BB936963 ( RCC09979 )

[UP]


[1][TOP]
>UniRef100_Q0JJP4 Os01g0726700 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q0JJP4_ORYSJ
          Length = 662

 Score =  108 bits (271), Expect = 1e-22
 Identities = 72/185 (38%), Positives = 87/185 (47%), Gaps = 46/185 (24%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPS-------------SPPGGGSYDPTPS--PPSDSGGSPPGSYD 135
           D +PT P G G Y PTPS             +P GGG Y PTPS  PPS S GS      
Sbjct: 188 DTSPTTPGGGGGYTPTPSDAPPSPSSDTSPTTPGGGGGYTPTPSDTPPSPSSGS------ 241

Query: 136 PTPSPPSGDGSYNPTPS-TPPS----SDCTPPSQDSPP----SDPTPTTPSTPTTPSGGY 288
            +P+ P G G Y PTPS TPPS    S  T P   S P    + P P++ ++PTTP G Y
Sbjct: 242 -SPTTPGGGGGYTPTPSDTPPSPSSGSSRTTPGGCSTPTPCGTPPAPSSGTSPTTPGGSY 300

Query: 289 Y----------NSPPQDSSP------------PTDPTPTTPSTPTTPSGGYYNSPPQDSS 402
           Y           SP  D+SP             T P+P++ ++PTTP GGYY   P    
Sbjct: 301 YPPTPSIGDVPPSPSSDTSPTTPGGGSPSTPCDTPPSPSSGTSPTTPGGGYYPPTPSVGD 360

Query: 403 PPSDP 417
            P  P
Sbjct: 361 VPPSP 365

 Score =  108 bits (269), Expect = 2e-22
 Identities = 74/184 (40%), Positives = 85/184 (46%), Gaps = 45/184 (24%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPS-------------SPPGGGSYDPTPS--PPSDSGGSPP---- 123
           D +PT P G G Y+PTPS             +P GGG Y PTPS  PPS S  + P    
Sbjct: 136 DTSPTTPGGGGGYSPTPSDTPPSPSSDTSPTTPGGGGGYTPTPSDAPPSPSSDTSPTTPG 195

Query: 124 --GSYDPTPS--PPS-----------GDGSYNPTPS-TPPSSDCTPPSQDSPPSDP---- 243
             G Y PTPS  PPS           G G Y PTPS TPPS     PS  S P+ P    
Sbjct: 196 GGGGYTPTPSDAPPSPSSDTSPTTPGGGGGYTPTPSDTPPS-----PSSGSSPTTPGGGG 250

Query: 244 --TPTTPSTPTTPSGGYYNSPPQDSSPP----TDPTPTTPSTPTTPSGGYYNSPPQDSSP 405
             TPT   TP +PS G   + P   S P    T P P++ ++PTTP G YY   P     
Sbjct: 251 GYTPTPSDTPPSPSSGSSRTTPGGCSTPTPCGTPPAPSSGTSPTTPGGSYYPPTPSIGDV 310

Query: 406 PSDP 417
           P  P
Sbjct: 311 PPSP 314

 Score =  105 bits (261), Expect = 2e-21
 Identities = 73/179 (40%), Positives = 90/179 (50%), Gaps = 42/179 (23%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPS-------------SPPGGGSYDPTPS--PPSDSGGS----PP 123
           D +PT P G G Y PTPS             +P GGG Y PTPS  PPS S GS    P 
Sbjct: 214 DTSPTTPGGGGGYTPTPSDTPPSPSSGSSPTTPGGGGGYTPTPSDTPPSPSSGSSRTTPG 273

Query: 124 GSYDPTP--SPPS----------GDGSYNPTPS-----TPPSSDCTP--PSQDSP--PSD 240
           G   PTP  +PP+          G   Y PTPS       PSSD +P  P   SP  P D
Sbjct: 274 GCSTPTPCGTPPAPSSGTSPTTPGGSYYPPTPSIGDVPPSPSSDTSPTTPGGGSPSTPCD 333

Query: 241 --PTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
             P+P++ ++PTTP GGYY  PP  S     P+P + ++P+TP  G Y+     S+PPS
Sbjct: 334 TPPSPSSGTSPTTPGGGYY--PPTPSVGDVPPSPASGTSPSTPGSGGYSPSTPCSAPPS 390

 Score =  103 bits (257), Expect = 6e-21
 Identities = 65/174 (37%), Positives = 88/174 (50%), Gaps = 40/174 (22%)
 Frame = +1

Query: 10  PTPPSGDGS-YNP-------TPSSPPGGGSYDPTPS-----PPSDSGGSPPG-------- 126
           PTPP G G  YNP       +P++P GGG Y PTPS     P SD+  S PG        
Sbjct: 66  PTPPQGGGGGYNPPSPSIGTSPTTPGGGGGYTPTPSDTPPSPSSDTSPSTPGGGCSSSPT 125

Query: 127 --------SYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSP---------PSD--PTP 249
                   S D +P+ P G G Y+PTPS  P S  +  S  +P         PSD  P+P
Sbjct: 126 PCDAPPSPSSDTSPTTPGGGGGYSPTPSDTPPSPSSDTSPTTPGGGGGYTPTPSDAPPSP 185

Query: 250 TTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           ++ ++PTTP GG   +P    +P   P+P++ ++PTTP GG   +P    +PPS
Sbjct: 186 SSDTSPTTPGGGGGYTPTPSDAP---PSPSSDTSPTTPGGGGGYTPTPSDTPPS 236

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 60/157 (38%), Positives = 78/157 (49%), Gaps = 20/157 (12%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP--------PS 156
           D +P+ P G  S +PTP   P   S D +P+ P   GG  P   D  PSP        P 
Sbjct: 110 DTSPSTPGGGCSSSPTPCDAPPSPSSDTSPTTPGGGGGYSPTPSDTPPSPSSDTSPTTPG 169

Query: 157 GDGSYNPTPSTPPSSDCTPPSQDSP---------PSD--PTPTTPSTPTTP-SGGYYNSP 300
           G G Y PTPS  P S  +  S  +P         PSD  P+P++ ++PTTP  GG Y   
Sbjct: 170 GGGGYTPTPSDAPPSPSSDTSPTTPGGGGGYTPTPSDAPPSPSSDTSPTTPGGGGGYTPT 229

Query: 301 PQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           P D    T P+P++ S+PTTP GG   +P    +PPS
Sbjct: 230 PSD----TPPSPSSGSSPTTPGGGGGYTPTPSDTPPS 262

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 67/185 (36%), Positives = 84/185 (45%), Gaps = 46/185 (24%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNP--TPSSP--------PGGGSYDPTPS----PPSDSGGSPP----- 123
           D +PT P G     P  TP SP        PGGG Y PTPS    PPS + G+ P     
Sbjct: 317 DTSPTTPGGGSPSTPCDTPPSPSSGTSPTTPGGGYYPPTPSVGDVPPSPASGTSPSTPGS 376

Query: 124 GSYDPT------PSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTP--------- 258
           G Y P+      PSP SG     P     PS+ C  P   SP SD +PTTP         
Sbjct: 377 GGYSPSTPCSAPPSPSSGTSPTTPGGGYSPSTPCNAPP--SPSSDTSPTTPGGGNYPPAP 434

Query: 259 ------------STPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSS 402
                       ++P+TP GG  +SP    +P   P+P++ ++PTTP GGYY   P   +
Sbjct: 435 TIGNVPPSPSSGTSPSTPGGGCSSSPTPCDAP---PSPSSDTSPTTPGGGYYPPTPSIGT 491

Query: 403 PPSDP 417
            PS P
Sbjct: 492 SPSTP 496

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 61/158 (38%), Positives = 83/158 (52%), Gaps = 20/158 (12%)
 Frame = +1

Query: 10  PTPPSGDGSYNPT----PSSPPGGGSYDPTPSPPSDSGGSPP-----GSYDPTPS----P 150
           PTP  GD   +P+    P++P GG    P  +PPS S G+ P     G Y PTPS    P
Sbjct: 303 PTPSIGDVPPSPSSDTSPTTPGGGSPSTPCDTPPSPSSGTSPTTPGGGYYPPTPSVGDVP 362

Query: 151 PSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP 330
           PS   +   +PSTP S   +P +  S P  P+P++ ++PTTP GGY  S P ++     P
Sbjct: 363 PS--PASGTSPSTPGSGGYSPSTPCSAP--PSPSSGTSPTTPGGGYSPSTPCNA----PP 414

Query: 331 TPTTPSTPTTPSGGYY-------NSPPQDSSPPSDPLP 423
           +P++ ++PTTP GG Y       N PP  SS  S   P
Sbjct: 415 SPSSDTSPTTPGGGNYPPAPTIGNVPPSPSSGTSPSTP 452

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 58/149 (38%), Positives = 76/149 (51%), Gaps = 11/149 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS----PPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P   PPS     +PT    PGGG+Y P P+    PPS S G+       +PS P G  S 
Sbjct: 409 PCNAPPSPSSDTSPTT---PGGGNYPPAPTIGNVPPSPSSGT-------SPSTPGGGCSS 458

Query: 172 NPTPSTPP---SSDCTPPSQDSPPSDPTPTTPSTPTTP--SGGYYNSPPQDSSPPTDPTP 336
           +PTP   P   SSD +P +       PTP+  ++P+TP   GGYY  PP  S+    PTP
Sbjct: 459 SPTPCDAPPSPSSDTSPTTPGGGYYPPTPSIGTSPSTPGTGGGYY--PPSPSTGGYTPTP 516

Query: 337 TTP-STPTTPSGGYYNSPPQDSSP-PSDP 417
             P STP++P      +PP  ++P P DP
Sbjct: 517 DVPISTPSSPYSPLVPTPPSSTTPMPFDP 545

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 57/148 (38%), Positives = 74/148 (50%), Gaps = 8/148 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT------PSPPSDSGGSPPGSYDPTPSPPSGDG 165
           P   PPS     +PT    PGGG Y P+      PSP SD+  + PG  +  P+P  G+ 
Sbjct: 384 PCSAPPSPSSGTSPTT---PGGG-YSPSTPCNAPPSPSSDTSPTTPGGGNYPPAPTIGNV 439

Query: 166 SYNPTPSTPPSSDCTPPSQDSPPSD--PTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
             +P+  T PS+     S    P D  P+P++ ++PTTP GGYY        PPT    T
Sbjct: 440 PPSPSSGTSPSTPGGGCSSSPTPCDAPPSPSSDTSPTTPGGGYY--------PPTPSIGT 491

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           +PSTP T  GGYY  PP  S+    P P
Sbjct: 492 SPSTPGT-GGGYY--PPSPSTGGYTPTP 516

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 52/142 (36%), Positives = 66/142 (46%), Gaps = 30/142 (21%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNP---------------TPSSPPGGGSYDPTP-----SPPSDSGGSP 120
           D +PT P G G+Y P               +PS+P GG S  PTP     SP SD+  + 
Sbjct: 419 DTSPTTPGG-GNYPPAPTIGNVPPSPSSGTSPSTPGGGCSSSPTPCDAPPSPSSDTSPTT 477

Query: 121 PGS--YDPTPS-------PPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDP-TPTTPSTPT 270
           PG   Y PTPS       P +G G Y P+PST   +    P+ D P S P +P +P  PT
Sbjct: 478 PGGGYYPPTPSIGTSPSTPGTGGGYYPPSPSTGGYT----PTPDVPISTPSSPYSPLVPT 533

Query: 271 TPSGGYYNSPPQDSSPPTDPTP 336
            PS    ++ P    P T P P
Sbjct: 534 PPS----STTPMPFDPNTAPFP 551

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 42/119 (35%), Positives = 56/119 (47%), Gaps = 7/119 (5%)
 Frame = +1

Query: 76  YDPTP------SPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPS 237
           Y P P      S PS S  +PP +  PTP P  G G YNP                    
Sbjct: 42  YTPGPTGQHHSSSPSHSHKAPPCA--PTP-PQGGGGGYNP-------------------- 78

Query: 238 DPTPTTPSTPTTP-SGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
            P+P+  ++PTTP  GG Y   P D    T P+P++ ++P+TP GG  +SP    +PPS
Sbjct: 79  -PSPSIGTSPTTPGGGGGYTPTPSD----TPPSPSSDTSPSTPGGGCSSSPTPCDAPPS 132

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 42/111 (37%), Positives = 50/111 (45%), Gaps = 12/111 (10%)
 Frame = +1

Query: 4   PTP--TPPSGDGSYNPTPSSPPGGGSYDPTPS------PPSDSGGSPPGSYDPTPSPPSG 159
           PTP   PPS     +PT    PGGG Y PTPS       P   G    G Y P+PS    
Sbjct: 460 PTPCDAPPSPSSDTSPTT---PGGGYYPPTPSIGTSPSTPGTGG----GYYPPSPS---- 508

Query: 160 DGSYNPTPSTPPSSDCTP--PSQDSPPSD--PTPTTPSTPTTPSGGYYNSP 300
            G Y PTP  P S+  +P  P   +PPS   P P  P+T   P   + + P
Sbjct: 509 TGGYTPTPDVPISTPSSPYSPLVPTPPSSTTPMPFDPNTAPFPCSYWLSHP 559

[2][TOP]
>UniRef100_B9EZH8 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9EZH8_ORYSJ
          Length = 650

 Score =  108 bits (271), Expect = 1e-22
 Identities = 72/185 (38%), Positives = 87/185 (47%), Gaps = 46/185 (24%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPS-------------SPPGGGSYDPTPS--PPSDSGGSPPGSYD 135
           D +PT P G G Y PTPS             +P GGG Y PTPS  PPS S GS      
Sbjct: 176 DTSPTTPGGGGGYTPTPSDAPPSPSSDTSPTTPGGGGGYTPTPSDTPPSPSSGS------ 229

Query: 136 PTPSPPSGDGSYNPTPS-TPPS----SDCTPPSQDSPP----SDPTPTTPSTPTTPSGGY 288
            +P+ P G G Y PTPS TPPS    S  T P   S P    + P P++ ++PTTP G Y
Sbjct: 230 -SPTTPGGGGGYTPTPSDTPPSPSSGSSRTTPGGCSTPTPCGTPPAPSSGTSPTTPGGSY 288

Query: 289 Y----------NSPPQDSSP------------PTDPTPTTPSTPTTPSGGYYNSPPQDSS 402
           Y           SP  D+SP             T P+P++ ++PTTP GGYY   P    
Sbjct: 289 YPPTPSIGDVPPSPSSDTSPTTPGGGSPSTPCDTPPSPSSGTSPTTPGGGYYPPTPSVGD 348

Query: 403 PPSDP 417
            P  P
Sbjct: 349 VPPSP 353

 Score =  108 bits (269), Expect = 2e-22
 Identities = 74/184 (40%), Positives = 85/184 (46%), Gaps = 45/184 (24%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPS-------------SPPGGGSYDPTPS--PPSDSGGSPP---- 123
           D +PT P G G Y+PTPS             +P GGG Y PTPS  PPS S  + P    
Sbjct: 124 DTSPTTPGGGGGYSPTPSDTPPSPSSDTSPTTPGGGGGYTPTPSDAPPSPSSDTSPTTPG 183

Query: 124 --GSYDPTPS--PPS-----------GDGSYNPTPS-TPPSSDCTPPSQDSPPSDP---- 243
             G Y PTPS  PPS           G G Y PTPS TPPS     PS  S P+ P    
Sbjct: 184 GGGGYTPTPSDAPPSPSSDTSPTTPGGGGGYTPTPSDTPPS-----PSSGSSPTTPGGGG 238

Query: 244 --TPTTPSTPTTPSGGYYNSPPQDSSPP----TDPTPTTPSTPTTPSGGYYNSPPQDSSP 405
             TPT   TP +PS G   + P   S P    T P P++ ++PTTP G YY   P     
Sbjct: 239 GYTPTPSDTPPSPSSGSSRTTPGGCSTPTPCGTPPAPSSGTSPTTPGGSYYPPTPSIGDV 298

Query: 406 PSDP 417
           P  P
Sbjct: 299 PPSP 302

 Score =  105 bits (261), Expect = 2e-21
 Identities = 73/179 (40%), Positives = 90/179 (50%), Gaps = 42/179 (23%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPS-------------SPPGGGSYDPTPS--PPSDSGGS----PP 123
           D +PT P G G Y PTPS             +P GGG Y PTPS  PPS S GS    P 
Sbjct: 202 DTSPTTPGGGGGYTPTPSDTPPSPSSGSSPTTPGGGGGYTPTPSDTPPSPSSGSSRTTPG 261

Query: 124 GSYDPTP--SPPS----------GDGSYNPTPS-----TPPSSDCTP--PSQDSP--PSD 240
           G   PTP  +PP+          G   Y PTPS       PSSD +P  P   SP  P D
Sbjct: 262 GCSTPTPCGTPPAPSSGTSPTTPGGSYYPPTPSIGDVPPSPSSDTSPTTPGGGSPSTPCD 321

Query: 241 --PTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
             P+P++ ++PTTP GGYY  PP  S     P+P + ++P+TP  G Y+     S+PPS
Sbjct: 322 TPPSPSSGTSPTTPGGGYY--PPTPSVGDVPPSPASGTSPSTPGSGGYSPSTPCSAPPS 378

 Score =  103 bits (257), Expect = 6e-21
 Identities = 65/174 (37%), Positives = 88/174 (50%), Gaps = 40/174 (22%)
 Frame = +1

Query: 10  PTPPSGDGS-YNP-------TPSSPPGGGSYDPTPS-----PPSDSGGSPPG-------- 126
           PTPP G G  YNP       +P++P GGG Y PTPS     P SD+  S PG        
Sbjct: 54  PTPPQGGGGGYNPPSPSIGTSPTTPGGGGGYTPTPSDTPPSPSSDTSPSTPGGGCSSSPT 113

Query: 127 --------SYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSP---------PSD--PTP 249
                   S D +P+ P G G Y+PTPS  P S  +  S  +P         PSD  P+P
Sbjct: 114 PCDAPPSPSSDTSPTTPGGGGGYSPTPSDTPPSPSSDTSPTTPGGGGGYTPTPSDAPPSP 173

Query: 250 TTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           ++ ++PTTP GG   +P    +P   P+P++ ++PTTP GG   +P    +PPS
Sbjct: 174 SSDTSPTTPGGGGGYTPTPSDAP---PSPSSDTSPTTPGGGGGYTPTPSDTPPS 224

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 60/157 (38%), Positives = 78/157 (49%), Gaps = 20/157 (12%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP--------PS 156
           D +P+ P G  S +PTP   P   S D +P+ P   GG  P   D  PSP        P 
Sbjct: 98  DTSPSTPGGGCSSSPTPCDAPPSPSSDTSPTTPGGGGGYSPTPSDTPPSPSSDTSPTTPG 157

Query: 157 GDGSYNPTPSTPPSSDCTPPSQDSP---------PSD--PTPTTPSTPTTP-SGGYYNSP 300
           G G Y PTPS  P S  +  S  +P         PSD  P+P++ ++PTTP  GG Y   
Sbjct: 158 GGGGYTPTPSDAPPSPSSDTSPTTPGGGGGYTPTPSDAPPSPSSDTSPTTPGGGGGYTPT 217

Query: 301 PQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           P D    T P+P++ S+PTTP GG   +P    +PPS
Sbjct: 218 PSD----TPPSPSSGSSPTTPGGGGGYTPTPSDTPPS 250

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 67/185 (36%), Positives = 84/185 (45%), Gaps = 46/185 (24%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNP--TPSSP--------PGGGSYDPTPS----PPSDSGGSPP----- 123
           D +PT P G     P  TP SP        PGGG Y PTPS    PPS + G+ P     
Sbjct: 305 DTSPTTPGGGSPSTPCDTPPSPSSGTSPTTPGGGYYPPTPSVGDVPPSPASGTSPSTPGS 364

Query: 124 GSYDPT------PSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTP--------- 258
           G Y P+      PSP SG     P     PS+ C  P   SP SD +PTTP         
Sbjct: 365 GGYSPSTPCSAPPSPSSGTSPTTPGGGYSPSTPCNAPP--SPSSDTSPTTPGGGNYPPAP 422

Query: 259 ------------STPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSS 402
                       ++P+TP GG  +SP    +P   P+P++ ++PTTP GGYY   P   +
Sbjct: 423 TIGNVPPSPSSGTSPSTPGGGCSSSPTPCDAP---PSPSSDTSPTTPGGGYYPPTPSIGT 479

Query: 403 PPSDP 417
            PS P
Sbjct: 480 SPSTP 484

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 61/158 (38%), Positives = 83/158 (52%), Gaps = 20/158 (12%)
 Frame = +1

Query: 10  PTPPSGDGSYNPT----PSSPPGGGSYDPTPSPPSDSGGSPP-----GSYDPTPS----P 150
           PTP  GD   +P+    P++P GG    P  +PPS S G+ P     G Y PTPS    P
Sbjct: 291 PTPSIGDVPPSPSSDTSPTTPGGGSPSTPCDTPPSPSSGTSPTTPGGGYYPPTPSVGDVP 350

Query: 151 PSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP 330
           PS   +   +PSTP S   +P +  S P  P+P++ ++PTTP GGY  S P ++     P
Sbjct: 351 PS--PASGTSPSTPGSGGYSPSTPCSAP--PSPSSGTSPTTPGGGYSPSTPCNA----PP 402

Query: 331 TPTTPSTPTTPSGGYY-------NSPPQDSSPPSDPLP 423
           +P++ ++PTTP GG Y       N PP  SS  S   P
Sbjct: 403 SPSSDTSPTTPGGGNYPPAPTIGNVPPSPSSGTSPSTP 440

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 58/149 (38%), Positives = 76/149 (51%), Gaps = 11/149 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS----PPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P   PPS     +PT    PGGG+Y P P+    PPS S G+       +PS P G  S 
Sbjct: 397 PCNAPPSPSSDTSPTT---PGGGNYPPAPTIGNVPPSPSSGT-------SPSTPGGGCSS 446

Query: 172 NPTPSTPP---SSDCTPPSQDSPPSDPTPTTPSTPTTP--SGGYYNSPPQDSSPPTDPTP 336
           +PTP   P   SSD +P +       PTP+  ++P+TP   GGYY  PP  S+    PTP
Sbjct: 447 SPTPCDAPPSPSSDTSPTTPGGGYYPPTPSIGTSPSTPGTGGGYY--PPSPSTGGYTPTP 504

Query: 337 TTP-STPTTPSGGYYNSPPQDSSP-PSDP 417
             P STP++P      +PP  ++P P DP
Sbjct: 505 DVPISTPSSPYSPLVPTPPSSTTPMPFDP 533

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 57/148 (38%), Positives = 74/148 (50%), Gaps = 8/148 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT------PSPPSDSGGSPPGSYDPTPSPPSGDG 165
           P   PPS     +PT    PGGG Y P+      PSP SD+  + PG  +  P+P  G+ 
Sbjct: 372 PCSAPPSPSSGTSPTT---PGGG-YSPSTPCNAPPSPSSDTSPTTPGGGNYPPAPTIGNV 427

Query: 166 SYNPTPSTPPSSDCTPPSQDSPPSD--PTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
             +P+  T PS+     S    P D  P+P++ ++PTTP GGYY        PPT    T
Sbjct: 428 PPSPSSGTSPSTPGGGCSSSPTPCDAPPSPSSDTSPTTPGGGYY--------PPTPSIGT 479

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           +PSTP T  GGYY  PP  S+    P P
Sbjct: 480 SPSTPGT-GGGYY--PPSPSTGGYTPTP 504

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 52/142 (36%), Positives = 66/142 (46%), Gaps = 30/142 (21%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNP---------------TPSSPPGGGSYDPTP-----SPPSDSGGSP 120
           D +PT P G G+Y P               +PS+P GG S  PTP     SP SD+  + 
Sbjct: 407 DTSPTTPGG-GNYPPAPTIGNVPPSPSSGTSPSTPGGGCSSSPTPCDAPPSPSSDTSPTT 465

Query: 121 PGS--YDPTPS-------PPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDP-TPTTPSTPT 270
           PG   Y PTPS       P +G G Y P+PST   +    P+ D P S P +P +P  PT
Sbjct: 466 PGGGYYPPTPSIGTSPSTPGTGGGYYPPSPSTGGYT----PTPDVPISTPSSPYSPLVPT 521

Query: 271 TPSGGYYNSPPQDSSPPTDPTP 336
            PS    ++ P    P T P P
Sbjct: 522 PPS----STTPMPFDPNTAPFP 539

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 42/112 (37%), Positives = 54/112 (48%), Gaps = 9/112 (8%)
 Frame = +1

Query: 103 DSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPST------ 264
           DS  +PP +  PTP P  G G YNP    P  S  T P+        TPT   T      
Sbjct: 45  DSHKAPPCA--PTP-PQGGGGGYNP----PSPSIGTSPTTPGGGGGYTPTPSDTPPSPSS 97

Query: 265 ---PTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
              P+TP GG  +SP    +P   P+P++ ++PTTP GG   SP    +PPS
Sbjct: 98  DTSPSTPGGGCSSSPTPCDAP---PSPSSDTSPTTPGGGGGYSPTPSDTPPS 146

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 42/111 (37%), Positives = 50/111 (45%), Gaps = 12/111 (10%)
 Frame = +1

Query: 4   PTP--TPPSGDGSYNPTPSSPPGGGSYDPTPS------PPSDSGGSPPGSYDPTPSPPSG 159
           PTP   PPS     +PT    PGGG Y PTPS       P   G    G Y P+PS    
Sbjct: 448 PTPCDAPPSPSSDTSPTT---PGGGYYPPTPSIGTSPSTPGTGG----GYYPPSPS---- 496

Query: 160 DGSYNPTPSTPPSSDCTP--PSQDSPPSD--PTPTTPSTPTTPSGGYYNSP 300
            G Y PTP  P S+  +P  P   +PPS   P P  P+T   P   + + P
Sbjct: 497 TGGYTPTPDVPISTPSSPYSPLVPTPPSSTTPMPFDPNTAPFPCSYWLSHP 547

[3][TOP]
>UniRef100_A9U3I4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9U3I4_PHYPA
          Length = 291

 Score =  104 bits (260), Expect = 3e-21
 Identities = 65/144 (45%), Positives = 78/144 (54%), Gaps = 10/144 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS---PPSDSGGSPPGSYDPTPSPPSGDGS-- 168
           P+PT PSG    +PT SSPP    Y PTPS   P S +  SPP S  P+ S P+   S  
Sbjct: 141 PSPTAPSGPSPSSPTYSSPP----YSPTPSGSSPSSPTYSSPPYSPTPSSSSPTTPSSPS 196

Query: 169 -----YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT 333
                Y+PTPS P  S  + P+  SPP  PTP+ PS PT        S P  SSPP  PT
Sbjct: 197 YSSPPYSPTPSDPSPSTPSSPTYSSPPYSPTPSGPSPPTP-------SSPTYSSPPYSPT 249

Query: 334 PTTPSTPTTPSGGYYNSPPQDSSP 405
           P + S+PTTPS   Y+SPP   +P
Sbjct: 250 P-SGSSPTTPSSPSYSSPPYSPTP 272

 Score =  102 bits (254), Expect = 1e-20
 Identities = 72/165 (43%), Positives = 84/165 (50%), Gaps = 25/165 (15%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPP------SGDG 165
           PTP+  S     +PT SSPP    Y P PS PS +  S P    PT S P      SG  
Sbjct: 114 PTPSSSSPTTPSSPTYSSPP----YSPAPSSPSPTAPSGPSPSSPTYSSPPYSPTPSGSS 169

Query: 166 SYNPTPSTPP-------SSDCTP--PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP 318
             +PT S+PP       SS  TP  PS  SPP  PTP+ PS P+TPS   Y+SPP  S  
Sbjct: 170 PSSPTYSSPPYSPTPSSSSPTTPSSPSYSSPPYSPTPSDPS-PSTPSSPTYSSPPY-SPT 227

Query: 319 PTDPTPTTPSTPT--------TPSGGYYNSP--PQDSSPPSDPLP 423
           P+ P+P TPS+PT        TPSG    +P  P  SSPP  P P
Sbjct: 228 PSGPSPPTPSSPTYSSPPYSPTPSGSSPTTPSSPSYSSPPYSPTP 272

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/147 (43%), Positives = 83/147 (56%), Gaps = 8/147 (5%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP----PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS-GDGSY 171
           TP+P      Y+PTPSS     P   +Y   P  P+ S  SP     P+PS P+     Y
Sbjct: 102 TPSPSYSSPPYSPTPSSSSPTTPSSPTYSSPPYSPAPSSPSPTAPSGPSPSSPTYSSPPY 161

Query: 172 NPTPS-TPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
           +PTPS + PSS    P+  SPP  PTP++ S+PTTPS   Y+SPP  S  P+DP+P+TPS
Sbjct: 162 SPTPSGSSPSS----PTYSSPPYSPTPSS-SSPTTPSSPSYSSPPY-SPTPSDPSPSTPS 215

Query: 349 TPTTPSGGYYNSPPQDSSP--PSDPLP 423
           +PT      Y+SPP   +P  PS P P
Sbjct: 216 SPT------YSSPPYSPTPSGPSPPTP 236

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 70/163 (42%), Positives = 84/163 (51%), Gaps = 25/163 (15%)
 Frame = +1

Query: 10  PTPPSGDGSYNP-TPS-SPPGGGSYDP-TPSP----PSDSGGSPPGSYDPTPSPPSGDGS 168
           P PPS D    P TPS SPP      P TP+P    P  S G+P G    TPSP      
Sbjct: 52  PPPPSTDPPATPYTPSYSPPVASDPSPVTPTPVYSSPPYSPGTPSGGSPVTPSPSYSSPP 111

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGY-----YNSPPQD-------- 309
           Y+PTPS+   +  + P+  SPP  P P++PS PT PSG       Y+SPP          
Sbjct: 112 YSPTPSSSSPTTPSSPTYSSPPYSPAPSSPS-PTAPSGPSPSSPTYSSPPYSPTPSGSSP 170

Query: 310 -----SSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
                SSPP  PTP++ S+PTTPS   Y+SPP  S  PSDP P
Sbjct: 171 SSPTYSSPPYSPTPSS-SSPTTPSSPSYSSPPY-SPTPSDPSP 211

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 62/139 (44%), Positives = 78/139 (56%), Gaps = 7/139 (5%)
 Frame = +1

Query: 22  SGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP-TPSTPPS 198
           SG GS  P+ +  P   S DP P+ P     SPP + DP+P  P+   S  P +P TP  
Sbjct: 39  SGLGSLIPSLTLCPPPPSTDP-PATPYTPSYSPPVASDPSPVTPTPVYSSPPYSPGTPSG 97

Query: 199 -SDCTP-PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGG 372
            S  TP PS  SPP  PTP++ S+PTTPS   Y+SPP  S  P+ P+PT PS P +PS  
Sbjct: 98  GSPVTPSPSYSSPPYSPTPSS-SSPTTPSSPTYSSPPY-SPAPSSPSPTAPSGP-SPSSP 154

Query: 373 YYNSPPQDSSP----PSDP 417
            Y+SPP   +P    PS P
Sbjct: 155 TYSSPPYSPTPSGSSPSSP 173

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 56/129 (43%), Positives = 68/129 (52%), Gaps = 5/129 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPG----SYDPTPSPPSGDGSY 171
           PTP+  S     +P+ SSPP    Y PTPS PS S  S P      Y PTPS PS     
Sbjct: 182 PTPSSSSPTTPSSPSYSSPP----YSPTPSDPSPSTPSSPTYSSPPYSPTPSGPS----- 232

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP-TDPTPTTPS 348
            PTPS+P  S        SPP  PTP + S+PTTPS   Y+SPP   +P    P+  +PS
Sbjct: 233 PPTPSSPTYS--------SPPYSPTP-SGSSPTTPSSPSYSSPPYSPTPSGGSPSGGSPS 283

Query: 349 TPTTPSGGY 375
             + P+GGY
Sbjct: 284 -GSPPAGGY 291

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 43/102 (42%), Positives = 54/102 (52%), Gaps = 6/102 (5%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           DP+P+ PS     +PT SSPP    Y PTPS P     SPP    PT S P     Y+PT
Sbjct: 208 DPSPSTPS-----SPTYSSPP----YSPTPSGP-----SPPTPSSPTYSSP----PYSPT 249

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPT--TPS----TPTTPSGGY 288
           PS    +  + PS  SPP  PTP+  +PS    + + P+GGY
Sbjct: 250 PSGSSPTTPSSPSYSSPPYSPTPSGGSPSGGSPSGSPPAGGY 291

[4][TOP]
>UniRef100_B8A8Z5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8A8Z5_ORYSI
          Length = 625

 Score =  103 bits (257), Expect = 6e-21
 Identities = 65/174 (37%), Positives = 88/174 (50%), Gaps = 40/174 (22%)
 Frame = +1

Query: 10  PTPPSGDGS-YNP-------TPSSPPGGGSYDPTPS-----PPSDSGGSPPG-------- 126
           PTPP G G  YNP       +P++P GGG Y PTPS     P SD+  S PG        
Sbjct: 54  PTPPQGGGGGYNPPSPSIGTSPTTPGGGGGYTPTPSDTPPSPSSDTSPSTPGGGCSSSPT 113

Query: 127 --------SYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSP---------PSD--PTP 249
                   S D +P+ P G G Y+PTPS  P S  +  S  +P         PSD  P+P
Sbjct: 114 PCDAPPSPSSDTSPTTPGGGGGYSPTPSDAPPSPSSDTSPTTPGGGGGYTPTPSDAPPSP 173

Query: 250 TTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           ++ ++PTTP GG   +P    +P   P+P++ ++PTTP GG   +P    +PPS
Sbjct: 174 SSDTSPTTPGGGGGYTPTPSDAP---PSPSSDTSPTTPGGGGGYTPTPSDTPPS 224

 Score =  102 bits (253), Expect = 2e-20
 Identities = 62/157 (39%), Positives = 80/157 (50%), Gaps = 20/157 (12%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP--------PS 156
           D +PT P G G Y+PTPS  P   S D +P+ P   GG  P   D  PSP        P 
Sbjct: 124 DTSPTTPGGGGGYSPTPSDAPPSPSSDTSPTTPGGGGGYTPTPSDAPPSPSSDTSPTTPG 183

