  PP PP   PSPPPPSPPPP    SPPPP     
Sbjct: 407 PPLPPPSPPPPSPPPPSPSPPPPSP-PPPSPPPPSPSPPPPSPPPP----SPPPPSPPPP 461

Query: 181 SPPPP----PYVYNSPPPPPYVYKSPPPPPYVYKSPPPP------PYVYKSP 306
           SPPPP    P     PP PP    SPPPP     SPPPP      PY   SP
Sbjct: 462 SPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPYYEVSP 513

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 46/81 (56%), Positives = 46/81 (56%), Gaps = 2/81 (2%)
 Frame = +1

Query: 73  PFSPPPP--PYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           P SPPPP  P   PSPPPPSPPPP    SPPPP     SPPPP     SPPPP     SP
Sbjct: 411 PPSPPPPSPPPPSPSPPPPSPPPP----SPPPPS---PSPPPPSPPPPSPPPPSPPPPSP 463

Query: 247 PPPPYVYKSPPPPPYVYKSPP 309
           PPP     SPPPP     SPP
Sbjct: 464 PPPS---PSPPPPSPPPPSPP 481

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 55/139 (39%), Positives = 57/139 (41%), Gaps = 37/139 (26%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------------SPPPPYI 144
           PP S    SP+      P      P SPPPP    PSPPPP            SPPPP  
Sbjct: 432 PPPSPPPPSPSPPPPSPP------PPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 485

Query: 145 YKSP--------------PPPPYVYNSP-----PPPPYVYNSPPPPPYVYKSP------P 249
              P              PPPPY   SP      PPP  Y   PPPPY   SP      P
Sbjct: 486 SPPPPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPPPYYEVSPEDRYLSP 545

Query: 250 PPPYVYKSPPPPPYVYKSP 306
           PPP V+  PPPPPY   SP
Sbjct: 546 PPPPVHHDPPPPPYYEVSP 564

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 42/77 (54%), Positives = 42/77 (54%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPP 258
           SPP PP   PSPPPPSPPPP     PP PP     PP PP    SPPPP     SPPPP 
Sbjct: 406 SPPLPP---PSPPPPSPPPPSPSPPPPSPP-----PPSPPPPSPSPPPPSPPPPSPPPPS 457

Query: 259 YVYKSPPPPPYVYKSPP 309
               SPPPP     SPP
Sbjct: 458 PPPPSPPPPS---PSPP 471

 Score = 73.2 bits (178), Expect = 8e-12
 Identities = 41/83 (49%), Positives = 41/83 (49%), Gaps = 4/83 (4%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPP----PPYVYK 240
           P SPPPP    P P PP P PP    SPPPP     SPPPP     SPPP    PP    
Sbjct: 416 PPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSP 475

Query: 241 SPPPPPYVYKSPPPPPYVYKSPP 309
            PP PP    SPPPP     SPP
Sbjct: 476 PPPSPPPPSPSPPPPSPPPPSPP 498

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/73 (50%), Positives = 38/73 (52%), Gaps = 2/73 (2%)
 Frame = +1

Query: 97  YVYPSPP--PPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYK 270
           +V PSPP  PPSPPPP      PPPP     PP PP     PP PP    SPPPP     
Sbjct: 402 FVLPSPPLPPPSPPPP-----SPPPPSPSPPPPSPP-----PPSPPPPSPSPPPPSPPPP 451

Query: 271 SPPPPPYVYKSPP 309
           SPPPP     SPP
Sbjct: 452 SPPPPSPPPPSPP 464

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 35/93 (37%), Positives = 42/93 (45%), Gaps = 21/93 (22%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP------FSPPPPPYV-------YPSPPPPSPP--P 135
           PP +     P    +++P    +SP        PPPPPY        Y SPPPPSP   P
Sbjct: 521 PPPAYTEVPPPPYYEVSPEDRYLSPPPPPVHHDPPPPPYYEVSPEDRYLSPPPPSPASLP 580

Query: 136 PYIYKSPPPP------PYVYNSPPPPPYVYNSP 216
            Y Y SPPPP      P    S PPPP   ++P
Sbjct: 581 KYDYSSPPPPRALPKLPVYDYSSPPPPAAGSTP 613

[149][TOP]
>UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA
          Length = 599

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 51/103 (49%), Positives = 53/103 (51%), Gaps = 1/103 (0%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-SPPPPYIYKSPPPPPYVYN 180
           P S  S+ P       PS +  SP  PPPPP   PSPPPP  PPPP    SPPPPP    
Sbjct: 203 PISQASTLPLPLPNAPPSPLPPSP-PPPPPPSPPPSPPPPPPPPPPSPPPSPPPPP---- 257

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP     PPPPP     PPPPP     PPPPP     PP
Sbjct: 258 -PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 46/81 (56%), Positives = 46/81 (56%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   PSPPPP PPPP     PPPPP     PPPPP    SPPPPP     PPP
Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPP-----PPPPP-----PPPPPPPPPSPPPPPPPPPPPPP 289

Query: 253 PPYVYKSPPPPPYVYKSPPSC 315
           PP     PPPPP VY  P  C
Sbjct: 290 PPPPPPPPPPPPPVY--PDQC 308

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/109 (44%), Positives = 49/109 (44%), Gaps = 4/109 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP      SP  S    P      P  PPPPP   PSPPPP PPPP     PPPPP    
Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP-----PPPPP---- 290

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP----PYVYKSPPSC 315
            PPPPP     PPPPP VY        V K  PP     PY Y  P +C
Sbjct: 291 -PPPPP----PPPPPPPVYPDQCSVCIVAKLQPPAIDVRPYRY-DPYAC 333

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 43/91 (47%), Positives = 43/91 (47%), Gaps = 2/91 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
           PP S     P       PS     P  PPPPP   P PPPP   PPPP     PPPPP  
Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPP-----PPPPP-- 286

Query: 175 YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVY 267
              PPPPP     PPPPP     PPPPP VY
Sbjct: 287 ---PPPPP-----PPPPP-----PPPPPPVY 304

[150][TOP]
>UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q852P0_VOLCA
          Length = 606

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 43/80 (53%), Positives = 44/80 (55%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPP PPPP     PPPPP     PPPPP    SPPPPP      PP
Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPP 265

Query: 253 PPYVYKSPPPPPYVYKSPPS 312
           PP    SPPPPP     PP+
Sbjct: 266 PPPPSPSPPPPPPPPSPPPA 285

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 46/86 (53%), Positives = 46/86 (53%)
 Frame = +1

Query: 52  PSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPY 231
           P  I V P  PPPPP     PPPPSPPPP     PPPPP     PPPPP     PPPPP 
Sbjct: 196 PQNIVVEPQPPPPPP----PPPPPSPPPP---PPPPPPPSPPPPPPPPPPPSPPPPPPPP 248

Query: 232 VYKSPPPPPYVYKSPPPPPYVYKSPP 309
              SPPPPP      PPPP    SPP
Sbjct: 249 PPPSPPPPPPPPSPSPPPPPPSPSPP 274

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 41/75 (54%), Positives = 43/75 (57%)
 Frame = +1

Query: 70  SPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPP 249
           SP  PPPPP     PPPP PPPP     PPPPP   + PPPPP    SPPPPP     PP
Sbjct: 216 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPP 275

Query: 250 PPPYVYKSPPPPPYV 294
           PPP     P PPP+V
Sbjct: 276 PPPPPSPPPAPPPFV 290

 Score = 73.2 bits (178), Expect = 8e-12
 Identities = 38/75 (50%), Positives = 38/75 (50%)
 Frame = +1

Query: 88  PPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVY 267
           P   V    PPP PPPP     PPPPP     PPPPP     PPPPP     PPPPP   
Sbjct: 196 PQNIVVEPQPPPPPPPPPPPSPPPPPP-----PPPPPSPPPPPPPPPPPSPPPPPPPPPP 250

Query: 268 KSPPPPPYVYKSPPS 312
            SPPPPP     PPS
Sbjct: 251 PSPPPPP----PPPS 261

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 35/78 (44%), Positives = 36/78 (46%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P       PS     P  PPP P   P PP PSPPPP    SPPPPP    
Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPP---- 277

Query: 181 SPPPPPYVYNSPPPPPYV 234
            PPP P     P PPP+V
Sbjct: 278 -PPPSP----PPAPPPFV 290

[151][TOP]
>UniRef100_A9SW33 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SW33_PHYPA
          Length = 284

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 59/120 (49%), Positives = 65/120 (54%), Gaps = 18/120 (15%)
 Frame = +1

Query: 7   FSAVSSSPNSSTKITPSGIGVSPFSPPPPPY-VYPSPPPPSPPPPYIYKSPP-PPPYVYN 180
           F+ V    N++ K     +   P  PPPP   VY SPP  SP P  +Y+SPP  P  VY 
Sbjct: 111 FARVLDDVNANQKFKLPKLPTLPSCPPPPESPVYESPPYASPSP--VYESPPYSPSPVYK 168

Query: 181 SPPPPPY----VYNSPPPPPY----VYKSPPPPPY----VYKSPPPPPY----VYKSPPS 312
           SPP P Y    VY SPP P Y    VYKSPP P Y    VYKSPP P Y    VYKSPPS
Sbjct: 169 SPPSPTYSPSPVYKSPPSPTYSPSPVYKSPPSPTYSPSPVYKSPPSPTYSPSPVYKSPPS 228

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 52/107 (48%), Positives = 58/107 (54%), Gaps = 13/107 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP-FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPY-- 171
           PP S V  SP  ++   PS +  SP +SP P   VY SPP P+  P  +YKSPP P Y  
Sbjct: 138 PPESPVYESPPYAS---PSPVYESPPYSPSP---VYKSPPSPTYSPSPVYKSPPSPTYSP 191

Query: 172 --VYNSPPPPPY----VYNSPPPPPY----VYKSPPPPPYVYKSPPP 282
             VY SPP P Y    VY SPP P Y    VYKSPP P Y   SP P
Sbjct: 192 SPVYKSPPSPTYSPSPVYKSPPSPTYSPSPVYKSPPSPSY---SPSP 235

[152][TOP]
>UniRef100_P13983 Extensin n=1 Tax=Nicotiana tabacum RepID=EXTN_TOBAC
          Length = 620

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 53/126 (42%), Positives = 59/126 (46%), Gaps = 23/126 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYP---SPPPP-----------SPPPP 138
           PP S + S P  +   +P       FSPPPP Y  P   SPPPP           SPPPP
Sbjct: 292 PPPSPIYSPPPPAYSPSPPPTPTPTFSPPPPAYSPPPTYSPPPPTYLPLPSSPIYSPPPP 351

Query: 139 YIYKSPPPPPYVYNSPPPPPYVYNSPP---------PPPYVYKSPPPPPYVYKSPPPPPY 291
            +Y  PPPP Y   SPPPP Y+   PP         PPP  Y+  PPPP  Y  P P P 
Sbjct: 352 -VYSPPPPPSY---SPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPP 407

Query: 292 VYKSPP 309
            Y  PP
Sbjct: 408 TYSPPP 413

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/120 (44%), Positives = 54/120 (45%), Gaps = 17/120 (14%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SP--PPPYIYKSPP--- 159
           PP S     P       PS      FSPPPP Y    PPPP  SP  P P  Y  PP   
Sbjct: 357 PPPSYSPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPPTYSPPPPTY 416

Query: 160 -PPPYVYNSPPPPPYVYNSP-----PPPPYVYKSPP----PPPYVYKSPPPPPYVYKSPP 309
            PPP  Y  PPP P  Y+ P     PPPP  Y  PP    PPP  Y  PPPPP  Y  PP
Sbjct: 417 SPPPPTYAQPPPLPPTYSPPPPAYSPPPPPTYSPPPPTYSPPPPAYAQPPPPPPTYSPPP 476

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 52/136 (38%), Positives = 58/136 (42%), Gaps = 33/136 (24%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPY--------------VYPSPPPPS- 126
           PP  + S  P  +   +P     SP   +SPPPP Y              VY  PPPPS 
Sbjct: 302 PPAYSPSPPPTPTPTFSPPPPAYSPPPTYSPPPPTYLPLPSSPIYSPPPPVYSPPPPPSY 361

Query: 127 --PPPPYIYKSPP---------PPPYVYNSPPPPPYVYNSPPPPPYVYKSPP----PPPY 261
             PPP Y+   PP         PPP  Y   PPPP  Y+ P P P  Y  PP    PPP 
Sbjct: 362 SPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPPTYSPPPPTYSPPPP 421

Query: 262 VYKSPPPPPYVYKSPP 309
            Y  PPP P  Y  PP
Sbjct: 422 TYAQPPPLPPTYSPPP 437

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 53/123 (43%), Positives = 60/123 (48%), Gaps = 20/123 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP------FSPPPPPYVYPSPPPPSP---PPPYIYKS 153
           PP  A + SP  S   +P     SP      +SPPPP Y    PP P+P   PPP  Y  
Sbjct: 267 PPPPAYAQSPQPSPTYSPPPPTYSPPPPSPIYSPPPPAYSPSPPPTPTPTFSPPPPAYSP 326

Query: 154 PP---PPPYVYNSPP------PPPYVYNSPPPPPYVYKSPPPPPYVYKSPP--PPPYVYK 300
           PP   PPP  Y   P      PPP VY+ PPPP Y   SPPPP Y+   PP  PPP  + 
Sbjct: 327 PPTYSPPPPTYLPLPSSPIYSPPPPVYSPPPPPSY---SPPPPTYLPPPPPSSPPPPSFS 383

Query: 301 SPP 309
            PP
Sbjct: 384 PPP 386

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/92 (53%), Positives = 52/92 (56%), Gaps = 13/92 (14%)
 Frame = +1

Query: 76  FSPPPPPYVYP-------SPPPP--SPPPPYIYKSPPP----PPYVYNSPPPPPYVYNSP 216
           +SPPPP Y  P       SPPPP  SPPPP  Y  PPP    PP  Y  PPPPP  Y SP
Sbjct: 416 YSPPPPTYAQPPPLPPTYSPPPPAYSPPPPPTYSPPPPTYSPPPPAYAQPPPPPPTY-SP 474

Query: 217 PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           PPP Y   SPPPP  +Y   PPPP V   PP+
Sbjct: 475 PPPAY---SPPPPSPIYS--PPPPQVQPLPPT 501

 Score = 82.4 bits (202), Expect(2) = 5e-15
 Identities = 49/114 (42%), Positives = 53/114 (46%), Gaps = 35/114 (30%)
 Frame = +1

Query: 76  FSPPPPPYVYP-------SPPPP--SPPPPYIYKSPPPPPYVYNSPP-------PPPYVY 207
           +SPPPP Y          SPPPP  SPPPP    SPPPP Y  + PP       PPP  Y
Sbjct: 265 YSPPPPAYAQSPQPSPTYSPPPPTYSPPPPSPIYSPPPPAYSPSPPPTPTPTFSPPPPAY 324

Query: 208 NSPP-------------------PPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           + PP                   PPP VY  PPPP Y   SPPPP Y+   PPS
Sbjct: 325 SPPPTYSPPPPTYLPLPSSPIYSPPPPVYSPPPPPSY---SPPPPTYLPPPPPS 375