Query: 157 GDGSYNPTPSTPPSSDCTPPSQDSP---------PSD--PTPTTPSTPTTP-SGGYYNSP 300
           G G Y PTPS  P S  +  S  +P         PSD  P+P++ S+PTTP  GG Y   
Sbjct: 184 GGGGYTPTPSDAPPSPSSDTSPTTPGGGGGYTPTPSDTPPSPSSGSSPTTPGGGGGYTPT 243

Query: 301 PQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           P D    T P+P++ S+PTTP G   ++P    +PP+
Sbjct: 244 PSD----TPPSPSSGSSPTTPGG--CSTPTPCGTPPA 274

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 60/157 (38%), Positives = 78/157 (49%), Gaps = 20/157 (12%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP--------PS 156
           D +P+ P G  S +PTP   P   S D +P+ P   GG  P   D  PSP        P 
Sbjct: 98  DTSPSTPGGGCSSSPTPCDAPPSPSSDTSPTTPGGGGGYSPTPSDAPPSPSSDTSPTTPG 157

Query: 157 GDGSYNPTPSTPPSSDCTPPSQDSP---------PSD--PTPTTPSTPTTP-SGGYYNSP 300
           G G Y PTPS  P S  +  S  +P         PSD  P+P++ ++PTTP  GG Y   
Sbjct: 158 GGGGYTPTPSDAPPSPSSDTSPTTPGGGGGYTPTPSDAPPSPSSDTSPTTPGGGGGYTPT 217

Query: 301 PQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           P D    T P+P++ S+PTTP GG   +P    +PPS
Sbjct: 218 PSD----TPPSPSSGSSPTTPGGGGGYTPTPSDTPPS 250

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 58/149 (38%), Positives = 76/149 (51%), Gaps = 11/149 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS----PPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P   PPS     +PT    PGGG+Y P P+    PPS S G+       +PS P G  S 
Sbjct: 372 PCNAPPSPSSDTSPTT---PGGGNYPPAPTIGNVPPSPSSGT-------SPSTPGGGCSS 421

Query: 172 NPTPSTPP---SSDCTPPSQDSPPSDPTPTTPSTPTTP--SGGYYNSPPQDSSPPTDPTP 336
           +PTP   P   SSD +P +       PTP+  ++P+TP   GGYY  PP  S+    PTP
Sbjct: 422 SPTPCDAPPSPSSDTSPTTPGGGYYPPTPSIGTSPSTPGTGGGYY--PPSPSTGGYTPTP 479

Query: 337 TTP-STPTTPSGGYYNSPPQDSSP-PSDP 417
             P STP++P      +PP  ++P P DP
Sbjct: 480 DVPISTPSSPYSPLVPTPPSSTTPTPFDP 508

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 50/124 (40%), Positives = 66/124 (53%), Gaps = 1/124 (0%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           D +PT P G G Y PTPS  P   S D +P+ P   GG  P   D  PSP SG      +
Sbjct: 176 DTSPTTPGGGGGYTPTPSDAPPSPSSDTSPTTPGGGGGYTPTPSDTPPSPSSGS-----S 230

Query: 181 PSTP-PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
           P+TP      TP   D+PPS   P++ S+PTTP G   ++P    +P   P P++ ++PT
Sbjct: 231 PTTPGGGGGYTPTPSDTPPS---PSSGSSPTTPGG--CSTPTPCGTP---PAPSSGTSPT 282

Query: 358 TPSG 369
           TP G
Sbjct: 283 TPGG 286

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 56/144 (38%), Positives = 73/144 (50%), Gaps = 8/144 (5%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPT------PSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           PPS     +PT    PGGG Y P+      PSP SD+  + PG  +  P+P  G+   +P
Sbjct: 351 PPSPSSGTSPTT---PGGG-YSPSTPCNAPPSPSSDTSPTTPGGGNYPPAPTIGNVPPSP 406

Query: 178 TPSTPPSSDCTPPSQDSPPSD--PTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
           +  T PS+     S    P D  P+P++ ++PTTP GGYY        PPT    T+PST
Sbjct: 407 SSGTSPSTPGGGCSSSPTPCDAPPSPSSDTSPTTPGGGYY--------PPTPSIGTSPST 458

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLP 423
           P T  GGYY  PP  S+    P P
Sbjct: 459 PGT-GGGYY--PPSPSTGGYTPTP 479

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 55/190 (28%), Positives = 72/190 (37%), Gaps = 51/190 (26%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPG-----------GGSYDPTP-----SPPSDSGGSPPGSYDP 138
           +PT P G G Y PTPS  P            GG   PTP     +P S +  + PG    
Sbjct: 230 SPTTPGGGGGYTPTPSDTPPSPSSGSSPTTPGGCSTPTPCGTPPAPSSGTSPTTPGGITI 289

Query: 139 TPSPPSGD----------------------------GSYNPTPSTPPSSDCTPPSQDSPP 234
            P  P G                             G     P        T P   S  
Sbjct: 290 RPRRPYGRCATLAVQRHLSDHTGRRLPVHAMRHAALGRPVARPRPRQVEATTRPRHPSAT 349

Query: 235 SDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYY-------NSPPQ 393
           + P+P++ ++PTTP GGY  S P ++     P+P++ ++PTTP GG Y       N PP 
Sbjct: 350 APPSPSSGTSPTTPGGGYSPSTPCNA----PPSPSSDTSPTTPGGGNYPPAPTIGNVPPS 405

Query: 394 DSSPPSDPLP 423
            SS  S   P
Sbjct: 406 PSSGTSPSTP 415

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 55/159 (34%), Positives = 70/159 (44%), Gaps = 30/159 (18%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNP---------------TPSSPPGGGSYDPTP-----SPPSDSGGSP 120
           D +PT P G G+Y P               +PS+P GG S  PTP     SP SD+  + 
Sbjct: 382 DTSPTTPGG-GNYPPAPTIGNVPPSPSSGTSPSTPGGGCSSSPTPCDAPPSPSSDTSPTT 440

Query: 121 PGS--YDPTPS-------PPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDP-TPTTPSTPT 270
           PG   Y PTPS       P +G G Y P+PST   +    P+ D P S P +P +P  PT
Sbjct: 441 PGGGYYPPTPSIGTSPSTPGTGGGYYPPSPSTGGYT----PTPDVPISTPSSPYSPLVPT 496

Query: 271 TPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSP 387
            PS              T PTP  P+T   P   + + P
Sbjct: 497 PPSS-------------TTPTPFDPNTAPFPCSYWLSHP 522

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 42/112 (37%), Positives = 54/112 (48%), Gaps = 9/112 (8%)
 Frame = +1

Query: 103 DSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPST------ 264
           DS  +PP +  PTP P  G G YNP    P  S  T P+        TPT   T      
Sbjct: 45  DSHKAPPCA--PTP-PQGGGGGYNP----PSPSIGTSPTTPGGGGGYTPTPSDTPPSPSS 97

Query: 265 ---PTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
              P+TP GG  +SP    +P   P+P++ ++PTTP GG   SP    +PPS
Sbjct: 98  DTSPSTPGGGCSSSPTPCDAP---PSPSSDTSPTTPGGGGGYSPTPSDAPPS 146

[5][TOP]
>UniRef100_B6U5L9 DNA-directed RNA polymerase II largest subunit n=1 Tax=Zea mays
           RepID=B6U5L9_MAIZE
          Length = 566

 Score =  103 bits (256), Expect = 8e-21
 Identities = 66/166 (39%), Positives = 83/166 (50%), Gaps = 30/166 (18%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDS-----GGS-------PPGSYDPTPSPPSG 159
           PPS     +PTP    GGG Y   PSP SD+     GGS       PP S   +PS P G
Sbjct: 242 PPSPSSDTSPTPPPGGGGGGYSAPPSPSSDTSPSTPGGSDGRCSTPPPSSSGISPSTPGG 301

Query: 160 DGSYNPTPSTPPSSDCTPPSQD------SPPSDPTPTTPSTPTTPSGGYYN--SPPQDSS 315
            G+   +    PSSD +P +         PPS  + T+P+TP+ PSGGYY   SP  D+S
Sbjct: 302 GGTGGCSAPPSPSSDTSPSTPGGGGGYYGPPSPSSDTSPTTPSAPSGGYYGPPSPSSDTS 361

Query: 316 PPT--------DPTPTTPSTPTTP--SGGYYNSPPQDSSPPSDPLP 423
           P T         P+P++ ++PTTP  SGG Y  PP  SS  S   P
Sbjct: 362 PTTPGGGGYYGPPSPSSDTSPTTPGGSGGGYYGPPSPSSETSPTTP 407

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 71/185 (38%), Positives = 87/185 (47%), Gaps = 48/185 (25%)
 Frame = +1

Query: 7   TPTPPSGDGSYNP----------TPSSPPGGGSYDPTPSPPSDSGGSPPG---------S 129
           TPT P G GSY P          TP++P G G YD  PSP SD+  + PG         S
Sbjct: 78  TPTTPGGGGSYYPPSPDIGTSPTTPTAPGGSGGYDAPPSPSSDTSPTTPGGGYYGPPSPS 137

Query: 130 YDPTPSPP---SGDGSYNPTPSTPPSSDCTPPSQDS------PPSDPTPTTPSTPTTPSG 282
            D +P+ P    G G Y+  PS  PSSD +P +  S      PPS  + T+PSTP    G
Sbjct: 138 SDTSPATPPGGGGGGGYSAPPS--PSSDTSPSTPGSGGGCSVPPSPSSDTSPSTP-GGGG 194

Query: 283 GYYNSPPQDSSPPTDPTPTTP----------------STPTTP--SGGYYN--SPPQDSS 402
           GYY  P    SP +D +PTTP                 +P+TP   GGYY   SP  D+S
Sbjct: 195 GYYGPP----SPSSDTSPTTPGGGGTGGCGAPPSPSSGSPSTPGGGGGYYGPPSPSSDTS 250

Query: 403 PPSDP 417
           P   P
Sbjct: 251 PTPPP 255

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 75/202 (37%), Positives = 92/202 (45%), Gaps = 61/202 (30%)
 Frame = +1

Query: 1   DPTPTPPSGDGSY--NPTPSS-----PPGGGSYDPTPSPPSDSGGSP--PG--------- 126
           D +P+ P G G Y   P+PSS      PGGG      +PPS S GSP  PG         
Sbjct: 184 DTSPSTPGGGGGYYGPPSPSSDTSPTTPGGGGTGGCGAPPSPSSGSPSTPGGGGGYYGPP 243

Query: 127 --SYDPTPSPPSGDG----------SYNPTPSTPPSSD---CTPPSQDS--PPSDP---- 243
             S D +P+PP G G          S + +PSTP  SD    TPP   S   PS P    
Sbjct: 244 SPSSDTSPTPPPGGGGGGYSAPPSPSSDTSPSTPGGSDGRCSTPPPSSSGISPSTPGGGG 303

Query: 244 -----TPTTPSTPTTPS-----GGYYN--SPPQDSSPPT----------DPTPTTPSTPT 357
                 P +PS+ T+PS     GGYY   SP  D+SP T           P+P++ ++PT
Sbjct: 304 TGGCSAPPSPSSDTSPSTPGGGGGYYGPPSPSSDTSPTTPSAPSGGYYGPPSPSSDTSPT 363

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
           TP GG Y  PP  SS  S   P
Sbjct: 364 TPGGGGYYGPPSPSSDTSPTTP 385

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 64/170 (37%), Positives = 81/170 (47%), Gaps = 29/170 (17%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNP-------TPSSPPGGGS---YDPTPSPPSDSGGSPPGS------- 129
           D +PT P G G Y P       +P++PPGGG    Y   PSP SD+  S PGS       
Sbjct: 120 DTSPTTPGG-GYYGPPSPSSDTSPATPPGGGGGGGYSAPPSPSSDTSPSTPGSGGGCSVP 178

Query: 130 ----YDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQ--------DSPPSDPTPTTPSTPTT 273
                D +PS P G G Y   PS  PSSD +P +          +PPS P+  +PSTP  
Sbjct: 179 PSPSSDTSPSTPGGGGGYYGPPS--PSSDTSPTTPGGGGTGGCGAPPS-PSSGSPSTP-G 234

Query: 274 PSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             GGYY        PP+  + T+P+ P    GG Y++PP  SS  S   P
Sbjct: 235 GGGGYY-------GPPSPSSDTSPTPPPGGGGGGYSAPPSPSSDTSPSTP 277

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 57/161 (35%), Positives = 76/161 (47%), Gaps = 23/161 (14%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYD-----PTPSPPSGDGSYN 174
           P  P      + TP  PP  G+   TP+ P   G   P S D      TP+ P G G Y+
Sbjct: 53  PADPDHSPGSHRTPPCPPSIGTSPTTPTTPGGGGSYYPPSPDIGTSPTTPTAPGGSGGYD 112

Query: 175 PTPSTPPSSDCTPPSQD----SPPSDPTPTTPSTPT-TPSGGYYNSPP---QDSSPPT-- 324
             PS  PSSD +P +       PPS  + T+P+TP     GG Y++PP    D+SP T  
Sbjct: 113 APPS--PSSDTSPTTPGGGYYGPPSPSSDTSPATPPGGGGGGGYSAPPSPSSDTSPSTPG 170

Query: 325 -------DPTPTTPSTPTTP-SGGYYNSPPQDSSPPSDPLP 423
                   P+P++ ++P+TP  GG Y  PP  SS  S   P
Sbjct: 171 SGGGCSVPPSPSSDTSPSTPGGGGGYYGPPSPSSDTSPTTP 211

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 60/148 (40%), Positives = 74/148 (50%), Gaps = 21/148 (14%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSG------------GSPPGSYDPTPSPP 153
           P  PS D S    PS+P GGG Y   PSP SD+             G P  S D +P+ P
Sbjct: 310 PPSPSSDTS----PSTPGGGGGYYGPPSPSSDTSPTTPSAPSGGYYGPPSPSSDTSPTTP 365

Query: 154 SGDGSYNPTPSTPPSSDCTPPSQDSPP----SDPTPTTPSTPTTPSG-GYYNSPPQDSSP 318
            G G Y P PS  PSSD +P +           P+P++ ++PTTP G G Y   PQ   P
Sbjct: 366 GGGGYYGP-PS--PSSDTSPTTPGGSGGGYYGPPSPSSETSPTTPGGDGGYTPTPQVPLP 422

Query: 319 P--TDP--TPTTPSTPTTPSGGYYNSPP 390
           P  T P  +P TP TPTTP+    N+PP
Sbjct: 423 PISTSPPFSPLTP-TPTTPTPYDPNTPP 449

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 49/116 (42%), Positives = 56/116 (48%), Gaps = 17/116 (14%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP-----PGGGSYDPTPSPPSDS-----GGSPPGSYDP------ 138
           TP+ PSG     P+PSS      PGGG Y   PSP SD+     GGS  G Y P      
Sbjct: 342 TPSAPSGGYYGPPSPSSDTSPTTPGGGGYYGPPSPSSDTSPTTPGGSGGGYYGPPSPSSE 401

Query: 139 -TPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPP 303
            +P+ P GDG Y PTP  P      PP   SPP  P   TP+TPT       N+PP
Sbjct: 402 TSPTTPGGDGGYTPTPQVP-----LPPISTSPPFSPLTPTPTTPTPYDP---NTPP 449

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 47/122 (38%), Positives = 61/122 (50%), Gaps = 3/122 (2%)
 Frame = +1

Query: 61  PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSD 240
           P GG  DP     S      PGS+   P PPS  G+   TP+TP            PPS 
Sbjct: 46  PFGGRKDPADPDHS------PGSHRTPPCPPS-IGTSPTTPTTPGGG-----GSYYPPSP 93

Query: 241 PTPTTPSTPTTPSG-GYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYN--SPPQDSSPPS 411
              T+P+TPT P G G Y++PP         +P++ ++PTTP GGYY   SP  D+SP +
Sbjct: 94  DIGTSPTTPTAPGGSGGYDAPP---------SPSSDTSPTTPGGGYYGPPSPSSDTSPAT 144

Query: 412 DP 417
            P
Sbjct: 145 PP 146

[6][TOP]
>UniRef100_B6KLS9 Voltage gated chloride channel domain-containing protein n=1
           Tax=Toxoplasma gondii ME49 RepID=B6KLS9_TOXGO
          Length = 1779

 Score =  101 bits (252), Expect = 2e-20
 Identities = 61/138 (44%), Positives = 79/138 (57%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+ +PPS   S +P+PSSPP   S  P+PSPP  S   PP S  P+ SPPS     +P P
Sbjct: 207 PSSSPPSS--STSPSPSSPPS--SSPPSPSPPPSS---PPSSSPPSSSPPSPS---SPPP 256

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S+PPSS  + PS  SPP   +P + S P++ S    + PP  S PP  P+P + ST  +P
Sbjct: 257 SSPPSS--SSPSSSSPPPSSSPPSSSPPSSSSPSSSSPPPSSSPPP--PSPPSSSTSPSP 312

Query: 364 SGGYYNSPPQDSSPPSDP 417
           S    +SPP  S PPS P
Sbjct: 313 SSPPSSSPPSPSPPPSSP 330

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 65/158 (41%), Positives = 84/158 (53%), Gaps = 18/158 (11%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGG----------GSYDPTPSPPSDSGGS----PPGSYDPT 141
           P+ +PPS     +P PSSPP             S  P+ SPPS S  S    PP S  P 
Sbjct: 244 PSSSPPSPS---SPPPSSPPSSSSPSSSSPPPSSSPPSSSPPSSSSPSSSSPPPSSSPPP 300

Query: 142 PSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP 321
           PSPPS   S +P+PS+PPSS  +PPS   PPS P  ++P + + PS    +SPP  SSPP
Sbjct: 301 PSPPS--SSTSPSPSSPPSS--SPPSPSPPPSSPPSSSPPSSSPPSPPSPSSPP-PSSPP 355

Query: 322 TDPTPTT----PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           +  +P++    PS+   P     +SPP  SSP S P P
Sbjct: 356 SSSSPSSSSPPPSSSPPPPSPPSSSPPSSSSPSSSPSP 393

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 59/151 (39%), Positives = 77/151 (50%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS----PPGSYDPTPSPPSGDGSY 171
           P+P+PP      +  PSS P   S  P  SPPS S  S    PP S  P+ SPPS     
Sbjct: 229 PSPSPPPSSPPSSSPPSSSPPSPSSPPPSSPPSSSSPSSSSPPPSSSPPSSSPPSSSSPS 288

Query: 172 NPTPSTPPSSDCTPPSQDS-----PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           + +P  PPSS   PPS  S      PS P  ++P +P+ P     +S P  SSPP+ P+P
Sbjct: 289 SSSP--PPSSSPPPPSPPSSSTSPSPSSPPSSSPPSPSPPPSSPPSSSPPSSSPPSPPSP 346

Query: 337 TT--PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           ++  PS+P + S    +SPP  SSPP    P
Sbjct: 347 SSPPPSSPPSSSSPSSSSPPPSSSPPPPSPP 377

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 61/146 (41%), Positives = 77/146 (52%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSG---GSPPGSYDP---TPSPPSGDG 165
           P+  P S   S +P PSSPP   S  P+ SPPS S     SPP S  P   +P P S   
Sbjct: 220 PSSPPSSSPPSPSPPPSSPP--SSSPPSSSPPSPSSPPPSSPPSSSSPSSSSPPPSSSPP 277

Query: 166 SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
           S +P  S+ PSS   PPS   PP  P+P + ST  +PS    +SPP  S PP+ P  ++P
Sbjct: 278 SSSPPSSSSPSSSSPPPSSSPPP--PSPPSSSTSPSPSSPPSSSPPSPSPPPSSPPSSSP 335

Query: 346 STPTTPSGGYYNSPPQDSSPPSDPLP 423
            + + PS    +SPP  SSPPS   P
Sbjct: 336 PSSSPPSPPSPSSPP-PSSPPSSSSP 360

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 61/150 (40%), Positives = 81/150 (54%), Gaps = 12/150 (8%)
 Frame = +1

Query: 4   PTPTPPSGDG-------SYNPTPSSPPGGGSYDPTPSPPSDSGG----SPPGSYDPTPSP 150
           P+ +PPS          S +P+PSSPP   S  P+ SPPS S      SPP S  P+PSP
Sbjct: 176 PSLSPPSSSSPSSSPSSSTSPSPSSPPS--SSPPSSSPPSSSTSPSPSSPPSSSPPSPSP 233

Query: 151 PSGDGSYNPTPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTD 327
           P         PS+PPSS  +PPS   P PS P P++P + ++PS    +SPP  SSPP+ 
Sbjct: 234 P---------PSSPPSS--SPPSSSPPSPSSPPPSSPPSSSSPSS---SSPPPSSSPPSS 279

Query: 328 PTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
             P++ S+P++ S      PP  S PP  P
Sbjct: 280 SPPSS-SSPSSSS-----PPPSSSPPPPSP 303

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 51/112 (45%), Positives = 65/112 (58%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PPS   S +P+PSSPP   S  P+PSPP  S   PP S  P+ SPPS     +P P
Sbjct: 299 PPPSPPSS--STSPSPSSPPS--SSPPSPSPPPSS---PPSSSPPSSSPPSPPSPSSPPP 351

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
           S+PPSS  + PS  SPP   +P  PS P+       +SPP  SSP + P+P+
Sbjct: 352 SSPPSS--SSPSSSSPPPSSSPPPPSPPS-------SSPPSSSSPSSSPSPS 394

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 53/117 (45%), Positives = 67/117 (57%), Gaps = 3/117 (2%)
 Frame = +1

Query: 82  PTPSPPSDSG--GSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTT 255
           P+ SPPS S    SP  S  P+PS P    S +P  S+PPSS  T PS  SPPS  +P +
Sbjct: 176 PSLSPPSSSSPSSSPSSSTSPSPSSPP---SSSPPSSSPPSSS-TSPSPSSPPSS-SPPS 230

Query: 256 PSTPTTPSGGYYNSPPQDSSP-PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PS P  PS    +SPP  S P P+ P P++P + ++PS    +SPP  SSPPS   P
Sbjct: 231 PSPP--PSSPPSSSPPSSSPPSPSSPPPSSPPSSSSPSS---SSPPPSSSPPSSSPP 282

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 48/147 (32%), Positives = 70/147 (47%), Gaps = 6/147 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPS-DSGGSPPGSYDPTPSPPSGDG---SY 171
           P+  P S   S +P PSSPP   S  P+ SPPS  S  SPP S  P+ S PS      S 
Sbjct: 312 PSSPPSSSPPSPSPPPSSPPS--SSPPSSSPPSPPSPSSPPPSSPPSSSSPSSSSPPPSS 369

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT--PTTP 345
           +P P +PPSS  +PPS  SP S P+P+   +             ++ S   D T  P   
Sbjct: 370 SPPPPSPPSS--SPPSSSSPSSSPSPSADLSERAQGPADEAPEKRNESAEVDKTSHPREN 427

Query: 346 STPTTPSGGYYNSPPQDSSPPSDPLPR 426
           ++  +P+ G  +   ++++  S  L +
Sbjct: 428 ASNGSPASGRLSGSEKEATQNSSDLDK 454

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 54/139 (38%), Positives = 67/139 (48%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PPS   S    PSSPP        P PPS     PP S    P PPS   S + + S+
Sbjct: 625 PVPPSSP-SMPLLPSSPPS------VPVPPS---SPPPSSSLSAPVPPSPSSSSSHS-SS 673

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           PPS    PP     PS P+P++ S+P+ P       P   SSPP+ P P++PS P + S 
Sbjct: 674 PPSVLPLPP---HVPSSPSPSSASSPSMP------LPTSSSSPPSSP-PSSPSVPLSSSS 723

Query: 370 GYYNSPPQDSSPPSDPLPR 426
              + PP  SSP S  L R
Sbjct: 724 P--SVPPSPSSPVSVLLSR 740

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 46/151 (30%), Positives = 65/151 (43%), Gaps = 12/151 (7%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            +P P+ PS   +     S  P   S   + + PS      P      PS P       P 
Sbjct: 567  EPLPSHPSSVSNVISLSSLSPVVSSRRLSVNFPSPHQPKQPSFSPVHPSSPYSSSPSVPV 626

Query: 181  PSTPPSSDC---TPPSQDSPPSDPTPTT----PSTPTTPSGGYYNSPPQDSSP-----PT 324
            P + PS      +PPS   PPS P P++    P  P+  S   ++S P    P     P+
Sbjct: 627  PPSSPSMPLLPSSPPSVPVPPSSPPPSSSLSAPVPPSPSSSSSHSSSPPSVLPLPPHVPS 686

Query: 325  DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
             P+P++ S+P+ P     +SPP  SSPPS P
Sbjct: 687  SPSPSSASSPSMPLPTSSSSPP--SSPPSSP 715

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 50/153 (32%), Positives = 61/153 (39%), Gaps = 13/153 (8%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+  PPS   +   + SSPP G    P  S   +S  +   +      P SG  +  P P
Sbjct: 515 PSALPPSSSSTVASSLSSPPPG----PVTSALEESKRNETTASGEKKQPYSGVVTLEPLP 570

Query: 184 STPPS-SDCTPPSQDSP-----------PSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPT 324
           S P S S+    S  SP           PS   P  PS +P  PS       P  SSP  
Sbjct: 571 SHPSSVSNVISLSSLSPVVSSRRLSVNFPSPHQPKQPSFSPVHPSS------PYSSSPSV 624

Query: 325 DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              P++PS P  PS     SPP    PPS P P
Sbjct: 625 PVPPSSPSMPLLPS-----SPPSVPVPPSSPPP 652

[7][TOP]
>UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK5_CHLRE
          Length = 853

 Score =  101 bits (251), Expect = 3e-20
 Identities = 55/140 (39%), Positives = 61/140 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P P PPS      P P
Sbjct: 200 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP    +PP    PP  P P  P +P  P       PP  S PP  P P +P  P  P
Sbjct: 254 SPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 313

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           S    + PP    PPS P P
Sbjct: 314 SPPPPSPPPPSPPPPSPPPP 333

 Score =  100 bits (248), Expect = 7e-20
 Identities = 57/140 (40%), Positives = 61/140 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P PSPP     SPP    P+P PPS      P P
Sbjct: 352 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 411

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PPS P P  PS P  P       PP    PP  P+P  P  P+ P
Sbjct: 412 SPPPPSP--PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 469

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 470 PP----SPPPPSPPPPSPPP 485

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 56/143 (39%), Positives = 60/143 (41%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P PSPP  S   PP    P PSPP       P P
Sbjct: 220 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 279

Query: 184 STPPS---SDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           S PP    S   PP    PP  P P +P  P  PS    + PP    PP+ P P  PS P
Sbjct: 280 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 339

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
             P       PP    PPS P P
Sbjct: 340 PPPPPSPPPPPPPSPPPPSPPPP 362

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 58/140 (41%), Positives = 61/140 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P PSPP     SPP    P PSPP       P P
Sbjct: 210 PSPPPPSPPPPSPPPPSPPPPS---PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 266

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PPS P P  PS P  P      SPP  S PP  P P  P +P  P
Sbjct: 267 SPPPPSPPPPP----PPSPPPPPPPSPPPPPPP----SPPPPSPPPPSPPPPPPPSPPPP 318

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           S    + PP    PP  P P
Sbjct: 319 SPPPPSPPPPSPPPPPPPSP 338

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 58/138 (42%), Positives = 61/138 (44%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P PS PP      P PSPP     SPP    P+P PPS      P P
Sbjct: 308 PPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 367

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PPS P P  PS P  P      SPP  S PP  P P +P  P+ P
Sbjct: 368 SPPPPSPPPPP----PPSPPPPPPPSPPPPPPP----SPPPPSPPPPSPPPPSPPPPSPP 419

Query: 364 SGGYYNSPPQDSSPPSDP 417
                 SPP  S PP  P
Sbjct: 420 P----PSPPPPSPPPPPP 433

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 55/143 (38%), Positives = 59/143 (41%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP       P PS PP      P P PPS    SPP    P P PPS      P P
Sbjct: 264 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 323

Query: 184 STPPSSDCTPPSQD---SPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           S PP S   PP       PP  P P  P +P  PS    + PP    PP+ P P  PS P
Sbjct: 324 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 383

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
             P       PP    PPS P P
Sbjct: 384 PPPPPSPPPPPPPSPPPPSPPPP 406

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 57/140 (40%), Positives = 61/140 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP       P P SPP      P PSPP     SPP    P+P PPS      P P
Sbjct: 426 PSPPPPPPPSPPPPPPPSPPP----PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 481

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PPS P P  PS P  P      SPP  S PP  P P +P  P+ P
Sbjct: 482 SPPPPSPPPPP----PPSPPPPPPPSPPPPPPP----SPPPPSPPPPSPPPPSPPPPSPP 533

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PPS P P
Sbjct: 534 PPSPPPPPPPSPPPPSPPPP 553

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 56/141 (39%), Positives = 59/141 (41%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P P PPS     PP    P+P PPS      P P
Sbjct: 357 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 416

Query: 184 STPPSSDCTP-PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           S PP S   P P    PPS P P  PS P  P       PP    PP  P+P  PS P  
Sbjct: 417 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 476

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
                  SPP  S PP  P P
Sbjct: 477 -------SPPPPSPPPPSPPP 490

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 55/140 (39%), Positives = 61/140 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP       P P SPP      P+P PPS    SPP    P PSPP      +P P
Sbjct: 380 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP-SPPP 438

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PPS    PP    PP  P+P  P  P+ P      SPP  S PP  P P +P  P  P
Sbjct: 439 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP----SPPPPSPPPPSPPPPSPPPPPPP 494

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           S      PP   SPP  P P
Sbjct: 495 S----PPPPPPPSPPPPPPP 510

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 54/141 (38%), Positives = 62/141 (43%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P P SPP      P+P PPS    SPP    P P PPS      P+P
Sbjct: 391 PPPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 444

Query: 184 STPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
             PP     PP   SPP  P P+  P +P  PS    + PP    PP  P+P  P  P+ 
Sbjct: 445 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 504

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P     + PP    PPS P P
Sbjct: 505 PPPPPPSPPPPSPPPPSPPPP 525

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/140 (40%), Positives = 61/140 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P+P  PP      P+P PPS    SPP    P PSPP       P P
Sbjct: 375 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 434

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP    +PP    PPS P P  PS P  P      SPP  S PP  P P +P  P+ P
Sbjct: 435 SPPPPPPPSPPPPP-PPSPPPPPPPSPPPPPPP----SPPPPSPPPPSPPPPSPPPPSPP 489

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP   SPP  P P
Sbjct: 490 -------PPPPPSPPPPPPP 502

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 53/140 (37%), Positives = 59/140 (42%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P P PPS     PP    P+P PPS      P P
Sbjct: 313 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 372

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP     PP    PP  P+P  P  P+ P      SPP  S PP  P P +P  P+ P
Sbjct: 373 SPPP----PPPPSPPPPPPPSPPPPPPPSPPP----PSPPPPSPPPPSPPPPSPPPPSPP 424

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 425 PPSPPPPPPPSPPPPPPPSP 444

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 53/140 (37%), Positives = 61/140 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P PSPP     SPP    P+P PP       P P
Sbjct: 406 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP-------PPP 458

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP    +PP    PP  P P +P  P+ P     + PP    PP  P P  P +P  P
Sbjct: 459 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP---PPPSPPPPPPPSPPPP 515

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           S    + PP    PPS P P
Sbjct: 516 SPPPPSPPPPSPPPPSPPPP 535

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 56/140 (40%), Positives = 60/140 (42%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP       P PS PP      P P PPS    SPP    P PSPP      +P P
Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP----SPPP 376

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PPS    PP    PP  P+P  PS P  P      SPP  S PP  P P +P  P  P
Sbjct: 377 PPPPSPPPPPPPSPPPPPPPSPPPPSPP--PPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 434

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           S      PP   SPP  P P
Sbjct: 435 S----PPPPPPPSPPPPPPP 450

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 55/143 (38%), Positives = 61/143 (42%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P PS PP      P PSPP  S   PP    P P PPS      P+P
Sbjct: 238 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 297

Query: 184 ---STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
              S PP S   PP    PP  P P +P  P+ P     + PP    PP  P P  P +P
Sbjct: 298 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP---PPPSPPPPPPPSP 354

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
             PS    + PP    PPS P P
Sbjct: 355 PPPSPPPPSPPPPSPPPPSPPPP 377

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 50/140 (35%), Positives = 56/140 (40%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP       P PS PP      P PSPP     SPP    P+P PPS      P P
Sbjct: 251 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 310

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             P     +PP    PP  P P  P +P  P       PP  S PP  P P +P  P+ P
Sbjct: 311 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 370

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 371 PPSPPPPPPPSPPPPPPPSP 390

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 53/136 (38%), Positives = 61/136 (44%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPP 195
           P S  G  +P P SPP      P+P PPS    SPP    P+P PPS      P PS PP
Sbjct: 183 PISTPGIPSPPPPSPP-----PPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPP 234

Query: 196 SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGY 375
            S   PP    PP  P P +P  P  PS    + PP    PP  P+P  P  P+ P    
Sbjct: 235 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294

Query: 376 YNSPPQDSSPPSDPLP 423
            + PP    PPS P P
Sbjct: 295 PSPPPPSPPPPSPPPP 310

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/141 (36%), Positives = 59/141 (41%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP       P P SPP      P+P PP      PP    P+P PPS      P+P
Sbjct: 279 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 338

Query: 184 STPPSSDCTPPSQDSPPS-DPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
             PP     PP   SPP   P P +P  P+ P       PP    PP  P+P  P  P+ 
Sbjct: 339 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 398

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P      SPP  S PP  P P
Sbjct: 399 PP----PSPPPPSPPPPSPPP 415

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 54/141 (38%), Positives = 61/141 (43%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P+P  PP      P+P PPS    SPP    P P PPS      P P
Sbjct: 331 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS------PPP 384

Query: 184 STPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
             PPS    PP    PPS P P+  P +P  PS    + PP    PP  P+P  P  P+ 
Sbjct: 385 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 444

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P       PP   SPP  P P
Sbjct: 445 P-------PPPPPSPPPPPPP 458

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 56/141 (39%), Positives = 61/141 (43%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P PS PP      P+P PPS    SPP    P P PPS      P+P
Sbjct: 290 PPPPPPSPPPPSPPPPSPPPPP---PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 346

Query: 184 STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
             PP     PPS   P P  P+P  PS P  P       PP    PP  P+P  PS P  
Sbjct: 347 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP- 405

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           PS    + PP    PPS P P
Sbjct: 406 PSPPPPSPPPPSPPPPSPPPP 426

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/140 (36%), Positives = 59/140 (42%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP       P P SPP      P+P PPS    SPP    P+P PP       P P
Sbjct: 336 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            +PP     PPS   PP  P P +P  P+ P       PP    PP  P+P  P  P+ P
Sbjct: 396 PSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 453

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP   SPP  P P
Sbjct: 454 -------PPPPPSPPPPPPP 466

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/140 (37%), Positives = 59/140 (42%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P PSPP     SPP    P+P PP       P P
Sbjct: 401 PSPPPPSPPPPSPPPPSPPPPS---PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 457

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            +PP     PP    PP  P P +P  P+ P       PP    PP  P+P  P  P+ P
Sbjct: 458 PSPP----PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 513

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 514 P----PSPPPPSPPPPSPPP 529

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 55/140 (39%), Positives = 59/140 (42%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP       P PS PP      P PSPP     SPP    P PSPP       P P
Sbjct: 303 PPPSPPPPPPPSPPPPSPPPPS---PPPPSPPPPPPPSPPPP--PPPSPPPPPPPSPPPP 357

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PP  P P  P +P  P       PP  S PP  P P +P  P+ P
Sbjct: 358 SPPPPS---PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 414

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 415 P----PSPPPPSPPPPSPPP 430

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 55/140 (39%), Positives = 58/140 (41%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P PS PP      P P PPS    SPP    P PSPP       P+P
Sbjct: 437 PPPPPPSPPPP--PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP------PSP 488

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP   SPP  P P+ P     P      SPP  S PP  P P +P  P  P
Sbjct: 489 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP-----SPPPPSPPPPSPPPPSPPPPPPP 543

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 544 ------SPPPPSPPPPSPPP 557

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 44/117 (37%), Positives = 51/117 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP       P P SPP      P+P PPS    SPP    P+P PP       P P
Sbjct: 450 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            +PP     PPS   PP  P P +P  P+ P       PP  S PP  P P +P  P
Sbjct: 510 PSPPPPSPPPPSP--PPPSPPPPSPPPPSPPP------PPPPSPPPPSPPPPSPPPP 558

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 55/147 (37%), Positives = 59/147 (40%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4   PTPTPPSG-------DGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGD 162
           P P  P G       D   +  P S PG     P+P PPS    SPP    P PSPP   
Sbjct: 161 PPPGLPKGVCSAALFDSQNDCCPISTPG----IPSPPPPSPPPPSPPPPSPPPPSPPP-- 214

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
                 PS PP S   PP    PP  P P +P  P  PS      PP  S PP  P P  
Sbjct: 215 ------PSPPPPS---PPPPSPPPPSPPPPSPPPPPPPS------PPPPSPPPPSPPPPP 259

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P +P  PS      PP    PPS P P
Sbjct: 260 PPSPPPPS------PP----PPSPPPP 276

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 29/73 (39%), Positives = 32/73 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP       P P SPP      P+P PPS    SPP    P P PPS      P P
Sbjct: 494 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS------PPP 547

Query: 184 STPPSSDCTPPSQ 222
            +PP     PP Q
Sbjct: 548 PSPPPPSPPPPCQ 560

[8][TOP]
>UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1
            Tax=Ostreococcus tauri RepID=Q010M7_OSTTA
          Length = 1449

 Score =  101 bits (251), Expect = 3e-20
 Identities = 61/146 (41%), Positives = 69/146 (47%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNP-TPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG----- 165
            P P PPS     NP TP SPP   S  P PS P     SPP S  P PSPP         
Sbjct: 807  PPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAP 866

Query: 166  SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
            +  P PS PPS   +PP   SPP  P+P    +P   S    +SPP  SSPP   +P  P
Sbjct: 867  TPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPP 926

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
            S+P  PS     SPP   +PP  P P
Sbjct: 927  SSPPPPSPPLPPSPPLPPNPPPPPSP 952

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 61/148 (41%), Positives = 69/148 (46%), Gaps = 8/148 (5%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYD-PTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            P P  PS   S  P PS PP       PTP PP     SPP S  P PSPP    S  P+
Sbjct: 839  PPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPP-SPPPS 897

Query: 181  PSTPPSSD---CTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            PS PPSS+    +PP   SPP   +P  PS+P  P      SPP   SPP  P P  P +
Sbjct: 898  PSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPP------SPPLPPSPPLPPNPPPPPS 951

Query: 352  PTTPSGGYYNSPPQ----DSSPPSDPLP 423
            P +P       PP+       PPS PLP
Sbjct: 952  P-SPXXXXXXXPPRLPTPSPPPPSPPLP 978

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 53/138 (38%), Positives = 60/138 (43%), Gaps = 2/138 (1%)
 Frame = +1

Query: 16   PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPP 195
            PPS      P+P  PP      P PSPP       P S  P PSPP    S  P   +PP
Sbjct: 788  PPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPP 847

Query: 196  SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGY 375
             S    PS   PP+ P   TP  P +P      SPP   SPP  P+P    +P   S   
Sbjct: 848  PSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPP 907

Query: 376  YNSPPQDSSPP--SDPLP 423
             +SPP  SSPP  S P P
Sbjct: 908  LSSPPPLSSPPPLSSPPP 925

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 57/143 (39%), Positives = 67/143 (46%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS     +P P  PP   S  P P+PP+     PP S  P PS P    S +P P
Sbjct: 792  PPPLPPSPPPPPSPPPPPPPP--SPPPPPNPPTPPSPPPPPSPPPPPSSPPPP-SPSPPP 848

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTP---TTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            S PP+   +PP   +PP  PTP  P +P     PS     SPP   SPP  P+P   S P
Sbjct: 849  SPPPAP--SPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNP 906

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
               S    +SPP  SSPP    P
Sbjct: 907  PLSSPPPLSSPPPLSSPPPPSSP 929

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 60/145 (41%), Positives = 65/145 (44%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP-SPPSGDGSYNPT 180
            P P+PP       P P SPP   S  P P PPS     PP    PTP SPP       P 
Sbjct: 787  PPPSPPP------PLPPSPPPPPSPPPPPPPPSP----PPPPNPPTPPSPP-------PP 829

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT---TPST 351
            PS PP     PP   SPP  P P  PS P  P+     +PP   SPP  P P+    PS 
Sbjct: 830  PSPPPPPSSPPPPSPSPPPSPPPA-PSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSP 888

Query: 352  PTTPSGGYYNSPPQDSSPP-SDPLP 423
            P  PS     SPP  S+PP S P P
Sbjct: 889  PPPPSPPPSPSPPPSSNPPLSSPPP 913

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 51/123 (41%), Positives = 55/123 (44%), Gaps = 3/123 (2%)
 Frame = +1

Query: 64   GGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDP 243
            G     P PSPP     SPP    P P PP       P P TPPS    PPS   PPS P
Sbjct: 781  GQARQSPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPP-PPPSPPPPPSSP 839

Query: 244  TPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT---PSGGYYNSPPQDSSPPSD 414
             P +PS P +P      SPP   +PP  PTP  P +P     PS     SPP   SPP  
Sbjct: 840  PPPSPSPPPSPPPA--PSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPS 897

Query: 415  PLP 423
            P P
Sbjct: 898  PSP 900

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 43/125 (34%), Positives = 48/125 (38%), Gaps = 11/125 (8%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSG---------GSPPGSYDPTP--SP 150
            P P+PP       P P SPP   S  P+PSPP  S           SPP    P P  SP
Sbjct: 870  PPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSP 929

Query: 151  PSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP 330
            P       P+P  PP+    PP   SP        P  PT        SPP    PP+ P
Sbjct: 930  PPPSPPLPPSPPLPPNP--PPPPSPSPXXXXXXXPPRLPTP-------SPP----PPSPP 976

Query: 331  TPTTP 345
             P  P
Sbjct: 977  LPPPP 981

[9][TOP]
>UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S9_EHV86
          Length = 621

 Score =  100 bits (250), Expect = 4e-20
 Identities = 57/138 (41%), Positives = 64/138 (46%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P+P PPS    SPP    P+P PPS      P P
Sbjct: 398 PSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPP 457

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PP  P P +P  P+ P      SPP  S PP  P P +P  P+ P
Sbjct: 458 SPPPPS---PPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPPSPPPPSPPPPSPP 510

Query: 364 SGGYYNSPPQDSSPPSDP 417
                 SPP  S PPS P
Sbjct: 511 PP----SPPPPSPPPSPP 524

 Score =  100 bits (248), Expect = 7e-20
 Identities = 60/141 (42%), Positives = 67/141 (47%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP   S  P+P PPS    SPP    P+P PPS      P P
Sbjct: 352 PSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP 408

Query: 184 STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           S PP S   PPS   P P  P+P  PS P+ P      SPP  S PP  P P +P  P+ 
Sbjct: 409 SPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPP----SPPPPSPPPPSPPPPSPPPPSP 464

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P      SPP  S PP  P P
Sbjct: 465 PPP----SPPPPSPPPPSPPP 481

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 57/143 (39%), Positives = 65/143 (45%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPP---SGDGSYN 174
           P+P PP      +P P SPP      P+P PPS    SPP    P PSPP   S      
Sbjct: 367 PSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSP 426

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           P PS PP S  +PP    PP  P P +P  P+ P      SPP  S PP  P P +P  P
Sbjct: 427 PPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPPSPPPPSPPPP 482

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
           + P      SPP  S PP  P P
Sbjct: 483 SPPPP----SPPPPSPPPPSPPP 501

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 58/140 (41%), Positives = 64/140 (45%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P PSPP  S   PP S  P+P PPS      P P
Sbjct: 337 PSPPPPSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPP 393

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PPS P P+ P  P         SPP  S PP  P P +P +P  P
Sbjct: 394 SPPPPSP--PPPSPPPPSPPPPSPPPPP---------SPPPPSPPPPSPPPPSPPSPPPP 442

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           S    + PP    PPS P P
Sbjct: 443 SPPPPSPPPPSPPPPSPPPP 462

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 56/141 (39%), Positives = 63/141 (44%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS-GDGSYNPT 180
           P+P PPS      P PS PP   S  P+P PPS    SPP    P PSPP       +P 
Sbjct: 296 PSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 355

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           P +PP     PPS   PP  P P+ P     P      SPP  S PP  P P +P  P+ 
Sbjct: 356 PPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 415

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P      SPP  S PP  P P
Sbjct: 416 PPP---PSPPPPSPPPPSPPP 433

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 56/140 (40%), Positives = 62/140 (44%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP      +P P SPP      P+P PPS    SPP    P+P PPS      P P
Sbjct: 151 PPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP 207

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PPS P P+ P     P      SPP  S PP  P P +P  P  P
Sbjct: 208 SPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 265

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 266 PSPPPPSPPPPSPPPPSPPP 285

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 57/143 (39%), Positives = 66/143 (46%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP      +P P SPP      P+P PPS    SPP    P PSPP       P P
Sbjct: 316 PPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPPP 374

Query: 184 STPPS--SDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           S PPS      PP    PPS P P+  P +P  PS    + PP  S PP  P P +P  P
Sbjct: 375 SPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPP 434

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
           + PS    + PP    PPS P P
Sbjct: 435 SPPSPPPPSPPPPSPPPPSPPPP 457

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 57/140 (40%), Positives = 61/140 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP        P PPS    SPP    P PSPPS      P P
Sbjct: 388 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPP 447

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PPS P P+ P     P      SPP  S PP  P P +P  P+ P
Sbjct: 448 SPPPPS--PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 505

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 506 P----PSPPPPSPPPPSPPP 521

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 54/140 (38%), Positives = 63/140 (45%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP      +P P SPP      P+P PPS    SPP    P PSPP      +P P
Sbjct: 255 PPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPP 310

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            +PP    +PP    PPS P P+ P     P      SPP  S PP  P P +P  P+ P
Sbjct: 311 PSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 370

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP  S PPS P P
Sbjct: 371 -------PPPPSPPPSPPPP 383

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 56/140 (40%), Positives = 63/140 (45%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P PSPP    S  P+P
Sbjct: 271 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSP 324

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             P     +PP    PP  P P +P  P+ P      SPP  S PP  P P  PS P +P
Sbjct: 325 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP----PSPPPPSPPPPSPPPPPPSPPPSP 380

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 381 PP---PSPPPPSPPPPSPPP 397

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 57/140 (40%), Positives = 64/140 (45%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P PSPP  S   PP S  P+P PPS      P P
Sbjct: 281 PSPPPPSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPP 337

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PP  P P +P  P+ P     + PP   SPP  P P +P  P+ P
Sbjct: 338 SPPPPS---PPPPSPPPPSPPPPSPPPPSPPPP---SPPPPPPSPPPSPPPPSPPPPSPP 391

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 392 P----PSPPPPSPPPPSPPP 407

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 57/140 (40%), Positives = 64/140 (45%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P PSPP      +P P
Sbjct: 217 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPP 270

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            +PP     PPS   PP  P P +P  P+ P      SPP  S PP  P P  PS P +P
Sbjct: 271 PSPPPPSPPPPS--PPPPSPPPPSPPPPSPPP----PSPPPPSPPPPSPPPPPPSPPPSP 324

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 325 PP---PSPPPPSPPPPSPPP 341

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 57/140 (40%), Positives = 64/140 (45%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP       P P SPP      P+P PPS    SPP    P+P PPS      P P
Sbjct: 250 PPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP 306

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP   SPP  P P +P  P+ P      SPP  S PP  P P +P  P+ P
Sbjct: 307 SPPPPSP--PPPPPSPPPSPPPPSPPPPSPPPP----SPPPPSPPPPSPPPPSPPPPSPP 360

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 361 PP----SPPPPSPPPPPPSP 376

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 56/140 (40%), Positives = 62/140 (44%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP      +P P SPP      P+P PPS     PP S  P P PPS      P P
Sbjct: 116 PPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPP---PPPSPPPPPPPPSPPPPSPPPP 172

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PPS P P+ P     P      SPP  S PP  P P +P  P+ P
Sbjct: 173 SPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 230

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 231 P----PSPPPPSPPPPSPPP 246

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 57/140 (40%), Positives = 64/140 (45%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P+P PPS      P P
Sbjct: 182 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP 232

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PP  P P +P  P+ P      SPP  S PP  P P +P  P+ P
Sbjct: 233 SPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 289

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 290 P----PSPPPPSPPPPSPPP 305

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 57/140 (40%), Positives = 63/140 (45%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P+P PPS      P P
Sbjct: 187 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP 237

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PP  P P +P  P  P      SPP  S PP  P P +P  P+ P
Sbjct: 238 SPPPPS---PPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 294

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 295 P----PSPPPPSPPPPSPPP 310

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 57/140 (40%), Positives = 64/140 (45%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P PSPP      +P P
Sbjct: 197 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPP 246

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            +PP     PPS   PP  P+P  PS P  P      SPP  S PP  P P +P  P+ P
Sbjct: 247 PSPPPPSPPPPSPPPPPPPPSPPPPSPP--PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 304

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 305 P----PSPPPPSPPPPPPSP 320

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 56/138 (40%), Positives = 62/138 (44%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS     PP    P+P PPS      P P
Sbjct: 403 PSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPP 462

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PPS P P+ P     P      SPP  S PP  P P +P  P+ P
Sbjct: 463 SPPPPSP--PPPSPPPPSPPPPSPPPPSPPPP-----SPPPPSPPPPSPPPPSPPPPSPP 515

Query: 364 SGGYYNSPPQDSSPPSDP 417
                 SPP  S PPS P
Sbjct: 516 PPSPPPSPP-PSHPPSHP 532

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 59/140 (42%), Positives = 65/140 (46%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP   S  P P PPS    SPP    P+P PPS      P P
Sbjct: 237 PSPPPPSPPPPSPPPPSPPPP--SPPPPPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP 291

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PPS P P+ P  P +P      SPP  S PP  P P +P  P+ P
Sbjct: 292 SPPPPSP--PPPSPPPPSPPPPSPPPPPPSPPP----SPPPPSPPPPSPPPPSPPPPSPP 345

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 346 PP----SPPPPSPPPPSPPP 361

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 58/142 (40%), Positives = 64/142 (45%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P PSPP      PP    P+P PPS      P P
Sbjct: 342 PSPPPPSPPPPSPPPPSPPPPS---PPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPP 398

Query: 184 STPPSSDCTP-PSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
           S PP S   P P   SPP  P+P  PS  P +P      SPP  S PP  P P +P  P+
Sbjct: 399 SPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPS 458

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
            P      SPP  S PP  P P
Sbjct: 459 PPP----PSPPPPSPPPPSPPP 476

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 58/140 (41%), Positives = 63/140 (45%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP   S  P P PPS    SPP    P+P PPS      P P
Sbjct: 137 PSPPPPS------PPPPSPPPPPSPPPPPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP 187

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PPS P P+ P     P      SPP  S PP  P P +P  P+ P
Sbjct: 188 SPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 245

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 246 PP----SPPPPSPPPPSPPP 261

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/140 (40%), Positives = 63/140 (45%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P+P PPS      P P
Sbjct: 177 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP 227

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PP  P P +P  P+ P       PP  S PP  P P +P  P+ P
Sbjct: 228 SPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPP 284

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 285 P----PSPPPPSPPPPSPPP 300

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 55/140 (39%), Positives = 62/140 (44%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS        P SPP      P+P PPS    SPP    P PSPP      +P P
Sbjct: 306 PSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPP 361

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            +PP     PP    PPS P P+ P     P      SPP  S PP  P+P  PS P  P
Sbjct: 362 PSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPPP 419

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           S    + PP    PPS P P
Sbjct: 420 SPPPPSPPPPSPPPPSPPSP 439

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 54/140 (38%), Positives = 62/140 (44%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P PSPP  S   PP    P+P PPS      P+P
Sbjct: 383 PSPPPPSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSP 439

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             P     +PP    PP  P P +P  P+ P      SPP  S PP  P P +P  P+ P
Sbjct: 440 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP----PSPPPPSPPPPSPPPPSPPPPSPP 495

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 496 P----PSPPPPSPPPPSPPP 511

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 58/142 (40%), Positives = 64/142 (45%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P+P PPS      P P
Sbjct: 202 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP 252

Query: 184 STPPSSDCTPPSQDSPP--SDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
           S PP S   PP   SPP  S P P+ P     P      SPP  S PP  P P +P  P+
Sbjct: 253 SPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 312

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
            P       PP  S PPS P P
Sbjct: 313 PP-------PPPPSPPPSPPPP 327

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 53/140 (37%), Positives = 61/140 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P P PP      +P P
Sbjct: 222 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPP 275

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            +PP     PPS   P   P    P +P  PS    + PP   SPP  P P +P  P+ P
Sbjct: 276 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPP 335

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 336 P----PSPPPPSPPPPSPPP 351

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 55/140 (39%), Positives = 61/140 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P+P PP      PP    P+P PPS      P P
Sbjct: 127 PSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPP----PSPPPPSPPPPSPPPP 182

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PPS P P+ P     P      SPP  S PP  P P +P  P+ P
Sbjct: 183 SPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 240

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 241 P----PSPPPPSPPPPSPPP 256

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 56/140 (40%), Positives = 61/140 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP       P PS PP      P PSPP  S   PP    P+P PPS      P P
Sbjct: 147 PSPPPPPSPPPPPPPPSPPPPS---PPPPSPPPPS-PPPPSPPPPSPPPPSPPPPSPPPP 202

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PPS P P+ P     P      SPP  S PP  P P +P  P+ P
Sbjct: 203 SPPPPS--PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 260

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 261 PPPPPPSPPPPSPPPPSPPP 280

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 56/140 (40%), Positives = 61/140 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P  TPP       P PS PP      P PSPP  S   PP S  P PSPP      +P P
Sbjct: 112 PPTTPPPSPPPSQPPPSPPPPS---PPPPSPPPPS--PPPPSPPPPPSPPPPPPPPSPPP 166

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            +PP     PPS   PPS P P+ P     P      SPP  S PP  P P +P  P+ P
Sbjct: 167 PSPPPPSPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 225

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 226 P----PSPPPPSPPPPSPPP 241

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 49/123 (39%), Positives = 55/123 (44%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P+P PPS      P P
Sbjct: 442 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP 492

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PP  P P +P  P+ P     + PP  S PP  P    P  P T 
Sbjct: 493 SPPPPS---PPPPSPPPPSPPPPSPPPPSPPPSPPPSHPP--SHPPMHPPMHPPFLPPTT 547

Query: 364 SGG 372
           S G
Sbjct: 548 STG 550

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 32/85 (37%), Positives = 38/85 (44%)
 Frame = +1

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
           Y P  + PPS   + P    PP  P P +P  P+ P      SPP   SPP  P P +P 
Sbjct: 110 YIPPTTPPPSPPPSQPPPSPPPPSPPPPSPPPPSPPP----PSPPPPPSPPPPPPPPSPP 165

Query: 349 TPTTPSGGYYNSPPQDSSPPSDPLP 423
            P+ P      SPP  S PP  P P
Sbjct: 166 PPSPPP----PSPPPPSPPPPSPPP 186

[10][TOP]
>UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2B5_EHV86
          Length = 2332

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 62/146 (42%), Positives = 75/146 (51%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSP-PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP- 177
            P+P PPS   S  P+P  P P   S  P+P PPS S   PP S  P+P PPS   S  P 
Sbjct: 1739 PSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPP 1798

Query: 178  --TPSTPPSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDPTPT-TP 345
              +PS PP S  T PS   PP+ P+P  PS +P+ P      SPP  SS P+ P P+ +P
Sbjct: 1799 SLSPSPPPPS--TSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPPPPSLSP 1856

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
            S P +P       PP    PPS P P
Sbjct: 1857 SPPPSP-------PPSSPPPPSPPTP 1875

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 58/142 (40%), Positives = 73/142 (51%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP-PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P+P PPS   S  P   SP P   S  P+P PPS S   PP S  P+P PPS   S  P+
Sbjct: 242 PSPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPS 301

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
           P  PPS+  +PP +  P + P+P  PS +P+ P      SPP  S  P+ P P+   +P 
Sbjct: 302 P-PPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPP 360

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
            PS     SPP  + PPS P P
Sbjct: 361 PPS--LSPSPPPATPPPSPPPP 380

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 56/140 (40%), Positives = 60/140 (42%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P  PP      P PSPP     SPP    P P+PP       P P
Sbjct: 703  PSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPP 762

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            S PPS   +PP   SPP  P P TP  P  P       P    SPP  P P TP  P  P
Sbjct: 763  SPPPSPPPSPP--PSPPPSPPPPTPPPPAPP------PPTPPPSPPPSPPPPTPPPPAPP 814

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
                  +PP  S PP  PLP
Sbjct: 815  P----PNPPPPSPPPPLPLP 830

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 55/141 (39%), Positives = 66/141 (46%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSS-PPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            P P PPS      P+PSS PP      P P PP     +PP    P PSPPS      P 
Sbjct: 1684 PAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPP 1743

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            PS PPS   +PP    PP   +P+ P   T+P      SPP  S+ P+ P P+   +P  
Sbjct: 1744 PSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSP------SPPPPSASPSPPPPSASPSPPP 1797

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            PS     SPP  S+ PS P P
Sbjct: 1798 PS--LSPSPPPPSTSPSPPPP 1816

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/143 (38%), Positives = 70/143 (48%), Gaps = 8/143 (5%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSP-PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            P+P PPS   S  P  +SP P   S  P+P PPS S   PP S  P+P PPS   S  P 
Sbjct: 1757 PSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPP 1816

Query: 181  PSTP----PSSDCTPPSQDSPPSDPTPTTPSTPTTPS---GGYYNSPPQDSSPPTDPTPT 339
            P++P    PS+  +PP   S PS P P++  +P  PS       + PP    PP+ PTP 
Sbjct: 1817 PASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPPPPSLSPSPPPSPPPSSPPPPSPPTPP 1876

Query: 340  TPSTPTTPSGGYYNSPPQDSSPP 408
             P  P   S     + P  S+PP
Sbjct: 1877 APPRPFLVSLDIIATQPSSSNPP 1899

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/140 (37%), Positives = 59/140 (42%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS     +P P SPP      P+P PPS     PP    P P PP      +P P
Sbjct: 683  PSPPPPSPSPPPSPPPPSPP------PSPPPPSPPPPLPPPPLPPPPLPPP-----SPPP 731

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            S PPS   +PP    PP  P P  P     PS      P    SPP  P P TP  P  P
Sbjct: 732  SPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPP 791

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
                  SPP    PP+ P P
Sbjct: 792  PPTPPPSPPPSPPPPTPPPP 811

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/146 (35%), Positives = 62/146 (42%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PP+      P P+ PP      P PSPP     SPP S  P+P PP+      P P
Sbjct: 739  PSPPPPTPPPPAPPPPAPPPA-----PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPP 793

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP------PTDPTPTTP 345
            + PPS   +PP    PP  P P  P  P+ P       PP    P      P  P P  P
Sbjct: 794  TPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPP 853

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
            S P +P      SPP    PP+ P P
Sbjct: 854  SPPPSPPPSPPPSPPPSPPPPTPPPP 879

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 51/147 (34%), Positives = 67/147 (45%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGS-------YDPTPSPPSDSGGSPPGSYDPTPSPPSGD 162
            P+P+PP      +P PS PP             P P PP     SPP S  P+P PP+  
Sbjct: 688  PSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPP 747

Query: 163  GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
                P P+ PP+   +PP   SPP  P P+ P +P  P+      PP  + PP  P P+ 
Sbjct: 748  PPAPPPPAPPPAPPPSPPP--SPPPSPPPSPPPSPPPPT------PPPPAPPPPTPPPSP 799

Query: 343  PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P +P  P+      PP +  PPS P P
Sbjct: 800  PPSPPPPTPPPPAPPPPNPPPPSPPPP 826

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/146 (36%), Positives = 60/146 (41%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS      P P  PP      P PSPP     SPP S  P+P PP+      P P
Sbjct: 1006 PLPPPPSPPPPLPPPPLPPP---PLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPP 1062

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP------PTDPTPTTP 345
            + PPS   +PP    PP  P P  P  P+ P       PP    P      P  P P  P
Sbjct: 1063 APPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPP 1122

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
            S P +P      SPP    PP+ P P
Sbjct: 1123 SPPPSPPPSPPPSPPPSPPPPTPPPP 1148

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 58/151 (38%), Positives = 71/151 (47%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP-- 177
            P P PP       P PS PP      P PSPP  S   PP S  P+P PPS   S  P  
Sbjct: 1724 PPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPS--PPPPSLSPSPPPPSTSPSPPPPS 1781

Query: 178  -TPS-TPPSSDCTPPSQDSPPSDPTPTT-------PSTPTTPSGGYYNSPPQDSSPPTDP 330
             +PS  PPS+  +PP     PS P P+T       P++P+ P      SPP  SS P+ P
Sbjct: 1782 ASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPP 1841

Query: 331  TPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             P++  +P  PS    +  P  S PPS P P
Sbjct: 1842 PPSSSPSPPPPS---LSPSPPPSPPPSSPPP 1869

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 58/150 (38%), Positives = 71/150 (47%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP-PGGGSYDPTPSPPSDSGGSPPGSYDPTP--SPPSGDGSYN 174
           P+P PPS   S  P   SP P   S  P+P PPS S   PP S  P+P  SPP    S +
Sbjct: 251 PSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPS 310

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPT-TPS------TPTTPSGGYYNSPPQDSSPPTDPT 333
           P P  PPS+  +PP     PS P P+ +PS      +P+ P   +  SPP  S  P+ P 
Sbjct: 311 PPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPP 370

Query: 334 PTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            T P +P  PS      PP    PP  P P
Sbjct: 371 ATPPPSPPPPSPPPPLPPPPSPPPPLPPPP 400

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 60/145 (41%), Positives = 69/145 (47%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP-PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P+P PPS   S  P   SP P   S  P+P PPS S   PP S  P+P PP    S +P+
Sbjct: 224 PSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPPP----SLSPS 279

Query: 181 PSTPPSSDCTPP---SQDSPPSDPTP-TTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
           P  P  S   PP   S   PPS P P T+PS P  P      SPP  S  P+ P P+   
Sbjct: 280 PPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSP 339

Query: 349 TPTTPSGGYYNSPPQDSSPPSDPLP 423
           +P  PS     SPP  S  PS P P
Sbjct: 340 SPPPPS--LSPSPPPPSFSPSPPPP 362

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/146 (36%), Positives = 60/146 (41%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS   S  P+P   P      PTP PP+    +PP S  P+P PP+      P P
Sbjct: 1026 PLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPP 1085

Query: 184  STPPSSDCTPPSQDSPPSDPTP------TTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
            + PP S   P     PPS P P        P  P  PS      P    SPP  P P TP
Sbjct: 1086 NPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTP 1145

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
              P  P      SPP    PP+ P P
Sbjct: 1146 PPPAPPPPAPPPSPPPSPPPPTPPPP 1171

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 54/142 (38%), Positives = 57/142 (40%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PP       P PS PP      P PSPP     SPP    P P+PP      NP P
Sbjct: 948  PLPPPPLPPPPLPPPPSPPPS-----PPPSPPPSPPPSPPPPTPPPPAPPPP----NPPP 998

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQD--SSPPTDPTPTTPSTPT 357
             +PP     PP    PP  P P  P  P  P      SPP     SPP  P P TP  P 
Sbjct: 999  PSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPA 1058

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             P      SPP    PP+ P P
Sbjct: 1059 PPPPAPPPSPPPSPPPPTPPPP 1080

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 57/141 (40%), Positives = 71/141 (50%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS-GDGSYNPT 180
            P P PP      NP P  PP      P+P PPS    SPP S  P+P PPS    S +P+
Sbjct: 1716 PLPPPP------NPPPPLPPPPSP--PSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPS 1767

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            P  PPS+  +PP   + PS P P+   +P  PS     SPP  S+ P+ P P  P++P+ 
Sbjct: 1768 P-PPPSTSPSPPPPSASPSPPPPSASPSPPPPS--LSPSPPPPSTSPSPPPP--PASPSP 1822

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            P      SPP  SS PS P P
Sbjct: 1823 PPPSASPSPPPPSSSPSPPPP 1843

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 52/142 (36%), Positives = 58/142 (40%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P+PP       P P+ PP      P P+PP     SPP    P P+PP      NP P
Sbjct: 768  PPPSPPPSPPPSPPPPTPPPPA---PPPPTPPPSPPPSPPPPTPPPPAPPPP----NPPP 820

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQD--SSPPTDPTPTTPSTPT 357
             +PP     PP    PP  P P  P  P  P      SPP     SPP  P P TP  P 
Sbjct: 821  PSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPA 880

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             P      SPP    PP+ P P
Sbjct: 881  PPPPAPPPSPPPSPPPPTPPPP 902

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 57/145 (39%), Positives = 65/145 (44%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDP--TPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
            P P+PP      +P PS PP      P  TP PPS    SPP    P PSPP  +    P
Sbjct: 1646 PPPSPPP-----SPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNA---P 1697

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            +PS+ P S   PP    PP  P P  P  P  P      SPP  S PP  P P+ P +P 
Sbjct: 1698 SPSSMPPSQSPPPPLPPPPLPPPPNPP--PPLPPPPSPPSPPPPSPPPPSPPPSPPPSPP 1755

Query: 358  TPS---GGYYNSPPQDSSPPSDPLP 423
             PS        SPP  S+ PS P P
Sbjct: 1756 PPSPPPPSLSPSPPPPSTSPSPPPP 1780

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 54/139 (38%), Positives = 62/139 (44%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP    S +P P  PP   S  P+P PPS S   PP S  P+P PPS     +P+P
Sbjct: 298 PPPSPPPPSTSPSPPPRPPP---SASPSPPPPSLSPSPPPPSLSPSPPPPS----LSPSP 350

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PPS   +PP     PS P  T P +P  PS      PP    PP  P P  P  P  P
Sbjct: 351 P-PPSFSPSPPPPSLSPSPPPATPPPSPPPPS------PPPPLPPPPSPPPPLPPPPIPP 403

Query: 364 SGGYYNSPPQDSSPPSDPL 420
                  PP    PP  PL
Sbjct: 404 -------PPSPPPPPPPPL 415

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 52/140 (37%), Positives = 57/140 (40%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS      P P  PP      P PSPP     SPP S  P+P PP+      P P
Sbjct: 828  PLPPPPSPPPPLPPPPLPPP---PLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPP 884

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            + PPS   +PP    PP  P P  P  P+ P       PP    PP  P P  P  P  P
Sbjct: 885  APPPSPPPSPPPPTPPPPAPPPPNPPPPSPP-------PPLPLPPPPSPPPPLPPPPLPP 937

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
                   PP  S PP  P P
Sbjct: 938  P----PVPPPPSPPPLPPPP 953

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 52/144 (36%), Positives = 60/144 (41%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS----GDGSY 171
            P P PPS   S  P+P   P      PTP PP+    +PP S  P+P PP+         
Sbjct: 848  PLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPP 907

Query: 172  NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            NP P +PP     PP    PP  P P  P  P  P       PP    PP  P P  PS 
Sbjct: 908  NPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPP--PLPPPPSP 965

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P +P      SPP    PP+ P P
Sbjct: 966  PPSPPPSPPPSPPPSPPPPTPPPP 989

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 50/140 (35%), Positives = 60/140 (42%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P PTPP       P P+ PP      P P PP+    SPP    P P PPS      P P
Sbjct: 791  PPPTPPPSPPPSPPPPTPPP------PAPPPPNPPPPSPPPPL-PLPPPPSPPPPLPPPP 843

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
              PP     P    SPP  P P+ P +P  P+      PP  + PP  P P+ P +P  P
Sbjct: 844  LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPT------PPPPAPPPPAPPPSPPPSPPPP 897

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
            +      PP +  PPS P P
Sbjct: 898  TPPPPAPPPPNPPPPSPPPP 917