 Score = 21.9 bits (45), Expect(2) = 5e-15
 Identities = 9/26 (34%), Positives = 12/26 (46%)
 Frame = +2

Query: 11  PPSHLHPTPPQK*HPPALESLHSPHL 88
           PP+H H  P  +  PP  +     HL
Sbjct: 227 PPTHRHAPPTHRHAPPTHQPSPLRHL 252

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/101 (47%), Positives = 52/101 (51%), Gaps = 23/101 (22%)
 Frame = +1

Query: 76  FSPPPPP-YVYP-----------SPPPP--SPPPPYIYKSPPPPPYVYNSPPPPPYVYNS 213
           +SPPPPP Y  P           SPPPP  SPPPP   +SPPPPP  Y+ P P P  Y+ 
Sbjct: 353 YSPPPPPSYSPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPP-AYSPPLPAPPTYSP 411

Query: 214 PP----PPPYVYKSPPPPPYVYKSP-----PPPPYVYKSPP 309
           PP    PPP  Y  PPP P  Y  P     PPPP  Y  PP
Sbjct: 412 PPPTYSPPPPTYAQPPPLPPTYSPPPPAYSPPPPPTYSPPP 452

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 47/114 (41%), Positives = 55/114 (48%), Gaps = 11/114 (9%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
           PP  A S  P  +    P       +SPPPP Y  P PPPP  SPPPP    SPPPP  +
Sbjct: 435 PPPPAYSPPPPPTYSPPPP-----TYSPPPPAYAQPPPPPPTYSPPPPAY--SPPPPSPI 487

Query: 175 YNSPPPP----PYVYNSPPP-----PPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           Y+ PPP     P  ++ PPP     PP  ++ P PP   Y  PP PP     PP
Sbjct: 488 YSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQPPSPPTFSPPPP 541

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 49/123 (39%), Positives = 58/123 (47%), Gaps = 19/123 (15%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP----FSPPPPPYVYPSPPPPSPPPPYIYKSPPPPP 168
           PP    S  P +  +  P     SP    +SPPPPP   P PP  SPPPP   + PPPPP
Sbjct: 411 PPPPTYSPPPPTYAQPPPLPPTYSPPPPAYSPPPPPTYSPPPPTYSPPPPAYAQPPPPPP 470

Query: 169 Y------VYNSPPPPPYVYNSPPPP----PYVYKSPPP-----PPYVYKSPPPPPYVYKS 303
                   Y SPPPP  +Y+ PPP     P  +  PPP     PP  ++ P PP   Y  
Sbjct: 471 TYSPPPPAY-SPPPPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQ 529

Query: 304 PPS 312
           PPS
Sbjct: 530 PPS 532

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 41/83 (49%), Positives = 44/83 (53%), Gaps = 7/83 (8%)
 Frame = +1

Query: 85  PPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYV 264
           PP P   P PP  SPPPP   +SP P P    SPPPP Y   SPPPP  +Y SPPPP Y 
Sbjct: 253 PPSPRRQPQPPTYSPPPPAYAQSPQPSPTY--SPPPPTY---SPPPPSPIY-SPPPPAYS 306

Query: 265 YKSPP-------PPPYVYKSPPS 312
              PP       PPP  Y  PP+
Sbjct: 307 PSPPPTPTPTFSPPPPAYSPPPT 329

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/132 (37%), Positives = 56/132 (42%), Gaps = 28/132 (21%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPP-----------SPPPP 138
           PP S + S P    +  P      P      PPPP+  P PP P           SPPPP
Sbjct: 482 PPPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQPPSPPTFSPPPP 541

Query: 139 YIYKSPPPPPY-------VYNSPP-------PPPYVYNSPPPPPYVYKSPPPPPYVYKSP 276
               SPPPP +        Y  PP       PPP   +SPPPP   ++ P PP   Y  P
Sbjct: 542 RQIHSPPPPHWQPRTPTPTYGQPPSPPTFSAPPPRQIHSPPPP---HRQPRPPTPTYGQP 598

Query: 277 PPPPYVYKSPPS 312
           P PP  Y SPPS
Sbjct: 599 PSPPTTY-SPPS 609

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 10/82 (12%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPP---PSPPPPYIYKSPP-------PPPYVYNSPPPPPYVYNSPPPP 225
           FSPPPP  ++  PPP   P  P P  Y  PP       PPP   +SPPPP   +  P PP
Sbjct: 536 FSPPPPRQIHSPPPPHWQPRTPTP-TYGQPPSPPTFSAPPPRQIHSPPPP---HRQPRPP 591

Query: 226 PYVYKSPPPPPYVYKSPPPPPY 291
              Y  PP PP  Y  P PPPY
Sbjct: 592 TPTYGQPPSPPTTYSPPSPPPY 613

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 46/118 (38%), Positives = 52/118 (44%), Gaps = 22/118 (18%)
 Frame = +1

Query: 25  SPNSSTKITPSGIGVSPFSPPPPPYVYPSPP-----------------PPSP-----PPP 138
           SP   T + P+    S    P PP    +PP                 PPSP     PP 
Sbjct: 205 SPPPPTHVQPTPSPPSRGHQPQPPTHRHAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPT 264

Query: 139 YIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           Y   SPPPP Y  +  P P Y   SPPPP Y   SPPPP  +Y SPPPP Y    PP+
Sbjct: 265 Y---SPPPPAYAQSPQPSPTY---SPPPPTY---SPPPPSPIY-SPPPPAYSPSPPPT 312

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 39/96 (40%), Positives = 46/96 (47%), Gaps = 9/96 (9%)
 Frame = +1

Query: 52  PSGIGVSPFSPPPPPYVYPSPPP-PSPPPPYIYKSPPPPPYVYNSP---PPPPYVYNSPP 219
           PSG    P    PP +  PSPP     PPP  Y  PPP P    SP   PPP Y   SPP
Sbjct: 151 PSGGHTPPRGQHPPSHRRPSPPSRHGHPPPPTYAQPPPTPIYSPSPQVQPPPTY---SPP 207

Query: 220 PPPYVYKSPPPPPYVYKSPPP-----PPYVYKSPPS 312
           PP +V  +P PP   ++  PP     PP    +PP+
Sbjct: 208 PPTHVQPTPSPPSRGHQPQPPTHRHAPPTHRHAPPT 243

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 45/119 (37%), Positives = 50/119 (42%), Gaps = 40/119 (33%)
 Frame = +1

Query: 76  FSPPPPPYVYPSPPPPS-------------------PPPPYIYKSPP-----------PP 165
           F+PPP P + PS PPPS                   PP P    +PP           PP
Sbjct: 105 FNPPPSPVISPSHPPPSYGAPPPSHGPGHLPSHGQRPPSPSHGHAPPSGGHTPPRGQHPP 164

Query: 166 PYVYNSPP-----PPPYVYNSPPPPPYVYKSP---PPPPYVYKSPPPPPYVY--KSPPS 312
            +   SPP     PPP  Y  PPP P    SP   PPP Y   SPPPP +V    SPPS
Sbjct: 165 SHRRPSPPSRHGHPPPPTYAQPPPTPIYSPSPQVQPPPTY---SPPPPTHVQPTPSPPS 220

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 39/106 (36%), Positives = 43/106 (40%), Gaps = 29/106 (27%)
 Frame = +1

Query: 82  PPPPPYVYPSPPP---PSPP--PPYIYKSPPPPPYVYNSPPPPPYVYNSPPP-------- 222
           PPPP Y  P P P   PSP   PP  Y SPPPP +V  +P PP   +   PP        
Sbjct: 178 PPPPTYAQPPPTPIYSPSPQVQPPPTY-SPPPPTHVQPTPSPPSRGHQPQPPTHRHAPPT 236

Query: 223 ----------------PPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
                           PP   + P PP Y   SPPPP Y     PS
Sbjct: 237 HRHAPPTHQPSPLRHLPPSPRRQPQPPTY---SPPPPAYAQSPQPS 279

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 31/80 (38%), Positives = 38/80 (47%), Gaps = 3/80 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPY 171
           PP    S  P      TP+      +  PP P  + +PPP    SPPPP+  + P PP  
Sbjct: 540 PPRQIHSPPPPHWQPRTPT----PTYGQPPSPPTFSAPPPRQIHSPPPPH--RQPRPPTP 593

Query: 172 VYNSPPPPPYVYNSPPPPPY 231
            Y  PP PP  Y+ P PPPY
Sbjct: 594 TYGQPPSPPTTYSPPSPPPY 613

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 51/149 (34%), Positives = 60/149 (40%), Gaps = 46/149 (30%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP--PPPPYVYPSPP----PPS----PP-----P 135
           PP S++  SP S+   TP   G  P SP   PP + YP P     PPS    PP     P
Sbjct: 42  PPPSSIGLSPPSAPTTTPPSRGHVP-SPRHAPPRHAYPPPSHGHLPPSVGGPPPHRGHLP 100

Query: 136 PYIYKSPPPPPYVYNSPPPPPYVYNSPPP----------------------PPYVYKSPP 249
           P    +PPP P +  S PPP   Y +PPP                      PP    +PP
Sbjct: 101 PSRGFNPPPSPVISPSHPPPS--YGAPPPSHGPGHLPSHGQRPPSPSHGHAPPSGGHTPP 158

Query: 250 ----PPPYVYKSPP-----PPPYVYKSPP 309
               PP +   SPP     PPP  Y  PP
Sbjct: 159 RGQHPPSHRRPSPPSRHGHPPPPTYAQPP 187

[153][TOP]
>UniRef100_Q94ES2 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES2_PEA
          Length = 88

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 49/87 (56%), Positives = 51/87 (58%), Gaps = 11/87 (12%)
 Frame = +1

Query: 82  PPPPPYVYPSPPPPS----PPPPYIYKSPPPPP------YVYNSPPPPPYVYNSPP-PPP 228
           P   PY YPSPPPP     P P  +Y SPPPPP      Y Y SPPPPP  +  PP  P 
Sbjct: 1   PHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPP-AHTYPPHVPT 59

Query: 229 YVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            VY SPPPP Y   SPPPP Y YKSPP
Sbjct: 60  PVYHSPPPPAY---SPPPPAYYYKSPP 83

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 45/80 (56%), Positives = 47/80 (58%), Gaps = 9/80 (11%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSP------PPPSPPP---PYIYKSPPPPPYVYNSPPPPPYVYNSPPPP 225
           P  PPPP + YP P      PPP P P   PY Y SPPPPP     P  P  VY+SPPPP
Sbjct: 9   PSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPP 68

Query: 226 PYVYKSPPPPPYVYKSPPPP 285
            Y   SPPPP Y YKSPPPP
Sbjct: 69  AY---SPPPPAYYYKSPPPP 85

[154][TOP]
>UniRef100_Q41986 Extensin (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q41986_ARATH
          Length = 97

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 50/88 (56%), Positives = 52/88 (59%), Gaps = 7/88 (7%)
 Frame = +1

Query: 67  VSPFSPPPPPYV-YPSPPPPSPPPPYIYKSPPPPPYVYNSP------PPPPYVYNSPPPP 225
           V  F PPPP Y   P     SPP PY+  SPPPPP    SP       PPPYVY+SPPPP
Sbjct: 8   VCXFXPPPPCYSNSPKXEYKSPPTPYVXHSPPPPPXXSXSPKPAYNFXPPPYVYSSPPPP 67

Query: 226 PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              Y SP P P VYK  PPPPYVY SPP
Sbjct: 68  ---YXSPAPKP-VYKF-PPPPYVYNSPP 90

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 44/86 (51%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS--PPPPYIYKSPPPPPYV 174
           PP    S+SP    K  P+       SPPPPP    SP P     PPPY+Y SPPPP   
Sbjct: 13  PPPPCYSNSPKXEYKSPPTPY--VXHSPPPPPXXSXSPKPAYNFXPPPYVYSSPPPP--- 67

Query: 175 YNSPPPPPYVYNSPPPPPYVYKSPPP 252
           Y SP P P VY  PPPP YVY SPPP
Sbjct: 68  YXSPAPKP-VYKFPPPP-YVYNSPPP 91

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 33/63 (52%), Positives = 34/63 (53%), Gaps = 12/63 (19%)
 Frame = +1

Query: 157 PPPPYVYNSPPPPPYVYNSP------PPPPYVYKSPPPPPYVYKSP------PPPPYVYK 300
           PP P+V    PPPP   NSP      PP PYV  SPPPPP    SP       PPPYVY 
Sbjct: 3   PPHPHVCXFXPPPPCYSNSPKXEYKSPPTPYVXHSPPPPPXXSXSPKPAYNFXPPPYVYS 62

Query: 301 SPP 309
           SPP
Sbjct: 63  SPP 65

[155][TOP]
>UniRef100_Q41400 Root nodule extensin (Fragment) n=1 Tax=Sesbania rostrata
           RepID=Q41400_SESRO
          Length = 91

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 48/87 (55%), Positives = 52/87 (59%), Gaps = 14/87 (16%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPY---------VYNSPPPP-----PYVYN 210
           P   P P  VY SPPPP   P Y Y SPPPP +         VY+SPPPP     PY Y+
Sbjct: 7   PHPHPHPHPVYHSPPPPYKKP-YKYHSPPPPVHTYPPHIPHPVYHSPPPPTPYKKPYKYH 65

Query: 211 SPPPPPYVYKSPPPPPYVYKSPPPPPY 291
           SPPPP +   SPPPP Y YKSPPPPPY
Sbjct: 66  SPPPPVH---SPPPPHYYYKSPPPPPY 89

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 47/91 (51%), Positives = 53/91 (58%), Gaps = 17/91 (18%)
 Frame = +1

Query: 88  PPPYVYPSPPPPSPPPPYIYKSPPPP---PYVYNSPPPPPY---------VYNSPPPP-- 225
           PP + YP P P   P   +Y SPPPP   PY Y+SPPPP +         VY+SPPPP  
Sbjct: 1   PPVHKYPHPHPHPHP---VYHSPPPPYKKPYKYHSPPPPVHTYPPHIPHPVYHSPPPPTP 57

Query: 226 ---PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              PY Y SPPPP +   SPPPP Y YKSPP
Sbjct: 58  YKKPYKYHSPPPPVH---SPPPPHYYYKSPP 85

[156][TOP]
>UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO
          Length = 2618

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 51/105 (48%), Positives = 56/105 (53%), Gaps = 1/105 (0%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
            PP+    S P       P G   +P+ PPP P    SPPPPSPPPP    SPPPPP    
Sbjct: 2083 PPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSP----SPPPPSPPPP---PSPPPPP---P 2132

Query: 181  SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPP-PPPYVYKSPPS 312
            SPPP P     PPPPP    SPPPPP    SPP PPP+    PP+
Sbjct: 2133 SPPPAPL----PPPPPSPPPSPPPPPSPPPSPPAPPPHPPPEPPA 2173

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 50/113 (44%), Positives = 55/113 (48%), Gaps = 9/113 (7%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYV---------YPSPPPPSPPPPYIYKS 153
            PP      +P+ S    P      P  PPPPP           +P PP PSPPPP    S
Sbjct: 2065 PPPPLPPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPP----S 2120

Query: 154  PPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            PPPPP   + PPPPP    SPPP P     PPPPP    SPPPPP    SPP+
Sbjct: 2121 PPPPP---SPPPPPP----SPPPAPL----PPPPPSPPPSPPPPPSPPPSPPA 2162

 Score = 76.3 bits (186), Expect(2) = 1e-14
 Identities = 42/83 (50%), Positives = 45/83 (54%), Gaps = 3/83 (3%)
 Frame = +1

Query: 70   SPFSPPPPPYV--YPSPPPPSPPPPY-IYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYK 240
            +P  PPPPP     PSP PP PPPP+    SPPPPP     P PPP    +P PPP    
Sbjct: 2060 APLPPPPPPLPPPAPSPSPPPPPPPWPPPPSPPPPP----PPAPPPGAAQAPWPPPPSPS 2115

Query: 241  SPPPPPYVYKSPPPPPYVYKSPP 309
             PPP P    SPPPPP    SPP
Sbjct: 2116 PPPPSPPPPPSPPPPP---PSPP 2135

 Score = 26.6 bits (57), Expect(2) = 1e-14
 Identities = 12/26 (46%), Positives = 14/26 (53%)
 Frame = +2

Query: 5    RSPPSHLHPTPPQK*HPPALESLHSP 82
            R PP+H  P+PP    PP L S   P
Sbjct: 2019 RPPPNHPPPSPPPLPSPPPLPSPPPP 2044

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 48/105 (45%), Positives = 52/105 (49%), Gaps = 8/105 (7%)
 Frame = +1

Query: 22   SSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPP-PPP 198
            S P   +   PS   +SP  PPPPP     PPPP  PPP    SPPPPP  +  PP PPP
Sbjct: 2034 SPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPPPPLPPPAPSPSPPPPPPPWPPPPSPPP 2093

Query: 199  YVYNSPPP-------PPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
                +PPP       PP    SPPPP     SPPPPP     PPS
Sbjct: 2094 PPPPAPPPGAAQAPWPPPPSPSPPPP-----SPPPPPSPPPPPPS 2133

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 45/83 (54%), Positives = 46/83 (55%), Gaps = 3/83 (3%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPP-PSPPPPYIYKSPPP--PPYVYNSPPPPPYVYNSPPPPPYVYKS 243
            P  PPP P   PSPPP PSPPPP    SPPP  PP     PPPPP     PPPPP     
Sbjct: 2022 PNHPPPSPPPLPSPPPLPSPPPP----SPPPLSPP-----PPPPPPPAPLPPPPP----- 2067

Query: 244  PPPPPYVYKSPPPPPYVYKSPPS 312
            P PPP    SPPPPP  +  PPS
Sbjct: 2068 PLPPPAPSPSPPPPPPPWPPPPS 2090

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 40/80 (50%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P SPPP P   P P PP P PP +   PPPPP     PPPPP     P PPP    SPPP
Sbjct: 2026 PPSPPPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPPP-----PLPPPAPSPSPPP 2080

Query: 253  PPYVYKSPP-PPPYVYKSPP 309
            PP  +  PP PPP    +PP
Sbjct: 2081 PPPPWPPPPSPPPPPPPAPP 2100

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 44/103 (42%), Positives = 45/103 (43%), Gaps = 8/103 (7%)
 Frame = +1

Query: 28   PNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVY 207
            PN      P      P   PPPP   P  PPP PPPP     PPPPP     PPP P   
Sbjct: 2022 PNHPPPSPPPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPPPPL----PPPAPSPS 2077

Query: 208  NSPPPPPY-VYKSPPPPPYVYKSP-------PPPPYVYKSPPS 312
              PPPPP+    SPPPPP     P       PPPP     PPS
Sbjct: 2078 PPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPS 2120

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 45/104 (43%), Positives = 50/104 (48%), Gaps = 7/104 (6%)
 Frame = +1

Query: 19   SSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------SPPPPYIYKSPPPPPY-VY 177
            S  P S   ++P      P  PPPPP   P PPPP      SP PP     PPPPP+   
Sbjct: 2040 SPPPPSPPPLSP------PPPPPPPPAPLPPPPPPLPPPAPSPSPP-----PPPPPWPPP 2088

Query: 178  NSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             SPPPPP     P PPP   ++P PPP     PPP P    SPP
Sbjct: 2089 PSPPPPP----PPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSPP 2128

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 45/97 (46%), Positives = 49/97 (50%), Gaps = 1/97 (1%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPP-PSPPPPYIYKSPPPPPYVY 177
            PP +A +  P   +   P      P SPPPPP   PSPPP P PPPP     P PPP   
Sbjct: 2100 PPGAAQAPWPPPPSPSPPPPSPPPPPSPPPPP---PSPPPAPLPPPP-----PSPPP--- 2148

Query: 178  NSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPP 288
             SPPPPP    SPPP P     P PPP+    PP PP
Sbjct: 2149 -SPPPPP----SPPPSP-----PAPPPHPPPEPPAPP 2175

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 35/88 (39%), Positives = 39/88 (44%), Gaps = 1/88 (1%)
 Frame = +1

Query: 19   SSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-SPPPPYIYKSPPPPPYVYNSPPPP 195
            S SP   +   P      P SPPP P   P P PP SPPPP    SPPP P     P PP
Sbjct: 2113 SPSPPPPSPPPPPSPPPPPPSPPPAPLPPPPPSPPPSPPPP---PSPPPSP-----PAPP 2164

Query: 196  PYVYNSPPPPPYVYKSPPPPPYVYKSPP 279
            P+    PP PP       PP + +   P
Sbjct: 2165 PHPPPEPPAPPSF-----PPQFDFGDEP 2187

[157][TOP]
>UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2Z7_EHV86
          Length = 516

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/123 (43%), Positives = 60/123 (48%), Gaps = 20/123 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVY- 177
           PP S    SP   +   PS    SP   PPP    PSPPPPSPPPP I  SPPPPP  + 
Sbjct: 95  PPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWW 154

Query: 178 -------NSPPPPPYVYNSP-----PPPPYVYKSP-------PPPPYVYKSPPPPPYVYK 300
                  + PPPPP  + +P     PPPP +  SP       PPPP    SPPPP     
Sbjct: 155 QAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPP 214

Query: 301 SPP 309
           SPP
Sbjct: 215 SPP 217

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 56/128 (43%), Positives = 59/128 (46%), Gaps = 25/128 (19%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVY------PSPPP------------PS 126
           PP    S SP S    +P    +SP  PPPPP  +      PSPPP            PS
Sbjct: 120 PPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPS 179

Query: 127 PPPPYIYKSP-------PPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
           PPPP I  SP       PPPP    SPPPP     SPPPPP     PPPPP    SP PP
Sbjct: 180 PPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPP---PPPPPPPPSPPSPNPP 236

Query: 286 PYVYKSPP 309
           P    SPP
Sbjct: 237 PSASPSPP 244

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/123 (42%), Positives = 60/123 (48%), Gaps = 20/123 (16%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSP PPSPPPP      PPPP +  
Sbjct: 90  PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPP-----SPPPPSISP 144

Query: 181 SPPPPPYVY--------NSPPPPPYVYKSP-----PPPPYVYKSP-------PPPPYVYK 300
           SPPPPP  +        + PPPPP  +++P     PPPP +  SP       PPPP    
Sbjct: 145 SPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASP 204

Query: 301 SPP 309
           SPP
Sbjct: 205 SPP 207

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 51/109 (46%), Positives = 55/109 (50%), Gaps = 13/109 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP----PPPPYVYPSPPPPSPPPPYIYKSPPPPP 168
           PP      +P++S    P  I  SP S     PPPP   PSPPPPSPPPP    SPPPPP
Sbjct: 165 PPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPP----SPPPPP 220

Query: 169 YVYNSPPPPPYVYNSPPPPPYV---------YKSPPPPPYVYKSPPPPP 288
                PPPPP    SP PPP            +SPPPPP     PPPPP
Sbjct: 221 ---PPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPP-----PPPPP 261

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 52/119 (43%), Positives = 57/119 (47%), Gaps = 16/119 (13%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPP---PPYIYKSPPPPPY 171
           PP S    SP  S   +PS     P SPPPP  + PSPPPP PP    P    SPPPPP 
Sbjct: 110 PPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPS-ISPSPPPPPPPWWQAPSASPSPPPPPP 168

Query: 172 VY------NSPPPPPYVYNSP-------PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            +      +  PPPP +  SP       PPPP    SPPPP     SPPPPP     PP
Sbjct: 169 PWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPP 227

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/107 (47%), Positives = 52/107 (48%), Gaps = 3/107 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGI---GVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPY 171
           PP    S  P S     P  +     SP SPPPP    PSPPPPSPP P    SPPPP  
Sbjct: 42  PPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSP--PPSPPPP-- 97

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
              SPPPP     SPPPP     SPPP P    SPP PP     PPS
Sbjct: 98  ---SPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPS 141

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 49/105 (46%), Positives = 52/105 (49%), Gaps = 1/105 (0%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-SPPPPYIYKSPPPPPYVY 177
           PP    S SP S    +P      P SPP PP   PSPPPP  PPP     SPPPP    
Sbjct: 60  PPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPP---PSPPPPSPPPPSPPPPSPPPPSPPP 116

Query: 178 NSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            SPPP P    SPP PP      PPPP +  SPPPPP  +   PS
Sbjct: 117 PSPPPSPPPSPSPPSPP---PPSPPPPSISPSPPPPPPPWWQAPS 158

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 54/129 (41%), Positives = 62/129 (48%), Gaps = 25/129 (19%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPP---PPYVYPSPPPP------SPPPPYIYKS 153
           PP S    SP   +   PS    SP SPPP   PP   P  PPP      SPPPP    S
Sbjct: 63  PPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPS 122

Query: 154 PPPPPYVYNSP---PPPPYVYNSPPPPPYVY--------KSPPPPPYVYKSP-----PPP 285
           PPP P   + P   PPPP +  SPPPPP  +          PPPPP  +++P     PPP
Sbjct: 123 PPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPP 182

Query: 286 PYVYKSPPS 312
           P +  SPPS
Sbjct: 183 PSISPSPPS 191

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/99 (46%), Positives = 51/99 (51%), Gaps = 3/99 (3%)
 Frame = +1

Query: 22  SSPNSSTKITPSGIGVSPFSPPP--PPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPP 195
           ++P S    +P      P SPPP  PP   PSPPPPSPPP      PPP P   + PPP 
Sbjct: 17  ATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPS 76

Query: 196 PYVYNSPPP-PPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P   + PPP PP    SPPPP     SPPPP     SPP
Sbjct: 77  PPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 115

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 44/88 (50%), Positives = 46/88 (52%), Gaps = 4/88 (4%)
 Frame = +1

Query: 58  GIGVSPFSPPPPPYVYPSPPPPSP---PPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPP 228
           G   +P SPPPP    PSPPPPSP   PPP    SPPPP    + PPP P    SPP PP
Sbjct: 14  GAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPP 73

Query: 229 YVYKSPP-PPPYVYKSPPPPPYVYKSPP 309
                PP PPP    SPPP P     PP
Sbjct: 74  PPSPPPPSPPPPSPPSPPPSPPPPSPPP 101

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 46/106 (43%), Positives = 47/106 (44%), Gaps = 2/106 (1%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
           PP S    SP       P      P  PP PP   P P P   SPPPP      PPPP  
Sbjct: 28  PPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSP 87

Query: 175 YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            + PP PP    SPPPP     SPPPP     SPPP P    SPPS
Sbjct: 88  PSPPPSPP--PPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPS 131

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 39/72 (54%), Positives = 40/72 (55%), Gaps = 3/72 (4%)
 Frame = +1

Query: 106 PSPPPPSP-PPPYIYKSPP--PPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSP 276
           PSPPPPSP PP     SPP  PPP    SPPPP    + PPP P    SPP PP    SP
Sbjct: 20  PSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPP--PPSP 77

Query: 277 PPPPYVYKSPPS 312
           PPP     SPPS
Sbjct: 78  PPPSPPPPSPPS 89

[158][TOP]
>UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S9_EHV86
          Length = 621

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/103 (50%), Positives = 53/103 (51%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP      SP   +   PS    SP SPPPP    PSPPPPSPPPP    SPPPP     
Sbjct: 412 PPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPP 467

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 468 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 510

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/103 (50%), Positives = 53/103 (51%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS     P SPPPP    PSPPPPSPPPP    SPPPP     
Sbjct: 417 PPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPP 472

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 473 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 515

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/104 (50%), Positives = 53/104 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP S    +P      P SPPPP    PSPPPPSPPPP    SPPPP     
Sbjct: 427 PPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPP 482

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPP     SPPPP     SPPPP     SPPPP      PPS
Sbjct: 483 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPS 526

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/104 (50%), Positives = 53/104 (50%), Gaps = 1/104 (0%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP     S P  S    P      P SPPPP    PSPPPPSPPPP    SPPPP     
Sbjct: 246 PPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPP 301

Query: 181 SPPPP-PYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP P   + PPPPP    SPPPP     SPPPP     SPP
Sbjct: 302 SPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 345

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 51/103 (49%), Positives = 53/103 (51%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P S    +P      P SPPPP    PSPPPPSPPPP    SPPPP    +
Sbjct: 317 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP----S 368

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP    SPPPP     SPPPP     SPPPP     SPP
Sbjct: 369 PPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 411

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/103 (50%), Positives = 52/103 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP     S P  S    PS    SP  P PPP   PSPPPPSPPPP    SPPPP     
Sbjct: 402 PPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPP----SPPPPSPPPP 457

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 458 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 500

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 51/103 (49%), Positives = 53/103 (51%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +  +P      P SPPPP    PSPPPPSPPPP    SPPPP     
Sbjct: 422 PPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPP 477

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 478 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 520

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 52/103 (50%), Positives = 53/103 (51%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP    SPPPP     
Sbjct: 175 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPP----SPPPPSPPPP 227

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPPP     PP
Sbjct: 228 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPP 270

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 51/103 (49%), Positives = 53/103 (51%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P S    +P      P SPPPP    PSPPPPSPPPP    SPPPP    +
Sbjct: 261 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP----S 312

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP    SPPPP     SPPPP     SPPPP     SPP
Sbjct: 313 PPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 355

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 54/103 (52%), Positives = 55/103 (53%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  PPPPP   PSPPPPSPPPP    SPPPP     
Sbjct: 345 PPPSPPPPSPPPPSPPPPSPPPPSP--PPPPPSPPPSPPPPSPPPP----SPPPP----- 393

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPPP    SPPPP     SPP
Sbjct: 394 SPPPPSPPPPSPPPPSPPPPSPPPPP----SPPPPSPPPPSPP 432

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 51/103 (49%), Positives = 52/103 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P S    +P      P SPPPP    PSPPPPSPPPP    SPPPP     
Sbjct: 157 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPP 212

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 213 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 255

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 51/104 (49%), Positives = 53/104 (50%), Gaps = 1/104 (0%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-SPPPPYIYKSPPPPPYVY 177
           PP +   S P S    +P      P SPPPP    PSPPPP SPPPP    SPPPP    
Sbjct: 112 PPTTPPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPP 171