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 53/140 (37%), Positives = 57/140 (40%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P+PP       P P +PP      P+P PP      PP    P P PP       P P
Sbjct: 1064 PPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLP-PPPSPPPPLPPPPLPPPPLPPPP 1122

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            S PPS   +PP   SPP  P P TP  P  P      SPP    PPT P P  P  P  P
Sbjct: 1123 SPPPSPPPSPPP--SPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPT-PPPPAPPPPNPP 1179

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
                  SPP    PP  P P
Sbjct: 1180 P----PSPPPPLPPPPSPPP 1195

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/140 (39%), Positives = 57/140 (40%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            PTP PP+     NP P SPP      P P PP      PP    P P PP       P P
Sbjct: 1075 PTPPPPAPPPP-NPPPPSPP-----PPLPLPP------PPSPPPPLPPPPLPPPPLPPPP 1122

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            S PPS   +PP   SPP  P P TP  P  P      SPP    PPT P P  P     P
Sbjct: 1123 SPPPSPPPSPP--PSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPP 1180

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
                   PP  S PP  P P
Sbjct: 1181 PSPPPPLPPPPSPPPPLPPP 1200

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/144 (36%), Positives = 61/144 (42%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS   S  P+P   P      PTP PP+    +PP S  P+P PP+      P P
Sbjct: 1117 PLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPP 1176

Query: 184  STPPSSDCTP--PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP--ST 351
            + PP S   P  P    PP  P P  P  P  P       PP    PP  P P +P  S 
Sbjct: 1177 NPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSP 1236

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P +P      SPP    PP+ P P
Sbjct: 1237 PPSPPPSPPPSPPPSPPPPTPPPP 1260

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 50/144 (34%), Positives = 61/144 (42%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP----SPPSGDGSY 171
            P P PPS   S  P+P   P      PTP PP+    +PP    P P     PPS     
Sbjct: 958  PLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPL 1017

Query: 172  NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
             P P  PP     P    SPP  P P+ P +P  P+      PP  + PP  P P+ P +
Sbjct: 1018 PPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPT------PPPPAPPPPAPPPSPPPS 1071

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  P+      PP +  PPS P P
Sbjct: 1072 PPPPTPPPPAPPPPNPPPPSPPPP 1095

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 55/141 (39%), Positives = 61/141 (43%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P P     S +P P SPP   S  P P PP     +PP S  P P PP+   S  P P
Sbjct: 2091 PSPPPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPPLP 2150

Query: 184  STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
              P     TPP Q  P PS P P+ P+ P  P       PP  S  P  P P  PS P  
Sbjct: 2151 PPP-----TPPPQSPPLPSPPPPSPPTPPPLP-------PPSPSPLPPPPIPPPPSPPPH 2198

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            P       PPQ   PPS P P
Sbjct: 2199 P-------PPQSPLPPSPPPP 2212

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 56/140 (40%), Positives = 59/140 (42%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            PTP PP+     NP P SPP      P P PP      PP    P P PP       P P
Sbjct: 806  PTPPPPAPPPP-NPPPPSPP-----PPLPLPP------PPSPPPPLPPPPLPPPPLPPPP 853

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            S PPS   +PP   SPP  P P TP  P  P       P    SPP  P P TP  P  P
Sbjct: 854  SPPPSPPPSPP--PSPPPSPPPPTPPPPAPP------PPAPPPSPPPSPPPPTPPPPAPP 905

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
                  +PP  S PP  PLP
Sbjct: 906  P----PNPPPPSPPPPLPLP 921

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 56/140 (40%), Positives = 59/140 (42%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            PTP PP+     NP P SPP      P P PP      PP    P P PP       P P
Sbjct: 984  PTPPPPAPPPP-NPPPPSPP-----PPLPLPP------PPSPPPPLPPPPLPPPPLPPPP 1031

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            S PPS   +PP   SPP  P P TP  P  P       P    SPP  P P TP  P  P
Sbjct: 1032 SPPPSPPPSPP--PSPPPSPPPPTPPPPAPP------PPAPPPSPPPSPPPPTPPPPAPP 1083

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
                  +PP  S PP  PLP
Sbjct: 1084 P----PNPPPPSPPPPLPLP 1099

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/142 (35%), Positives = 61/142 (42%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPT--PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
            PTP PP+      P   P SPP      P P PP+    SPP    P P PPS      P
Sbjct: 1052 PTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPL-PLPPPPSPPPPLPP 1110

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
             P  PP     P    SPP  P P+ P +P  P      +PP  + PP  P P+ P +P 
Sbjct: 1111 PPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPP------TPPPPAPPPPAPPPSPPPSPP 1164

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             P+      PP +  PPS P P
Sbjct: 1165 PPTPPPPAPPPPNPPPPSPPPP 1186

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 58/141 (41%), Positives = 68/141 (48%), Gaps = 3/141 (2%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P+PP      +P PS PP   S  P+P PPS S   PP S  P+P PPS     +P+P  
Sbjct: 203 PSPPYPPSLPSP-PSLPPPSAS--PSPPPPSLSPSPPPPSLSPSPPPPS----ISPSPP- 254

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDS-SPPTDPTP--TTPSTPTT 360
           PPS   +PP     PS P P+   +P  PS      PP  S SPP  P P  T+PS P  
Sbjct: 255 PPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPR 314

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P      SPP  S  PS P P
Sbjct: 315 PPPSASPSPPPPSLSPSPPPP 335

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/141 (37%), Positives = 61/141 (43%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PP      +P PS PP   S  P+P PP+    +PP    P   PPS      P P
Sbjct: 716  PPPLPPPPLPPPSPPPSPPP---SPPPSPPPPTPPPPAPPPPAPPPAPPPS------PPP 766

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            S PPS   +PP    PP+ P P  P  P TP      SPP  + PP  P P  P  P+ P
Sbjct: 767  SPPPSPPPSPPPSPPPPTPPPPAPP--PPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 824

Query: 364  SGGYYNSPPQDSSP-PSDPLP 423
                   PP    P P  PLP
Sbjct: 825  PPLPLPPPPSPPPPLPPPPLP 845

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 55/152 (36%), Positives = 62/152 (40%), Gaps = 12/152 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P+PS PP      P PSPP  S   PP    P P PPS     +P P
Sbjct: 1534 PSPPPPSPPP---PSPSPPPSPPPPSPPPSPPPPS---PPPPLPPPPVPPSPLPPPSPPP 1587

Query: 184  STPPSSDCTPPSQDSPP------SDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
            S PPS   +PP    PP        P P  P  P  P       PP    PP  P P+ P
Sbjct: 1588 SPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPP 1647

Query: 346  ST------PTTPSGGYYNSPPQDSSPPSDPLP 423
             +      P+ P       PP    PPS PLP
Sbjct: 1648 PSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLP 1679

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/142 (37%), Positives = 62/142 (43%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPS-DSGGSPPGSYDPTPSPPSGDGSYNPT 180
            PTP PPS      P P+ PP        PSP S     SPP    P P PP  +    P 
Sbjct: 1669 PTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNP---PP 1725

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS-TPT 357
            P  PP S  +PP    PP  P P+ P +P  PS    +  P    P T P+P  PS +P+
Sbjct: 1726 PLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPS 1785

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             P      SPP  S  PS P P
Sbjct: 1786 PPPPSASPSPPPPSLSPSPPPP 1807

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/139 (37%), Positives = 57/139 (41%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P+PP       P P +PP      P+P PP     SPP    P P PP       P  
Sbjct: 1155 PPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPP-------PPV 1207

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
              PPS    PP    PP  P P  PS P +P      SPP   SPP  P P TP  P  P
Sbjct: 1208 PPPPSPPPLPPPPLPPP--PLPPPPSPPPSPPPSPPPSPPP--SPPPSPPPPTPPPPAPP 1263

Query: 364  SGGYYNSPPQDSSPPSDPL 420
                  SPP  + PP  PL
Sbjct: 1264 PPTPPPSPPPPTPPPPPPL 1282

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 52/146 (35%), Positives = 57/146 (39%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS      P P  PP      P P PPS     PP    P P PP      +P P
Sbjct: 919  PLPPPPSPPPPLPPPPLPPP------PVPPPPSPPP-LPPPPLPPPPLPPPPSPPPSPPP 971

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP------PTDPTPTTP 345
            S PPS   +PP    PP  P P  P  P+ P       PP    P      P  P P  P
Sbjct: 972  SPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPP 1031

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
            S P +P      SPP    PP+ P P
Sbjct: 1032 SPPPSPPPSPPPSPPPSPPPPTPPPP 1057

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 52/144 (36%), Positives = 57/144 (39%), Gaps = 6/144 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS      P P  PP      P PSPP     SPP S  P+P PP+      P P
Sbjct: 1097 PLPPPPSPPPPLPPPPLPPP---PLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPP 1153

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            + PPS   +PP    PP  P P  P  P+ P       PP  S PP  P P  P  P  P
Sbjct: 1154 APPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPP----LPPPPSPPPPLPPPPLPPPPVPP 1209

Query: 364  SGGYYNSPPQD------SSPPSDP 417
                   PP          PPS P
Sbjct: 1210 PPSPPPLPPPPLPPPPLPPPPSPP 1233

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 53/142 (37%), Positives = 57/142 (40%), Gaps = 4/142 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPP-GGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            P+P PP       P PS PP       P PSPP     SPP S  P PSPP       P 
Sbjct: 1611 PSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPS--PPPSPPPSPSPLPPP 1668

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYY---NSPPQDSSPPTDPTPTTPST 351
            P+ PP S   PP    P   P P +P  P  PS        SPP    PP  P P  P  
Sbjct: 1669 PTPPPPS---PPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPP 1725

Query: 352  PTTPSGGYYNSPPQDSSPPSDP 417
            P  P     + PP    PPS P
Sbjct: 1726 PLPPPPSPPSPPPPSPPPPSPP 1747

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 53/141 (37%), Positives = 59/141 (41%), Gaps = 3/141 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P+PP       P P+ PP      P P+PP     SPP S  P PSPP       P P
Sbjct: 729  PPPSPPPSPPPSPPPPTPPPPA---PPPPAPPPAPPPSPPPS--PPPSPPPSPPPSPPPP 783

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP--- 354
            + PP +   P    SPP  P P TP  P  P      +PP  S PP  P P  PS P   
Sbjct: 784  TPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPP----PNPPPPSPPPPLPLPPPPSPPPPL 839

Query: 355  TTPSGGYYNSPPQDSSPPSDP 417
              P       PP  S PPS P
Sbjct: 840  PPPPLPPPPLPPPPSPPPSPP 860

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 59/143 (41%), Positives = 63/143 (44%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS      P P  PP   S  P P PP     SPP S  P PSPP      +P P
Sbjct: 1606 PLPPPPSPPPPLPPPPVPPPP--SPPPLPPPPLPPPPSPPPS--PPPSPPP-----SPPP 1656

Query: 184  STPPS-SDCTPPSQDSPPSDPTPTTP-STPTTPSGGYYNSPPQDSSPPT-DPTPTTPSTP 354
            S PPS S   PP    PPS P P+ P   P  PS    N+P   S PP+  P P  P  P
Sbjct: 1657 SPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPP 1716

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
              P     N PP    PPS P P
Sbjct: 1717 LPPPP---NPPPPLPPPPSPPSP 1736

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 57/154 (37%), Positives = 59/154 (38%), Gaps = 14/154 (9%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS      P P  PP      P PSPP     SPP S  P P PP+      P P
Sbjct: 1621 PVPPPPSPP-PLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLP 1679

Query: 184  STP--------------PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP 321
            S P              PS    PPSQ  PP  P P  P  P  P       PP   SPP
Sbjct: 1680 SPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPP--LPPPPSPPSPP 1737

Query: 322  TDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              P+P  PS P         SPP    PPS P P
Sbjct: 1738 P-PSPPPPSPPP--------SPPPSPPPPSPPPP 1762

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 58/149 (38%), Positives = 65/149 (43%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4   PTPTPPS-------GDGSYNPTPSSPPGGGSYDPTP-SPPSDSGGSPPGSYDPTPSPPSG 159
           P+P PPS          S +P PS PP   S  P P  PPS S   PP S  P+P PP  
Sbjct: 278 PSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPP-- 335

Query: 160 DGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDPTP 336
             S +P+P  P  S   PP   SP   P   +PS  P TP      SPP  S PP  P P
Sbjct: 336 --SLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPP----PSPPPPSPPPPLPPP 389

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            +P  P  P       PP  S PP  P P
Sbjct: 390 PSPPPPLPPP----PIPPPPSPPPPPPPP 414

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 53/141 (37%), Positives = 56/141 (39%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYN-PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            P P PPS       P P SPP      P P PP     SPP S  P PSPP       P 
Sbjct: 1085 PNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPS--PPPSPPPSPPPSPPP 1142

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            P+ PP +   P    SPP  P P TP  P  P     N PP    PP  P P+ P     
Sbjct: 1143 PTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPP---NPPPPSPPPPLPPPPSPPPPLPP 1199

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            P       PP  S PP  P P
Sbjct: 1200 PPLPPPPVPPPPSPPPLPPPP 1220

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 54/152 (35%), Positives = 62/152 (40%), Gaps = 12/152 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGG-----------SYDPTPSPPSDSGGSPPGSYDPTPSP 150
            P+P+PP      +P PS PP              S  P PSPP     SPP S  P+P P
Sbjct: 1544 PSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPP 1603

Query: 151  PSG-DGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTD 327
            P       +P P  PP     PPS    P  P P  PS P +P      SPP   SPP  
Sbjct: 1604 PLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPP--SPPPS 1661

Query: 328  PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P+P  P     P      SPP  + PP  P P
Sbjct: 1662 PSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPP 1693

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 53/141 (37%), Positives = 60/141 (42%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS-GDGSYNPT 180
            P P+PP      +P PS PP      P P PPS     PP    P PSPP        P 
Sbjct: 1585 PPPSPPP-----SPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPP 1639

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            PS PPS   +PP    P   P+P+    P TP      SPP  S P   P P +P  P  
Sbjct: 1640 PSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPP---PSPPLPSPPLPAPPPPSPPPPNA 1696

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            PS    + PP  S PP  P P
Sbjct: 1697 PSPS--SMPPSQSPPPPLPPP 1715

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 53/141 (37%), Positives = 56/141 (39%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYN-PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            P P PPS       P P SPP      P P PP     SPP S  P PSPP       P 
Sbjct: 816  PNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPS--PPPSPPPSPPPSPPP 873

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            P+ PP +   P    SPP  P P TP  P  P      +PP  S PP  P P  PS P  
Sbjct: 874  PTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPP----PNPPPPSPPPPLPLPPPPSPPPP 929

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
                    PP    P   PLP
Sbjct: 930  LPPPPLPPPPVPPPPSPPPLP 950

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 58/149 (38%), Positives = 61/149 (40%), Gaps = 11/149 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--------PGSYDPTPSPPSG 159
            PTP PP+     NP P SPP      P PSPP      P        P S  P P PP  
Sbjct: 897  PTPPPPAPPPP-NPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLP 955

Query: 160  DGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
                 P PS PPS   +PP   SPP  P P TP  P  P      +PP  S PP  P P 
Sbjct: 956  PPPLPPPPSPPPSPPPSPP--PSPPPSPPPPTPPPPAPPP----PNPPPPSPPPPLPLPP 1009

Query: 340  TPSTP---TTPSGGYYNSPPQDSSPPSDP 417
             PS P     P       PP  S PPS P
Sbjct: 1010 PPSPPPPLPPPPLPPPPLPPPPSPPPSPP 1038

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 53/143 (37%), Positives = 66/143 (46%), Gaps = 5/143 (3%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS-----GDGSYN 174
           P+PPS     + +PS PP   S  P+P PPS S   PP S  P+P PPS        S +
Sbjct: 212 PSPPSLPPP-SASPSPPPPSLS--PSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVS 268

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           P+P  P  S   PP   SP   P   +PS P +P       PP  +SP   P P   ++P
Sbjct: 269 PSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSP-------PPPSTSPSPPPRPPPSASP 321

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
           + P      SPP  S  PS P P
Sbjct: 322 SPPPPSLSPSPPPPSLSPSPPPP 344

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 55/142 (38%), Positives = 58/142 (40%), Gaps = 4/142 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYN-PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            P P PPS       P P SPP      P P PP     SPP S  P PSPP       P 
Sbjct: 994  PNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPS--PPPSPPPSPPPSPPP 1051

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP-- 354
            P+ PP +   P    SPP  P P TP  P  P      +PP  S PP  P P  PS P  
Sbjct: 1052 PTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPP----PNPPPPSPPPPLPLPPPPSPPPP 1107

Query: 355  -TTPSGGYYNSPPQDSSPPSDP 417
               P       PP  S PPS P
Sbjct: 1108 LPPPPLPPPPLPPPPSPPPSPP 1129

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 54/156 (34%), Positives = 65/156 (41%), Gaps = 16/156 (10%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPP--SDSGGSPPGSYDPTPS---------- 147
            P P+PP       P P+ PP      P PSPP  +    SPP    P+PS          
Sbjct: 1654 PPPSPPPSPSPLPPPPTPPPPS---PPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPP 1710

Query: 148  ----PPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSS 315
                PP       P P  PP S  +PP    PP  P P+ P +P  P      SPP  S 
Sbjct: 1711 PLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPP------SPPPPSL 1764

Query: 316  PPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             P+ P P+T  +P  PS     SPP  S+ PS P P
Sbjct: 1765 SPSPPPPSTSPSPPPPSAS--PSPPPPSASPSPPPP 1798

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 47/131 (35%), Positives = 60/131 (45%), Gaps = 1/131 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSP-PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            P+P PPS   S  P  +SP P   S  P+P PPS S   PP    P+P PPS     +P+
Sbjct: 1775 PSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSA----SPS 1830

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            P  P SS   PP   SP   P   +PS P +P       PP   +PP  P P   S    
Sbjct: 1831 PPPPSSSPSPPPPSSSPSPPPPSLSPSPPPSPPPSS-PPPPSPPTPPAPPRPFLVSLDII 1889

Query: 361  PSGGYYNSPPQ 393
             +    ++PP+
Sbjct: 1890 ATQPSSSNPPE 1900

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 55/144 (38%), Positives = 58/144 (40%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPT--PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
            PTP PP+      P   P SPP      P P PP+    SPP    P P PPS      P
Sbjct: 874  PTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPL-PLPPPPSPPPPLPP 932

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQD--SSPPTDPTPTTPST 351
             P  PP      P   SPP  P P  P  P  P      SPP     SPP  P P TP  
Sbjct: 933  PPLPPP----PVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPP 988

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  P      +PP  S PP  PLP
Sbjct: 989  PAPPP----PNPPPPSPPPPLPLP 1008

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 51/143 (35%), Positives = 59/143 (41%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS     +P PS PP      P PSPP       P    P+P PP       P P
Sbjct: 1572 PPPVPPSPLPPPSPPPSPPPS-----PPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPP 1626

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTP--TTPSGGYYNSPPQDSSPPTDPTPTTP-STP 354
            S PP      P   SPP  P P+ P +P  + P       PP    PP+ P P+ P   P
Sbjct: 1627 SPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAP 1686

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
              PS    N+P   S PPS   P
Sbjct: 1687 PPPSPPPPNAPSPSSMPPSQSPP 1709

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 48/129 (37%), Positives = 56/129 (43%), Gaps = 2/129 (1%)
 Frame = +1

Query: 43   PTPSSPPGGGSYDPTPSPPSDSG--GSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPP 216
            P+PS PP      P+P PPS S     PP S  P+P PPS      P P  PP     P 
Sbjct: 676  PSPSPPP------PSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPP-----PL 724

Query: 217  SQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQD 396
               SPP  P P+ P +P  P+      PP    PP  P    PS P +P      SPP  
Sbjct: 725  PPPSPPPSPPPSPPPSPPPPT-----PPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPS 779

Query: 397  SSPPSDPLP 423
              PP+ P P
Sbjct: 780  PPPPTPPPP 788

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/130 (39%), Positives = 57/130 (43%), Gaps = 1/130 (0%)
 Frame = +1

Query: 31   GSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDC 207
            GS +  PS SPP      P+PSPP      PP S  P+P PPS      P P  PPS   
Sbjct: 1526 GSVDCVPSPSPPPPSPPPPSPSPPP---SPPPPSPPPSPPPPSPPPPL-PPPPVPPSPLP 1581

Query: 208  TPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSP 387
             P    SPP  P P+ P +P  P       PP  S PP  P P  P  P+ P       P
Sbjct: 1582 PPSPPPSPPPSPPPSPPPSPPPP----LPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLP 1637

Query: 388  PQDSSPPSDP 417
            P  S PPS P
Sbjct: 1638 PPPSPPPSPP 1647

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 50/138 (36%), Positives = 55/138 (39%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P PTPP       P P+ PP   S  P P PP+    SPP    P PSPP+      P P
Sbjct: 2125 PPPTPPPSPPPLPPPPTPPP---SPPPLPPPPTPPPQSPPLPSPPPPSPPT------PPP 2175

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
              PPS    PP    PP  P P+ P  P          PPQ   PP+ P P  P      
Sbjct: 2176 LPPPSPSPLPP----PPIPPPPSPPPHP----------PPQSPLPPSPPPPPPPPP---- 2217

Query: 364  SGGYYNSPPQDSSPPSDP 417
                   PP  S PPS P
Sbjct: 2218 ------LPPPPSPPPSQP 2229

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 53/145 (36%), Positives = 62/145 (42%), Gaps = 7/145 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPT---PSPPSGDGSYN 174
            P+P PP       P+P  PP      P PSPP     SPP S  P    P PPS      
Sbjct: 1564 PSPPPPLPPPPVPPSPLPPPS-----PPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLP 1618

Query: 175  PTPSTPPSSD--CTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP- 345
            P P  PP S     PP    PPS P    PS P +P      SP     PPT P P+ P 
Sbjct: 1619 PPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPL 1678

Query: 346  STPTTPSGGYYNSPPQDS-SPPSDP 417
             +P  P+    + PP ++ SP S P
Sbjct: 1679 PSPPLPAPPPPSPPPPNAPSPSSMP 1703

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 50/147 (34%), Positives = 59/147 (40%), Gaps = 10/147 (6%)
 Frame = +1

Query: 13   TPPSGDGSYNPTPSSPPGGG----------SYDPTPSPPSDSGGSPPGSYDPTPSPPSGD 162
            +P +G   +N T  +PPGG           S  P PSPP     S P S  P+P PPS  
Sbjct: 2058 SPTNGRIYFNLT--NPPGGAYSSIGGLQLMSVPPPPSPPP----SLPSS-SPSPPPPSPP 2110

Query: 163  GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
               +P P  PP     P    SPP  P P TP     P       PPQ    P+ P P+ 
Sbjct: 2111 LPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPPLPPPPTPPPQSPPLPSPPPPSP 2170

Query: 343  PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P+ P  P       PP    PP  P P
Sbjct: 2171 PTPPPLPPPSPSPLPPPPIPPPPSPPP 2197

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 39/92 (42%), Positives = 44/92 (47%), Gaps = 1/92 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP-PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P+P PPS   S  P   SP P   S+ P+P PPS S   PP +  P+P PPS      P 
Sbjct: 330 PSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPSPPPPLPPP 389

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTP 276
           PS PP     PP    PPS P P  P  P  P
Sbjct: 390 PSPPPP--LPPPPIPPPPSPPPP--PPPPLAP 417

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 40/101 (39%), Positives = 43/101 (42%), Gaps = 1/101 (0%)
 Frame = +1

Query: 124  GSYDPTPSP-PSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSP 300
            GS D  PSP P       P+PS PPS     P    PP  P P  P  P  PS     SP
Sbjct: 1526 GSVDCVPSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSP 1585

Query: 301  PQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P   SPP  P P+ P +P  P       PP  S PP  P P
Sbjct: 1586 P--PSPPPSPPPSPPPSPPPP----LPLPPPPSPPPPLPPP 1620

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 40/101 (39%), Positives = 42/101 (41%), Gaps = 3/101 (2%)
 Frame = +1

Query: 124 GSYDPTPSP-PSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSP 300
           GS D  PSP P       P+PS PPS     P    PP  P P  P  P  P      SP
Sbjct: 670 GSVDCAPSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSP 729

Query: 301 PQD--SSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
           P     SPP  P P TP  P  P      +PP  S PPS P
Sbjct: 730 PPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPP-PSPPPSPP 769

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 42/119 (35%), Positives = 46/119 (38%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PP       P PS PP      P P PP     SPP S  P+P P       +P P
Sbjct: 1196 PLPPPPLPPPPVPPPPSPPPLPPP--PLPPPPLPPPPSPPPSPPPSPPP-------SPPP 1246

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            S PPS    PP    PP+ P PT P +P                PP  P P  P  P T
Sbjct: 1247 SPPPS---PPPPTPPPPAPPPPTPPPSP----------------PPPTPPPPPPLAPFT 1286

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 36/97 (37%), Positives = 42/97 (43%), Gaps = 5/97 (5%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP---PSGDGSYN 174
            P PTPP       P P+ PP      P PSPP  S  +PP    P+PSP   P      +
Sbjct: 2138 PPPTPPPSPPPLPPPPTPPPQS---PPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPS 2194

Query: 175  PTPSTPPSSDC--TPPSQDSPPSDPTPTTPSTPTTPS 279
            P P  PP S    +PP    PP  P P +P     PS
Sbjct: 2195 PPPHPPPQSPLPPSPPPPPPPPPLPPPPSPPPSQPPS 2231

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 30/76 (39%), Positives = 33/76 (43%)
 Frame = +1

Query: 196 SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGY 375
           S DC P     PPS P P+    P+ P      SPP  S PP  P P  P  P  P    
Sbjct: 671 SVDCAPSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPP 730

Query: 376 YNSPPQDSSPPSDPLP 423
            + PP  S PPS P P
Sbjct: 731 PSPPP--SPPPSPPPP 744

[11][TOP]
>UniRef100_Q6YXX5 Os02g0138000 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q6YXX5_ORYSJ
          Length = 694

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 65/140 (46%), Positives = 75/140 (53%), Gaps = 10/140 (7%)
 Frame = +1

Query: 34  SYNPTPSSPPG-GGSYDPTP--SPPSDSGGSP-PGSYDPTPSPPSGDGSY-----NPTPS 186
           SY PTP   PG GG   P P  SPP   G  P P S  PTPS PS   SY     + TPS
Sbjct: 384 SYTPTPGGSPGRGGQGPPAPVSSPPRRRGPYPQPPSSSPTPSYPSPSSSYPAPPGSNTPS 443

Query: 187 TP-PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            P P S  T PS  SPP   + TTPS P+ P+GG   S P   SPP   TP+ PS P++ 
Sbjct: 444 YPSPPSSATTPSSHSPPGGSSSTTPSYPS-PNGG-KPSTPSHPSPPGSTTPSYPSPPSSS 501

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           +   Y+SPPQ  + PS P P
Sbjct: 502 TTPSYHSPPQGHTTPSHPSP 521

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 59/151 (39%), Positives = 75/151 (49%), Gaps = 17/151 (11%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P+PPS   +  P+  SPPGG S   TPS PS +GG P      TPS PS  GS  P+  +
Sbjct: 445 PSPPSS--ATTPSSHSPPGGSS-STTPSYPSPNGGKP-----STPSHPSPPGSTTPSYPS 496

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDS----SPPTDPTPTTPSTPT 357
           PPSS  TP     P    TP+ PS P++ +    +SPPQ +    S P+ P   TP  PT
Sbjct: 497 PPSSSTTPSYHSPPQGHTTPSHPSPPSSSTAPPSHSPPQSTPTHPSYPSPPVTYTPPPPT 556

Query: 358 T----------PSGGY---YNSPPQDSSPPS 411
           +          P G Y    ++PP   SPPS
Sbjct: 557 SADRPDVRFAPPPGSYGPIPSTPPSSGSPPS 587

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 55/146 (37%), Positives = 72/146 (49%), Gaps = 11/146 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYN 174
           P P PPS     +PTPS P    SY   P   + S  SPP S   TPS   PP G  S  
Sbjct: 413 PYPQPPSS----SPTPSYPSPSSSYPAPPGSNTPSYPSPPSSAT-TPSSHSPPGGSSSTT 467

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST- 351
           P+  +P     + PS  SPP   TP+ PS P++ +   Y+SPPQ  + P+ P+P + ST 
Sbjct: 468 PSYPSPNGGKPSTPSHPSPPGSTTPSYPSPPSSSTTPSYHSPPQGHTTPSHPSPPSSSTA 527

Query: 352 -------PTTPSGGYYNSPPQDSSPP 408
                   +TP+   Y SPP   +PP
Sbjct: 528 PPSHSPPQSTPTHPSYPSPPVTYTPP 553

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 68/184 (36%), Positives = 80/184 (43%), Gaps = 46/184 (25%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG-----------------SPPGSYDP 138
            P+PPS   S  P+  SPP G +    PSPPS S                   SPP +Y P
Sbjct: 495  PSPPSS--STTPSYHSPPQGHTTPSHPSPPSSSTAPPSHSPPQSTPTHPSYPSPPVTYTP 552

Query: 139  TPSPPSGD----------GSYNPTPSTPPSSDCTPPSQDS---PPSDPTPTTPSTPTTPS 279
             P P S D          GSY P PSTPPSS  +PPS  S   PPS     +P T   P 
Sbjct: 553  PP-PTSADRPDVRFAPPPGSYGPIPSTPPSSG-SPPSPSSGYQPPSGQPGASPPTQHVPG 610

Query: 280  GGY-YNSPPQDSSPPTDPTPTTPS--TPTTP-----------SGGYYNS--PPQDSSPPS 411
             G    +PP  S P T P+P+ PS   P TP           +GG +    PP  S+PP 
Sbjct: 611  AGTPTTTPPSHSHPSTPPSPSGPSFHPPPTPHNCSPPSHGSSTGGGHGGGHPPSTSTPPG 670

Query: 412  DPLP 423
              LP
Sbjct: 671  GKLP 674

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 59/148 (39%), Positives = 74/148 (50%), Gaps = 9/148 (6%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPT-PSPPSDSGG----SPPGSYDPTPSPPSGDGSY 171
           TP+ PS +G    TPS P   GS  P+ PSPPS S      SPP  +  TPS PS   S 
Sbjct: 467 TPSYPSPNGGKPSTPSHPSPPGSTTPSYPSPPSSSTTPSYHSPPQGHT-TPSHPSPPSSS 525

Query: 172 NPTPS-TPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
              PS +PP S  T PS  SPP   TP  P++   P   +  +PP  S  P   TP +  
Sbjct: 526 TAPPSHSPPQSTPTHPSYPSPPVTYTPPPPTSADRPDVRF--APPPGSYGPIPSTPPSSG 583

Query: 349 TPTTPSGGYYNSPPQ---DSSPPSDPLP 423
           +P +PS GY   PP     +SPP+  +P
Sbjct: 584 SPPSPSSGY--QPPSGQPGASPPTQHVP 609

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 55/153 (35%), Positives = 63/153 (41%), Gaps = 20/153 (13%)
 Frame = +1

Query: 7   TPTPPSG-----------DGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPP 153
           TP PP+             GSY P PS+PP  GS      PPS S G  P S  P  SPP
Sbjct: 551 TPPPPTSADRPDVRFAPPPGSYGPIPSTPPSSGS------PPSPSSGYQPPSGQPGASPP 604

Query: 154 SGDGSYNPTPSTPPSSDC---TPPSQDSPPSDPTPT-----TPSTPTTPSGGYYNS-PPQ 306
           +       TP+T P S     TPPS   P   P PT      PS  ++  GG+    PP 
Sbjct: 605 TQHVPGAGTPTTTPPSHSHPSTPPSPSGPSFHPPPTPHNCSPPSHGSSTGGGHGGGHPPS 664

Query: 307 DSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSP 405
            S+PP    P  P       G  Y SPP    P
Sbjct: 665 TSTPPGGKLPFPP-----VYGVSYASPPPPVKP 692

[12][TOP]
>UniRef100_A2X0P1 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2X0P1_ORYSI
          Length = 695

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 65/140 (46%), Positives = 75/140 (53%), Gaps = 10/140 (7%)
 Frame = +1

Query: 34  SYNPTPSSPPG-GGSYDPTP--SPPSDSGGSP-PGSYDPTPSPPSGDGSY-----NPTPS 186
           SY PTP   PG GG   P P  SPP   G  P P S  PTPS PS   SY     + TPS
Sbjct: 385 SYTPTPGGSPGRGGQGPPAPVSSPPRRRGPYPQPPSSSPTPSYPSPSSSYPAPPGSNTPS 444

Query: 187 TP-PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            P P S  T PS  SPP   + TTPS P+ P+GG   S P   SPP   TP+ PS P++ 
Sbjct: 445 YPSPPSSATTPSSHSPPGGSSSTTPSYPS-PNGG-KPSTPSHPSPPGSTTPSYPSPPSSS 502

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           +   Y+SPPQ  + PS P P
Sbjct: 503 TTPSYHSPPQGHTTPSHPSP 522

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 59/151 (39%), Positives = 75/151 (49%), Gaps = 17/151 (11%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P+PPS   +  P+  SPPGG S   TPS PS +GG P      TPS PS  GS  P+  +
Sbjct: 446 PSPPSS--ATTPSSHSPPGGSS-STTPSYPSPNGGKP-----STPSHPSPPGSTTPSYPS 497

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDS----SPPTDPTPTTPSTPT 357
           PPSS  TP     P    TP+ PS P++ +    +SPPQ +    S P+ P   TP  PT
Sbjct: 498 PPSSSTTPSYHSPPQGHTTPSHPSPPSSSTAPPSHSPPQSTPTHPSYPSPPVTYTPPPPT 557

Query: 358 T----------PSGGY---YNSPPQDSSPPS 411
           +          P G Y    ++PP   SPPS
Sbjct: 558 SADRPDVRFAPPPGSYGPIPSTPPSSGSPPS 588

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 55/146 (37%), Positives = 72/146 (49%), Gaps = 11/146 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYN 174
           P P PPS     +PTPS P    SY   P   + S  SPP S   TPS   PP G  S  
Sbjct: 414 PYPQPPSS----SPTPSYPSPSSSYPAPPGSNTPSYPSPPSSAT-TPSSHSPPGGSSSTT 468