Query: 178 NSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 172 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 215

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 51/103 (49%), Positives = 52/103 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP      PPPP    
Sbjct: 210 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPPPPP 266

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 267 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 309

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 51/103 (49%), Positives = 52/103 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP     PPPP     
Sbjct: 215 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPPPPPSPPPP 271

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 272 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 314

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 53/104 (50%), Positives = 54/104 (51%), Gaps = 1/104 (0%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP     PPPPP    
Sbjct: 325 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPP---SPPPPPPSPPP 378

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP-PYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP P    SPP
Sbjct: 379 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPP 422

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/103 (48%), Positives = 51/103 (49%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P S    +P      P SPPPP    PSPPPPSPPPP    SPPPP     
Sbjct: 152 PPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPP 207

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 208 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 250

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 52/103 (50%), Positives = 53/103 (51%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP    SPPPP     
Sbjct: 165 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPP----SPPPPSPPPP 217

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 218 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 260

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 51/103 (49%), Positives = 52/103 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP    SPPPP     
Sbjct: 185 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPP----SPPPPSPPPP 237

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPPP     PPP P     PP
Sbjct: 238 SPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPP 280

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 53/103 (51%), Positives = 54/103 (52%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP    SPPPP     
Sbjct: 195 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPP----SPPPPSPPPP 247

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPPP    SPPPP     SPPPP     SPP
Sbjct: 248 SPPPPSPPPPSPPPPP-PPPSPPPPSPPPPSPPPPSPPPPSPP 289

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 53/103 (51%), Positives = 54/103 (52%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP    SPPPP     
Sbjct: 205 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPP----SPPPPSPPPP 257

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP    SPPPP     SPPPP     SPPPP     SPP
Sbjct: 258 SPPPPP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 299

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 51/103 (49%), Positives = 52/103 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P S    +P      P SPPPP    PSPPPPSPPPP    SPPPP     
Sbjct: 373 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---PSPPPPSPPPP 429

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 430 SPPPPS--PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 470

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 48/94 (51%), Positives = 50/94 (53%)
 Frame = +1

Query: 28  PNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVY 207
           P  S   +P      P SPPPP    PSPPPPSPPPP    SPPPP     SPPPP    
Sbjct: 316 PPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPPSPPPP---- 367

Query: 208 NSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           + PPPPP    SPPPP     SPPPP     SPP
Sbjct: 368 SPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 401

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 51/103 (49%), Positives = 51/103 (49%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP     S P  S    PS     P  PPPP    PSPPPPSPPPP    SPPPP     
Sbjct: 136 PPSPPPPSPPPPSPPPPPS----PPPPPPPPSPPPPSPPPPSPPPP----SPPPPSPPPP 187

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 188 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 230

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 49/97 (50%), Positives = 49/97 (50%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPP 198
           S  P  S    P      P SPPPP    PSPPPPSPPPP    SPPPP     SPPPP 
Sbjct: 148 SPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPPSPPPPS 203

Query: 199 YVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
               SPPPP     SPPPP     SPPPP     SPP
Sbjct: 204 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 240

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 51/103 (49%), Positives = 52/103 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP     P PPP    
Sbjct: 274 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPPPSPPPSPPP---P 327

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 328 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 370

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 50/103 (48%), Positives = 51/103 (49%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP     S P   +   PS    SP  P PP    PSPPPPSPPPP    SPPPP     
Sbjct: 407 PPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPP----SPPPPSPPPP 462

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 463 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 505

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 50/104 (48%), Positives = 51/104 (49%), Gaps = 1/104 (0%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPP-PYVYPSPPPPSPPPPYIYKSPPPPPYVY 177
           PP    S  P S    +P      P SPPPP P   PSPPPP PPP     SPPPP    
Sbjct: 117 PPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPP 176

Query: 178 NSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 177 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 220

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/103 (49%), Positives = 52/103 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPP PPP     SPPPP     
Sbjct: 225 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPPPPPSPPPPSPPPPSPPPP 281

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPPP    SPP
Sbjct: 282 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP---PSPP 321

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/105 (49%), Positives = 53/105 (50%), Gaps = 2/105 (1%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-SPPPPYIYKSPPPPPYVY 177
           PP S    SP   +   PS    SP  PPPPP   P  PPP SPPPP    SPPPP    
Sbjct: 235 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPP----SPPPPSPPP 290

Query: 178 NSPPPPPYVYNSPPPP-PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            SPPPP     SPPPP P     PPPPP    SPPPP     SPP
Sbjct: 291 PSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPP 335

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 48/95 (50%), Positives = 49/95 (51%)
 Frame = +1

Query: 28  PNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVY 207
           P  S   +P      P SPPPP    PSPPPPSPPPP    SPPPP     SPPPPP   
Sbjct: 372 PPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP-----SPPPPP--- 419

Query: 208 NSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            SPPPP     SPPPP      PP PP     PPS
Sbjct: 420 -SPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPS 453

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/103 (47%), Positives = 50/103 (48%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPP  PPP     P PPP    
Sbjct: 381 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPPSPPPPSPPPPSPPPPSPP 437

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 438 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 480

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/103 (47%), Positives = 50/103 (48%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS     P SPPPPP   P  PPP  PPP    SPPPP     
Sbjct: 391 PPPSPPPPSPPPPSPPPPSP---PPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPP 447

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 448 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 490

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 52/105 (49%), Positives = 53/105 (50%), Gaps = 2/105 (1%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
           PP S    SP   +   PS    SP  P PPP   PSPPPP  SPPP     SPPPP   
Sbjct: 279 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPPPSPPPSPPPPSPPPPSPP 335

Query: 175 YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             SPPPP     SPPPP     SPPPP     SPPPPP    SPP
Sbjct: 336 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP---PSPP 377

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 50/105 (47%), Positives = 51/105 (48%), Gaps = 2/105 (1%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
           PP S    SP   +   PS    SP  P PPP   P P PP  SPPPP     PPPPP  
Sbjct: 264 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPPPSP 320

Query: 175 YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 321 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 365

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 50/109 (45%), Positives = 51/109 (46%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   P P PP PPPP    SPPPP     
Sbjct: 220 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP---PSPPPPSPPPP 276

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPP------PYVYKSPPPPPYVYKSPP 309
           SPPPP     SPPPP     SPPPP      P     PPPPP    SPP
Sbjct: 277 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPP 325

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 50/104 (48%), Positives = 51/104 (49%), Gaps = 1/104 (0%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-SPPPPYIYKSPPPPPYVY 177
           PP S    SP   +   PS     P SPPPPP   P PPPP  PPP     SPPPP    
Sbjct: 125 PPPSPPPPSPPPPSPPPPSP---PPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPP 181

Query: 178 NSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 182 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 225

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 45/103 (43%), Positives = 48/103 (46%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  PPP P   P PP P PP P     PPP P   +
Sbjct: 289 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 348

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPP P   + PPP P     PPPPP    SPPPP     SPP
Sbjct: 349 PPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPP 391

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 43/81 (53%), Positives = 44/81 (54%)
 Frame = +1

Query: 70  SPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPP 249
           +P   PPP    PSPPPPSPPPP    SPPPP     SPPPP     SPPPPP     PP
Sbjct: 115 TPPPSPPPSQPPPSPPPPSPPPP----SPPPP-----SPPPP-----SPPPPP---SPPP 157

Query: 250 PPPYVYKSPPPPPYVYKSPPS 312
           PPP     PP PP     PPS
Sbjct: 158 PPPPPSPPPPSPPPPSPPPPS 178

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 50/107 (46%), Positives = 51/107 (47%), Gaps = 3/107 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPY 171
           PP S    SP   +   PS     P  PP PP   P PP P   SPPPP    SPPPP  
Sbjct: 350 PPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPP----SPPPP-- 403

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
              SPPPP     SPPPPP    SPPPP     SPPPP      PPS
Sbjct: 404 ---SPPPPSPPPPSPPPPP----SPPPPSPPPPSPPPPSPPSPPPPS 443

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 52/106 (49%), Positives = 53/106 (50%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPY 171
           PP S    SP   +   PS     P SPPPP    PSPPPP   SPPPP    SPPPP  
Sbjct: 396 PPPSPPPPSPPPPSPPPPSP--PPPPSPPPPSPPPPSPPPPSPPSPPPP----SPPPPSP 449

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 450 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 495

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 48/105 (45%), Positives = 49/105 (46%), Gaps = 2/105 (1%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
           PP S    SP   +   P      P  P PPP   P P PP  SPPPP    SPPPP   
Sbjct: 135 PPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPP 190

Query: 175 YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
             SPPPP     SPPPP     SPPPP     SPPPP     SPP
Sbjct: 191 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 235

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 43/84 (51%), Positives = 45/84 (53%), Gaps = 3/84 (3%)
 Frame = +1

Query: 67  VSPFSPPP-PPYVYPSPPPP--SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVY 237
           + P +PPP PP   P P PP  SPPPP    SPPPP     SPPPPP     PPPP    
Sbjct: 111 IPPTTPPPSPPPSQPPPSPPPPSPPPP----SPPPPSPPPPSPPPPPSPPPPPPPPSPPP 166

Query: 238 KSPPPPPYVYKSPPPPPYVYKSPP 309
            SPPPP     SPPPP     SPP
Sbjct: 167 PSPPPPSPPPPSPPPPSPPPPSPP 190

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 37/71 (52%), Positives = 39/71 (54%)
 Frame = +1

Query: 97  YVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSP 276
           Y+ P+ PPPSPPP     SPPPP     SPPPP     SPPPPP     PPPP     SP
Sbjct: 110 YIPPTTPPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSP 169

Query: 277 PPPPYVYKSPP 309
           PPP     SPP
Sbjct: 170 PPPSPPPPSPP 180

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 47/96 (48%), Positives = 48/96 (50%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP    SPPPP     
Sbjct: 460 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPP----SPPPP----- 507

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPP 288
           SPPPP     SPPPP     SPPP P     P  PP
Sbjct: 508 SPPPP-----SPPPP-----SPPPSPPPSHPPSHPP 533

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 47/104 (45%), Positives = 51/104 (49%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S    SP   +   PS    SP  P PPP   PSPPPPSPPPP    SPPPP     
Sbjct: 465 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPP----SPPPP----- 512

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPP     SPPP P     P  PP     P  PP++   PP+
Sbjct: 513 SPPPP-----SPPPSPPPSHPPSHPP--MHPPMHPPFL---PPT 546

[159][TOP]
>UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK2_CHLRE
          Length = 541

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 48/80 (60%), Positives = 48/80 (60%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P SPPPPP   PSPPPPSPPPP    SPPPPP     PPPPP    SPPPP     SPPP
Sbjct: 180 PPSPPPPPP--PSPPPPSPPPP----SPPPPPPPSPPPPPPP----SPPPPSPPPPSPPP 229

Query: 253 PPYVYKSPPPPPYVYKSPPS 312
           P     SPPPPP     PPS
Sbjct: 230 PSPPPPSPPPPPPPSPPPPS 249

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 46/80 (57%), Positives = 46/80 (57%)
 Frame = +1

Query: 70  SPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPP 249
           SP  PPPP    PSPPPPSPPPP     PPPPP    SPPPP     SPPPP     SPP
Sbjct: 182 SPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP---PSPPPPSPPPPSPPPPSPPPPSPP 238

Query: 250 PPPYVYKSPPPPPYVYKSPP 309
           PPP    SPPPP     SPP
Sbjct: 239 PPP--PPSPPPPSPPPPSPP 256

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 47/95 (49%), Positives = 47/95 (49%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP     S P       P      P  PPPPP   P PPPPSPPPP    SPPPP     
Sbjct: 175 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP----SPPPP----- 225

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
           SPPPP     SPPPPP    SPPPP     SPPPP
Sbjct: 226 SPPPPSPPPPSPPPPP--PPSPPPPSPPPPSPPPP 258

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 37/68 (54%), Positives = 37/68 (54%)
 Frame = +1

Query: 106 PSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
           P PPPP  PPP    SPPPP     SPPPPP     PPPPP    SPPPP     SPPPP
Sbjct: 175 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP----SPPPPSPPPPSPPPP 230

Query: 286 PYVYKSPP 309
                SPP
Sbjct: 231 SPPPPSPP 238

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 37/72 (51%), Positives = 38/72 (52%)
 Frame = +1

Query: 94  PYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKS 273
           P    + PPP PPP     SPPPPP    SPPPP     SPPPPP     PPPPP    S
Sbjct: 168 PVTRGASPPPPPPP-----SPPPPP--PPSPPPPSPPPPSPPPPPPPSPPPPPPP----S 216

Query: 274 PPPPPYVYKSPP 309
           PPPP     SPP
Sbjct: 217 PPPPSPPPPSPP 228

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 31/54 (57%), Positives = 32/54 (59%)
 Frame = +1

Query: 151 SPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPPP   + PPPPP    SPPPP     SPPPPP    SPPPPP     PPS
Sbjct: 174 SPPPPP-PPSPPPPPP---PSPPPPSPPPPSPPPPP--PPSPPPPPPPSPPPPS 221

[160][TOP]
>UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q948Y6_VOLCA
          Length = 1143

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/103 (52%), Positives = 57/103 (55%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S + +SP   +   P     SP  PP PP     PPPPSPPPP    SPPPPP    
Sbjct: 501 PPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPP---PSPPPPP---- 553

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP    SPPPPP    SPPPPP    SPPPPP    SPP
Sbjct: 554 SPPPPP----SPPPPP----SPPPPP----SPPPPP----SPP 580

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 53/103 (51%), Positives = 55/103 (53%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PPF     SP  ++   PS     P  P PPP   P PPP  PPPP    SPPPPP    
Sbjct: 496 PPFVPPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPP----SPPPPP---- 547

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           SPPPPP    SPPPPP    SPPPPP    SPPPPP    SPP
Sbjct: 548 SPPPPP----SPPPPP----SPPPPP----SPPPPP----SPP 574

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 42/72 (58%), Positives = 42/72 (58%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P SPPPPP   P P PP PP P    SPPPPP    SPPPPP    SPPPPP    SPPP
Sbjct: 534 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP----SPPPPP----SPPPPP----SPPP 581

Query: 253 PPYVYKSPPPPP 288
           PP     P PPP
Sbjct: 582 PPSPRHPPSPPP 593

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 50/104 (48%), Positives = 50/104 (48%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP      SP       P      P SPPPPP     PPPPSPPPP    SPPPPP    
Sbjct: 522 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP---SPPPPPSPPPP---PSPPPPP---- 571

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPPP    SPPPPP     P PPP      P PP    SPPS
Sbjct: 572 SPPPPP----SPPPPPSPRHPPSPPPRPRPPRPQPP----SPPS 607

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 47/104 (45%), Positives = 48/104 (46%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP      SP       P      P SPPPPP   P PPP  PPPP    SPPPPP    
Sbjct: 528 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPS--PPPPPSPPPPP----SPPPPP---- 577

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           SPPPPP   + P PPP      P PP    SPP P     SPPS
Sbjct: 578 SPPPPPSPRHPPSPPPRPRPPRPQPP----SPPSP-----SPPS 612

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 41/95 (43%), Positives = 42/95 (44%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP      SP       P      P SPPPPP   P PPP  PPPP    SPPPPP   +
Sbjct: 534 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPS--PPPPPSPPPPP----SPPPPPSPRH 587

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP 285
            P PPP      P PP    SPP P     SPP P
Sbjct: 588 PPSPPPRPRPPRPQPP----SPPSP-----SPPSP 613

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 38/80 (47%), Positives = 39/80 (48%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           PF PPPP  +  SP PPSP PP               P PP     SPPPPP    SPPP
Sbjct: 497 PFVPPPPSPLLTSPRPPSPRPP--------------RPSPP-----SPPPPP----SPPP 533

Query: 253 PPYVYKSPPPPPYVYKSPPS 312
           PP    SPPPPP     PPS
Sbjct: 534 PP----SPPPPPS-PPPPPS 548

[161][TOP]
>UniRef100_Q10R38 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=Q10R38_ORYSJ
          Length = 209

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 49/98 (50%), Positives = 55/98 (56%), Gaps = 2/98 (2%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPF--SPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYV 174
           P   A +S P+  T+ +P  +   P   S PPPP   P  PPP PPPP +  SPPPPP  
Sbjct: 31  PSPEAEASPPSPPTEASPPPLAPPPSVTSSPPPPAAGPLMPPP-PPPPSVTSSPPPPPL- 88

Query: 175 YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPP 288
              PPPPP    SPPPPP    SPPPP  V  SPPPPP
Sbjct: 89  ---PPPPPPPAASPPPPP---PSPPPPSPVKSSPPPPP 120

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 47/112 (41%), Positives = 55/112 (49%), Gaps = 11/112 (9%)
 Frame = +1

Query: 7   FSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPY-----------IYKS 153
           F    ++ +  T   P+    +  SPP PP    SPPP +PPP             +   
Sbjct: 14  FVVAIANADDYTTAAPAPSPEAEASPPSPP-TEASPPPLAPPPSVTSSPPPPAAGPLMPP 72

Query: 154 PPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           PPPPP V +SPPPPP     PPPPP    SPPPPP    SPPPP  V  SPP
Sbjct: 73  PPPPPSVTSSPPPPPL----PPPPPPPAASPPPPP---PSPPPPSPVKSSPP 117

[162][TOP]
>UniRef100_B9HRV2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HRV2_POPTR
          Length = 711

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/120 (44%), Positives = 64/120 (53%), Gaps = 22/120 (18%)
 Frame = +1

Query: 16  VSSSPNSSTKITPSGIGVSPFSPPPPPYVY-PSPPPPSPPPPYIYKSPP----PPPYVYN 180
           V S P SS  + P    + P +  PPP ++ P PP  SPPPP ++  PP    PPP VY+
Sbjct: 399 VHSPPPSSQSLPPLVHSLPPPAHSPPPSIHFPPPPVHSPPPPPVHSPPPPIYSPPPLVYS 458

Query: 181 SPP----PPPYVYNSPPP----PPYVYKSP-----PPPPYVYKSPP----PPPYVYKSPP 309
            PP    PPP V++ PPP    PP V+  P     PPPP VY  PP    PPP VY  PP
Sbjct: 459 PPPPVHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPVYSPPPPVHSPPPPVYSPPP 518

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 51/119 (42%), Positives = 59/119 (49%), Gaps = 16/119 (13%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPP----PPP 168
           PP    S  P   +   P      P   PPPP VY  PPP   PPP +Y  PP    PPP
Sbjct: 466 PPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPVYSPPPPVHSPPPPVYSPPPLVQSPPP 525

Query: 169 YVYNSP-----PPPPYVYNSPP----PPPYVYKSPPP---PPYVYKSPPPPPYVYKSPP 309
            V++ P     PPPP VY+ PP    PPP V+  PPP   PP    SPPPPP ++  PP
Sbjct: 526 PVHSPPPPLHSPPPPPVYSPPPPVHSPPPPVHSPPPPIQSPPPPVHSPPPPP-IHSPPP 583

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 57/127 (44%), Positives = 64/127 (50%), Gaps = 32/127 (25%)
 Frame = +1

Query: 25  SPNSSTKITPSGIGVSP----FSPPPPPYVYP----SPPPP--SPPPPYIYKSPPP---- 162
           SP  S    P  +   P     SPPPP Y  P    SPPPP  SPPPP ++  PPP    
Sbjct: 422 SPPPSIHFPPPPVHSPPPPPVHSPPPPIYSPPPLVYSPPPPVHSPPPP-VHSPPPPVQSF 480

Query: 163 PPYVYNSP-----PPPPYVYNSPP----PPPYVYKSPP----PPPYVYKSP-----PPPP 288
           PP V++ P     PPPP VY+ PP    PPP VY  PP    PPP V+  P     PPPP
Sbjct: 481 PPPVHSPPPPVHSPPPPPVYSPPPPVHSPPPPVYSPPPLVQSPPPPVHSPPPPLHSPPPP 540

Query: 289 YVYKSPP 309
            VY  PP
Sbjct: 541 PVYSPPP 547

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 56/126 (44%), Positives = 64/126 (50%), Gaps = 28/126 (22%)
 Frame = +1

Query: 16  VSSSPNSSTKITPSGIGVSPFSPPP-----PPYVYPSPPPPSPPPPYIYKSP------PP 162
           V S P   +K   SG GV   SPPP     PP V+  PPP   PPP I+  P      PP
Sbjct: 382 VVSRPVDCSKDKCSGGGVH--SPPPSSQSLPPLVHSLPPPAHSPPPSIH-FPPPPVHSPP 438

Query: 163 PPYVYNSPP----PPPYVYNSPP----PPPYVYKSPPP----PPYVYKSP-----PPPPY 291
           PP V++ PP    PPP VY+ PP    PPP V+  PPP    PP V+  P     PPPP 
Sbjct: 439 PPPVHSPPPPIYSPPPLVYSPPPPVHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPP 498

Query: 292 VYKSPP 309
           VY  PP
Sbjct: 499 VYSPPP 504

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 53/117 (45%), Positives = 59/117 (50%), Gaps = 14/117 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPP----P 162
           PP   V S P       P      P    PPP V+ SPPPP  SPPPP +Y  PP    P
Sbjct: 494 PPPPPVYSPPPPVHSPPPPVYSPPPLVQSPPPPVH-SPPPPLHSPPPPPVYSPPPPVHSP 552

Query: 163 PPYVYNSPPP---PPYVYNSPPPPPYVYKSPPPPPYVYKSPPPP-----PYVYKSPP 309
           PP V++ PPP   PP   +SPPPPP    SPPPP  V   PPPP     P V+  PP
Sbjct: 553 PPPVHSPPPPIQSPPPPVHSPPPPP--IHSPPPP--VQSLPPPPVNSPLPPVHSPPP 605

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 60/136 (44%), Positives = 66/136 (48%), Gaps = 34/136 (25%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSP---FSPPPP-----PYVYPSPPPP---------SPP 132
           P   V S P       P  I   P   +SPPPP     P V+ SPPPP         SPP
Sbjct: 430 PPPPVHSPPPPPVHSPPPPIYSPPPLVYSPPPPVHSPPPPVH-SPPPPVQSFPPPVHSPP 488

Query: 133 PPYIYKSPPPPPYVYNSPP----PPPYVYNSPP----PPPYVYKSP-----PPPPYVYKS 273
           PP    SPPPPP VY+ PP    PPP VY+ PP    PPP V+  P     PPPP VY  
Sbjct: 489 PP--VHSPPPPP-VYSPPPPVHSPPPPVYSPPPLVQSPPPPVHSPPPPLHSPPPPPVYSP 545

Query: 274 PP----PPPYVYKSPP 309
           PP    PPP V+  PP
Sbjct: 546 PPPVHSPPPPVHSPPP 561

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 45/109 (41%), Positives = 54/109 (49%), Gaps = 7/109 (6%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPP---PPY 171
           PP    S  P   +   P      P   PPPP VY  PPP   PPP ++  PPP   PP 
Sbjct: 509 PPPPVYSPPPLVQSPPPPVHSPPPPLHSPPPPPVYSPPPPVHSPPPPVHSPPPPIQSPPP 568

Query: 172 VYNSPPPPPYVYNSPPP----PPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
             +SPPPPP +++ PPP    PP    SP PP +   SPPPP +   SP
Sbjct: 569 PVHSPPPPP-IHSPPPPVQSLPPPPVNSPLPPVH---SPPPPVHSPTSP 613

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 41/91 (45%), Positives = 47/91 (51%), Gaps = 12/91 (13%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPP----PPYVYNSPPPPPYVYNSPPPPPY--- 231
           P   PPPP   P PP  SPPPP I+  PPP    PP   NSP PP    +SPPPP +   
Sbjct: 555 PVHSPPPPIQSPPPPVHSPPPPPIHSPPPPVQSLPPPPVNSPLPP---VHSPPPPVHSPT 611

Query: 232 --VYKSPPP---PPYVYKSPPPPPYVYKSPP 309
             ++  PPP   PP   +S PPPP     PP
Sbjct: 612 SPIHSHPPPVNSPPPPVQSLPPPPVNSPPPP 642

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 46/127 (36%), Positives = 59/127 (46%), Gaps = 23/127 (18%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPS------PPPPSPPPPYIYKS 153
           PP   + S P     + P  +  SP  P   PPPP   P+      PPP + PPP +   
Sbjct: 573 PPPPPIHSPPPPVQSLPPPPVN-SPLPPVHSPPPPVHSPTSPIHSHPPPVNSPPPPVQSL 631

Query: 154 PPPPPYVYNSPPPP-----PYVYNSPPP---PPYVYKSPPPPPY------VYKSPPPPPY 291
           PPPP    NSPPPP     P +++  PP   PP   +SPPPP +      V   PPPP  
Sbjct: 632 PPPP---VNSPPPPVHSPTPPIHSPSPPLHSPPPPIRSPPPPVFSPPPVIVSPPPPPPEE 688

Query: 292 VYKSPPS 312
            +  PP+
Sbjct: 689 DFILPPN 695

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 54/139 (38%), Positives = 59/139 (42%), Gaps = 36/139 (25%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPP---P 162
           PP    S  P   +   P      P   PPPP ++ SPPPP    PPPP     PP   P
Sbjct: 545 PPPPVHSPPPPVHSPPPPIQSPPPPVHSPPPPPIH-SPPPPVQSLPPPPVNSPLPPVHSP 603

Query: 163 PPYVY-------------NSPPP-----PPYVYNSPPP------PPYVYKSPP---PPPY 261
           PP V+             NSPPP     PP   NSPPP      PP    SPP   PPP 
Sbjct: 604 PPPVHSPTSPIHSHPPPVNSPPPPVQSLPPPPVNSPPPPVHSPTPPIHSPSPPLHSPPPP 663

Query: 262 VYKSPPP---PPYVYKSPP 309
           +   PPP   PP V  SPP
Sbjct: 664 IRSPPPPVFSPPPVIVSPP 682

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 39/86 (45%), Positives = 46/86 (53%), Gaps = 15/86 (17%)
 Frame = +1

Query: 79  SPPPPPYVYP-----SPPPP--SPPPPYIYKSPP---PPPYVYNSPP----PPPYVYNSP 216
           SPPPP    P     SPPPP  SP PP    SPP   PPP + + PP    PPP + + P
Sbjct: 623 SPPPPVQSLPPPPVNSPPPPVHSPTPPIHSPSPPLHSPPPPIRSPPPPVFSPPPVIVSPP 682

Query: 217 PPPPYV-YKSPPPPPYVYKSPPPPPY 291
           PPPP   +  PP   + Y SPPPP +
Sbjct: 683 PPPPEEDFILPPNLGFQYASPPPPTF 708

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 39/100 (39%), Positives = 46/100 (46%), Gaps = 21/100 (21%)
 Frame = +1

Query: 25  SPNSSTKITPSGIGVSP---FSPPPPPYVYPSPPPPSPPPPYIYKSPP---PPPYVYNSP 186
           SP S     P  +   P    S PPPP   P PP  SP PP    SPP   PPP + + P
Sbjct: 609 SPTSPIHSHPPPVNSPPPPVQSLPPPPVNSPPPPVHSPTPPIHSPSPPLHSPPPPIRSPP 668

Query: 187 PP----PPYVYNSPPPPP-----------YVYKSPPPPPY 261
           PP    PP + + PPPPP           + Y SPPPP +
Sbjct: 669 PPVFSPPPVIVSPPPPPPEEDFILPPNLGFQYASPPPPTF 708

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 29/77 (37%), Positives = 34/77 (44%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP    S  P   +   P      P   PPPP   P PP  SPPP  +   PPPP   + 
Sbjct: 632 PPPPVNSPPPPVHSPTPPIHSPSPPLHSPPPPIRSPPPPVFSPPPVIVSPPPPPPEEDFI 691

Query: 181 SPPPPPYVYNSPPPPPY 231
            PP   + Y SPPPP +
Sbjct: 692 LPPNLGFQYASPPPPTF 708

[163][TOP]
>UniRef100_Q9NGX2 Diaphanous protein n=1 Tax=Entamoeba histolytica RepID=Q9NGX2_ENTHI
          Length = 1209

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 45/96 (46%), Positives = 51/96 (53%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP  A S  P       P   G+    PPPPP   P  PPP PPPP +   PPPPP +  
Sbjct: 602 PPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPP-PPPPGMPGMPPPPPGMPG 660

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPP 288
            PPPPP +   PPPPP +   PPPPP +   PPPPP
Sbjct: 661 MPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPP 696

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 50/117 (42%), Positives = 56/117 (47%), Gaps = 19/117 (16%)
 Frame = +1

Query: 16  VSSSPNSSTKITPSGIGVSPFSPPPPP----YVYPSPPPPS-------------PPPPYI 144
           VS S  SS    P   G S   PPPPP     V P PPPP              PPPP +
Sbjct: 577 VSVSGTSSLAPPPPPPGASSIPPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGM 636

Query: 145 --YKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
                PPPPP +   PPPPP +   PPPPP +   PPPPP +   PPPPP +   PP
Sbjct: 637 PGMPPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPP 693

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 44/114 (38%), Positives = 52/114 (45%), Gaps = 11/114 (9%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS-----PPPPYIYKSPPPP 165
           P    +   P       P G+   P  PPPP      PPPP      PPPP +   PPPP
Sbjct: 616 PGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPP 675

Query: 166 PYVYNSPPPPPYVYNSPPPP------PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P +   PPPPP +   PPPP      P +   PPPPP +   PPPPP +   PP
Sbjct: 676 PGMPGMPPPPPGMPGMPPPPPGMPGMPGMPGMPPPPPGMPGMPPPPPGMPGMPP 729

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 12/108 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------SPPPPYIYKSPPP 162
           PP       P       P G+   P  PPPPP +   PPPP       PPPP +   PPP
Sbjct: 628 PPPPPPPGMPGMPPPPPPPGM---PGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPP 684