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST- 351
           P+  +P     + PS  SPP   TP+ PS P++ +   Y+SPPQ  + P+ P+P + ST 
Sbjct: 469 PSYPSPNGGKPSTPSHPSPPGSTTPSYPSPPSSSTTPSYHSPPQGHTTPSHPSPPSSSTA 528

Query: 352 -------PTTPSGGYYNSPPQDSSPP 408
                   +TP+   Y SPP   +PP
Sbjct: 529 PPSHSPPQSTPTHPSYPSPPVTYTPP 554

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 68/184 (36%), Positives = 80/184 (43%), Gaps = 46/184 (25%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG-----------------SPPGSYDP 138
            P+PPS   S  P+  SPP G +    PSPPS S                   SPP +Y P
Sbjct: 496  PSPPSS--STTPSYHSPPQGHTTPSHPSPPSSSTAPPSHSPPQSTPTHPSYPSPPVTYTP 553

Query: 139  TPSPPSGD----------GSYNPTPSTPPSSDCTPPSQDS---PPSDPTPTTPSTPTTPS 279
             P P S D          GSY P PSTPPSS  +PPS  S   PPS     +P T   P 
Sbjct: 554  PP-PTSADRPDVRFAPPPGSYGPIPSTPPSSG-SPPSPSSGYQPPSGQPGASPPTQHVPG 611

Query: 280  GGY-YNSPPQDSSPPTDPTPTTPS--TPTTP-----------SGGYYNS--PPQDSSPPS 411
             G    +PP  S P T P+P+ PS   P TP           +GG +    PP  S+PP 
Sbjct: 612  AGTPTTTPPSHSHPSTPPSPSGPSFHPPPTPHNCSPPSHGSSTGGGHGGGHPPSTSTPPG 671

Query: 412  DPLP 423
              LP
Sbjct: 672  GKLP 675

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 59/148 (39%), Positives = 74/148 (50%), Gaps = 9/148 (6%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPT-PSPPSDSGG----SPPGSYDPTPSPPSGDGSY 171
           TP+ PS +G    TPS P   GS  P+ PSPPS S      SPP  +  TPS PS   S 
Sbjct: 468 TPSYPSPNGGKPSTPSHPSPPGSTTPSYPSPPSSSTTPSYHSPPQGHT-TPSHPSPPSSS 526

Query: 172 NPTPS-TPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
              PS +PP S  T PS  SPP   TP  P++   P   +  +PP  S  P   TP +  
Sbjct: 527 TAPPSHSPPQSTPTHPSYPSPPVTYTPPPPTSADRPDVRF--APPPGSYGPIPSTPPSSG 584

Query: 349 TPTTPSGGYYNSPPQ---DSSPPSDPLP 423
           +P +PS GY   PP     +SPP+  +P
Sbjct: 585 SPPSPSSGY--QPPSGQPGASPPTQHVP 610

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 54/149 (36%), Positives = 64/149 (42%), Gaps = 26/149 (17%)
 Frame = +1

Query: 7   TPTPPSG-----------DGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPP 153
           TP PP+             GSY P PS+PP  GS      PPS S G  P S  P  SPP
Sbjct: 552 TPPPPTSADRPDVRFAPPPGSYGPIPSTPPSSGS------PPSPSSGYQPPSGQPGASPP 605

Query: 154 SGDGSYNPTPSTPPSSDC---TPPSQDSPPSDPTPT-----TPSTPTTPSGGYYNS-PPQ 306
           +       TP+T P S     TPPS   P   P PT      PS  ++  GG+    PP 
Sbjct: 606 TQHVPGAGTPTTTPPSHSHPSTPPSPSGPSFHPPPTPHNCSPPSHGSSTGGGHGGGHPPS 665

Query: 307 DSSPPTDPTPTTP------STPTTPSGGY 375
            S+PP    P  P      ++PTTP   Y
Sbjct: 666 TSTPPGGKLPFPPVYGVSYASPTTPVKPY 694

[13][TOP]
>UniRef100_B9QEP3 Chloride channel protein k, putative n=1 Tax=Toxoplasma gondii VEG
           RepID=B9QEP3_TOXGO
          Length = 1733

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 59/148 (39%), Positives = 77/148 (52%), Gaps = 8/148 (5%)
 Frame = +1

Query: 4   PTPTPPSGDG----SYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P  +PPS       S +P+PSSPP      P+ +P S +  SP     P+  PPS   S 
Sbjct: 204 PPSSPPSPSSAPSSSTSPSPSSPPSSSPPSPSSAPSSSTSPSPSSPPSPSSPPPSSPPSS 263

Query: 172 N-PTPSTPPSSDCTPPSQDSPPSDP---TPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
           + P+PS+PPSS  +PPS   PPS P   + T+PS  + PS    +S P  SSPP   +P 
Sbjct: 264 SPPSPSSPPSS--SPPSPSPPPSSPPSSSSTSPSPSSAPSSSPPSSSPSSSSPPPSSSPP 321

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            PS P+       +SPP  SSP S P P
Sbjct: 322 PPSPPS-------SSPPSSSSPSSSPSP 342

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 60/148 (40%), Positives = 77/148 (52%), Gaps = 8/148 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPG--SYDPTPSPPSGDGSYNP 177
           P  +PPS   S   +PSS P   S  P+ SPP  S  SP    S   +PSP S   S  P
Sbjct: 176 PFLSPPSSSSS---SPSSSPSSSSPPPSSSPPPSSPPSPSSAPSSSTSPSPSSPPSSSPP 232

Query: 178 TPSTPPSSDCTP-PSQDSPPSDPTPTTP--STPTTPSGGYYNSPPQDSSPPTDP---TPT 339
           +PS+ PSS  +P PS    PS P P++P  S+P +PS    +SPP  S PP+ P   + T
Sbjct: 233 SPSSAPSSSTSPSPSSPPSPSSPPPSSPPSSSPPSPSSPPSSSPPSPSPPPSSPPSSSST 292

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           +PS  + PS    +S P  SSPP    P
Sbjct: 293 SPSPSSAPSSSPPSSSPSSSSPPPSSSP 320

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 51/126 (40%), Positives = 69/126 (54%), Gaps = 6/126 (4%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSG---GSPPGSYDPTPSPP--SGDGSY 171
           +P+P S   S  P+PSS P   +     SPPS S     SPP S  P+PS P  S   S 
Sbjct: 220 SPSPSSPPSSSPPSPSSAPSSSTSPSPSSPPSPSSPPPSSPPSSSPPSPSSPPSSSPPSP 279

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP-TPTTPS 348
           +P PS+PPSS  T PS  S PS   P+  S+P++ S    +SPP  S P + P + ++PS
Sbjct: 280 SPPPSSPPSSSSTSPSPSSAPSSSPPS--SSPSSSSPPPSSSPPPPSPPSSSPPSSSSPS 337

Query: 349 TPTTPS 366
           +  +PS
Sbjct: 338 SSPSPS 343

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 49/154 (31%), Positives = 73/154 (47%), Gaps = 14/154 (9%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTP---SPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           +P P S   S  P+PSSPP      P+P   SPPS S  SP  S  P+ SPPS     +P
Sbjct: 254 SPPPSSPPSSSPPSPSSPPSSSPPSPSPPPSSPPSSSSTSPSPSSAPSSSPPSS----SP 309

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSG-------GYYNSPPQ--DSSPPTDP 330
           + S+PP S   PP      S P+ ++PS+  +PS        G  N  P+  + S   D 
Sbjct: 310 SSSSPPPSSSPPPPSPPSSSPPSSSSPSSSPSPSADLSERAQGPANEAPEKRNESAEVDK 369

Query: 331 T--PTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
           T  P   ++  +P+ G  +   ++++  S  L +
Sbjct: 370 TSHPRENASNGSPASGRLSGSEKEATQNSSDLDK 403

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 49/134 (36%), Positives = 62/134 (46%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PPS   S    PSSPP        P PPS    S   S    PSP S     + +PS 
Sbjct: 574 PVPPSSP-SMPLLPSSPPS------VPVPPSSPSPSSSLSAPVPPSPSSSSSHSSSSPSV 626

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
            P     PP     PS P+P++ S+P+ P       P   SSPP+ P+P++PS P + S 
Sbjct: 627 LP----LPPHV---PSSPSPSSASSPSMPL------PTSSSSPPSSPSPSSPSVPLSSSS 673

Query: 370 GYYNSPPQDSSPPS 411
              + PP  SSP S
Sbjct: 674 P--SVPPSPSSPVS 685

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 48/138 (34%), Positives = 62/138 (44%), Gaps = 2/138 (1%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPT--PSPPSGDGSYNPTP 183
           P  PS   S  P P S P   S    P PPS S  S   S  P+  P PP    S +P+ 
Sbjct: 583 PLLPSSPPSV-PVPPSSPSPSSSLSAPVPPSPSSSSSHSSSSPSVLPLPPHVPSSPSPSS 641

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           ++ PS    P S  SPPS P+P++PS P +            SS P+   P +PS+P + 
Sbjct: 642 ASSPSMPL-PTSSSSPPSSPSPSSPSVPLS------------SSSPS--VPPSPSSPVSV 686

Query: 364 SGGYYNSPPQDSSPPSDP 417
                +SP    SP S P
Sbjct: 687 LFSRSSSP--SFSPDSAP 702

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 47/157 (29%), Positives = 67/157 (42%), Gaps = 16/157 (10%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYD-----PTPSPPSDSGGSP-----PGSYDPTPSP 150
           +P P+ PS   +     S  P   S       P+P  P     SP     P S  P+   
Sbjct: 516 EPLPSHPSSVSNVTSLSSLSPIVSSRRLSVNFPSPHQPKQPSFSPMHPSSPYSSSPSVPV 575

Query: 151 PSGDGSYNPTPSTPPSSDCTPPSQDSP------PSDPTPTTPSTPTTPSGGYYNSPPQDS 312
           P    S    PS+PPS    PPS  SP      P  P+P++ S+ ++ S      PP   
Sbjct: 576 PPSSPSMPLLPSSPPSVP-VPPSSPSPSSSLSAPVPPSPSSSSSHSSSSPSVLPLPPH-- 632

Query: 313 SPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             P+ P+P++ S+P+ P     +SPP   SP S  +P
Sbjct: 633 -VPSSPSPSSASSPSMPLPTSSSSPPSSPSPSSPSVP 668

[14][TOP]
>UniRef100_UPI0001A7B0C1 protein binding / structural constituent of cell wall n=1
           Tax=Arabidopsis thaliana RepID=UPI0001A7B0C1
          Length = 857

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 71/155 (45%), Positives = 79/155 (50%), Gaps = 17/155 (10%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGS------- 168
           PT PS  GS  P+PS  P      P+P      GGSPP S    PSPPS   S       
Sbjct: 414 PTTPSPGGS-PPSPSISPSPPITVPSPPTTPSPGGSPP-SPSIVPSPPSTTPSPGSPPTS 471

Query: 169 -YNPTPS-TPPSSDCTPPSQDSPPSDPTPTTP-----STPTTPSGGYYNSPPQDSSPPTD 327
              PTP  +PPSS  TP    SPPS PT  TP     S+PTTPS G   SPP  S  P+ 
Sbjct: 472 PTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPG--GSPPSPSISPSP 529

Query: 328 P--TPTTPSTPTTPSGGYYNSPPQDSSP-PSDPLP 423
           P   P+ PSTPT+P      SPP  SSP PS P+P
Sbjct: 530 PITVPSPPSTPTSP-----GSPPSPSSPTPSSPIP 559

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 65/156 (41%), Positives = 79/156 (50%), Gaps = 17/156 (10%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP--SPPSGDGSYNPT 180
           +PT P+  GS   +P++P  GGS   +P+ P+  G  P     P+P  SPPS   S +P 
Sbjct: 471 SPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSP- 529

Query: 181 PSTPPSSDCTPPSQDSPPSD---------PTPTTPSTPTTPSGGYYNSPPQDSSPP-TDP 330
           P T PS   TP S  SPPS          P+P TPSTP TP     NSPP   SPP T P
Sbjct: 530 PITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGP 589

Query: 331 TPTTPSTPTTPSGGYYNSPP-----QDSSPPSDPLP 423
           +P  PS+P+ P      SPP       S PPS P P
Sbjct: 590 SP--PSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTP 623

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 74/163 (45%), Positives = 82/163 (50%), Gaps = 25/163 (15%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDS------GGSPPGS-YDPTP--SPPSGD 162
           PT PS  GS  P+PS  P   S  P+P  P  S      GGSPP S   PTP  SPPS  
Sbjct: 440 PTTPSPGGS-PPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSP 498

Query: 163 GSYNPTPS-TPPSSDCTPPSQDSPPS---DPTP--TTPSTPTTPSGGYYNSPPQDSSPPT 324
            +  PTP  +PPSS  TP    SPPS    P+P  T PS P+TP+     SPP  SSP  
Sbjct: 499 TT--PTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSP--GSPPSPSSPTP 554

Query: 325 D---PTPTTPSTPTTPSGGYYNSPP-------QDSSPPSDPLP 423
               P+P TPSTP TP     NSPP          SPPS P P
Sbjct: 555 SSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSP 597

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 65/160 (40%), Positives = 81/160 (50%), Gaps = 21/160 (13%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP-PGGGSYDPT---------PSPPSD--SGGSPPGSYDPTPSP 150
           +PT P+  GS   +P++P PGG    P+         PSPPS   S GSPP    PTPS 
Sbjct: 497 SPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSS 556

Query: 151 PSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPT-----PTTPSTPTTPSGGYYNSPPQDSS 315
           P       PTPSTPP+     P Q+SPP  P+     P+ PS+P+ P      SPP    
Sbjct: 557 PIPS---PPTPSTPPTP--ISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGP 611

Query: 316 PPTDPTPTTPS---TPTTPSGGYYNSPP-QDSSPPSDPLP 423
            P+ P P+TP+   +P  PS GY   PP    SPPS P P
Sbjct: 612 TPSSPPPSTPTPVYSPPPPSTGYPPPPPFTGYSPPSPPPP 651

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 60/164 (36%), Positives = 71/164 (43%), Gaps = 26/164 (15%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTP--SPPSDSGGSPPG----SYDPTPSPPSGDGSY 171
            P+PP       PTPSSPP      PTP  SPP  S G PP      Y P   PP    ++
Sbjct: 604  PSPPI----VGPTPSSPPPS---TPTPVYSPPPPSTGYPPPPPFTGYSPPSPPPPPPPTF 656

Query: 172  NPTPSTPPSSDCT---------PPSQDSPPSDPTPTTP------STPTTPSGGYYNSPPQ 306
            +P+PS PP    T         PP Q   P  P+P+ P       TP      Y  SPPQ
Sbjct: 657  SPSPSIPPPPPQTYSPFPPPPPPPPQTYYPPQPSPSQPPQSPIYGTPPPSPIPYLPSPPQ 716

Query: 307  DSSPPTDPTPTTPSTPTTPSGGYYNSPPQDS-----SPPSDPLP 423
             +SPP  P P   S+P  P   +Y+ PP        SPP  P P
Sbjct: 717  FASPP-PPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTP 759

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 63/158 (39%), Positives = 70/158 (44%), Gaps = 19/158 (12%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPT-----PSPPSGDGS 168
           P P+PP+   S  PTP SP G  S    PSPP  +G SPP S  P      PSPP     
Sbjct: 557 PIPSPPTP--STPPTPISP-GQNSPPIIPSPPF-TGPSPPSSPSPPLPPVIPSPPI---- 608

Query: 169 YNPTPSTPPSSDCT------PPSQDSPP-------SDPTPTTPSTPT-TPSGGYYNSPPQ 306
             PTPS+PP S  T      PPS   PP       S P+P  P  PT +PS      PPQ
Sbjct: 609 VGPTPSSPPPSTPTPVYSPPPPSTGYPPPPPFTGYSPPSPPPPPPPTFSPSPSIPPPPPQ 668

Query: 307 DSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
             SP   P P  P T       YY   P  S PP  P+
Sbjct: 669 TYSPFPPPPPPPPQT-------YYPPQPSPSQPPQSPI 699

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 62/154 (40%), Positives = 75/154 (48%), Gaps = 19/154 (12%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPTPSPPS--DSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           PP   GS+    S+ P        PSPP+    GGSPP S   +PSPP       P+P T
Sbjct: 391 PPVDCGSFGCGRSTRPPV----VVPSPPTTPSPGGSPP-SPSISPSPPITV----PSPPT 441

Query: 190 PPSSDCTPPSQDSPPSDPTPT-----TPSTPTTPSGGYYNSPPQD-------SSPPTDPT 333
            PS   +PPS    PS P+ T      P++PTTP+ G   SPP          SPP+ PT
Sbjct: 442 TPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPG--GSPPSSPTTPTPGGSPPSSPT 499

Query: 334 PTT-----PSTPTTPSGGYYNSPPQDSSPPSDPL 420
             T     PS+PTTPS G   SPP  S  PS P+
Sbjct: 500 TPTPGGSPPSSPTTPSPG--GSPPSPSISPSPPI 531

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 55/149 (36%), Positives = 64/149 (42%), Gaps = 16/149 (10%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY----NP 177
            P PP   G Y+P    PP   ++ P+PS P      PP +Y P P PP           P
Sbjct: 635  PPPPPFTG-YSPPSPPPPPPPTFSPSPSIPPP----PPQTYSPFPPPPPPPPQTYYPPQP 689

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPT----TPSGGYYNSPPQDSSPP----TDPT 333
            +PS PP S    P   +PP  P P  PS P      P   YY S PQ   PP      PT
Sbjct: 690  SPSQPPQS----PIYGTPPPSPIPYLPSPPQFASPPPPAPYYYSSPQPPPPPHYSLPPPT 745

Query: 334  PT----TPSTPTTPSGGYYNSPPQDSSPP 408
            PT    +P  P TP     +SPP  S PP
Sbjct: 746  PTYHYISPPPPPTP----IHSPPPQSHPP 770

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 53/151 (35%), Positives = 63/151 (41%), Gaps = 12/151 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PP       P+PS PP    Y   P  P     SPP    P P  P    S  P P
Sbjct: 676  PPPPPPQTYYPPQPSPSQPPQSPIYGTPPPSPIPYLPSPPQFASPPPPAPYYYSS--PQP 733

Query: 184  STPPSSDCTPPSQD----SPPSDPTPT-TPSTPTTPSGGYYNSPPQDS---SPPTDPTPT 339
              PP     PP+      SPP  PTP  +P   + P    Y+ PP  +   +PP  P+P 
Sbjct: 734  PPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPA 793

Query: 340  TPSTPTTPSGGYYNSPPQDS----SPPSDPL 420
              S P +P   YYNSPP       SPP  P+
Sbjct: 794  HYSPPPSPPVYYYNSPPPPPAVHYSPPPPPV 824

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 61/157 (38%), Positives = 69/157 (43%), Gaps = 18/157 (11%)
 Frame = +1

Query: 7   TPTPPSGDGS-YNPTPSSPPGGGSYDPTPSPP----SDSGGSPPGSYDPT---PSPPSGD 162
           TPT P    S  +PTPSSP       PTPS P    S    SPP    P    PSPPS  
Sbjct: 539 TPTSPGSPPSPSSPTPSSPIPS---PPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPS-- 593

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS---TPTTPSGGYYNSPP----QDSSPP 321
              +P+P  PP    +PP     PS P P+TP+   +P  PS GY   PP       SPP
Sbjct: 594 ---SPSPPLPPVIP-SPPIVGPTPSSPPPSTPTPVYSPPPPSTGYPPPPPFTGYSPPSPP 649

Query: 322 TDPTPT---TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             P PT   +PS P  P   Y   PP    PP    P
Sbjct: 650 PPPPPTFSPSPSIPPPPPQTYSPFPPPPPPPPQTYYP 686

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 54/162 (33%), Positives = 69/162 (42%), Gaps = 24/162 (14%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSY---DPTPSPPSGDGSY 171
            P+P PP    +++P+PS  PP   +Y P P PP      PP +Y    P+PS P     Y
Sbjct: 646  PSPPPPPPP-TFSPSPSIPPPPPQTYSPFPPPPPP----PPQTYYPPQPSPSQPPQSPIY 700

Query: 172  NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDS-----SPPTDPT- 333
               P +P     +PP   SPP  P P   S+P  P   +Y+ PP        SPP  PT 
Sbjct: 701  GTPPPSPIPYLPSPPQFASPPP-PAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTP 759

Query: 334  ----------PTTPSTPTTPSGGYYNSPPQDS----SPPSDP 417
                      P    +P  P   +YN PP  S    SPP  P
Sbjct: 760  IHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSP 801

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 46/142 (32%), Positives = 54/142 (38%), Gaps = 14/142 (9%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPPGGGSYDPTPS--------PPSDSGGSPPGSYDPT---PSPP 153
            +P PP+     +P P  PP      PTP+        PP+     PP S+ P      PP
Sbjct: 719  SPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPP 778

Query: 154  SGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPP---QDSSPPT 324
                 YNP P  PPS    P     PPS P     S P  P+  Y   PP     S PP 
Sbjct: 779  PPTVHYNPPP--PPS----PAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPP 832

Query: 325  DPTPTTPSTPTTPSGGYYNSPP 390
             P    P  P  P   Y + PP
Sbjct: 833  PPIYEGP-LPPIPGISYASPPP 853

[15][TOP]
>UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2Z7_EHV86
          Length = 516

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 56/141 (39%), Positives = 66/141 (46%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDP-TPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P+P PPS      P PS PP      P +P PPS     PP    P+PSPPS      P 
Sbjct: 20  PSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPS------PP 73

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           P +PP     PPS  SPP  P P +P  P+ P      SPP  S PP  P P+ P +P+ 
Sbjct: 74  PPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPP----PSPPPPSPPPPSPPPSPPPSPSP 129

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           PS    + PP   SP   P P
Sbjct: 130 PSPPPPSPPPPSISPSPPPPP 150

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 55/143 (38%), Positives = 67/143 (46%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PPS   S  P P SPP      P+P PPS    SPP S  P+PSPPS      P P
Sbjct: 83  PPPSPPSPPPS--PPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPS-----PPPP 135

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP---TDPTPTTPSTP 354
           S PP S    P    PP    P+   +P  P   ++ +P    SPP     P+P + ++P
Sbjct: 136 SPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASP 195

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
           T P      SPP  S PP  P P
Sbjct: 196 TPPPPSASPSPPPPSPPPPSPPP 218

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 56/145 (38%), Positives = 66/145 (45%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP      +P PS PP      P+PSPPS    SPP    P PSPPS      P P
Sbjct: 41  PPPLPPPSPPPPSPPPSPPPP--LPPPSPSPPSPPPPSPPPPSPPPPSPPS------PPP 92

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP-----S 348
           S PP S   PP    PP  P P +P  P+ P      SPP   SPP+ P P+ P      
Sbjct: 93  SPPPPS---PPPPSPPPPSPPPPSPPPPSPPP-----SPPPSPSPPSPPPPSPPPPSISP 144

Query: 349 TPTTPSGGYYNSPPQDSSPPSDPLP 423
           +P  P   ++ +P    SPP  P P
Sbjct: 145 SPPPPPPPWWQAPSASPSPPPPPPP 169

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 56/152 (36%), Positives = 70/152 (46%), Gaps = 12/152 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGG-SYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P+P+PPS      P PS PP    S  P+P PPS    SPP    P PSPP      +P 
Sbjct: 65  PSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPP 120

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP-----------TD 327
           PS PPS   +PPS   PPS P P+   +P  P   ++ +P    SPP             
Sbjct: 121 PSPPPSP--SPPSPP-PPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSAS 177

Query: 328 PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P+P  PS   +P      +PP  S+ PS P P
Sbjct: 178 PSPPPPSISPSPPSSASPTPPPPSASPSPPPP 209

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 53/143 (37%), Positives = 64/143 (44%), Gaps = 5/143 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP      +P+P SPP      P+P PPS    SPP S  P+P PPS      P P
Sbjct: 54  PPPSPPPPLPPPSPSPPSPP-----PPSPPPPSPPPPSPP-SPPPSPPPPSPPPPSPPPP 107

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQD-----SSPPTDPTPTTPS 348
           S PP S   P    SPP  P+P +P  P+ P      SPP        +P   P+P  P 
Sbjct: 108 SPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPP 167

Query: 349 TPTTPSGGYYNSPPQDSSPPSDP 417
            P   +     SPP  S  PS P
Sbjct: 168 PPWWQAPSASPSPPPPSISPSPP 190

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 55/145 (37%), Positives = 66/145 (45%), Gaps = 9/145 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPG-SYDPTPSPP------SGD 162
           P+P PPS      P PS PP   S  P+PSPPS    SPP  S  P+P PP      +  
Sbjct: 102 PSPPPPSPPPPSPPPPSPPP---SPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPS 158

Query: 163 GSYNPTPSTPP--SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
            S +P P  PP   +    PS   P   P+P + ++PT P      SPP  S PP  P P
Sbjct: 159 ASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPP 218

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPS 411
             P  P  P      SPP  + PPS
Sbjct: 219 PPPPPPPPPP-----SPPSPNPPPS 238

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 54/150 (36%), Positives = 65/150 (43%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P PSP      SPP    P+P PPS   S  P P
Sbjct: 97  PSPPPPSPPPPSPPPPSPPPPSPPPSPPPSP------SPPSPPPPSPPPPSISPSPPPPP 150

Query: 184 --------STPPSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSP-PTDPT 333
                   ++P      PP   +P + P+P  PS +P+ PS      PP  +SP P  P+
Sbjct: 151 PPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPS 210

Query: 334 PTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  PS P  P       PP    PPS P P
Sbjct: 211 PPPPSPPPPP-------PPPPPPPPSPPSP 233

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 56/148 (37%), Positives = 69/148 (46%), Gaps = 10/148 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPP----------SDSGGSPPGSYDPTPSPP 153
           P P+PP    S +P P  PP   +   +PSPP          S S   PP S   +PSPP
Sbjct: 133 PPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSI--SPSPP 190

Query: 154 SGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT 333
           S   S +PTP  PPS+  +PP    PPS P P+ P  P  P       PP   SPP+ P 
Sbjct: 191 S---SASPTPP-PPSASPSPP----PPSPPPPSPPPPPPPP-------PPPPPSPPS-PN 234

Query: 334 PTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
           P   ++P+ P G    SPP    PP  P
Sbjct: 235 PPPSASPSPPFGRSLRSPPPPPPPPPPP 262

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 50/123 (40%), Positives = 57/123 (46%), Gaps = 8/123 (6%)
 Frame = +1

Query: 4   PTPTPP---SGDGSYNPTPSSPPGGGSYDPTPSPPSDS-GGSPPGSYDPTPSPPSGDGS- 168
           P P PP   +   S +P P  PP   +   +PSPP  S   SPP S  PTP PPS   S 
Sbjct: 147 PPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSP 206

Query: 169 ---YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
                P PS PP     PP   SPPS P P   ++P+ P G    SPP    PP  P P 
Sbjct: 207 PPPSPPPPSPPPPPPPPPPPPPSPPS-PNPPPSASPSPPFGRSLRSPP--PPPPPPPPPG 263

Query: 340 TPS 348
            PS
Sbjct: 264 LPS 266

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 34/87 (39%), Positives = 40/87 (45%)
 Frame = +1

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
           G+Y  TP +PP     PPS   PP  P P  P  P         SPP  S PP+ P P  
Sbjct: 14  GAY-ATPPSPPPPSPPPPS--PPPPSPPPLPPPLPPP-------SPPPPSPPPSPPPPLP 63

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P +P+ PS    + PP    PPS P P
Sbjct: 64  PPSPSPPSPPPPSPPPPSPPPPSPPSP 90

[16][TOP]
>UniRef100_Q9SN46 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9SN46_ARATH
          Length = 839

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 71/155 (45%), Positives = 79/155 (50%), Gaps = 17/155 (10%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGS------- 168
           PT PS  GS  P+PS  P      P+P      GGSPP S    PSPPS   S       
Sbjct: 414 PTTPSPGGS-PPSPSISPSPPITVPSPPTTPSPGGSPP-SPSIVPSPPSTTPSPGSPPTS 471

Query: 169 -YNPTPS-TPPSSDCTPPSQDSPPSDPTPTTP-----STPTTPSGGYYNSPPQDSSPPTD 327
              PTP  +PPSS  TP    SPPS PT  TP     S+PTTPS G   SPP  S  P+ 
Sbjct: 472 PTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPG--GSPPSPSISPSP 529

Query: 328 P--TPTTPSTPTTPSGGYYNSPPQDSSP-PSDPLP 423
           P   P+ PSTPT+P      SPP  SSP PS P+P
Sbjct: 530 PITVPSPPSTPTSP-----GSPPSPSSPTPSSPIP 559

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 65/156 (41%), Positives = 79/156 (50%), Gaps = 17/156 (10%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP--SPPSGDGSYNPT 180
           +PT P+  GS   +P++P  GGS   +P+ P+  G  P     P+P  SPPS   S +P 
Sbjct: 471 SPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSP- 529

Query: 181 PSTPPSSDCTPPSQDSPPSD---------PTPTTPSTPTTPSGGYYNSPPQDSSPP-TDP 330
           P T PS   TP S  SPPS          P+P TPSTP TP     NSPP   SPP T P
Sbjct: 530 PITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGP 589

Query: 331 TPTTPSTPTTPSGGYYNSPP-----QDSSPPSDPLP 423
           +P  PS+P+ P      SPP       S PPS P P
Sbjct: 590 SP--PSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTP 623

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 74/163 (45%), Positives = 82/163 (50%), Gaps = 25/163 (15%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDS------GGSPPGS-YDPTP--SPPSGD 162
           PT PS  GS  P+PS  P   S  P+P  P  S      GGSPP S   PTP  SPPS  
Sbjct: 440 PTTPSPGGS-PPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSP 498

Query: 163 GSYNPTPS-TPPSSDCTPPSQDSPPS---DPTP--TTPSTPTTPSGGYYNSPPQDSSPPT 324
            +  PTP  +PPSS  TP    SPPS    P+P  T PS P+TP+     SPP  SSP  
Sbjct: 499 TT--PTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSP--GSPPSPSSPTP 554

Query: 325 D---PTPTTPSTPTTPSGGYYNSPP-------QDSSPPSDPLP 423
               P+P TPSTP TP     NSPP          SPPS P P
Sbjct: 555 SSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSP 597

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 63/154 (40%), Positives = 78/154 (50%), Gaps = 15/154 (9%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP-PGGGSYDPT---------PSPPSD--SGGSPPGSYDPTPSP 150
           +PT P+  GS   +P++P PGG    P+         PSPPS   S GSPP    PTPS 
Sbjct: 497 SPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSS 556

Query: 151 PSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTP--TTPSTPTTPSGGYYNSPPQDSSPP- 321
           P       PTPSTPP+     P Q+SPP  P+P  T PS P++PS      PP   SPP 
Sbjct: 557 PIPS---PPTPSTPPTP--ISPGQNSPPIIPSPPFTGPSPPSSPSPPL---PPVIPSPPI 608

Query: 322 TDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             PTP++P  P+TP+ G    P     P    LP
Sbjct: 609 VGPTPSSP-PPSTPTPGTLLHPHHLLLPQLSHLP 641

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 62/154 (40%), Positives = 75/154 (48%), Gaps = 19/154 (12%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPTPSPPS--DSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           PP   GS+    S+ P        PSPP+    GGSPP S   +PSPP       P+P T
Sbjct: 391 PPVDCGSFGCGRSTRPPV----VVPSPPTTPSPGGSPP-SPSISPSPPITV----PSPPT 441

Query: 190 PPSSDCTPPSQDSPPSDPTPT-----TPSTPTTPSGGYYNSPPQD-------SSPPTDPT 333
            PS   +PPS    PS P+ T      P++PTTP+ G   SPP          SPP+ PT
Sbjct: 442 TPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPG--GSPPSSPTTPTPGGSPPSSPT 499

Query: 334 PTT-----PSTPTTPSGGYYNSPPQDSSPPSDPL 420
             T     PS+PTTPS G   SPP  S  PS P+
Sbjct: 500 TPTPGGSPPSSPTTPSPG--GSPPSPSISPSPPI 531

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 45/143 (31%), Positives = 57/143 (39%), Gaps = 15/143 (10%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPPGGGSYDPTPS--------PPSDSGGSPPGSYDPT---PSPP 153
            +P PP+     +P P  PP      PTP+        PP+     PP S+ P      PP
Sbjct: 701  SPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPP 760

Query: 154  SGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPP----QDSSPP 321
                 YNP P  PPS     P+  SPP  P     ++P  P   +Y+ PP      S PP
Sbjct: 761  PPTVHYNPPP--PPS-----PAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPP 813

Query: 322  TDPTPTTPSTPTTPSGGYYNSPP 390
              P    P  P  P   Y + PP
Sbjct: 814  PPPIYEGP-LPPIPGISYASPPP 835

[17][TOP]
>UniRef100_C5XIF9 Putative uncharacterized protein Sb03g033390 n=1 Tax=Sorghum
           bicolor RepID=C5XIF9_SORBI
          Length = 525

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 77/201 (38%), Positives = 94/201 (46%), Gaps = 62/201 (30%)
 Frame = +1

Query: 7   TPTPPSGDGSY--NPTPSS-----PPG--GGSYDPTPSPPSDSGGSPPG----------- 126
           +P+ P G G Y   P+PSS      PG  GG     PSP SD+  S PG           
Sbjct: 184 SPSTPGGGGGYYGPPSPSSGTSPTTPGGSGGGCSAPPSPSSDTSPSTPGGGAGYCGPPSP 243

Query: 127 SYDPTPSPPSGDGSYNPTPSTPPSSDCTP------------PSQDS-------------P 231
           S   +PS P G G Y   PS  PSSD TP            PS D+             P
Sbjct: 244 SSGTSPSTPGGGGGYYGPPS--PSSDTTPGGGGGGYSAPPSPSSDTSPSTPGGGGGYYGP 301

Query: 232 PSDPTPTTPSTPTTPSGGYYN--SPPQDSSPPT---------DPTPTTPSTPTTP--SGG 372
           PS  + T+P+TP+ PSGGYY   SP  D+SP T          P+P++ ++PTTP   GG
Sbjct: 302 PSPSSGTSPTTPSAPSGGYYGPPSPSSDTSPTTPGGGGGYYGPPSPSSDTSPTTPGSGGG 361