Query: 163 PPYVYNSPPPP------PYVYNSPPPPPYVYKSPPPPPYVYKSPPPPP 288
           PP +   PPPP      P +   PPPPP +   PPPPP +   PPPPP
Sbjct: 685 PPGMPGMPPPPPGMPGMPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPP 732

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 36/86 (41%), Positives = 43/86 (50%), Gaps = 12/86 (13%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPS------PPPPYIYKSPPPPPYVYNS------PPPPPYVYNSP 216
           P  PPPPP +   PPPP       PPPP +   PPPPP +         PPPPP +   P
Sbjct: 659 PGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPGMPGMPPPPPGMPGMP 718

Query: 217 PPPPYVYKSPPPPPYVYKSPPPPPYV 294
           PPPP +   PPPPP  +   P  P +
Sbjct: 719 PPPPGMPGMPPPPPGGFGFRPAAPVI 744

[164][TOP]
>UniRef100_Q9NGX1 Diaphanous protein (Fragment) n=1 Tax=Entamoeba histolytica
           RepID=Q9NGX1_ENTHI
          Length = 1096

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 45/96 (46%), Positives = 51/96 (53%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP  A S  P       P   G+    PPPPP   P  PPP PPPP +   PPPPP +  
Sbjct: 490 PPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPP-PPPPGMPGMPPPPPGMPG 548

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPP 288
            PPPPP +   PPPPP +   PPPPP +   PPPPP
Sbjct: 549 MPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPP 584

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 50/117 (42%), Positives = 56/117 (47%), Gaps = 19/117 (16%)
 Frame = +1

Query: 16  VSSSPNSSTKITPSGIGVSPFSPPPPP----YVYPSPPPPS-------------PPPPYI 144
           VS S  SS    P   G S   PPPPP     V P PPPP              PPPP +
Sbjct: 465 VSVSGTSSLAPPPPPPGASSIPPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGM 524

Query: 145 --YKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
                PPPPP +   PPPPP +   PPPPP +   PPPPP +   PPPPP +   PP
Sbjct: 525 PGMPPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPP 581

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 44/114 (38%), Positives = 52/114 (45%), Gaps = 11/114 (9%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPS-----PPPPYIYKSPPPP 165
           P    +   P       P G+   P  PPPP      PPPP      PPPP +   PPPP
Sbjct: 504 PGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPP 563

Query: 166 PYVYNSPPPPPYVYNSPPPP------PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
           P +   PPPPP +   PPPP      P +   PPPPP +   PPPPP +   PP
Sbjct: 564 PGMPGMPPPPPGMPGMPPPPPGMPGMPGMPGMPPPPPGMPGMPPPPPGMPGMPP 617

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 12/108 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP------SPPPPYIYKSPPP 162
           PP       P       P G+   P  PPPPP +   PPPP       PPPP +   PPP
Sbjct: 516 PPPPPPPGMPGMPPPPPPPGM---PGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPP 572

Query: 163 PPYVYNSPPPP------PYVYNSPPPPPYVYKSPPPPPYVYKSPPPPP 288
           PP +   PPPP      P +   PPPPP +   PPPPP +   PPPPP
Sbjct: 573 PPGMPGMPPPPPGMPGMPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPP 620

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 36/86 (41%), Positives = 43/86 (50%), Gaps = 12/86 (13%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPS------PPPPYIYKSPPPPPYVYNS------PPPPPYVYNSP 216
           P  PPPPP +   PPPP       PPPP +   PPPPP +         PPPPP +   P
Sbjct: 547 PGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPGMPGMPPPPPGMPGMP 606

Query: 217 PPPPYVYKSPPPPPYVYKSPPPPPYV 294
           PPPP +   PPPPP  +   P  P +
Sbjct: 607 PPPPGMPGMPPPPPGGFGFRPAAPVI 632

[165][TOP]
>UniRef100_C5YH07 Putative uncharacterized protein Sb07g003820 n=1 Tax=Sorghum
           bicolor RepID=C5YH07_SORBI
          Length = 640

 Score = 87.8 bits (216), Expect(2) = 7e-17
 Identities = 47/105 (44%), Positives = 54/105 (51%), Gaps = 23/105 (21%)
 Frame = +1

Query: 67  VSPFSPPP----------PPYVY--PSPPPPSPPPPYIYK---------SPPPPPYVYNS 183
           ++P++PPP          PPY    P PPPP PPPP+  +          PPPPP +Y  
Sbjct: 27  MNPYAPPPQQAPYNRMPAPPYHAGPPPPPPPGPPPPHQPQFNFGPGPPQQPPPPPQMYYQ 86

Query: 184 PPPPPY--VYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
           PPPPPY    N PPPPP V   PP PP     PPPPP     PPS
Sbjct: 87  PPPPPYGGTSNPPPPPPSVPPPPPSPPPAAPPPPPPPPA--QPPS 129

 Score = 22.7 bits (47), Expect(2) = 7e-17
 Identities = 9/24 (37%), Positives = 11/24 (45%)
 Frame = +2

Query: 11 PPSHLHPTPPQK*HPPALESLHSP 82
          P  H  P PPQ  +PP +     P
Sbjct: 10 PQQHPPPPPPQGGYPPQMNPYAPP 33

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 45/101 (44%), Positives = 47/101 (46%), Gaps = 21/101 (20%)
 Frame = +1

Query: 73  PFSPPP----PPYVYPSPPPPS-------PPPPYIYKSPPPPPYVYNSPPPP-------- 195
           P  PPP    PP + P  PPP        P PPY    PPPPP     PPPP        
Sbjct: 14  PPPPPPQGGYPPQMNPYAPPPQQAPYNRMPAPPYHAGPPPPPP---PGPPPPHQPQFNFG 70

Query: 196 PYVYNSPPPPPYVYKSPPPPPY--VYKSPPPPPYVYKSPPS 312
           P     PPPPP +Y  PPPPPY      PPPPP V   PPS
Sbjct: 71  PGPPQQPPPPPQMYYQPPPPPYGGTSNPPPPPPSVPPPPPS 111

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 38/98 (38%), Positives = 45/98 (45%), Gaps = 17/98 (17%)
 Frame = +1

Query: 67  VSPFSPPPPPYVYPSPPPPSP--PPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPP----- 225
           ++ + P  PP  +P PPPP    PP     +PPP    YN  P PPY    PPPP     
Sbjct: 1   MASYRPYAPPQQHPPPPPPQGGYPPQMNPYAPPPQQAPYNRMPAPPYHAGPPPPPPPGPP 60

Query: 226 ----------PYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
                     P   + PPPPP +Y  PPPPPY   S P
Sbjct: 61  PPHQPQFNFGPGPPQQPPPPPQMYYQPPPPPYGGTSNP 98

 Score = 62.8 bits (151), Expect(2) = 4e-09
 Identities = 35/72 (48%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKS--PPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           P  PPPPP +Y  PPPP    PY   S  PPPPP V   PP PP     PPPPP     P
Sbjct: 74  PQQPPPPPQMYYQPPPP----PYGGTSNPPPPPPSVPPPPPSPPPAAPPPPPPP-----P 124

Query: 247 PPPPYVYKSPPP 282
             PP V    PP
Sbjct: 125 AQPPSVQAPLPP 136

 Score = 21.6 bits (44), Expect(2) = 4e-09
 Identities = 8/17 (47%), Positives = 9/17 (52%)
 Frame = +2

Query: 8  SPPSHLHPTPPQK*HPP 58
          +PP H  P PP    PP
Sbjct: 44 APPYHAGPPPPPPPGPP 60

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 34/72 (47%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +1

Query: 76  FSPPPPPY---VYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSP 246
           + PPPPPY     P PPPPS PPP     PP PP     PPPPP     P  PP V ++P
Sbjct: 85  YQPPPPPYGGTSNPPPPPPSVPPP-----PPSPPPAAPPPPPPP-----PAQPPSV-QAP 133

Query: 247 PPPPYVYKSPPP 282
            PP    K  PP
Sbjct: 134 LPP----KEQPP 141

[166][TOP]
>UniRef100_Q41805 Extensin-like protein n=1 Tax=Zea mays RepID=Q41805_MAIZE
          Length = 1188

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 54/117 (46%), Positives = 59/117 (50%), Gaps = 14/117 (11%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSP---FSPPPP-PYVYPSPPPPSPPPPYIYKSPPPPP 168
           PP S VS  P   +   P+ +G  P    SPPPP P   P PP  SPPPP +  SPPPP 
Sbjct: 536 PPVSVVSPPPPVKSPPPPAPVGSPPPPEKSPPPPAPVASPPPPVKSPPPPTLVASPPPP- 594

Query: 169 YVYNSPPPPPYVYNSPPP-----PPYVYKSPPPPPYVYKSP-----PPPPYVYKSPP 309
               SPPPP  V + PPP     PP    SPPPP  V  SP     PPPP    SPP
Sbjct: 595 --VKSPPPPAPVASPPPPVKSPPPPTPVASPPPPAPVASSPPPMKSPPPPTPVSSPP 649

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 55/118 (46%), Positives = 61/118 (51%), Gaps = 15/118 (12%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPP--SPPPPYIYKSPPPP 165
           PP + V+S P       P  +  SP  P   PPPP    SPPPP  SPPPP    SPPPP
Sbjct: 567 PPPAPVASPPPPVKSPPPPTLVASPPPPVKSPPPPAPVASPPPPVKSPPPPTPVASPPPP 626

Query: 166 PYVYNSPPP-----PPYVYNSPPPPPYVYKSPPPPPYVYKSPPP-----PPYVYKSPP 309
             V +SPPP     PP   +SPPPP    KSPPPPP    +PPP     PP   KS P
Sbjct: 627 APVASSPPPMKSPPPPTPVSSPPPPE---KSPPPPPPAKSTPPPEEYPTPPTSVKSSP 681

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 53/114 (46%), Positives = 57/114 (50%), Gaps = 11/114 (9%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVS----PFSPPPPPYVYPSPPPP--SPPPPYIYKSPPP 162
            PP + +SS P    K  P    VS    P   PPPP    SPPPP  SPPPP    SPPP
Sbjct: 996  PPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPP 1055

Query: 163  PPYVYNSPPPPPYVYNSP-----PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            P     SPPPP  + + P     PPPP    SPPPP    KSPPPP  V   PP
Sbjct: 1056 P---VKSPPPPAPISSPPPPVKSPPPPAPVSSPPPP---VKSPPPPAPVSSPPP 1103

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 55/115 (47%), Positives = 57/115 (49%), Gaps = 11/115 (9%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVS----PFSPPPPPYVYPSPPPP--SPPPPYIYKSPPP 162
            PP  A  SSP    K  P    VS    P   PPPP    SPPPP  SPPPP    SPPP
Sbjct: 1012 PPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPISSPPP 1071

Query: 163  PPYVYNSPPPPPYVYNSP-----PPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            P     SPPPP  V + P     PPPP    SPPPP    KSPPPP  V   PP+
Sbjct: 1072 P---VKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPP---IKSPPPPAPVSSPPPA 1120

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 53/121 (43%), Positives = 58/121 (47%), Gaps = 18/121 (14%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSP---PPPPYVYPSPPPP-----------SPPPP 138
           PP + V S P       P     SP  P   PPPP +  SPPPP           SPPPP
Sbjct: 551 PPPAPVGSPPPPEKSPPPPAPVASPPPPVKSPPPPTLVASPPPPVKSPPPPAPVASPPPP 610

Query: 139 YIYKSPPPPPYVYNSPPPPPYVYNSP----PPPPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
              KSPPPP  V + PPP P   + P    PPPP    SPPPP    KSPPPPP    +P
Sbjct: 611 V--KSPPPPTPVASPPPPAPVASSPPPMKSPPPPTPVSSPPPPE---KSPPPPPPAKSTP 665

Query: 307 P 309
           P
Sbjct: 666 P 666

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 54/114 (47%), Positives = 57/114 (50%), Gaps = 11/114 (9%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSP----PPPPYVYPSPPPP--SPPPPYIYKSPPP 162
            PP + VSS P +     P     SP  P    PPPP    SPPPP  SPPPP    SPPP
Sbjct: 980  PPPTPVSSPPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPP 1039

Query: 163  PPYVYNSPPPPPYVYNSPPP-----PPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            P     SPPPP  V + PPP     PP    SPPPP    KSPPPP  V   PP
Sbjct: 1040 P---VKSPPPPAPVSSPPPPVKSPPPPAPISSPPPP---VKSPPPPAPVSSPPP 1087

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 53/120 (44%), Positives = 61/120 (50%), Gaps = 17/120 (14%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP-----FSPPPPPYVYPSPPP-PSPPPPYIYKSPPP 162
            PP +  SS P +   + P  +  SP      SPPP P   P P P  SPPPP + KSPPP
Sbjct: 956  PPATPKSSPPPAPVNLPPPEVKSSPPPTPVSSPPPAPKSSPPPAPMSSPPPPEV-KSPPP 1014

Query: 163  PPYVYNSP-----PPPPYVYNSPPPPPYVYKSPPP------PPYVYKSPPPPPYVYKSPP 309
            P  V + P     PPPP   +SPPPP    KSPPP      PP   KSPPPP  +   PP
Sbjct: 1015 PAPVSSPPPPVKSPPPPAPVSSPPPP---VKSPPPPAPVSSPPPPVKSPPPPAPISSPPP 1071

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 53/114 (46%), Positives = 54/114 (47%), Gaps = 11/114 (9%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVS----PFSPPPPPYVYPSPPPP--SPPPPYIYKSPPP 162
            PP  A  SSP    K  P    VS    P   PPPP    SPPPP  SPPPP    SPPP
Sbjct: 1028 PPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPISSPPPPVKSPPPPAPVSSPPP 1087

Query: 163  PPYVYNSPPPPPYVYNSPPP-----PPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            P     SPPPP  V + PPP     PP    SPPP P    S PPP  V   PP
Sbjct: 1088 P---VKSPPPPAPVSSPPPPIKSPPPPAPVSSPPPAPVKPPSLPPPAPVSSPPP 1138

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 52/104 (50%), Positives = 55/104 (52%), Gaps = 1/104 (0%)
 Frame = +1

Query: 1   PPFSAVSSSPNS-STKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVY 177
           PP + V S P    T   P+ IG SP  PPP   V P PP  SPPPP    SPPPP    
Sbjct: 508 PPQAPVGSPPPPVKTTSPPAPIG-SPSPPPPVSVVSPPPPVKSPPPPAPVGSPPPP---- 562

Query: 178 NSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
              PPPP    SPPPP    KSPPPP  +  SPPPP    KSPP
Sbjct: 563 EKSPPPPAPVASPPPP---VKSPPPPT-LVASPPPP---VKSPP 599

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 51/109 (46%), Positives = 56/109 (51%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-SPPPPYIYKSPPPPPYVY 177
           PP  A  +SP    K  P    V+  SPPPP  V  SPPP  SPPPP    SPPPP    
Sbjct: 598 PPPPAPVASPPPPVKSPPPPTPVA--SPPPPAPVASSPPPMKSPPPPTPVSSPPPPE--- 652

Query: 178 NSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPP-----PPPYVYKSPP 309
            SPPPPP   ++PPP  Y    P PP  V  SPP     PPP +  SPP
Sbjct: 653 KSPPPPPPAKSTPPPEEY----PTPPTSVKSSPPPEKSLPPPTLIPSPP 697

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 54/126 (42%), Positives = 60/126 (47%), Gaps = 23/126 (18%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP-----FSPPPPPYVYP-----SPPPPSP---PPPY 141
            PP + VSS P +     P  +  SP      SPPP P   P     S PPP+P   PPP 
Sbjct: 916  PPPAMVSSPPMTPKSSPPPVVVSSPPPTVKSSPPPAPVSSPPATPKSSPPPAPVNLPPPE 975

Query: 142  IYKSPPPPPYVYNSPPP-----PPYVYNSPPPPPYVYKSPPP-----PPYVYKSPPPPPY 291
            +  SPPP P   +SPPP     PP    S PPPP V   PPP     PP   KSPPPP  
Sbjct: 976  VKSSPPPTP--VSSPPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPPAP 1033

Query: 292  VYKSPP 309
            V   PP
Sbjct: 1034 VSSPPP 1039

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 49/108 (45%), Positives = 55/108 (50%), Gaps = 4/108 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP----SPPPPYIYKSPPPPP 168
           PP  A S+ P S  K++P     +P   PPPP    SPP P    SPPPP    SPPPP 
Sbjct: 493 PP--AASTPPPSLVKLSPPQ---APVGSPPPPVKTTSPPAPIGSPSPPPPVSVVSPPPPV 547

Query: 169 YVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
                 PPPP    SPPPP    KSPPPP  V  + PPPP     PP+
Sbjct: 548 ----KSPPPPAPVGSPPPPE---KSPPPPAPV--ASPPPPVKSPPPPT 586

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 53/135 (39%), Positives = 61/135 (45%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPP----PPPYVYPSPPP---PSPP-----PPYI 144
            PP  A S+ P       P+ +  SP  PP    PPP + PSPPP   P+PP     PP  
Sbjct: 657  PPPPAKSTPPPEEYPTPPTSVKSSP--PPEKSLPPPTLIPSPPPQEKPTPPSTPSKPPSS 714

Query: 145  YKSPPPPPYVYNSPP------PPPYVYNSPPP--------------PPYVYKSPPPPPYV 264
             + P PP    +SPP      PPP   +SPPP              PP V  SPPP P  
Sbjct: 715  PEKPSPPKEPVSSPPQTPKSSPPPAPVSSPPPTPVSSPPALAPVSSPPSVKSSPPPAP-- 772

Query: 265  YKSPPPPPYVYKSPP 309
              SPPP P V  SPP
Sbjct: 773  LSSPPPAPQVKSSPP 787

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 52/113 (46%), Positives = 56/113 (49%), Gaps = 9/113 (7%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
            PP  A  SSP    K  P     +P S PPPP   P PP P  SPPPP   KSPPPP  V
Sbjct: 1060 PPPPAPISSPPPPVKSPPPP---APVSSPPPPVKSPPPPAPVSSPPPPI--KSPPPPAPV 1114

Query: 175  YNSPPPPPYVYNSPP--PPPYVYKSPPP-----PPYVYKSPPPPPYVYKSPPS 312
             +SPPP P     PP  PPP    SPPP     PP   +   PPP   + PPS
Sbjct: 1115 -SSPPPAPV---KPPSLPPPAPVSSPPPVVTPAPPKKEEQSLPPPAESQPPPS 1163

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 55/134 (41%), Positives = 59/134 (44%), Gaps = 31/134 (23%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPP-----PPPYVYPSPP--PPSPPPPYIYKSPP 159
            PP      SP S  K +P    VS   PP     PPP +  SPP  P S PPP +  SPP
Sbjct: 883  PPAPTTVISPPSEPKSSPPPTPVS-LPPPIVKSSPPPAMVSSPPMTPKSSPPPVVVSSPP 941

Query: 160  P------PPYVYNSPP------PPPYVYNSPPP------PPYVYKSPPP------PPYVY 267
            P      PP   +SPP      PPP   N PPP      PP    SPPP      PP   
Sbjct: 942  PTVKSSPPPAPVSSPPATPKSSPPPAPVNLPPPEVKSSPPPTPVSSPPPAPKSSPPPAPM 1001

Query: 268  KSPPPPPYVYKSPP 309
             SPPPP    KSPP
Sbjct: 1002 SSPPPPE--VKSPP 1013

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 49/113 (43%), Positives = 55/113 (48%), Gaps = 16/113 (14%)
 Frame = +1

Query: 19   SSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPP------PPPYVYN 180
            S+ P  +T I+P     S  SPPP P   P P   S PPP +  SPP      PPP V +
Sbjct: 881  STPPAPTTVISPPSEPKS--SPPPTPVSLPPPIVKSSPPPAMVSSPPMTPKSSPPPVVVS 938

Query: 181  SPPPPPYVYNSPPP-----PPYVYKSPPPPPYVYKSPP-----PPPYVYKSPP 309
            SPPP   V +SPPP     PP   KS PPP  V   PP     PPP    SPP
Sbjct: 939  SPPPT--VKSSPPPAPVSSPPATPKSSPPPAPVNLPPPEVKSSPPPTPVSSPP 989

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 50/115 (43%), Positives = 56/115 (48%), Gaps = 11/115 (9%)
 Frame = +1

Query: 1    PPFSAVSSSP---NSSTKITPSGIGVSPFSPPPPPYVYPSPP--PPSPPPPYIYKSPPPP 165
            PP + + S P     +   TPS    SP  P PP     SPP  P S PPP    SPPP 
Sbjct: 688  PPPTLIPSPPPQEKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQTPKSSPPPAPVSSPPPT 747

Query: 166  PYVYNSPPP------PPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPS 312
            P   +SPP       PP V +SPPP P    SPPP P V KS PPP  V   PP+
Sbjct: 748  PV--SSPPALAPVSSPPSVKSSPPPAPL--SSPPPAPQV-KSSPPPVQVSSPPPA 797

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 51/130 (39%), Positives = 57/130 (43%), Gaps = 26/130 (20%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
           PP + V+SSP       P     +P S PPPP   P PPPP  S PPP  Y  P PP  V
Sbjct: 624 PPPAPVASSPPPMKSPPPP----TPVSSPPPPEKSPPPPPPAKSTPPPEEY--PTPPTSV 677

Query: 175 YNSPPP-----PPYVYNSPPP-----PPYVYKSPPP--------------PPYVYKSPPP 282
            +SPPP     PP +  SPPP     PP     PP               PP   KS PP
Sbjct: 678 KSSPPPEKSLPPPTLIPSPPPQEKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQTPKSSPP 737

Query: 283 PPYVYKSPPS 312
           P  V   PP+
Sbjct: 738 PAPVSSPPPT 747

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 48/125 (38%), Positives = 55/125 (44%), Gaps = 22/125 (17%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGV-SPFSPPPPPYVYPSPPPPSPPPPYIYKSP------- 156
           PP  +    P  S    P+ + + +P SPP   YV P+PP P   PP    SP       
Sbjct: 437 PPDVSPEPLPEPSPVPAPAPMPMPTPHSPPADDYVPPTPPVPGKSPPATSPSPQVQPPAA 496

Query: 157 --PPPPYVYNSPP------PPPYVYNSPPPPPYVYKSPPP------PPYVYKSPPPPPYV 294
             PPP  V  SPP      PPP V  + PP P    SPPP      PP   KSPPPP  V
Sbjct: 497 STPPPSLVKLSPPQAPVGSPPPPVKTTSPPAPIGSPSPPPPVSVVSPPPPVKSPPPPAPV 556

Query: 295 YKSPP 309
              PP
Sbjct: 557 GSPPP 561

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 56/135 (41%), Positives = 62/135 (45%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPP-----PPYVYPSPPPPS---PPPPYIYKSP 156
            PP   VSS P +  K +P    VS  SPPP     PP + P   PPS    PPP    SP
Sbjct: 720  PPKEPVSSPPQTP-KSSPPPAPVS--SPPPTPVSSPPALAPVSSPPSVKSSPPPAPLSSP 776

Query: 157  PPPPYVYNSPP------PPPYVYNSPP-----PPPYVYKSPPP------PPYVYKSPP-- 279
            PP P V +SPP      PPP   +SPP      PP V K+ PP      PP   KS P  
Sbjct: 777  PPAPQVKSSPPPVQVSSPPPAPKSSPPLAPVSSPPQVEKTSPPPAPLSSPPLAPKSSPPH 836

Query: 280  -----PPPYVYKSPP 309
                 PPP V  SPP
Sbjct: 837  VVVSSPPPVVKSSPP 851

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 52/121 (42%), Positives = 58/121 (47%), Gaps = 18/121 (14%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSP-----FSPPPPPYVYPSPPPP--SPPPPYIYKSPP 159
            PP + VSS P  +   +P  +  SP      SPPP P V  SPPP   S PPP    SPP
Sbjct: 744  PPPTPVSSPPALAPVSSPPSVKSSPPPAPLSSPPPAPQVKSSPPPVQVSSPPPAPKSSPP 803

Query: 160  ------PPPYVYNSPPPPPYVYNSPP-----PPPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
                  PP     SPPP P   +SPP      PP+V  S PPP  V  SPPP P    SP
Sbjct: 804  LAPVSSPPQVEKTSPPPAPL--SSPPLAPKSSPPHVVVSSPPP-VVKSSPPPAP--VSSP 858

Query: 307  P 309
            P
Sbjct: 859  P 859

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 52/142 (36%), Positives = 58/142 (40%), Gaps = 38/142 (26%)
 Frame = +1

Query: 1    PPFSAVSSSPN-SSTKITPSGIGVSPFSPPP-PPYVYPSPPPP---SPPPPYIYKSPP-- 159
            PP + VSS P    T   P+ +   P +P   PP+V  S PPP   S PPP    SPP  
Sbjct: 802  PPLAPVSSPPQVEKTSPPPAPLSSPPLAPKSSPPHVVVSSPPPVVKSSPPPAPVSSPPLT 861

Query: 160  ------------PPPYVYNSPPPPPYVYNSPP--------------PPPYVYKSPPP--- 252
                        PP  V  S PP P    SPP              PPP V  SPPP   
Sbjct: 862  PKPASPPAHVSSPPEVVKPSTPPAPTTVISPPSEPKSSPPPTPVSLPPPIVKSSPPPAMV 921

Query: 253  --PPYVYKSPPPPPYVYKSPPS 312
              PP   KS PPP  V   PP+
Sbjct: 922  SSPPMTPKSSPPPVVVSSPPPT 943

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 47/112 (41%), Positives = 52/112 (46%), Gaps = 9/112 (8%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP---SPPPPYIYKSPPPPPY 171
           PP   V      +T  +P  +     S PPP  V  SPP     SPPPP    SPP P  
Sbjct: 472 PPTPPVPGKSPPATSPSPQ-VQPPAASTPPPSLVKLSPPQAPVGSPPPPVKTTSPPAP-- 528

Query: 172 VYNSPPPPPYVYNSPPPPPYVYKSPPP------PPYVYKSPPPPPYVYKSPP 309
           + +  PPPP    SPPPP    KSPPP      PP   KSPPPP  V   PP
Sbjct: 529 IGSPSPPPPVSVVSPPPP---VKSPPPPAPVGSPPPPEKSPPPPAPVASPPP 577

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 48/122 (39%), Positives = 56/122 (45%), Gaps = 18/122 (14%)
 Frame = +1

Query: 1    PPFSAVSSSPNS-STKITPSGIGVSPFSPPP--PPYVYPSPP----PPSPPPPYIYKSPP 159
            PP   VSS P    +   P+ +   P +P P  PP    SPP    P +PP P    SPP
Sbjct: 834  PPHVVVSSPPPVVKSSPPPAPVSSPPLTPKPASPPAHVSSPPEVVKPSTPPAPTTVISPP 893

Query: 160  PPPYVYNSPPP------PPYVYNSPPP-----PPYVYKSPPPPPYVYKSPPPPPYVYKSP 306
              P   +SPPP      PP V +SPPP     PP   KS PPP  V  S PPP      P
Sbjct: 894  SEPK--SSPPPTPVSLPPPIVKSSPPPAMVSSPPMTPKSSPPPVVV--SSPPPTVKSSPP 949

Query: 307  PS 312
            P+
Sbjct: 950  PA 951

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 48/135 (35%), Positives = 55/135 (40%), Gaps = 32/135 (23%)
 Frame = +1

Query: 1    PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP-----SPPP----PYIYKS 153
            PP + V+S P  +    P      P   PPPP    SPPPP      PPP    P   + 
Sbjct: 615  PPPTPVASPPPPA----PVASSPPPMKSPPPPTPVSSPPPPEKSPPPPPPAKSTPPPEEY 670

Query: 154  PPPPPYVYNSPP-----PPPYVYNSPPP------------PPYVYKSPPPPPYVYKSPP- 279
            P PP  V +SPP     PPP +  SPPP            PP   + P PP     SPP 
Sbjct: 671  PTPPTSVKSSPPPEKSLPPPTLIPSPPPQEKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQ 730

Query: 280  -----PPPYVYKSPP 309
                 PPP    SPP
Sbjct: 731  TPKSSPPPAPVSSPP 745

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 49/114 (42%), Positives = 54/114 (47%), Gaps = 10/114 (8%)
 Frame = +1

Query: 1    PPFSAVSS---SPNSSTKITP--SGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPP 165
            PP   VSS   +P SS  + P  S   V   SPPP P   P   P S PP  +  S  PP
Sbjct: 786  PPPVQVSSPPPAPKSSPPLAPVSSPPQVEKTSPPPAPLSSPPLAPKSSPPHVVVSS--PP 843

Query: 166  PYVYNSPPPPPYVYNSPPPPPYVYKSPP-----PPPYVYKSPPPPPYVYKSPPS 312
            P V +SPPP P   +SPP  P    SPP     PP  V  S PP P    SPPS
Sbjct: 844  PVVKSSPPPAP--VSSPPLTPKP-ASPPAHVSSPPEVVKPSTPPAPTTVISPPS 894

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 43/109 (39%), Positives = 46/109 (42%), Gaps = 6/109 (5%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP S V   P +S  +          SP  PP V P P P   P P     P P P+   
Sbjct: 416 PPSSPVPGKPAASAPMP---------SPHTPPDVSPEPLPEPSPVPAPAPMPMPTPH--- 463

Query: 181 SPPPPPYVYNSPPPPPYVYKSPP---PPPYVY---KSPPPPPYVYKSPP 309
           SPP   YV   PP PP   KSPP   P P V     S PPP  V  SPP
Sbjct: 464 SPPADDYV---PPTPPVPGKSPPATSPSPQVQPPAASTPPPSLVKLSPP 509

[167][TOP]
>UniRef100_A3KD20 Leucine-rich repeat/extensin n=1 Tax=Nicotiana plumbaginifolia
           RepID=A3KD20_NICPL
          Length = 725

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 61/144 (42%), Positives = 68/144 (47%), Gaps = 42/144 (29%)
 Frame = +1