Query: 373 YYN--SPPQDSSP--PSDPLP 423
           YY   SP  D+SP  P  PLP
Sbjct: 362 YYGPPSPSSDTSPATPDVPLP 382

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 64/174 (36%), Positives = 81/174 (46%), Gaps = 39/174 (22%)
 Frame = +1

Query: 1   DPTPTPPSGDGSY--------NPTPSSPPGGGSYDPTPSP--------PSDSGGS----P 120
           D +P+ P G G Y          +PS+P GGG Y   PSP        P  SGG     P
Sbjct: 161 DTSPSTPGGGGGYYGPPSPSSGTSPSTPGGGGGYYGPPSPSSGTSPTTPGGSGGGCSAPP 220

Query: 121 PGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTP--SGGYYN 294
             S D +PS P G   Y   PS  PSS  +P +         P +PS+ TTP   GG Y+
Sbjct: 221 SPSSDTSPSTPGGGAGYCGPPS--PSSGTSPSTPGGGGGYYGPPSPSSDTTPGGGGGGYS 278

Query: 295 SPPQDSS---------------PPTDPTPTTPSTPTTPSGGYYN--SPPQDSSP 405
           +PP  SS               PP+  + T+P+TP+ PSGGYY   SP  D+SP
Sbjct: 279 APPSPSSDTSPSTPGGGGGYYGPPSPSSGTSPTTPSAPSGGYYGPPSPSSDTSP 332

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 64/171 (37%), Positives = 86/171 (50%), Gaps = 31/171 (18%)
 Frame = +1

Query: 1   DPTPTPPSGDGSY--------NPTPSSPPGGGSYDPTPSPPSDS------GG--SPPG-S 129
           D +P+ P G   Y          +PS+P GGG Y   PSP SD+      GG  +PP  S
Sbjct: 225 DTSPSTPGGGAGYCGPPSPSSGTSPSTPGGGGGYYGPPSPSSDTTPGGGGGGYSAPPSPS 284

Query: 130 YDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSD----PTPTTPSTPTTPSGG--YY 291
            D +PS P G G Y   PS  PSS  +P +  +P       P+P++ ++PTTP GG  YY
Sbjct: 285 SDTSPSTPGGGGGYYGPPS--PSSGTSPTTPSAPSGGYYGPPSPSSDTSPTTPGGGGGYY 342

Query: 292 N--SPPQDSSPPTDPT------PTTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
              SP  D+SP T  +      P +PS+ T+P+      PP  +SPP  PL
Sbjct: 343 GPPSPSSDTSPTTPGSGGGYYGPPSPSSDTSPATPDVPLPPISTSPPFSPL 393

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 66/180 (36%), Positives = 85/180 (47%), Gaps = 41/180 (22%)
 Frame = +1

Query: 7   TPTPPSGDGSYN--PTPSSPP-------GGGSYDPTPSPPSDSGGSPPG----------- 126
           TPT P G G YN  P+PSS         GGG Y   PSP SD+  + PG           
Sbjct: 98  TPTTPGGCGGYNAPPSPSSDTSPTTPGGGGGGYYGPPSPSSDTSPTTPGGGSGGCSAPPS 157

Query: 127 -SYDPTPSPPSGDGSYNPTPS-TPPSSDCTPPSQDSPPSDPTPTTPSTPTTP--SGGYYN 294
            S D +PS P G G Y   PS +  +S  TP         P+P++ ++PTTP  SGG  +
Sbjct: 158 PSSDTSPSTPGGGGGYYGPPSPSSGTSPSTPGGGGGYYGPPSPSSGTSPTTPGGSGGGCS 217

Query: 295 SPPQDSSPPTDPTPTTP---------------STPTTP--SGGYYNSPPQDSSPPSDPLP 423
           +PP   SP +D +P+TP               ++P+TP   GGYY  P    SP SD  P
Sbjct: 218 APP---SPSSDTSPSTPGGGAGYCGPPSPSSGTSPSTPGGGGGYYGPP----SPSSDTTP 270

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 54/137 (39%), Positives = 67/137 (48%), Gaps = 7/137 (5%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPG-SYDPTPSPPSGDGSYNP 177
           D +P+ P G G Y   PS  P  G+   TPS PS     PP  S D +P+ P G G Y  
Sbjct: 286 DTSPSTPGGGGGYYGPPS--PSSGTSPTTPSAPSGGYYGPPSPSSDTSPTTPGGGGGYYG 343

Query: 178 TPSTPPSSDCTPPSQDS------PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
            PS  PSSD +P +  S      PPS  + T+P+TP  P       PP  +SPP  P   
Sbjct: 344 PPS--PSSDTSPTTPGSGGGYYGPPSPSSDTSPATPDVPL------PPISTSPPFSPLTP 395

Query: 340 TPSTPTTPSGGYYNSPP 390
           TP+TPT       N+PP
Sbjct: 396 TPTTPTPYDP---NTPP 409

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 62/170 (36%), Positives = 81/170 (47%), Gaps = 31/170 (18%)
 Frame = +1

Query: 7   TPTPPS-GDGSYNP----------TPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPP 153
           +PT P  G G Y P          TP++P G G Y+  PSP SD+  + PG         
Sbjct: 74  SPTTPGGGGGGYYPPSPDIGTSPTTPTTPGGCGGYNAPPSPSSDTSPTTPG--------- 124

Query: 154 SGDGSYNPTPSTPPSSDCTPPSQ-------DSPPSDPTPTTPSTPTTPSGGYYN--SPPQ 306
            G G Y   PS  PSSD +P +         +PPS  + T+PSTP    GGYY   SP  
Sbjct: 125 GGGGGYYGPPS--PSSDTSPTTPGGGSGGCSAPPSPSSDTSPSTP-GGGGGYYGPPSPSS 181

Query: 307 DSSPPT---------DPTPTTPSTPTTP--SGGYYNSPPQDSSPPSDPLP 423
            +SP T          P+P++ ++PTTP  SGG  ++PP  SS  S   P
Sbjct: 182 GTSPSTPGGGGGYYGPPSPSSGTSPTTPGGSGGGCSAPPSPSSDTSPSTP 231

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 38/106 (35%), Positives = 49/106 (46%), Gaps = 2/106 (1%)
 Frame = +1

Query: 112 GSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPT-PTTPSTPTTPSGGY 288
           G P G      +    DG    +   P     +P S  +PP  P+  T+P+TP    GGY
Sbjct: 26  GEPFGGGLKNAARHLSDGDPFGSRKNPADPHHSPGSHGTPPCSPSIGTSPTTPGGGGGGY 85

Query: 289 YNSPPQDSSPPTDPTPTTPSTPTTPSG-GYYNSPPQDSSPPSDPLP 423
           Y        PP+    T+P+TPTTP G G YN+PP  SS  S   P
Sbjct: 86  Y--------PPSPDIGTSPTTPTTPGGCGGYNAPPSPSSDTSPTTP 123

[18][TOP]
>UniRef100_A7RPE6 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7RPE6_NEMVE
          Length = 1263

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 62/142 (43%), Positives = 80/142 (56%), Gaps = 4/142 (2%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           TP+ PS  G+ + TPS+P  P   S   TPS PS        S   TPS PS  G+ + T
Sbjct: 255 TPSTPSAPGTPS-TPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSAPGTPS-T 312

Query: 181 PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           PSTP  PS+  TP +  +P +  TP+TPS P+TPS    ++P   S+P T  TP+TPSTP
Sbjct: 313 PSTPSTPSTPSTPSTPSTPSTPSTPSTPSMPSTPSTP--STPSTPSTPSTPSTPSTPSTP 370

Query: 355 TTPSGGYYNSPPQDSSPPSDPL 420
           +TPS     S P   S PS P+
Sbjct: 371 STPSTPSTPSTPSTPSTPSTPI 392

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 63/141 (44%), Positives = 77/141 (54%), Gaps = 4/141 (2%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+ PS  G+   TPS+P  P   S   TPS PS        S   TPS PS  G+   T
Sbjct: 835  TPSTPSAPGTPG-TPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPGTPG-T 892

Query: 181  PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            PSTP  PS+  TP +  +P +  TP+TPSTP+TPS     +P   S+P T  TP+TPSTP
Sbjct: 893  PSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPS-----TPSTPSTPSTPSTPSTPSTP 947

Query: 355  TTPSGGYYNSPPQDSSPPSDP 417
            +TPS     S P   S PS P
Sbjct: 948  STPSTPSTPSTPSTPSTPSTP 968

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 63/143 (44%), Positives = 77/143 (53%), Gaps = 5/143 (3%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           TP+ PS  G+ + TPS+P  P   S   TPS PS        S   TPS PS       T
Sbjct: 300 TPSTPSAPGTPS-TPSTPSTPSTPSTPSTPSTPSTPSTPSTPSMPSTPSTPSTPS----T 354

Query: 181 PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP-TPTTPST 351
           PSTP  PS+  TP +  +P +  TP+TPSTP+TPS     S P   S P+ P TP+TPST
Sbjct: 355 PSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPITPSTPSTPSTPSTPSTPSTPST 414

Query: 352 PTTPSGGYYNSPPQDSSPPSDPL 420
           P+TPS     S P   S PS P+
Sbjct: 415 PSTPSTPSTPSTPSTPSTPSTPI 437

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 61/143 (42%), Positives = 82/143 (57%), Gaps = 6/143 (4%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
           TP+ PS   + + TPS+P   G+     +P + S  S PG+   TPS PS  G+ + TPS
Sbjct: 213 TPSTPSTPSTPS-TPSTPSTPGTLSTPSTPSTPSTPSTPGT-PSTPSTPSAPGTPS-TPS 269

Query: 187 TP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPS----GGYYNSPPQDSSPPTDPTPTTPS 348
           TP  PS+  TP +  +P +  TP+TPSTP+TPS     G  ++P   S+P T  TP+TPS
Sbjct: 270 TPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSAPGTPSTPSTPSTPSTPSTPSTPS 329

Query: 349 TPTTPSGGYYNSPPQDSSPPSDP 417
           TP+TPS     S P   S PS P
Sbjct: 330 TPSTPSTPSTPSMPSTPSTPSTP 352

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 62/141 (43%), Positives = 79/141 (56%), Gaps = 4/141 (2%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           TP+ PS  G+ + TPS+P  PG  S   TPS PS        S   TPS PS   + + T
Sbjct: 243 TPSTPSTPGTPS-TPSTPSAPGTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPS-T 300

Query: 181 PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           PSTP  P +  TP +  +P +  TP+TPSTP+TPS    ++P   S+P T  TP+TPSTP
Sbjct: 301 PSTPSAPGTPSTPSTPSTPSTPSTPSTPSTPSTPSTP--STPSMPSTPSTPSTPSTPSTP 358

Query: 355 TTPSGGYYNSPPQDSSPPSDP 417
           +TPS     S P   S PS P
Sbjct: 359 STPSTPSTPSTPSTPSTPSTP 379

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 61/141 (43%), Positives = 74/141 (52%), Gaps = 4/141 (2%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG--SYNPT 180
            TP+ PS  G+  P+  S P   S   TPS P   G     S   TPS PS     S   T
Sbjct: 814  TPSTPSAPGT--PSTPSTPSTPSTPSTPSAPGTPGTPSTPSTPSTPSTPSTPSTPSTPST 871

Query: 181  PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            PSTP  PS+  TP +  +P +  TP+TPSTP+TPS     +P   S+P T  TP+TPSTP
Sbjct: 872  PSTPSTPSTPSTPSTPGTPGTPSTPSTPSTPSTPS-----TPSTPSTPSTPSTPSTPSTP 926

Query: 355  TTPSGGYYNSPPQDSSPPSDP 417
            +TPS     S P   S PS P
Sbjct: 927  STPSTPSTPSTPSTPSTPSTP 947

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 64/144 (44%), Positives = 79/144 (54%), Gaps = 7/144 (4%)
 Frame = +1

Query: 7   TPTPPSGDG--SYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYN 174
           TP+ PS     S   TPS+P  PG  S   TPS PS        S   TPS PS   + +
Sbjct: 153 TPSTPSTSSTPSTPSTPSTPGTPGTPSTPSTPSAPSTPSTPSTPSTPSTPSTPSTPSTPS 212

Query: 175 PTPSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPS-GGYYNSPPQDSSPPTDPTPTTP 345
            TPSTP  PS+  TP +  +P +  TP+TPSTP+TPS  G  ++P   S+P T  TP+TP
Sbjct: 213 -TPSTPSTPSTPSTPSTPSTPGTLSTPSTPSTPSTPSTPGTPSTPSTPSAPGTPSTPSTP 271

Query: 346 STPTTPSGGYYNSPPQDSSPPSDP 417
           STP+TPS     S P   S PS P
Sbjct: 272 STPSTPSTPSTPSTPSTPSTPSTP 295

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 63/141 (44%), Positives = 77/141 (54%), Gaps = 4/141 (2%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           TP+ PS   + + TPS+P  PG  S   TPS PS        S   TPS PS   S   T
Sbjct: 288 TPSTPSTPSTPS-TPSTPSAPGTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTP-SMPST 345

Query: 181 PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           PSTP  PS+  TP +  +P +  TP+TPSTP+TPS     +P   S+P T  TP+TPSTP
Sbjct: 346 PSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPS-----TPSTPSTPSTPITPSTPSTP 400

Query: 355 TTPSGGYYNSPPQDSSPPSDP 417
           +TPS     S P   S PS P
Sbjct: 401 STPSTPSTPSTPSTPSTPSTP 421

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 62/141 (43%), Positives = 78/141 (55%), Gaps = 4/141 (2%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+ PS  G+   TPS+P  P   S   TPS PS        S   TPS PS   + + T
Sbjct: 880  TPSTPSTPGTPG-TPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPS-T 937

Query: 181  PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            PSTP  PS+  TP +  +P +  TP+TPSTP+TPS    ++P   S+P T  TP+TPSTP
Sbjct: 938  PSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTP--STPSTPSTPSTPGTPSTPSTP 995

Query: 355  TTPSGGYYNSPPQDSSPPSDP 417
            +TPS     S P   S PS P
Sbjct: 996  STPSTPSTPSTPSTPSTPSTP 1016

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 63/148 (42%), Positives = 77/148 (52%), Gaps = 11/148 (7%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           TP+ PS   + + TPS+P  P   S   TPS PS  G     S   TPS PS       T
Sbjct: 138 TPSTPSTPSTPS-TPSTPSTPSTSSTPSTPSTPSTPGTPGTPSTPSTPSAPS-------T 189

Query: 181 PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPS-------GGYYNSPPQDSSPPTDPT 333
           PSTP  PS+  TP +  +P +  TP+TPSTP+TPS        G  ++P   S+P T  T
Sbjct: 190 PSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPGTLSTPSTPSTPSTPST 249

Query: 334 PTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
           P TPSTP+TPS     S P   S PS P
Sbjct: 250 PGTPSTPSTPSAPGTPSTPSTPSTPSTP 277

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 68/148 (45%), Positives = 78/148 (52%), Gaps = 11/148 (7%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           TP+ PS  G+   TPS+P  P   S   TPS PS        S   TPS PS       T
Sbjct: 165 TPSTPSTPGTPG-TPSTPSTPSAPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPS----T 219

Query: 181 PSTP--PSSDCTP-----PSQDSPPSDP-TPTTPSTPTTPSG-GYYNSPPQDSSPPTDPT 333
           PSTP  PS+  TP     PS  S PS P TP TPSTP+TPS  G  ++P   S+P T  T
Sbjct: 220 PSTPSTPSTPSTPGTLSTPSTPSTPSTPSTPGTPSTPSTPSAPGTPSTPSTPSTPSTPST 279

Query: 334 PTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
           P+TPSTP+TPS     S P   S PS P
Sbjct: 280 PSTPSTPSTPSTPSTPSTPSTPSTPSAP 307

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 62/141 (43%), Positives = 77/141 (54%), Gaps = 4/141 (2%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+ PS   + + TPS+P  PG  S   TPS PS        S   TPS PS       T
Sbjct: 871  TPSTPSTPSTPS-TPSTPGTPGTPSTPSTPSTPSTPSTPSTPSTPSTPSTPS-------T 922

Query: 181  PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            PSTP  PS+  TP +  +P +  TP+TPSTP+TPS    ++P   S+P T  TP+TPSTP
Sbjct: 923  PSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTP--STPSTPSTPSTPSTPSTPSTP 980

Query: 355  TTPSGGYYNSPPQDSSPPSDP 417
            +TPS     S P   S PS P
Sbjct: 981  STPSTPGTPSTPSTPSTPSTP 1001

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 61/141 (43%), Positives = 76/141 (53%), Gaps = 4/141 (2%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           TP+ PS  G+ + TPS+P  P   S   TPS PS        S   TPS PS   + + T
Sbjct: 225 TPSTPSTPGTLS-TPSTPSTPSTPSTPGTPSTPSTPSAPGTPSTPSTPSTPSTPSTPS-T 282

Query: 181 PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           PSTP  PS+  TP +  +P +   P TPSTP+TPS     +P   S+P T  TP+TPSTP
Sbjct: 283 PSTPSTPSTPSTPSTPSTPSTPSAPGTPSTPSTPS-----TPSTPSTPSTPSTPSTPSTP 337

Query: 355 TTPSGGYYNSPPQDSSPPSDP 417
           +TPS     S P   S PS P
Sbjct: 338 STPSMPSTPSTPSTPSTPSTP 358

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 61/141 (43%), Positives = 77/141 (54%), Gaps = 4/141 (2%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+ PS   + + TPS+P  P   S   TPS PS        S   TPS PS   + + T
Sbjct: 907  TPSTPSTPSTPS-TPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPS-T 964

Query: 181  PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            PSTP  PS+  TP +  +P +  TP+TPSTP+TPS     +P   S+P T  TP+TPSTP
Sbjct: 965  PSTPSTPSTPSTPSTPSTPSTPGTPSTPSTPSTPS-----TPSTPSTPSTPSTPSTPSTP 1019

Query: 355  TTPSGGYYNSPPQDSSPPSDP 417
            +TPS     S P   S PS P
Sbjct: 1020 STPSTPSTPSTPSTPSMPSTP 1040

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 60/145 (41%), Positives = 74/145 (51%), Gaps = 8/145 (5%)
 Frame = +1

Query: 7   TPTPPSGDG-SYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG--SYNP 177
           TP+ PS    ++ P+  S P   S   TPS PS        S   TPS PS     S   
Sbjct: 108 TPSTPSTPSLTHTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTSSTPSTPS 167

Query: 178 TPSTP-----PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
           TPSTP     PS+  TP +  +P +  TP+TPSTP+TPS     +P   S+P T  TP+T
Sbjct: 168 TPSTPGTPGTPSTPSTPSAPSTPSTPSTPSTPSTPSTPS-----TPSTPSTPSTPSTPST 222

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDP 417
           PSTP+TPS     S P   S PS P
Sbjct: 223 PSTPSTPSTPGTLSTPSTPSTPSTP 247

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 62/142 (43%), Positives = 73/142 (51%), Gaps = 5/142 (3%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           TP  PS       TPS+P  P   S   TPS PS        S   TPS PS   + + T
Sbjct: 99  TPNTPS-------TPSTPSTPSTPSLTHTPSTPSTPSTPSTPSTPSTPSTPSTPSTPS-T 150

Query: 181 PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP-TPTTPST 351
           PSTP  PS+  TP +  +P +  TP TPSTP+TPS     S P   S P+ P TP+TPST
Sbjct: 151 PSTPSTPSTSSTPSTPSTPSTPGTPGTPSTPSTPSAPSTPSTPSTPSTPSTPSTPSTPST 210

Query: 352 PTTPSGGYYNSPPQDSSPPSDP 417
           P+TPS     S P   S PS P
Sbjct: 211 PSTPSTPSTPSTPSTPSTPSTP 232

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 63/136 (46%), Positives = 72/136 (52%), Gaps = 6/136 (4%)
 Frame = +1

Query: 28   DGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTP--PSS 201
            DG     P +P G  S   TPS P         S   TPS PS  G+   TPSTP  PS+
Sbjct: 799  DGGEGCAPGTP-GTPSTPSTPSAPGTPSTPSTPSTPSTPSTPSAPGTPG-TPSTPSTPST 856

Query: 202  DCTP--PSQDSPPSDP-TPTTPSTPTTPS-GGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
              TP  PS  S PS P TP+TPSTP+TPS  G   +P   S+P T  TP+TPSTP+TPS 
Sbjct: 857  PSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPGTPGTPSTPSTPSTPSTPSTPSTPSTPST 916

Query: 370  GYYNSPPQDSSPPSDP 417
                S P   S PS P
Sbjct: 917  PSTPSTPSTPSTPSTP 932

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 61/141 (43%), Positives = 77/141 (54%), Gaps = 4/141 (2%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+ PS   + + TPS+P  P   S   TPS PS        S   TPS PS   + + T
Sbjct: 910  TPSTPSTPSTPS-TPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPS-T 967

Query: 181  PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            PSTP  PS+  TP +  +P +  TP+TPSTP+TPS     +P   S+P T  TP+TPSTP
Sbjct: 968  PSTPSTPSTPSTPSTPSTPGTPSTPSTPSTPSTPS-----TPSTPSTPSTPSTPSTPSTP 1022

Query: 355  TTPSGGYYNSPPQDSSPPSDP 417
            +TPS     S P   S PS P
Sbjct: 1023 STPSTPSTPSTPSMPSTPSMP 1043

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 62/142 (43%), Positives = 75/142 (52%), Gaps = 5/142 (3%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+ PS   + + TPS+P  P   S   TPS PS        S   TPS PS  G    T
Sbjct: 934  TPSTPSTPSTPS-TPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPG----T 988

Query: 181  PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT-PTTPST 351
            PSTP  PS+  TP +  +P +  TP+TPSTP+TPS     S P   S P+ P+ P TPST
Sbjct: 989  PSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSMPSTPSMPNTPST 1048

Query: 352  PTTPSGGYYNSPPQDSSPPSDP 417
            P+TPS     S P   S PS P
Sbjct: 1049 PSTPSTPSTLSTPITPSTPSTP 1070

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 68/160 (42%), Positives = 80/160 (50%), Gaps = 23/160 (14%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           TP+ PS   + + TPS+P  P   S   TPS PS        S   TPS PS  G+ + T
Sbjct: 180 TPSTPSAPSTPS-TPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPGTLS-T 237

Query: 181 PSTP--PSSDCTP--PSQDSPPSDP----------TPTTPSTPTTPSGGYYNSPPQDSSP 318
           PSTP  PS+  TP  PS  S PS P          TP+TPSTP+TPS     S P   S 
Sbjct: 238 PSTPSTPSTPSTPGTPSTPSTPSAPGTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPST 297

Query: 319 PTDP-------TPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
           P+ P       TP+TPSTP+TPS     S P   S PS P
Sbjct: 298 PSTPSTPSAPGTPSTPSTPSTPSTPSTPSTPSTPSTPSTP 337

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 66/144 (45%), Positives = 75/144 (52%), Gaps = 7/144 (4%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           TP  PS       TPS+P  P   S   TPS PS        S   TPS PS   + + T
Sbjct: 584 TPNTPS-------TPSTPSTPSTPSLTHTPSTPSTPSTPSTPSTPSTPSTPSTPSTPS-T 635

Query: 181 PSTP--PSSDCTP--PSQDSPPSDP-TPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
           PSTP  PS+  TP  PS  S PS P TP TPSTP+TPS     +P   S+P T  TP+TP
Sbjct: 636 PSTPSTPSTSSTPSTPSTPSTPSAPGTPGTPSTPSTPSAP--GTPSTPSTPSTPSTPSTP 693

Query: 346 STPTTPSGGYYNSPPQDSSPPSDP 417
           STP+TPS     S P   S PS P
Sbjct: 694 STPSTPSMPSTPSTPSTPSTPSTP 717

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 63/147 (42%), Positives = 80/147 (54%), Gaps = 10/147 (6%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+ PS   + + TPS+P  P   S   TPS PS    S   S   TPS PS  G+   T
Sbjct: 608  TPSTPSTPSTPS-TPSTPSTPSTPSTPSTPSTPSTPSTSSTPSTPSTPSTPSAPGTPG-T 665

Query: 181  PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            PSTP  PS+  TP +  +P +  TP+TPSTP+TPS      P   S+P T  TP+TPSTP
Sbjct: 666  PSTPSTPSAPGTPSTPSTPSTPSTPSTPSTPSTPS-----MPSTPSTPSTPSTPSTPSTP 720

Query: 355  TTPSG-GYYNSPPQDSSP-----PSDP 417
            +TP   G   +P + S+P     PS P
Sbjct: 721  STPGTLGTPGTPNKPSTPITPGTPSTP 747

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 60/142 (42%), Positives = 75/142 (52%), Gaps = 5/142 (3%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           T   PS  G+   TP +P  P   S   TPS PS +      S   TPS PS       T
Sbjct: 84  THRKPSTPGTLG-TPGTPNTPSTPSTPSTPSTPSLTHTPSTPSTPSTPSTPSTPS----T 138

Query: 181 PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTP-SGGYYNSPPQDSSPPTDPTPTTPST 351
           PSTP  PS+  TP +  +P +  TP+TPSTP+TP + G  ++P   S+P T  TP+TPST
Sbjct: 139 PSTPSTPSTPSTPSTPSTPSTSSTPSTPSTPSTPGTPGTPSTPSTPSAPSTPSTPSTPST 198

Query: 352 PTTPSGGYYNSPPQDSSPPSDP 417
           P+TPS     S P   S PS P
Sbjct: 199 PSTPSTPSTPSTPSTPSTPSTP 220

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 61/145 (42%), Positives = 75/145 (51%), Gaps = 8/145 (5%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           T   PS  G+   TP +P  P   S   TPS PS +      S   TPS PS       T
Sbjct: 569 THRKPSTPGTLG-TPGTPNTPSTPSTPSTPSTPSLTHTPSTPSTPSTPSTPSTPS----T 623

Query: 181 PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSG----GYYNSPPQDSSPPTDPTPTT 342
           PSTP  PS+  TP +  +P +  TP+TPSTP+TPS     G  ++P   S+P T  TP+T
Sbjct: 624 PSTPSTPSTPSTPSTPSTPSTSSTPSTPSTPSTPSAPGTPGTPSTPSTPSAPGTPSTPST 683

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDP 417
           PSTP+TPS     S P   S PS P
Sbjct: 684 PSTPSTPSTPSTPSTPSMPSTPSTP 708

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 67/152 (44%), Positives = 77/152 (50%), Gaps = 15/152 (9%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG--SYN 174
            TP+ PS   + + TPS+P  PG  S   TPS PS        S   TPS PS     S  
Sbjct: 967  TPSTPSTPSTPS-TPSTPSTPGTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTP 1025

Query: 175  PTPSTP--PSSDCTP-----PSQDSPPSDP----TPTTPSTPTTPSGGYYNSPPQDSSPP 321
             TPSTP  PS   TP     PS  S PS P    TP TPSTP+TPS    ++P   S+P 
Sbjct: 1026 STPSTPSTPSMPSTPSMPNTPSTPSTPSTPSTLSTPITPSTPSTPSTP--STPSMPSTPS 1083

Query: 322  TDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
            T  TP+TPSTP TP+     S P   S PS P
Sbjct: 1084 TPSTPSTPSTPCTPNTPSTPSTPSMPSTPSTP 1115

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 63/148 (42%), Positives = 77/148 (52%), Gaps = 10/148 (6%)
 Frame = +1

Query: 7    TPTPPSGDG-SYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            TP+ PS    ++ P+  S P   S   TPS PS        S   TPS PS   S   TP
Sbjct: 593  TPSTPSTPSLTHTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPS-TSSTPSTP 651

Query: 184  STP--PSSDCTP--PSQDSPPSDP----TPTTPSTPTTPS-GGYYNSPPQDSSPPTDPTP 336
            STP  PS+  TP  PS  S PS P    TP+TPSTP+TPS     ++P   S+P T  TP
Sbjct: 652  STPSTPSAPGTPGTPSTPSTPSAPGTPSTPSTPSTPSTPSTPSTPSTPSMPSTPSTPSTP 711

Query: 337  TTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
            +TPSTP+TPS       P   + PS P+
Sbjct: 712  STPSTPSTPSTPGTLGTPGTPNKPSTPI 739

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 60/141 (42%), Positives = 72/141 (51%), Gaps = 4/141 (2%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+ PS   + + TPS+P  P   S   TPS PS        S   TPS PS       T
Sbjct: 1018 TPSTPSTPSTPS-TPSTPSMPSTPSMPNTPSTPSTPSTPSTLSTPITPSTPSTPS----T 1072

Query: 181  PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            PSTP  PS+  TP +  +P +  TP TPSTP+TPS          S+P T  TP+TPSTP
Sbjct: 1073 PSTPSMPSTPSTPSTPSTPSTPCTPNTPSTPSTPS--------MPSTPSTPSTPSTPSTP 1124

Query: 355  TTPSGGYYNSPPQDSSPPSDP 417
            +TPS     S P   S PS P
Sbjct: 1125 STPSAPSTPSTPSTPSTPSTP 1145

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 57/140 (40%), Positives = 72/140 (51%), Gaps = 5/140 (3%)
 Frame = +1

Query: 7    TPTPPSGDGSYN-PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG--SYNP 177
            TP+ PS   + + P+  S P   S   TPS PS        S   TPS PS     S   
Sbjct: 1024 TPSTPSTPSTPSMPSTPSMPNTPSTPSTPSTPSTLSTPITPSTPSTPSTPSTPSMPSTPS 1083

Query: 178  TPSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            TPSTP  PS+ CTP +  +P +   P+TPSTP+TPS     +P   S+P    TP+TPST
Sbjct: 1084 TPSTPSTPSTPCTPNTPSTPSTPSMPSTPSTPSTPS-----TPSTPSTPSAPSTPSTPST 1138

Query: 352  PTTPSGGYYNSPPQDSSPPS 411
            P+TPS     S P   + PS
Sbjct: 1139 PSTPSTPKTPSTPCTPNTPS 1158

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 59/143 (41%), Positives = 69/143 (48%), Gaps = 6/143 (4%)
 Frame = +1

Query: 7    TPTPPSGDG--SYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYN 174
            TP+ PS     S   TPS+P  PG      TPS PS  G     S   TPS PS      
Sbjct: 638  TPSTPSTSSTPSTPSTPSTPSAPGTPGTPSTPSTPSAPGTPSTPSTPSTPSTPS------ 691

Query: 175  PTPSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
             TPSTP  PS   TP +  +P +  TP+TPSTP     G   +P   + P T  TP TPS
Sbjct: 692  -TPSTPSTPSMPSTPSTPSTPSTPSTPSTPSTP-----GTLGTPGTPNKPSTPITPGTPS 745

Query: 349  TPTTPSGGYYNSPPQDSSPPSDP 417
            TP+TPS     S P   S P +P
Sbjct: 746  TPSTPSAPGTPSTPSTLSTPKEP 768

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 57/142 (40%), Positives = 76/142 (53%), Gaps = 4/142 (2%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+ PS   + + TPS+P  P   S   TPS PS        S   TPS PS   + + T
Sbjct: 925  TPSTPSTPSTPS-TPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPS-T 982

Query: 181  PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            PSTP  PS+  TP +  +P +  TP+TPSTP+TPS    ++P   S+P T  TP+ PSTP
Sbjct: 983  PSTPGTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTP--STPSTPSTPSTPSTPSMPSTP 1040

Query: 355  TTPSGGYYNSPPQDSSPPSDPL 420
            + P+     S P   S  S P+
Sbjct: 1041 SMPNTPSTPSTPSTPSTLSTPI 1062

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 58/140 (41%), Positives = 70/140 (50%), Gaps = 5/140 (3%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSP--PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+ PS   + + TPS+P  P   S   TPS PS            TPS PS  G+ + T
Sbjct: 623  TPSTPSTPSTPS-TPSTPSTPSTSSTPSTPSTPSTPSAPGTPGTPSTPSTPSAPGTPS-T 680

Query: 181  PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT-PTTPST 351
            PSTP  PS+  TP +  +P    TP+TPSTP+TPS     S P     P  P  P+TP T
Sbjct: 681  PSTPSTPSTPSTPSTPSTPSMPSTPSTPSTPSTPSTPSTPSTPGTLGTPGTPNKPSTPIT 740

Query: 352  PTTPSGGYYNSPPQDSSPPS 411
            P TPS     S P   S PS
Sbjct: 741  PGTPSTPSTPSAPGTPSTPS 760

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 63/133 (47%), Positives = 69/133 (51%), Gaps = 11/133 (8%)
 Frame = +1

Query: 52  SSPPGGGSYDPTPSPPSDSG--GSPPGSYDP-TPSPPSGDG--SYNPTPSTP--PSSDCT 210
           SS P   S   T   PS  G  G+P     P TPS PS     S   TPSTP  PS+  T
Sbjct: 558 SSIPCNPSTAATHRKPSTPGTLGTPGTPNTPSTPSTPSTPSTPSLTHTPSTPSTPSTPST 617

Query: 211 P--PSQDSPPSDP-TPTTPSTPTTPSGGYYNSPPQDSSPPTDP-TPTTPSTPTTPSGGYY 378
           P  PS  S PS P TP+TPSTP+TPS     S P   S P+ P TP TPSTP+TPS    
Sbjct: 618 PSTPSTPSTPSTPSTPSTPSTPSTPSTSSTPSTPSTPSTPSAPGTPGTPSTPSTPSAPGT 677

Query: 379 NSPPQDSSPPSDP 417
            S P   S PS P
Sbjct: 678 PSTPSTPSTPSTP 690

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 52/133 (39%), Positives = 67/133 (50%), Gaps = 4/133 (3%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP--T 180
            TP+ PS   +  P+  S P   S   TPS PS        S   TPS PS   + N   T
Sbjct: 1045 TPSTPSTPST--PSTLSTPITPSTPSTPSTPSTPSMPSTPSTPSTPSTPSTPCTPNTPST 1102

Query: 181  PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            PSTP  PS+  TP +  +P +  TP+ PSTP+TPS          S+P T  TP+TP TP
Sbjct: 1103 PSTPSMPSTPSTPSTPSTPSTPSTPSAPSTPSTPS--------TPSTPSTPKTPSTPCTP 1154

Query: 355  TTPSGGYYNSPPQ 393
             TPS    ++ P+
Sbjct: 1155 NTPSTNRKSTIPK 1167

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 54/134 (40%), Positives = 69/134 (51%), Gaps = 4/134 (2%)
 Frame = +1

Query: 7    TPTPPSGDGSYNP--TPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+ PS  G+     TPS+P   G+   TPS PS        S   TPS PS   + + T
Sbjct: 653  TPSTPSAPGTPGTPSTPSTPSAPGT-PSTPSTPSTPSTPSTPSTPSTPSMPSTPSTPS-T 710

Query: 181  PSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            PSTP  PS+  TP +  +P +   P+TP TP TPS     +P   S+P T  TP+T STP
Sbjct: 711  PSTPSTPSTPSTPGTLGTPGTPNKPSTPITPGTPS-----TPSTPSAPGTPSTPSTLSTP 765

Query: 355  TTPSGGYYNSPPQD 396
              P    +N  PQD
Sbjct: 766  KEP----FNCNPQD 775

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 34/79 (43%), Positives = 41/79 (51%), Gaps = 8/79 (10%)
 Frame = +1

Query: 205 CTPPSQDSPPSDP----TPTTPSTPTTPSGGYYNSPPQ----DSSPPTDPTPTTPSTPTT 360
           C+  +    PS P    TP TP+TP+TPS     S P      S+P T  TP+TPSTP+T
Sbjct: 79  CSTAATHRKPSTPGTLGTPGTPNTPSTPSTPSTPSTPSLTHTPSTPSTPSTPSTPSTPST 138

Query: 361 PSGGYYNSPPQDSSPPSDP 417
           PS     S P   S PS P
Sbjct: 139 PSTPSTPSTPSTPSTPSTP 157

[19][TOP]
>UniRef100_B9Q1D7 Chloride channel, putative n=1 Tax=Toxoplasma gondii GT1
           RepID=B9Q1D7_TOXGO
          Length = 1756

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 58/147 (39%), Positives = 75/147 (51%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4   PTPTPPSGDG----SYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P  +PPS       S +P+PSSPP      P+ +P S +  SP     P PS P    S 
Sbjct: 225 PPSSPPSPSSAPSSSTSPSPSSPPSSSPPSPSSAPSSSTSPSPSS---PPPSSPPSSSST 281

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDP---TPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
           +P+PS+ PSS  +PPS   PPS P   + T+PS  + PS    +S P  SSPP   +P  
Sbjct: 282 SPSPSSAPSS--SPPSPSPPPSSPPSSSSTSPSPSSAPSSSPPSSSPSSSSPPPSSSPPP 339

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PS P+       +SPP  SSP S P P
Sbjct: 340 PSPPS-------SSPPSSSSPSSSPSP 359

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 56/140 (40%), Positives = 73/140 (52%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+  P S   S +P+ SSPP   S  P PS P     +P  S  P+PS P    S  P+P
Sbjct: 200 PSSPPSSSPPSSSPSSSSPPPSSS--PPPSSPPSPSSAPSSSTSPSPSSPPS--SSPPSP 255

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S+ PSS  +P     PPS P P++ ST  +PS    +SPP  S PP+ P P++ ST  +P
Sbjct: 256 SSAPSSSTSPSPSSPPPSSP-PSSSSTSPSPSSAPSSSPPSPSPPPSSP-PSSSSTSPSP 313

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           S    +SPP  S   S P P
Sbjct: 314 SSAPSSSPPSSSPSSSSPPP 333

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 55/139 (39%), Positives = 72/139 (51%), Gaps = 1/139 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P  +PPS   S   +PSS P   S   +PSP S    SPP S   + SPP    S +P P
Sbjct: 176 PFLSPPSSSSS---SPSSSP---STSTSPSPSSPPSSSPPSSSPSSSSPPP---SSSPPP 226

Query: 184 STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           S+PPS    P S  SP PS P  ++P +P++      ++ P  SSPP    P++ ST  +
Sbjct: 227 SSPPSPSSAPSSSTSPSPSSPPSSSPPSPSSAPSS--STSPSPSSPPPSSPPSSSSTSPS 284

Query: 361 PSGGYYNSPPQDSSPPSDP 417
           PS    +SPP  S PPS P
Sbjct: 285 PSSAPSSSPPSPSPPPSSP 303

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 48/121 (39%), Positives = 63/121 (52%), Gaps = 9/121 (7%)
 Frame = +1

Query: 4   PTPTPPSGDG----SYNPTPSSPPGGG---SYDPTPSPPSDSGGSPPGSYDPTPSPPSGD 162
           P+ +PPS       S +P+PSSPP      S   +PSP S    SPP    P  SPPS  
Sbjct: 248 PSSSPPSPSSAPSSSTSPSPSSPPPSSPPSSSSTSPSPSSAPSSSPPSPSPPPSSPPSSS 307

Query: 163 GSYNPTPSTPPSSD--CTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
            S +P+PS+ PSS    + PS  SPP   +P  PS P+       +SPP  SSP + P+P
Sbjct: 308 -STSPSPSSAPSSSPPSSSPSSSSPPPSSSPPPPSPPS-------SSPPSSSSPSSSPSP 359

Query: 337 T 339
           +
Sbjct: 360 S 360

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 49/137 (35%), Positives = 63/137 (45%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PPS   S    PSSPP        P PPS    S   S    PSP S     + +PS 
Sbjct: 591 PVPPSSP-SMPLLPSSPPS------VPVPPSSPSPSSSLSAPVPPSPSSSSSHSSSSPSV 643

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
            P     PP     PS P+P++ S+P+ P       P   SSPP  P+P++PS P++PS 
Sbjct: 644 LP----LPPHV---PSSPSPSSASSPSMPL------PTLSSSPPPSPSPSSPS-PSSPSV 689

Query: 370 GYYNSPPQDSSPPSDPL 420
              +S P     PS P+
Sbjct: 690 PLSSSSPSVPPSPSSPV 706

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 49/161 (30%), Positives = 71/161 (44%), Gaps = 26/161 (16%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS------PPSDSGGS---PPGSYDPTPSPPS 156
           P+  P S   S +P PSSPP   S  P+PS      PPS S  S   PP S  P PSPPS
Sbjct: 285 PSSAPSSSPPSPSPPPSSPPSSSSTSPSPSSAPSSSPPSSSPSSSSPPPSSSPPPPSPPS 344

Query: 157 GD--GSYNPTPSTPPSSDCTPPSQ-----------DSPPSDPT--PTTPSTPTTPSGGYY 291
                S +P+ S  PS+D +  +Q           +S   D T  P   ++  +P+ G  
Sbjct: 345 SSPPSSSSPSSSPSPSADLSERAQGPANEAPEKRNESAEVDKTSHPRENASNGSPASGRL 404

Query: 292 NSPPQDSSPPTD--PTPTTPSTPTTPSGGYYNSPPQDSSPP 408
           +   ++++  +      ++PS   T       +P   SSPP
Sbjct: 405 SGSEKEATQNSSDLDKASSPSLAATTKDRERTAPVVSSSPP 445

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 44/123 (35%), Positives = 59/123 (47%), Gaps = 11/123 (8%)
 Frame = +1

Query: 88  PSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTP--PSSDCTPPSQDSPPSDPTPTT-- 255
           P  PS S   P   Y  +PS P    S    PS P  PSS   PPS   PPS P+P++  
Sbjct: 570 PKQPSFSPVHPSSPYSSSPSVPVPPSS----PSMPLLPSS---PPSVPVPPSSPSPSSSL 622

Query: 256 ----PSTPTTPSGGYYNSP---PQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
               P +P++ S    +SP   P     P+ P+P++ S+P+ P     +SPP   S PS 
Sbjct: 623 SAPVPPSPSSSSSHSSSSPSVLPLPPHVPSSPSPSSASSPSMPLPTLSSSPPPSPS-PSS 681

Query: 415 PLP 423
           P P
Sbjct: 682 PSP 684

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 2/94 (2%)
 Frame = +1

Query: 136 PTPSP-PSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGG-YYNSPPQD 309
           PT  P    D    P  S P SS  +P S  S  + P+P++P + + PS     +SPP  
Sbjct: 162 PTSEPFVHADLKMRPFLSPPSSSSSSPSSSPSTSTSPSPSSPPSSSPPSSSPSSSSPPPS 221

Query: 310 SSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           SSPP    P+  S P++ +    +SPP  SSPPS
Sbjct: 222 SSPPPSSPPSPSSAPSSSTSPSPSSPPS-SSPPS 254

[20][TOP]
>UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK6_CHLRE
          Length = 738

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 55/140 (39%), Positives = 60/140 (42%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P+P PPS      P P
Sbjct: 203 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP 253

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PP  P    P  P  P      SPP  S PP  P P +P  P+ P
Sbjct: 254 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 313

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PPS P P
Sbjct: 314 PPPPPRPPPPSPPPPSPPPP 333

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 54/140 (38%), Positives = 60/140 (42%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P+P PPS      P P
Sbjct: 198 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP 248

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   P     PP  P P  P +P  P       PP  S PP  P P +P  P+ P
Sbjct: 249 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPP 308

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PPS P P
Sbjct: 309 PPSPPPPPPPRPPPPSPPPP 328

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 54/140 (38%), Positives = 60/140 (42%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P PSPP      +P P
Sbjct: 213 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPP 262

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PPS    PP    PP  P P  P  P+ P      SPP  S PP  P P +P  P  P
Sbjct: 263 PPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPP----PSPPPPSPPPPSPPPPSPPPPPPP 318

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                + PP    PP  P P
Sbjct: 319 RPPPPSPPPPSPPPPPPPSP 338

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 58/142 (40%), Positives = 64/142 (45%), Gaps = 1/142 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P P PPS      P P
Sbjct: 223 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS------PPP 270

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS-TPTT 360
             PPS    PP +  PP  P+P  PS P  PS    + PP    PP  P P  PS  P +
Sbjct: 271 PPPPSPPPPPPPRPPPPPPPSPPPPS-PPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPS 329

Query: 361 PSGGYYNSPPQDSSPPSDPLPR 426
           P      SPP   SPP  P PR
Sbjct: 330 PPPPPPPSPPPPPSPPPPPPPR 351

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 54/141 (38%), Positives = 59/141 (41%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P P  PP      P+P PPS    SPP    P P PP       P P
Sbjct: 269 PPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPP 328

Query: 184 STPPSSDCTPPSQDSPPSDPTP-TTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           S PP    +PP   SPP  P P   P +P  PS    + PP    PP  P+P  P  P  
Sbjct: 329 SPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRP 388

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P      SPP  S PP  P P
Sbjct: 389 PP----PSPPPPSPPPPSPPP 405

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 59/141 (41%), Positives = 61/141 (43%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPG-SYDPTPSPPSGDGSYNPT 180
           P+P PPS      P PS PP      P PSPP  S   PP  S  P PSPP       P 
Sbjct: 295 PSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPP 354

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           PS PP S   PP    PPS P P  PS P  P       PP  S PP  P P +P  P  
Sbjct: 355 PSPPPPSP--PPPSPPPPSPPPPPPPSPPPPPPP----RPPPPSPPPPSPPPPSPPPPPP 408

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           PS      PP    PPS P P
Sbjct: 409 PSPP--PPPPPRPPPPSPPPP 427

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 54/141 (38%), Positives = 60/141 (42%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P P SPP      P+P PPS     PP    P+P PPS      P+P
Sbjct: 285 PPPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSP 338

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PPS    PP +  PPS P P +P  P+ P       PP    PP  P P  PS P   
Sbjct: 339 PPPPSPPPPPPPRPPPPS-PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPS 397

Query: 364 SGGYYNSPPQDSSPPSDPLPR 426
                  PP   SPP  P PR
Sbjct: 398 PPPPSPPPPPPPSPPPPPPPR 418

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 55/140 (39%), Positives = 61/140 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    SPP    P+P PPS      P P
Sbjct: 188 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP 238

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PP  P P +P  P  PS      P     PP  P P  P +P  P
Sbjct: 239 SPPPPS---PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPP 295

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           S    + PP    PPS P P
Sbjct: 296 SPPPPSPPPPSPPPPSPPPP 315

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/141 (37%), Positives = 58/141 (41%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P PSPP     SPP    P P PP      +P P
Sbjct: 238 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPP---SPPP 294

Query: 184 STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            +PP     PPS   P P  P P  P  P+ P       PP    PP  P P  P  P  
Sbjct: 295 PSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPP 354

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           PS    + PP    PPS P P
Sbjct: 355 PSPPPPSPPPPSPPPPSPPPP 375

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/140 (37%), Positives = 58/140 (41%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP       P PS PP      P PSPP      PP    P+P PPS      P P
Sbjct: 251 PPPSPPPPSPPPPPPPSPPP-----PPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPP 305

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PP  P P +P  P  PS      PP  S PP  P    P +P  P
Sbjct: 306 SPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPS-----PPPPPSPPPPPPPRPPPPSPPPP 360

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           S    + PP    PP  P P
Sbjct: 361 SPPPPSPPPPSPPPPPPPSP 380

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/140 (39%), Positives = 59/140 (42%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS PP      P PSPP  S   PP    P P PPS      P P
Sbjct: 228 PSPPPPSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRP 284

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PPS   PP  P P +P  P+ P       PP    PP+ P P  PS P  P
Sbjct: 285 PPPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPP 342

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           S      PP    PPS P P
Sbjct: 343 SPP--PPPPPRPPPPSPPPP 360

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 54/140 (38%), Positives = 57/140 (40%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP       P PS PP      P PSPP     SPP    P P PPS      P P
Sbjct: 308 PPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPP--SPPPPPPPRPPPPSPPPPSPPPP 365

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP    PP  P    P +P  PS      PP    PP  P+P  P  P  P
Sbjct: 366 SPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPS-----PPPPSPPPPPPPSPPPPPPPRPP 420

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PP  P P
Sbjct: 421 P----PSPPPPSPPPPSPPP 436

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 56/141 (39%), Positives = 58/141 (41%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P PS PP      P P PPS    SPP    P PSPP       P P
Sbjct: 261 PPPPPPSPPPP--PPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 318

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP S   PPS   PP    P  PS P  P       PP  S PP  P P +P  P+ P
Sbjct: 319 RPPPPSP-PPPSPPPPPPPSPPPPPSPPPPPP----PRPPPPSPPPPSPPPPSPPPPSPP 373

Query: 364 SGGYYNSPPQDSSPPSDPLPR 426
                  PP   SPP  P PR
Sbjct: 374 -------PPPPPSPPPPPPPR 387

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 46/123 (37%), Positives = 52/123 (42%), Gaps = 2/123 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P+P  PP      P P PP     SPP    P PSPP       P P
Sbjct: 323 PSPPPPSPPPPPPPSPPPPPS----PPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPP 378

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSP--PQDSSPPTDPTPTTPSTPT 357
           S PP     PP    PP  P P +P  P  PS      P  P  S PP  P P +P  P+
Sbjct: 379 SPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPS 438

Query: 358 TPS 366
            P+
Sbjct: 439 PPA 441

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 47/115 (40%), Positives = 51/115 (44%)
 Frame = +1

Query: 82  PTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS 261
           P+P PPS    SPP    P PSPP         PS PP S   PP    PP  P P +P 
Sbjct: 188 PSPPPPSPPPPSPPPPSPPPPSPPP--------PSPPPPS---PPPPSPPPPSPPPPSPP 236

Query: 262 TPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
            P+ P      SPP  S PP  P P +P  P  PS      PP   SPP  P PR
Sbjct: 237 PPSPPPP----SPPPPSPPPPSPPPPSPPPPPPPSP----PPPPPPSPPPPPPPR 283

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 30/75 (40%), Positives = 35/75 (46%)
 Frame = +1

Query: 199 SDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYY 378
           +DC P SQ + PS P P+ P     P      SPP  S PP  P P +P  P+ P     
Sbjct: 177 NDCCPLSQANVPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---- 232

Query: 379 NSPPQDSSPPSDPLP 423
            SPP  S PP  P P
Sbjct: 233 PSPPPPSPPPPSPPP 247

[21][TOP]
>UniRef100_A4F808 Putative uncharacterized protein n=1 Tax=Saccharopolyspora
           erythraea NRRL 2338 RepID=A4F808_SACEN
          Length = 504

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/142 (39%), Positives = 66/142 (46%), Gaps = 6/142 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGG----GSYDPTPSPPSDSGGSPPGSYDPTPS--PPSGDG 165
           PTPT    +G+  P PSS P      GS  P  SPP  S   PP S  P  S  PP G  
Sbjct: 302 PTPTAHPPNGTPPPAPSSTPPSSNPPGSTPPGSSPPPGSSQPPPESSKPPESTTPPPGSS 361

Query: 166 SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
              P  STPP S   PP   +PP D T   P + T P       PP  S+PP D T   P
Sbjct: 362 QPPPESSTPPESTTPPPDSSTPPPDSTTPPPESSTPPES--TTPPPDSSTPPPDSTTPPP 419

Query: 346 STPTTPSGGYYNSPPQDSSPPS 411
            + T P G   ++PP++  PPS
Sbjct: 420 DSSTPPPGS--STPPEEPGPPS 439

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 59/153 (38%), Positives = 70/153 (45%), Gaps = 13/153 (8%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           P P P  G    +PTP++ P  G+  P PS  PPS +   PPGS  P  SPP G     P
Sbjct: 292 PAPAPAPGP---SPTPTAHPPNGTPPPAPSSTPPSSN---PPGSTPPGSSPPPGSSQPPP 345

Query: 178 TPSTPPSSDCTPP--SQDSPPSDPTPTTPSTP----TTPSGGYYNSPPQDSSPPTDPTP- 336
             S PP    TPP  S   PP   TP   +TP    +TP       PP+ S+PP   TP 
Sbjct: 346 ESSKPPE-STTPPPGSSQPPPESSTPPESTTPPPDSSTPPPDSTTPPPESSTPPESTTPP 404

Query: 337 ----TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
               T P   TTP       PP  S+PP +P P
Sbjct: 405 PDSSTPPPDSTTPPPDSSTPPPGSSTPPEEPGP 437

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 48/126 (38%), Positives = 61/126 (48%), Gaps = 1/126 (0%)
 Frame = +1

Query: 49  PSSPPGGGSYDPTPSP-PSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQD 225
           P +PP  G+  P P+P PS +  + P +  P P+P S   S NP  STPP S   PP   
Sbjct: 283 PQTPPPAGAPAPAPAPGPSPTPTAHPPNGTPPPAPSSTPPSSNPPGSTPPGSS-PPPGSS 341

Query: 226 SPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSP 405
            PP  P  + P   TTP  G    PP+ S+PP   TP  P   +TP       PP+ S+P
Sbjct: 342 QPP--PESSKPPESTTPPPGSSQPPPESSTPPESTTP--PPDSSTPPPDSTTPPPESSTP 397

Query: 406 PSDPLP 423
           P    P
Sbjct: 398 PESTTP 403

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 52/152 (34%), Positives = 67/152 (44%), Gaps = 12/152 (7%)
 Frame = +1

Query: 4   PTPTPPSGD--GSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP---------SP 150
           P+ TPPS +  GS  P  S PPG     P  S P +S   PPGS  P P         +P
Sbjct: 317 PSSTPPSSNPPGSTPPGSSPPPGSSQPPPESSKPPESTTPPPGSSQPPPESSTPPESTTP 376

Query: 151 PSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP 330
           P    +  P  +TPP    TPP   +PP D + T P   TTP       PP  S+PP +P
Sbjct: 377 PPDSSTPPPDSTTPPPESSTPPESTTPPPD-SSTPPPDSTTPPPDSSTPPPGSSTPPEEP 435

Query: 331 -TPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             P++   P   +G +     QD     + LP
Sbjct: 436 GPPSSCQVPVLHNGEFVTE--QDRPTAGNDLP 465

[22][TOP]
>UniRef100_Q2TXY4 Predicted protein n=1 Tax=Aspergillus oryzae RepID=Q2TXY4_ASPOR
          Length = 474

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 65/149 (43%), Positives = 76/149 (51%), Gaps = 12/149 (8%)
 Frame = +1

Query: 13  TPPSGD---GSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS-PPSGDGSYNPT 180
           TPP G    G   PT  +PP GG+  PT   P   G  P G   PT   PP+GD    PT
Sbjct: 151 TPPGGTPPTGGTPPTGGTPPTGGT-PPTGGTPPTGGTPPSGGMPPTGGMPPTGD--VPPT 207

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTT----PSGGYYNSPPQDSSPPTDPTPTTPS 348
             TPP+    PPS  +PP+  TP T STP T    PSGG   +PP   +PPT  TP T  
Sbjct: 208 GGTPPTGSI-PPSGSNPPTGGTPPTGSTPPTGSTPPSGG---TPPSGGTPPTGGTPPTGG 263

Query: 349 TP----TTPSGGYYNSPPQDSSPPSDPLP 423
           TP    T P+GG   +PP  S+PPS   P
Sbjct: 264 TPPTGGTPPTGG---TPPTGSTPPSGGNP 289

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 68/162 (41%), Positives = 82/162 (50%), Gaps = 25/162 (15%)
 Frame = +1

Query: 13  TPPSGD----GSYNPTPSSPPGGGSYDPTPSPPSDS----GGSPP-GSYDPTPS-PPSG- 159
           TPPSG     G   PT   PP GG+      PPS S    GG+PP GS  PT S PPSG 
Sbjct: 186 TPPSGGMPPTGGMPPTGDVPPTGGTPPTGSIPPSGSNPPTGGTPPTGSTPPTGSTPPSGG 245

Query: 160 ---DGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGG---YYNSPPQDSSPP 321
               G   PT  TPP+   TPP+  +PP+  TP T STP  PSGG      +PP   +PP
Sbjct: 246 TPPSGGTPPTGGTPPTGG-TPPTGGTPPTGGTPPTGSTP--PSGGNPPIGGTPPSGGTPP 302

Query: 322 TDPTPTTPSTPT--------TPSGGYYNSPPQDSSPPSDPLP 423
           T  TP T S  +        TP+GG   +PP   +PP+  +P
Sbjct: 303 TSGTPPTGSNTSCEEDDDTCTPTGG---TPPTSGTPPTGGMP 341

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 57/134 (42%), Positives = 69/134 (51%), Gaps = 1/134 (0%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP-GSYDPTPSPPSGDGSYNPTPST 189
           TPP+G  S  PT S+PP GG+     +PP+  GG+PP G   PT   P   G+  PT ST
Sbjct: 228 TPPTG--STPPTGSTPPSGGTPPSGGTPPT--GGTPPTGGTPPTGGTPPTGGT-PPTGST 282

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           PPS    PP   +PPS  TP T  TP T S         D+  PT  TP T  TP  P+G
Sbjct: 283 PPSGG-NPPIGGTPPSGGTPPTSGTPPTGSNTSCEE-DDDTCTPTGGTPPTSGTP--PTG 338

Query: 370 GYYNSPPQDSSPPS 411
           G    PP   +PP+
Sbjct: 339 G---MPPTGGTPPT 349

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 58/155 (37%), Positives = 71/155 (45%), Gaps = 23/155 (14%)
 Frame = +1

Query: 13  TPPSGD----GSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDP----TPSPPSGDGS 168
           TPP+G     G   PT S+PP GG+     +PPS  GG+PP S  P      S    D +
Sbjct: 264 TPPTGGTPPTGGTPPTGSTPPSGGNPPIGGTPPS--GGTPPTSGTPPTGSNTSCEEDDDT 321

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS-----------TPTT----PSGGYYNSPP 303
             PT  TPP+S  TPP+   PP+  TP T +           TPTT    P+GG    PP
Sbjct: 322 CTPTGGTPPTSG-TPPTGGMPPTGGTPPTGTNTACEEGDDSCTPTTGGTPPTGG---MPP 377

Query: 304 QDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPP 408
               PPT  TP +  TP T        PP   +PP
Sbjct: 378 TGGMPPTSGTPPSGGTPPTGGNPPTGMPPTSGTPP 412

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 49/117 (41%), Positives = 61/117 (52%), Gaps = 11/117 (9%)
 Frame = +1

Query: 106 SGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTT---- 273
           +GG+PPG   PT   P   G+  PT  TPP+   TPP+  +PPS   P T   P T    
Sbjct: 148 NGGTPPGGTPPTGGTPPTGGT-PPTGGTPPTGG-TPPTGGTPPSGGMPPTGGMPPTGDVP 205

Query: 274 PSGG---YYNSPPQDSSPPTDPTPTTPSTP----TTPSGGYYNSPPQDSSPPSDPLP 423
           P+GG     + PP  S+PPT  TP T STP    T PSGG   +PP   +PP+   P
Sbjct: 206 PTGGTPPTGSIPPSGSNPPTGGTPPTGSTPPTGSTPPSGG---TPPSGGTPPTGGTP 259

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 47/151 (31%), Positives = 55/151 (36%), Gaps = 18/151 (11%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYD---------PTPSPPSDSGGSPPGSYDPTPSPP---- 153
           TPPSG     PT  +PP G +           PT   P  SG  P G   PT   P    
Sbjct: 294 TPPSGGTP--PTSGTPPTGSNTSCEEDDDTCTPTGGTPPTSGTPPTGGMPPTGGTPPTGT 351

Query: 154 -----SGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP 318
                 GD S  PT    P +   PP+   PP+  TP +  TP T        PP   +P
Sbjct: 352 NTACEEGDDSCTPTTGGTPPTGGMPPTGGMPPTSGTPPSGGTPPTGGNPPTGMPPTSGTP 411

Query: 319 PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           P      T     T SG   +S    SS  S
Sbjct: 412 PDGNNTGTNKGGNTSSGSSGSSSSSSSSSSS 442

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 48/169 (28%), Positives = 70/169 (41%), Gaps = 35/169 (20%)
 Frame = +1

Query: 13  TPPSG--------DGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP---------GSYDPT 141
           TPP+G        D +  PT  +PP  G+      PP+  GG+PP         G    T
Sbjct: 306 TPPTGSNTSCEEDDDTCTPTGGTPPTSGTPPTGGMPPT--GGTPPTGTNTACEEGDDSCT 363

Query: 142 PS----PPSGD----GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPT--------- 270
           P+    PP+G     G   PT  TPPS   TPP+  +PP+   PT+ + P          
Sbjct: 364 PTTGGTPPTGGMPPTGGMPPTSGTPPSGG-TPPTGGNPPTGMPPTSGTPPDGNNTGTNKG 422

Query: 271 -TPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
              S G   S    SS  +  + ++ S+ ++ +GG        + PP D
Sbjct: 423 GNTSSGSSGSSSSSSSSSSSSSSSSSSSSSSTTGGTPGCAECQAPPPED 471

[23][TOP]
>UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2U1_EHV86
          Length = 2873

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 52/125 (41%), Positives = 58/125 (46%)
 Frame = +1

Query: 49   PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDS 228
            P SPP   S  P+P PPS     PP    P+P PPS      P PS PPS    PP    
Sbjct: 2667 PPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPS----PPPPSP 2722

Query: 229  PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPP 408
            PP  P P +P  P+ P      SPP  S PP  P P +P  P  P+     SPP  S PP
Sbjct: 2723 PPPSPPPPSPPPPSPPP----PSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPP 2778

Query: 409  SDPLP 423
            S P P
Sbjct: 2779 SPPPP 2783

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 47/119 (39%), Positives = 55/119 (46%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS   S  P+P  P       P PSPP  S   PP    P+P PPS      P P
Sbjct: 2678 PSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPS--PPPSPPPPSPPPPSPPPPSPPPP 2735

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            S PP S   PP    PP  P P +P  P  P+     SPP  S PP+ P P+ P   +T
Sbjct: 2736 SPPPPS---PPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPPDRTST 2791

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 38/93 (40%), Positives = 44/93 (47%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P+PP      +P P SPP      P+P PPS    SPP    P+P PPS      P P
Sbjct: 2709 PPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP---PPSPPPPSPPPPLPPAP 2765

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSG 282
            S PPS     P   SPP  P P +P   T+ SG
Sbjct: 2766 SPPPS-----PPPPSPPPSPPPPSPPDRTSTSG 2793

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 34/102 (33%), Positives = 41/102 (40%)
 Frame = +1

Query: 118  PPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
            PP +++   +  SG     P    PP S    P   SPP  P P+ P     P      S
Sbjct: 2648 PPEAFESNVNYISGQTCIKPPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPS 2707

Query: 298  PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            PP  S PP+ P P+ P     P      SPP  S PP  P P
Sbjct: 2708 PPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2749

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 37/94 (39%), Positives = 42/94 (44%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SPP      P+P PPS    SPP    P PSPP       P P
Sbjct: 2725 PSPPPPS------PPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSP----PPP 2774

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGG 285
            S PPS    PP    P    T  T +T  + +GG
Sbjct: 2775 SPPPS----PPPPSPPDRTSTSGTKATIGSIAGG 2804

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 32/85 (37%), Positives = 39/85 (45%)
 Frame = +1

Query: 82   PTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS 261
            P PSPP      PP  + P+P PPS      P P +PP     PP+    P  P PT P 
Sbjct: 2253 PPPSPP------PPSPHPPSPPPPS------PPPPSPP-----PPTPPPSPPPPPPTPPP 2295

Query: 262  TPTTPSGGYYNSPPQDSSPPTDPTP 336
            +P  PS    + PP    PP+ P P
Sbjct: 2296 SPPPPSPPPPSPPPPSPPPPSQPPP 2320

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 36/94 (38%), Positives = 41/94 (43%)
 Frame = +1

Query: 40   NPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPS 219
            +P PS PP      P+P PPS    SPP    P P+PP       P+P  PP    TPP 
Sbjct: 2252 SPPPSPPP------PSPHPPSPPPPSPPPPSPPPPTPP-------PSPPPPPP---TPPP 2295

Query: 220  QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP 321
               PPS P P+ P            SPP  S PP
Sbjct: 2296 SPPPPSPPPPSPPPP----------SPPPPSQPP 2319

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 33/79 (41%), Positives = 37/79 (46%)
 Frame = +1

Query: 40   NPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPS 219
            N  P SPP    + P+P PPS    SPP    PTP P     S  P P TPP S   PP 
Sbjct: 2251 NSPPPSPPPPSPHPPSPPPPSPPPPSPP---PPTPPP-----SPPPPPPTPPPS---PPP 2299

Query: 220  QDSPPSDPTPTTPSTPTTP 276
               PP  P P +P  P+ P
Sbjct: 2300 PSPPPPSPPPPSPPPPSQP 2318

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 35/83 (42%), Positives = 40/83 (48%)
 Frame = +1

Query: 115  SPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYN 294
            SPP    P+P PPS      P P +PP     PPS   PPS P PT P +P  P      
Sbjct: 2252 SPP----PSPPPPS------PHPPSPP-----PPSPP-PPSPPPPTPPPSPPPPPPTPPP 2295

Query: 295  SPPQDSSPPTDPTPTTPSTPTTP 363
            SPP  S PP  P P +P  P+ P
Sbjct: 2296 SPPPPSPPPPSPPPPSPPPPSQP 2318

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 35/89 (39%), Positives = 41/89 (46%), Gaps = 1/89 (1%)
 Frame = +1

Query: 154  SGDGSYNPTPSTPPSSD-CTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP 330
            SG G   P   T  SSD C+PPS   PP  P P+ P +P  P       PP    PP+ P
Sbjct: 2509 SGCGYNTPYEHTMISSDPCSPPSP--PPPSPPPSPPPSPPPPL-----PPPPSPPPPSPP 2561

Query: 331  TPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
             P+ P +P  PS      PP    PPS P
Sbjct: 2562 PPSPPPSPPPPS------PPPSPPPPSPP 2584

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 33/82 (40%), Positives = 36/82 (43%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P PS PP      P+P PP+     PP    P PSPP         P
Sbjct: 2255 PSPPPPSPHPPSPPPPSPPP------PSPPPPTPPPSPPPPPPTPPPSPPP--------P 2300

Query: 184  STPPSSDCTPPSQDSPPSDPTP 249
            S PP S   PP    PPS P P
Sbjct: 2301 SPPPPSP--PPPSPPPPSQPPP 2320

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 35/85 (41%), Positives = 41/85 (48%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P+PP      +P P SPP      P+P PPS    +PP S  P P PP+      P P
Sbjct: 2253 PPPSPPPP----SPHPPSPP-----PPSPPPPSPPPPTPPPS--PPPPPPT------PPP 2295

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTP 258
            S PP S   PP    PPS P P+ P
Sbjct: 2296 SPPPPS--PPPPSPPPPSPPPPSQP 2318

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 32/79 (40%), Positives = 38/79 (48%)
 Frame = +1

Query: 172  NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            +P PS PP S   PPS   PP  P P +P  PT P     + PP   +PP  P P +P  
Sbjct: 2252 SPPPSPPPPSP-HPPSP--PPPSPPPPSPPPPTPPP----SPPPPPPTPPPSPPPPSPPP 2304

Query: 352  PTTPSGGYYNSPPQDSSPP 408
            P+ P      SPP  S PP
Sbjct: 2305 PSPPP----PSPPPPSQPP 2319

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 32/73 (43%), Positives = 33/73 (45%)
 Frame = +1

Query: 49   PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDS 228
            P SPP      P PSPP     SPP    P PSPP       P PS PPS    PP    
Sbjct: 2526 PCSPPS----PPPPSPPPSPPPSPPPPLPPPPSPPPPSP---PPPSPPPS----PPPPSP 2574

Query: 229  PPSDPTPTTPSTP 267
            PPS P P+ P  P
Sbjct: 2575 PPSPPPPSPPPYP 2587

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 32/76 (42%), Positives = 37/76 (48%)
 Frame = +1

Query: 127  SYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQ 306
            S DP  SPPS      P PS PPS   +PP    PP  P P +P  P+ P      SPP 
Sbjct: 2523 SSDPC-SPPSP-----PPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPP-----SPPP 2571

Query: 307  DSSPPTDPTPTTPSTP 354
             S PP+ P P+ P  P
Sbjct: 2572 PSPPPSPPPPSPPPYP 2587

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 35/77 (45%), Positives = 38/77 (49%)
 Frame = +1