Query: 1   PPFSAVSSSPNS--------STKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIY--- 147
           PP    SSSP+         + KI+P     SP  PPPP  VY   P PSPPPP +Y   
Sbjct: 449 PPPPVYSSSPSHKHRSPPPPTHKISPVTRHASP-PPPPPSPVYYHHPSPSPPPPPVYYAP 507

Query: 148 -----KSPPPPP---------YVYNSPPPPP--------YVYNSPPPPPYVYKSPP---- 249
                +SPPPPP         Y   SPPPPP        Y   SPPPPP V+  PP    
Sbjct: 508 PTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTP 567

Query: 250 --PPPYVY---KSPPPPPYVYKSP 306
             PPP VY    SPPPP  VY+ P
Sbjct: 568 HSPPPPVYVTPSSPPPPTPVYEHP 591

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/108 (48%), Positives = 54/108 (50%), Gaps = 5/108 (4%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKIT--PSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYV 174
           PP S     P  S   T  PS        PPPP Y Y SPPPPSP       SPPPP Y 
Sbjct: 621 PPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPSP-------SPPPPTYY 673

Query: 175 YNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYV---YKSPP 309
           Y+SPPPP     SP PPP    SP PPP  Y+  P PP V   Y SPP
Sbjct: 674 YSSPPPPSPPPPSPSPPP---PSPSPPPPSYEHVPLPPVVGVSYASPP 718

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 55/122 (45%), Positives = 59/122 (48%), Gaps = 18/122 (14%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKI--TPSGIGVSPFSPPPPPYVYPSPPP--------PSPPPPY--- 141
           PP + V   P  S     TP      P  P PP    P+PPP        PSPPP Y   
Sbjct: 582 PPPTPVYEHPTPSPPAGYTPPQEPSHPAPPTPPCNEPPTPPPSTPHWQPKPSPPPTYNPS 641

Query: 142 --IYKSPPPPP--YVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSP-PPPPYVYKSP 306
               +SPPPPP  Y Y+SPPPP     SPPPP Y Y SPPPP     SP PPPP     P
Sbjct: 642 PSYTQSPPPPPPTYTYSSPPPPS---PSPPPPTYYYSSPPPPSPPPPSPSPPPPSPSPPP 698

Query: 307 PS 312
           PS
Sbjct: 699 PS 700

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/107 (44%), Positives = 53/107 (49%), Gaps = 4/107 (3%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPP----PPSPPPPYIYKSPPPPP 168
           PP +   + P S+    P         P PPP   PSP     PP PPP Y Y SPPPP 
Sbjct: 613 PPCNEPPTPPPSTPHWQPK--------PSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPS 664

Query: 169 YVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
               SPPPP Y Y+SPPPP     SP PPP    SP PPP  Y+  P
Sbjct: 665 ---PSPPPPTYYYSSPPPPSPPPPSPSPPP---PSPSPPPPSYEHVP 705

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 54/134 (40%), Positives = 69/134 (51%), Gaps = 31/134 (23%)
 Frame = +1

Query: 4   PFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV- 174
           P + + S P  S+K + S    SP  PPP     PSPPPP  S  P + ++SPPPP +  
Sbjct: 415 PVAPIESPPPPSSKSSGSHFKRSP--PPPQSTPPPSPPPPVYSSSPSHKHRSPPPPTHKI 472

Query: 175 -----YNSPPPPP----YVYN---SPPPPPYVY-------KSPPPPP---------YVYK 270
                + SPPPPP    Y ++   SPPPPP  Y       +SPPPPP         Y  +
Sbjct: 473 SPVTRHASPPPPPPSPVYYHHPSPSPPPPPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQ 532

Query: 271 SPPPPPYVYKSPPS 312
           SPPPPP V+  PP+
Sbjct: 533 SPPPPPPVHYEPPT 546

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 57/145 (39%), Positives = 67/145 (46%), Gaps = 41/145 (28%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPY------VYPSPPPP-----------SP 129
           PP  +  SS +   +  P      P SPPPP Y       + SPPPP           SP
Sbjct: 422 PPPPSSKSSGSHFKRSPPPPQSTPPPSPPPPVYSSSPSHKHRSPPPPTHKISPVTRHASP 481

Query: 130 PPP------YIYKSP-PPPPYVYNSPPPPPYVYNSPPPPP---------YVYKSPPPPP- 258
           PPP      Y + SP PPPP VY +  PP Y   SPPPPP         Y  +SPPPPP 
Sbjct: 482 PPPPPSPVYYHHPSPSPPPPPVYYA--PPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPP 539

Query: 259 -------YVYKSPPPPPYVYKSPPS 312
                  Y  +SPPPPP V+  PP+
Sbjct: 540 VHYEPPTYTPQSPPPPPPVHYEPPT 564

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 49/119 (41%), Positives = 52/119 (43%), Gaps = 39/119 (32%)
 Frame = +1

Query: 70  SPFSPPPPPYVYPSPPPPSPPPPYIYKSP-PPPPYVYNSP-------------------- 186
           +P SPPPP YV PS PPP  P   +Y+ P P PP  Y  P                    
Sbjct: 566 TPHSPPPPVYVTPSSPPPPTP---VYEHPTPSPPAGYTPPQEPSHPAPPTPPCNEPPTPP 622

Query: 187 ---------PPPPYVYN-------SPPPPP--YVYKSPPPPPYVYKSPPPPPYVYKSPP 309
                    P PP  YN       SPPPPP  Y Y SPPPP     SPPPP Y Y SPP
Sbjct: 623 PSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPS---PSPPPPTYYYSSPP 678

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 48/114 (42%), Positives = 55/114 (48%), Gaps = 9/114 (7%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPP---PPSPPPPYIYKSPP---- 159
           PP     S P     +       +P SPPPPP V+  PP   P SPPPP     PP    
Sbjct: 507 PPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPQSPPPP-----PPVHYE 561

Query: 160 PPPYVYNSPPPPPYVY-NSPPPPPYVYKSP-PPPPYVYKSPPPPPYVYKSPPSC 315
           PP Y  +SPPPP YV  +SPPPP  VY+ P P PP  Y  P  P +     P C
Sbjct: 562 PPTYTPHSPPPPVYVTPSSPPPPTPVYEHPTPSPPAGYTPPQEPSHPAPPTPPC 615

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 40/67 (59%), Positives = 41/67 (61%), Gaps = 4/67 (5%)
 Frame = +1

Query: 79  SPPPPPYVYPSPPPPSPPPPYIYKSP-PPPPYVYNSPPPPPYVYNSPPPPPYV---YKSP 246
           SPPPP Y Y SPPPPSPPPP    SP PPPP    SPPPP Y +   P PP V   Y SP
Sbjct: 666 SPPPPTYYYSSPPPPSPPPP----SPSPPPPSP--SPPPPSYEH--VPLPPVVGVSYASP 717

Query: 247 PPPPYVY 267
           PPP   Y
Sbjct: 718 PPPVIPY 724

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 43/103 (41%), Positives = 52/103 (50%), Gaps = 23/103 (22%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPP-----------SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPP 219
           P +P  P     SPPPP           SPPPP     P PPP VY+S   P + + SPP
Sbjct: 409 PSTPSRPVAPIESPPPPSSKSSGSHFKRSPPPPQSTPPPSPPPPVYSS--SPSHKHRSPP 466

Query: 220 PPPYV------YKSPPPPP-----YVYKSP-PPPPYVYKSPPS 312
           PP +       + SPPPPP     Y + SP PPPP VY +PP+
Sbjct: 467 PPTHKISPVTRHASPPPPPPSPVYYHHPSPSPPPPPVYYAPPT 509

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 35/74 (47%), Positives = 36/74 (48%), Gaps = 5/74 (6%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPP--SPPPPYIYKSPPPPPYV 174
           PP    SS P  S    P     S   PP PP   PSPPPP  SPPPP  Y+  P PP V
Sbjct: 652 PPTYTYSSPPPPSPSPPPPTYYYSSPPPPSPPPPSPSPPPPSPSPPPP-SYEHVPLPPVV 710

Query: 175 ---YNSPPPPPYVY 207
              Y SPPPP   Y
Sbjct: 711 GVSYASPPPPVIPY 724

[168][TOP]
>UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1
           Tax=Vitis vinifera RepID=UPI0001982DE4
          Length = 569

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/79 (58%), Positives = 46/79 (58%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P  PPPPP   P PPPPSPPPP    SPPPPP    SPPPPP    SPPPPP     PPP
Sbjct: 128 PECPPPPPPSPPPPPPPSPPPP---PSPPPPP--PPSPPPPP----SPPPPPPPSPPPPP 178

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 179 PPPPPPPPPPPPPPPPPPP 197

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 43/72 (59%), Positives = 43/72 (59%)
 Frame = +1

Query: 73  PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           P SPPPPP   PSPPPP  PPP    SPPPPP    SPPPPP     PPPPP     PPP
Sbjct: 135 PPSPPPPPP--PSPPPPPSPPPPPPPSPPPPP----SPPPPPPPSPPPPPPPPPPPPPPP 188

Query: 253 PPYVYKSPPPPP 288
           PP     PPPPP
Sbjct: 189 PPPPPPPPPPPP 200

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 48/98 (48%), Positives = 48/98 (48%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP       P  S    P      P SPPPPP   P PPPPSPPPP     PPPPP    
Sbjct: 125 PPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSP-PPPPSPPPPPPPSPPPPPP---- 179

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYV 294
            PPPPP     PPPPP     PPPPP     PPPPP V
Sbjct: 180 -PPPPP-----PPPPP-----PPPPP---PPPPPPPPV 203

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 40/79 (50%), Positives = 40/79 (50%), Gaps = 4/79 (5%)
 Frame = +1

Query: 85  PPPPYVYPSPPPP----SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
           PPP Y    PPPP     PPPP     PPPPP    SPPPPP     PPP P    SPPP
Sbjct: 113 PPPEYEEGCPPPPPEPECPPPPPPSPPPPPPP----SPPPPPSPPPPPPPSPPPPPSPPP 168

Query: 253 PPYVYKSPPPPPYVYKSPP 309
           PP     PPPPP     PP
Sbjct: 169 PPPPSPPPPPPPPPPPPPP 187

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 37/71 (52%), Positives = 38/71 (53%), Gaps = 4/71 (5%)
 Frame = +1

Query: 109 SPPPP----SPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPPPPYVYKSP 276
           SPPP      PPPP   + PPPPP    SPPPPP    SPPPPP     PPP P    SP
Sbjct: 112 SPPPEYEEGCPPPPPEPECPPPPP---PSPPPPP--PPSPPPPPSPPPPPPPSPPPPPSP 166

Query: 277 PPPPYVYKSPP 309
           PPPP     PP
Sbjct: 167 PPPPPPSPPPP 177

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 33/71 (46%), Positives = 35/71 (49%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP  +    P  S    PS     P SPPPPP   P PPPP PPPP     PPPPP    
Sbjct: 147 PPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP-----PPPPP---- 197

Query: 181 SPPPPPYVYNS 213
            PPPPP   N+
Sbjct: 198 -PPPPPVDRNA 207

[169][TOP]
>UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra
           magnipapillata RepID=UPI0001924514
          Length = 490

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 49/99 (49%), Positives = 51/99 (51%)
 Frame = +1

Query: 19  SSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPP 198
           + SPN+     PS     P  PPPPP   P PPPP PPPP    SPPPPP     PPPPP
Sbjct: 338 TGSPNACCPPPPSANPCQPCPPPPPPPPPPPPPPPPPPPP---PSPPPPP-----PPPPP 389

Query: 199 YVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPPSC 315
                PPPPP     PPPPP     PPPP     SP SC
Sbjct: 390 -----PPPPP----PPPPPPPPPPPPPPPCPASCSPTSC 419

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 39/85 (45%), Positives = 39/85 (45%)
 Frame = +1

Query: 1   PPFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYN 180
           PP SA    P       P      P  PPPPP   P PPPP PPPP     PPPPP    
Sbjct: 347 PPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP-----PPPPP---- 397

Query: 181 SPPPPPYVYNSPPPPPYVYKSPPPP 255
            PPPPP     PPPPP     PP P
Sbjct: 398 -PPPPP-----PPPPP-----PPCP 411

[170][TOP]
>UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae
            RepID=UPI000186983E
          Length = 1411

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 42/79 (53%), Positives = 43/79 (54%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P +PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 851  PTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 911  PPPPPPPPPPPPPPPPPPP 929

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 46/102 (45%), Positives = 47/102 (46%)
 Frame = +1

Query: 4    PFSAVSSSPNSSTKITPSGIGVSPFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNS 183
            P   V   P +     P      P  PPPPP   P PPPP PPPP     PPPPP     
Sbjct: 843  PAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902

Query: 184  PPPPPYVYNSPPPPPYVYKSPPPPPYVYKSPPPPPYVYKSPP 309
            PPPPP     PPPPP     PPPPP     PPPPP     PP
Sbjct: 903  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 891  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 951  PPPPPPPPPPPPGAPPPPP 969

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 43/79 (54%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 888  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP    +PP
Sbjct: 948  PPPPPPPPPPPPPPPGAPP 966

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 867  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 927  PPPPPPPPPPPPPPPPPPP 945

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 868  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 928  PPPPPPPPPPPPPPPPPPP 946

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 869  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 929  PPPPPPPPPPPPPPPPPPP 947

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 870  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 930  PPPPPPPPPPPPPPPPPPP 948

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 871  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 931  PPPPPPPPPPPPPPPPPPP 949

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 872  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 932  PPPPPPPPPPPPPPPPPPP 950

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 873  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 933  PPPPPPPPPPPPPPPPPPP 951

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 874  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 934  PPPPPPPPPPPPPPPPPPP 952

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 875  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 935  PPPPPPPPPPPPPPPPPPP 953

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 876  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 936  PPPPPPPPPPPPPPPPPPP 954

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 877  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 937  PPPPPPPPPPPPPPPPPPP 955

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 878  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 938  PPPPPPPPPPPPPPPPPPP 956

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 879  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 939  PPPPPPPPPPPPPPPPPPP 957

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 880  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 940  PPPPPPPPPPPPPPPPPPP 958

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 881  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 941  PPPPPPPPPPPPPPPPPPP 959

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 882  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 942  PPPPPPPPPPPPPPPPPPP 960

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 883  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 943  PPPPPPPPPPPPPPPPPPP 961

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 884  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 944  PPPPPPPPPPPPPPPPPPP 962

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 889  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 949  PPPPPPPPPPPPPPGAPPP 967

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/79 (53%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 890  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP     PP
Sbjct: 950  PPPPPPPPPPPPPGAPPPP 968

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 41/79 (51%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP     PPPPP     PPP
Sbjct: 899  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958

Query: 253  PPYVYKSPPPPPYVYKSPP 309
            PP     PPPPP +    P
Sbjct: 959  PPPPGAPPPPPPALPPGAP 977

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 41/79 (51%), Positives = 42/79 (53%)
 Frame = +1

Query: 73   PFSPPPPPYVYPSPPPPSPPPPYIYKSPPPPPYVYNSPPPPPYVYNSPPPPPYVYKSPPP 252
            P  PPPPP   P PPPP PPPP     PPPPP     PPPPP