Query: 73   SYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPT 252
            S DP  SPPS    SPP S  P+P PP       P PS PP S   PP    PPS P P+
Sbjct: 2523 SSDPC-SPPSPPPPSPPPSPPPSPPPP-----LPPPPSPPPPS---PPPPSPPPSPPPPS 2573

Query: 253  TPSTPTTPSGGYYNSPP 303
             P +P  PS   Y  PP
Sbjct: 2574 PPPSPPPPSPPPY--PP 2588

[24][TOP]
>UniRef100_Q4A2S6 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S6_EHV86
          Length = 430

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 58/147 (39%), Positives = 68/147 (46%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGS------YNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG 165
           PTP PPS          ++P PS PP    Y P PSPP      PP  Y P+  PP    
Sbjct: 155 PTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPP---- 210

Query: 166 SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT-T 342
            ++P PS PP S   PPS  S P  P P  P  P++P      S P  + PPT P P+  
Sbjct: 211 -FSPPPSPPPFS--PPPSPPSQPPQPPPVLP--PSSPPPSPVPSAPPSAPPPTQPPPSPV 265

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PSTP +P      SPP    PP  P P
Sbjct: 266 PSTPPSPQP---VSPPPSPEPPLQPPP 289

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/141 (38%), Positives = 66/141 (46%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS-PPGSYDPTPSPPSGDGSYNPT 180
           P P+PP     + P PS PP      PTP PPS S    PP  + P PSPP     Y P 
Sbjct: 130 PVPSPPPPPSPFAPEPSPPPPMPP-PPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPP 188

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           PS PP     PP+Q  PP  P+   P +P  PS   ++ PP   S P  P P  P  P++
Sbjct: 189 PSPPPH----PPNQPPPPYPPSQPPPFSPP-PSPPPFSPPPSPPSQPPQPPPVLP--PSS 241

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P      S P  + PP+ P P
Sbjct: 242 PPPSPVPSAPPSAPPPTQPPP 262

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 57/144 (39%), Positives = 62/144 (43%), Gaps = 7/144 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG-SPPGS---YDPTPSPPSGDGSY 171
           P P+PP     Y P PS PP   +  P P PPS     SPP S   + P PSPPS     
Sbjct: 174 PDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPPQ- 232

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTP---STPTTPSGGYYNSPPQDSSPPTDPTPTT 342
            P P  PPSS    P   +PPS P PT P     P+TP      SPP    PP  P P  
Sbjct: 233 -PPPVLPPSSPPPSPVPSAPPSAPPPTQPPPSPVPSTPPSPQPVSPPPSPEPPLQPPPNV 291

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSD 414
           P     P G    SPP   S   D
Sbjct: 292 PYPYAPPPG----SPPTSPSVEED 311

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 56/148 (37%), Positives = 66/148 (44%), Gaps = 8/148 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDP----TPSPPSGDGSY 171
           P+P PPS        PS PP   +  P+P PP+    SPP    P    +PSPPS     
Sbjct: 54  PSPPPPS-------PPSLPPWWPNVSPSPPPPTTPSPSPPPPMPPRSPPSPSPPSPSPPP 106

Query: 172 NPTPSTPPSSD--CTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
           +  PS PP S+    PPS  SP   P+P  P +P  P      SPP    PP  P P +P
Sbjct: 107 SFPPSVPPPSNPPNVPPSIPSPSPVPSPPPPPSPFAPE----PSPPPPMPPPPTPPPPSP 162

Query: 346 STPTTPSGGYYNSPP--QDSSPPSDPLP 423
           S P  P       PP   D SPP  P P
Sbjct: 163 SPPPLP------PPPWSPDPSPPPPPSP 184

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 51/142 (35%), Positives = 63/142 (44%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P+PP       P PS+PP      P+PSP   S   PP  + P PSPP       P P
Sbjct: 100 PSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVP-SPPPPPSPFAPEPSPPPP----MPPP 154

Query: 184 STPPSSDCTPPSQDSPP--SDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            TPP    +PP    PP   DP+P  P +P  P       PP    PP  P+   P +P 
Sbjct: 155 PTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSP- 213

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
            PS   ++ PP   S P  P P
Sbjct: 214 PPSPPPFSPPPSPPSQPPQPPP 235

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 55/148 (37%), Positives = 66/148 (44%), Gaps = 8/148 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG------ 165
           P+P PP+   S +P P  PP      P+PSPPS S   PP S+ P+  PPS         
Sbjct: 73  PSPPPPTTP-SPSPPPPMPPRS---PPSPSPPSPS---PPPSFPPSVPPPSNPPNVPPSI 125

Query: 166 -SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
            S +P PS PP     PPS  +P   P P  P  PT P       PP  S PP  P P +
Sbjct: 126 PSPSPVPSPPP-----PPSPFAPEPSPPPPMPPPPTPP-------PPSPSPPPLPPPPWS 173

Query: 343 PS-TPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  +P  P   Y   P     PP+ P P
Sbjct: 174 PDPSPPPPPSPYMPPPSPPPHPPNQPPP 201

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 54/140 (38%), Positives = 60/140 (42%), Gaps = 2/140 (1%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P  P    S +P PS PP    + P PSPP      PP    PTP PPS   S  P P  
Sbjct: 119 PNVPPSIPSPSPVPSPPPPPSPFAPEPSPP------PPMPPPPTPPPPS--PSPPPLPPP 170

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           P S D +PP   SP   P    P  P  P   Y  S P   SPP  P P +P  P +P  
Sbjct: 171 PWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPSPPPFSP--PPSPPS 228

Query: 370 GYYNSPP--QDSSPPSDPLP 423
                PP    SSPP  P+P
Sbjct: 229 QPPQPPPVLPPSSPPPSPVP 248

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 53/145 (36%), Positives = 61/145 (42%), Gaps = 7/145 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPG--SYDPTPSPPSGDGSYNP 177
           P P PP    S +P   SPP   S+ P+  PPS+    PP   S  P PSPP     + P
Sbjct: 86  PPPMPPRSPPSPSPPSPSPPP--SFPPSVPPPSNPPNVPPSIPSPSPVPSPPPPPSPFAP 143

Query: 178 TPSTPPSSDCTP----PSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDPTPTT 342
            PS PP     P    PS   PP  P P +P  +P  P   Y   P     PP  P P  
Sbjct: 144 EPSPPPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPY 203

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDP 417
           P +   P      SPP  S PPS P
Sbjct: 204 PPSQPPPFSPP-PSPPPFSPPPSPP 227

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 52/140 (37%), Positives = 59/140 (42%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P+PPS     +P PS PP   S  P  +PP+     P  S  P PSPP     + P P
Sbjct: 95  PSPSPPSP----SPPPSFPP---SVPPPSNPPNVPPSIP--SPSPVPSPPPPPSPFAPEP 145

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP     PP    PPS   P  P  P +P      SPP   SP   P    P  P  P
Sbjct: 146 SPPP--PMPPPPTPPPPSPSPPPLPPPPWSPD----PSPPPPPSPYMPPPSPPPHPPNQP 199

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
              Y  S P   SPP  P P
Sbjct: 200 PPPYPPSQPPPFSPPPSPPP 219

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 50/129 (38%), Positives = 56/129 (43%), Gaps = 9/129 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP----GSYDPTP---SPPSGD 162
           P P PPS    ++P PS PP    + P PSPPS     PP     S  P+P   +PPS  
Sbjct: 200 PPPYPPSQPPPFSPPPSPPP----FSPPPSPPSQPPQPPPVLPPSSPPPSPVPSAPPSAP 255

Query: 163 GSYNPTPSTPPSSDCTPPSQD--SPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
               P PS  PS   TPPS    SPP  P P     P  P    Y   P   SPPT P+ 
Sbjct: 256 PPTQPPPSPVPS---TPPSPQPVSPPPSPEPPLQPPPNVP----YPYAPPPGSPPTSPSV 308

Query: 337 TTPSTPTTP 363
              ST   P
Sbjct: 309 EEDSTDMLP 317

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 51/135 (37%), Positives = 61/135 (45%), Gaps = 10/135 (7%)
 Frame = +1

Query: 49  PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPP---SSDCTPPS 219
           PSSPP      P  SPP  S   PP S  P+  PP         PS PP   +   +PP 
Sbjct: 18  PSSPPSHPPIWPHQSPPPPSNPPPPLSPPPSLPPPPPSPPPPSPPSLPPWWPNVSPSPPP 77

Query: 220 QDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST--PTTPSGGYYNSPP 390
             +P PS P P  P +P +PS    + PP  S PP+ P P+ P    P+ PS     SPP
Sbjct: 78  PTTPSPSPPPPMPPRSPPSPSPPSPSPPP--SFPPSVPPPSNPPNVPPSIPSPSPVPSPP 135

Query: 391 QDSSP----PSDPLP 423
              SP    PS P P
Sbjct: 136 PPPSPFAPEPSPPPP 150

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 57/160 (35%), Positives = 66/160 (41%), Gaps = 20/160 (12%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT--PSPPSDSGGSPPG------SYDPTPSPPSG 159
           P   PP       P PS+PP   S  P+  P PPS    SPP       +  P+P PP+ 
Sbjct: 21  PPSHPPIWPHQSPPPPSNPPPPLSPPPSLPPPPPSPPPPSPPSLPPWWPNVSPSPPPPTT 80

Query: 160 DGSYNPTPSTPPSSDCTPPSQDSP-------PSDPTPTTPST--PTTPSGGYYNSPPQDS 312
             S +P P  PP S  +P S  SP       PS P P+ P    P+ PS     SPP   
Sbjct: 81  P-SPSPPPPMPPRSPPSP-SPPSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVPSPPPPP 138

Query: 313 S---PPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           S   P   P P  P  PT P       PP  S PP  P P
Sbjct: 139 SPFAPEPSPPPPMPPPPTPP-------PPSPSPPPLPPPP 171

[25][TOP]
>UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J4Y2_HUMAN
          Length = 253

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 54/139 (38%), Positives = 58/139 (41%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P PS PP      P PSPP     SPP    P+P PP       P P
Sbjct: 8   PPPPPPPSSPPPPPPPSPPP------PPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPP 61

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP    +PP    PPS P P  PS P          PP  S PP  P P+ P  P  P
Sbjct: 62  SQPPPPPSSPPPPPPPPSPPPPPPPSPP----------PPLPSPPPPPPLPSPPPPPPLP 111

Query: 364 SGGYYNSPPQDSSPPSDPL 420
           S    + PP   SPP  PL
Sbjct: 112 S----SPPPPPPSPPPPPL 126

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 51/140 (36%), Positives = 58/140 (41%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P+P  PP      P+P PP  S   PP S  P P PP       P+P
Sbjct: 33  PPPPPPSPPSPLPPSPPPPP-----PPSPPPPPPSQPPPPPSSPPPPPPP-------PSP 80

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P+ P  P  PS    + PP   SPP  P    P  P+ P
Sbjct: 81  PPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPS----SPPPPPPSPPPPPLSPPPPPPSPP 136

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                + PP   SPP  P P
Sbjct: 137 PPPLLSPPPPPPSPPPPPPP 156

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 52/141 (36%), Positives = 58/141 (41%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP    S  P P SPP      P P PPS     PP    P PSPP      +P P
Sbjct: 117 PPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLP 176

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSP-PQDSSPPTDPTPTTPSTPTT 360
             PPS     P    PP  P+P  P  P+ P     + P P   SPP  P P  P +P  
Sbjct: 177 PPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPP 236

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P       PP    PPS P P
Sbjct: 237 P-------PPPSPPPPSPPPP 250

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 53/143 (37%), Positives = 58/143 (40%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDP---TPSPPSGDGSYN 174
           P+P PP       P PS PP   S  P P PP      PP S  P   +P PP    S  
Sbjct: 46  PSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPP 105

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           P P  P S    PPS   PP  P P  PS P  P     + PP   SPP  P P+ P  P
Sbjct: 106 PPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPP---LLSPPPPPPSPPPPPPPSPPPPP 162

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
            +P        P    PPS P P
Sbjct: 163 PSPPPPLPPPSPLPPPPPSPPHP 185

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 54/143 (37%), Positives = 59/143 (41%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP--SPPSGDGSYNP 177
           P+P PP       P PS PP      P P PP  S   PP    P P  SPP       P
Sbjct: 78  PSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPP------P 131

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            PS PP    +PP    PPS P P  PS P  P       PP    PP  P+P  P  P+
Sbjct: 132 PPSPPPPPLLSPPPP--PPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPS 189

Query: 358 TPSGGYYN-SPPQDSSPPSDPLP 423
            P     +  PP   SPP  PLP
Sbjct: 190 PPPPPPPSPPPPPPPSPPPPPLP 212

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 52/138 (37%), Positives = 57/138 (41%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PPS      P PS PP      P+P PP  S   PP    P P PP       P PS 
Sbjct: 65  PPPPSSPPPPPPPPSPPPPP---PPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSP 121

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           PP     PP   SPP  P  + P  P +P       PP  S PP  P+P  P  P +P  
Sbjct: 122 PPPPLSPPPPPPSPPPPPLLSPPPPPPSPP-----PPPPPSPPPPPPSPPPPLPPPSPLP 176

Query: 370 GYYNSPPQDSSPPSDPLP 423
               SPP    PPS P P
Sbjct: 177 PPPPSPPH-PLPPSPPPP 193

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 55/127 (43%), Positives = 57/127 (44%)
 Frame = +1

Query: 43  PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQ 222
           P P SPP      P P PPS    SPP    P PSPP       P PS PP    +PPS 
Sbjct: 2   PPPPSPP------PPPPPPS----SPPP--PPPPSPPP------PPPSPPPPPPPSPPS- 42

Query: 223 DSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSS 402
             PPS P P  PS P  P       PP  SSPP  P P +P  P  PS      PP  S 
Sbjct: 43  PLPPSPPPPPPPSPPPPPPS---QPPPPPSSPPPPPPPPSPPPPPPPS----PPPPLPSP 95

Query: 403 PPSDPLP 423
           PP  PLP
Sbjct: 96  PPPPPLP 102

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 53/140 (37%), Positives = 57/140 (40%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P PS PP   S  P P PPS     PP    P P PPS      P P
Sbjct: 104 PPPPPPLPSSPPPPPPSPPPPPLS--PPPPPPSPP---PPPLLSPPPPPPS------PPP 152

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PPS    PPS   P   P+P  P  P+ P     + PP     P  P P +P  P  P
Sbjct: 153 PPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLP 212

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           S       P   SPPS PLP
Sbjct: 213 S-------PPAPSPPSPPLP 225

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 55/149 (36%), Positives = 60/149 (40%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDP----TPSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P+P PP       P PSSPP      P    +P PP  S   PP    P P PPS     
Sbjct: 102 PSPPPPP------PLPSSPPPPPPSPPPPPLSPPPPPPS-PPPPPLLSPPPPPPSPPPPP 154

Query: 172 NPTPSTPPSSDCTP-----PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
            P+P  PP S   P     P    PPS P P  PS P  P       PP    PP  P+P
Sbjct: 155 PPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSP 214

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             PS P+ P       PP    PPS P P
Sbjct: 215 PAPSPPSPP------LPPPPPPPPSPPPP 237

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 43/115 (37%), Positives = 47/115 (40%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP       P PS PP      P P PP     SPP    P+P PP       P P
Sbjct: 148 PSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPP----SPPHPLPPSPPPPPPPSPPPPPP 203

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
            +PP      P   SPPS P P  P  P +P       PP  S PP  P P  PS
Sbjct: 204 PSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPP-----PPPPPSPPPPSPPPPPPS 253

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 50/138 (36%), Positives = 57/138 (41%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P PS PP      P PSP       PP    P+P PP      +P P
Sbjct: 143 PPPPPPSPPPP--PPPSPPP------PPPSP-------PPPLPPPSPLPPPPPSPPHPLP 187

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            +PP     PP    PP  P+P  P  P+ P+     SPP    PP  P P +P  P  P
Sbjct: 188 PSPPP---PPPPSPPPPPPPSPPPPPLPSPPA----PSPPSPPLPPPPPPPPSPPPPPPP 240

Query: 364 SGGYYNSPPQDSSPPSDP 417
                 SPP  S PP  P
Sbjct: 241 ------SPPPPSPPPPPP 252

[26][TOP]
>UniRef100_Q9S728 En/Spm-like transposon protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9S728_ARATH
          Length = 306

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 62/142 (43%), Positives = 75/142 (52%), Gaps = 9/142 (6%)
 Frame = +1

Query: 13  TPPSGDGSYNPT---PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG-----S 168
           +PPSG     P+   PSS  G   YDP+PS PS    SPP S+ PTPS PS        S
Sbjct: 39  SPPSGSHGTPPSHTPPSSNCGSPPYDPSPSTPSHP--SPP-SHTPTPSTPSHTPTPHTPS 95

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDP-TPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
           + PTP TPP +  +PPS  S PS P TP+ P+    PSGGYY+SP     PP  P   TP
Sbjct: 96  HTPTPHTPPCNCGSPPSHPSTPSHPSTPSHPTPSHPPSGGYYSSP-----PPRTPVVVTP 150

Query: 346 STPTTPSGGYYNSPPQDSSPPS 411
            +P    G    +P    SPP+
Sbjct: 151 PSPIVDPG----TPIIGGSPPT 168

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 52/130 (40%), Positives = 63/130 (48%), Gaps = 8/130 (6%)
 Frame = +1

Query: 1   DPTPTPPSGDG--SYNPTPSSP-----PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSG 159
           DP+P+ PS     S+ PTPS+P     P   S+ PTP  P  + GSPP S+  TPS PS 
Sbjct: 64  DPSPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCNCGSPP-SHPSTPSHPST 122

Query: 160 DGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTD-PTP 336
               +PTPS PPS          PP  P   TP +P    G    +P    SPPT    P
Sbjct: 123 PS--HPTPSHPPSGGY---YSSPPPRTPVVVTPPSPIVDPG----TPIIGGSPPTPIIDP 173

Query: 337 TTPSTPTTPS 366
            TP TP  P+
Sbjct: 174 GTPGTPFIPA 183

[27][TOP]
>UniRef100_Q9FPQ6 Vegetative cell wall protein gp1 n=1 Tax=Chlamydomonas reinhardtii
           RepID=GP1_CHLRE
          Length = 555

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 56/146 (38%), Positives = 69/146 (47%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS     +P P SP       P+P+PPS +  SP     P+P+PPS      P+P
Sbjct: 79  PSPAPPS-PAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSP 137

Query: 184 STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS-TPT 357
           S P  +   PPS   P PS P P +PS P  PS    +  P   SPP  P+P  PS  P 
Sbjct: 138 SPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPP 197

Query: 358 TPSGGYYNSP----PQDSSPPSDPLP 423
            P      SP    P   +PPS P P
Sbjct: 198 VPPSPAPPSPAPPVPPSPAPPSPPSP 223

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 50/141 (35%), Positives = 64/141 (45%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P+P+ P       P+PSPPS +   PP    P+PSPP       P P
Sbjct: 109 PSPAPPSPAPPSPPSPAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVP 168

Query: 184 STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            +P     TPPS   P P  P P +P+ P  PS       P   +PP  P+P  PS P+ 
Sbjct: 169 PSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPS-----PAPPSPAPPVPPSPAPPSPPSP 223

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
                 +  P   SPP+ P P
Sbjct: 224 APPSPPSPAPPSPSPPAPPSP 244

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 54/156 (34%), Positives = 67/156 (42%), Gaps = 16/156 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT----------------PSPPSDSGGSPPGSYD 135
           P+PTPPS      P+P+ P       P+                PSPPS +  SPP    
Sbjct: 174 PSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAP 233

Query: 136 PTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSS 315
           P+PSPP+      P+P+ PPS     P   +PP  P+P  P  P  P       PP   S
Sbjct: 234 PSPSPPAPPSPVPPSPA-PPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPPS 292

Query: 316 PPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PP  P P TP TP +P      SPP    P   P+P
Sbjct: 293 PPPSPAPPTPPTPPSP------SPPSPVPPSPAPVP 322

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 54/158 (34%), Positives = 66/158 (41%), Gaps = 18/158 (11%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P+PS P       P+P+PPS S   PP    P+P+PP       P+P
Sbjct: 148 PSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSP 207

Query: 184 STPPSSDCTPPSQDSP----PSDPTPTTPSTPTTPS--------------GGYYNSPPQD 309
           + P      PPS  SP    P  P P +PS P  PS                   +PP  
Sbjct: 208 APPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPP 267

Query: 310 SSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            SPP  P P  P    TP      SPP   +PP+ P P
Sbjct: 268 PSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTP 305

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 58/145 (40%), Positives = 74/145 (51%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS  G  +P P SPP      P P  P+    +PP    P+P+PPS     +P P
Sbjct: 61  PSPAPPS-PGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPS-PAPPSPAP 118

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYN-SP--PQDSSPPTDPTPTTPS-T 351
            +PPS     PS  +PPS P+P +P+ P  PS    + SP  P   SPP  P+P  PS T
Sbjct: 119 PSPPSPAPPSPSPPAPPS-PSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPT 177

Query: 352 PTTPSGGYYNSP-PQDSSPPSDPLP 423
           P +PS     SP P   +PP  P P
Sbjct: 178 PPSPSPPVPPSPAPPSPAPPVPPSP 202

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/148 (36%), Positives = 67/148 (45%), Gaps = 8/148 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTP---SPPSDSGGSPPGSYDPTPSPPSGDGSYN 174
           P+P PPS      P+P+ P       P+P   SPPS +  SPP    P+PSPP+      
Sbjct: 187 PSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVP 246

Query: 175 PTPS----TPPS-SDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
           P+P+     PPS     PP   SPP  P P  P    TP      SPP   +PPT PTP 
Sbjct: 247 PSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPP 306

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           +PS P+         PP  + P   P P
Sbjct: 307 SPSPPSPVPPSPAPVPPSPAPPSPAPSP 334

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/145 (35%), Positives = 68/145 (46%), Gaps = 4/145 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P+PPS      P+P+ P       P+PSPP     +PP    P+PSPP       P+P
Sbjct: 135 PSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSP 194

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           + P      PPS  +PP  P+P  PS P+       +  P   SPP  P+P  PS P  P
Sbjct: 195 APPVPPSPAPPSP-APPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPS-PAPP 252

Query: 364 SGGYYN----SPPQDSSPPSDPLPR 426
           S    +    +PP   SPP  P PR
Sbjct: 253 SPAPPSPKPPAPPPPPSPPPPPPPR 277

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 57/162 (35%), Positives = 70/162 (43%), Gaps = 22/162 (13%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P+P SP       P+PSPP+     PP    P+P+PPS      P P
Sbjct: 213 PSPAPPSPPSPAPPSPPSPA-----PPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPP 267

Query: 184 STPP----------SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGY-----------YNSP 300
            +PP          ++   PPS  SPP  P P TP TP +PS                +P
Sbjct: 268 PSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAP 327

Query: 301 PQDS-SPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  + SPP  P P TPS   +PS     SP    SP   P P
Sbjct: 328 PSPAPSPPPSPAPPTPSPSPSPSPSPSPSPSPSPSPSPSPSP 369

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 56/146 (38%), Positives = 70/146 (47%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS     +P P SP       P+P+PPS    +PP    P+P+PPS        P
Sbjct: 46  PSPAPPS-PAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPP 104

Query: 184 STPPSSDCTP-PSQDSPPSDPTPTTPSTPTTPSGGYYN-SPPQDSSP----PTDPTPTTP 345
           S  P S   P P+  SPPS P P +PS P  PS    + +PP   SP    P+ P P +P
Sbjct: 105 SPAPPSPAPPSPAPPSPPS-PAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSP 163

Query: 346 STPTTPSGGYYNSPPQDSSPPSDPLP 423
           S P  PS    +  P   SPP  P P
Sbjct: 164 SPPVPPSPAPPSPTPPSPSPPVPPSP 189

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 59/146 (40%), Positives = 72/146 (49%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPG---SYDPTPSPPSGDGSYN 174
           P+P PPS     +P P SP       P+P+PPS    +PP       P+PSPPS      
Sbjct: 89  PSPAPPS-PAPPSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSPSPPSPAPPLP 147

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSP-PQDSSPPTDPTPTTPS 348
           P+P+ P  S   PPS  SPP  P+P  PS TP +PS     SP P   +PP  P+P  PS
Sbjct: 148 PSPAPPSPSPPVPPS-PSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPS 206

Query: 349 -TPTTPSGGYYNSPPQDSSPPSDPLP 423
             P  P      SPP   +PPS P P
Sbjct: 207 PAPPVPPSPAPPSPP-SPAPPSPPSP 231

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/150 (34%), Positives = 70/150 (46%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--------PPSDSGGSPPGSYDPTPSPPSG 159
           P+P PPS      P+PS P       P+P+        PPS S   PP    P+P+PPS 
Sbjct: 122 PSPAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSP 181

Query: 160 DGSYNPTPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPT 333
                P+P+ P  +   PPS   P P+ P P +P+ P+ PS     +PP   SP P  P+
Sbjct: 182 SPPVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPSPPS----PAPPSPPSPAPPSPS 237

Query: 334 PTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  P +P  PS    +  P    PP+ P P
Sbjct: 238 PPAPPSPVPPSPAPPSPAPPSPKPPAPPPP 267

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/149 (35%), Positives = 67/149 (44%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPP---SDSGGSPPGSYDPTPSPPSGDGSYN 174
           P+P PPS      P+PS P       P+P+PP   S +  SP     P+PSPP       
Sbjct: 114 PSPAPPSPPSPAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAP 173

Query: 175 PTPSTPPSSDCTPPS----QDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSP-PTDPTP 336
           P+P+ P  S   PPS      +PP  P+P  PS  P  P      SPP  + P P  P P
Sbjct: 174 PSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAP 233

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            +PS P  PS    +  P   +PPS   P
Sbjct: 234 PSPSPPAPPSPVPPSPAPPSPAPPSPKPP 262

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 52/133 (39%), Positives = 69/133 (51%), Gaps = 2/133 (1%)
 Frame = +1

Query: 31  GSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCT 210
           G +N  PS  P      P+P+PPS +   PP    P+P+PPS  G  +P P +PPS    
Sbjct: 35  GIFNCPPSPAP------PSPAPPSPA---PPSPAPPSPAPPS-PGPPSPAPPSPPSP--A 82

Query: 211 PPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSP 387
           PPS   P P+ P+P  PS P  PS    +  P   +PP+ P+P  PS P+ P      +P
Sbjct: 83  PPSPAPPSPAPPSPAPPS-PAPPSPAPPSPAPPSPAPPSPPSPAPPS-PSPP------AP 134

Query: 388 PQDSSP-PSDPLP 423
           P  S P P+ PLP
Sbjct: 135 PSPSPPSPAPPLP 147

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 40/120 (33%), Positives = 56/120 (46%), Gaps = 3/120 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSS---PPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYN 174
           P P+PP       P P++   PP   S  P+P+PP+    +PP    P+P PPS      
Sbjct: 266 PPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPP--TPPSPSPPSPVPPS-PAPVP 322

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           P+P+ P  +   PPS   P   P+P +PS   +PS     SP    SP   P+P    +P
Sbjct: 323 PSPAPPSPAPSPPPSPAPPTPSPSP-SPSPSPSPSPSPSPSPSPSPSPIPSPSPKPSPSP 381

[28][TOP]
>UniRef100_Q8H899 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=Q8H899_ORYSJ
          Length = 293

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 62/174 (35%), Positives = 79/174 (45%), Gaps = 36/174 (20%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS----PPSDSGGSPP-----GSYDPT----- 141
           P  TPP      +PT    PGGG Y PTPS    PPS + G+ P     G Y P+     
Sbjct: 109 PCDTPPLPSSGTSPTT---PGGGYYPPTPSVGDVPPSPASGTSPSTPGSGGYSPSTPCSA 165

Query: 142 -PSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTP-------------------- 258
            P P SG     P     PS+ C  P   SP SD +PTTP                    
Sbjct: 166 PPLPSSGTSPTTPGGGYSPSTPCNAPP--SPSSDTSPTTPGGGNYPPAPTIGNVPPSPSS 223

Query: 259 -STPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
            ++P+TP GG  +SP    +P   P+P++ ++PTTP GGYY   P   + PS P
Sbjct: 224 GTSPSTPGGGCSSSPTPCDAP---PSPSSDTSPTTPGGGYYPPKPSIGTSPSTP 274

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 55/148 (37%), Positives = 73/148 (49%), Gaps = 20/148 (13%)
 Frame = +1

Query: 7   TPTPPSGDGSYNP-TPSSPPG-----------GGSYDPT------PSPPSDSGGSPPGSY 132
           +P+ P G G Y+P TP S P            GG Y P+      PSP SD+  + PG  
Sbjct: 148 SPSTP-GSGGYSPSTPCSAPPLPSSGTSPTTPGGGYSPSTPCNAPPSPSSDTSPTTPGGG 206

Query: 133 DPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSD--PTPTTPSTPTTPSGGYYNSPPQ 306
           +  P+P  G+   +P+  T PS+     S    P D  P+P++ ++PTTP GGYY     
Sbjct: 207 NYPPAPTIGNVPPSPSSGTSPSTPGGGCSSSPTPCDAPPSPSSDTSPTTPGGGYY----- 261

Query: 307 DSSPPTDPTPTTPSTPTTPSGGYYNSPP 390
              PP     T+PSTP T  GGYY  PP
Sbjct: 262 ---PPKPSIGTSPSTPGT-GGGYY--PP 283

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 47/139 (33%), Positives = 59/139 (42%), Gaps = 27/139 (19%)
 Frame = +1

Query: 88  PSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTP--- 258
           PS P D+   P     PT     G G Y PTPS        PPS   P S  +P+TP   
Sbjct: 106 PSTPCDTPPLPSSGTSPTTP---GGGYYPPTPSVGD----VPPS---PASGTSPSTPGSG 155

Query: 259 -----------------STPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYY--- 378
                            ++PTTP GGY  S P ++     P+P++ ++PTTP GG Y   
Sbjct: 156 GYSPSTPCSAPPLPSSGTSPTTPGGGYSPSTPCNA----PPSPSSDTSPTTPGGGNYPPA 211

Query: 379 ----NSPPQDSSPPSDPLP 423
               N PP  SS  S   P
Sbjct: 212 PTIGNVPPSPSSGTSPSTP 230

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 29/72 (40%), Positives = 40/72 (55%), Gaps = 2/72 (2%)
 Frame = +1

Query: 199 SDCTPPSQDSPPSD--PTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGG 372
           SD T     S P D  P P++ ++PTTP GGYY  PP  S     P+P + ++P+TP  G
Sbjct: 98  SDHTGRRLPSTPCDTPPLPSSGTSPTTPGGGYY--PPTPSVGDVPPSPASGTSPSTPGSG 155

Query: 373 YYNSPPQDSSPP 408
            Y+     S+PP
Sbjct: 156 GYSPSTPCSAPP 167

[29][TOP]
>UniRef100_C1E8G6 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E8G6_9CHLO
          Length = 3204

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 57/142 (40%), Positives = 67/142 (47%), Gaps = 6/142 (4%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYD-PTPSPPSGDG-SYNPTP 183
            P PP  D    P PS PP      P PSPP      PP + D P PSPP  D  S  P P
Sbjct: 923  PAPPPPDAPDAPAPSPPPPDAPDAPAPSPP------PPDAPDAPAPSPPPPDAPSPLPPP 976

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTD----PTPTTPST 351
              PP+   +PP  D+PP+ P+P  P  P  PS    ++PP  S PP D    P P  P  
Sbjct: 977  DAPPAP--SPPPPDAPPA-PSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPDAPAPPPPDA 1033

Query: 352  PTTPSGGYYNSPPQDSSPPSDP 417
            P  PS    ++PP  S PP  P
Sbjct: 1034 PPAPSPPPPDAPPAPSPPPPSP 1055

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 52/143 (36%), Positives = 64/143 (44%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P P+PP  D    P PS PP      P PSPP     SP  P    P PSPP  D    P
Sbjct: 934  PAPSPPPPDAPDAPAPSPPPPDAPDAPAPSPPPPDAPSPLPPPDAPPAPSPPPPDAPPAP 993

Query: 178  TPSTPPSSDC-TPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            +P  P +    +PP  D+PP+ P+P  P  P  P+    ++PP  S PP D  P     P
Sbjct: 994  SPPPPDAPPAPSPPPPDAPPA-PSPPPPDAPDAPAPPPPDAPPAPSPPPPDAPPAPSPPP 1052

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
             +P     + PP     PS P P
Sbjct: 1053 PSPDAPPPSPPPLAPPAPSPPPP 1075

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 52/139 (37%), Positives = 62/139 (44%), Gaps = 2/139 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPS--DSGGSPPGSYDPTPSPPSGDGSYNP 177
            P P+PP  D    P PS PP      P+P PP   D+   PP    P PSPP        
Sbjct: 991  PAPSPPPPDAP--PAPSPPPPDAPPAPSPPPPDAPDAPAPPPPDAPPAPSPPP------- 1041

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
             P  PP+    PPS D+PP  P P  P  P+ P      SPP  ++P T P+P  P  P 
Sbjct: 1042 -PDAPPAPSPPPPSPDAPPPSPPPLAPPAPSPPPPPVVPSPPPPNAP-TAPSPPPPDAPM 1099

Query: 358  TPSGGYYNSPPQDSSPPSD 414
             PS     +P   S PP D
Sbjct: 1100 APSPPPPGAPAAPSPPPPD 1118

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 55/154 (35%), Positives = 65/154 (42%), Gaps = 14/154 (9%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGG-------SYDPTPSPPSDSG----GSPPGSYDPTPSP 150
            P P+PP  D    P PS PP             P PSPP          PP    P PSP
Sbjct: 947  PAPSPPPPDAPDAPAPSPPPPDAPSPLPPPDAPPAPSPPPPDAPPAPSPPPPDAPPAPSP 1006

Query: 151  PSGDGSYNPTPSTPPSSDC-TPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTD 327
            P  D    P+P  P + D   PP  D+PP+ P+P  P  P  PS      PP   +PP  
Sbjct: 1007 PPPDAPPAPSPPPPDAPDAPAPPPPDAPPA-PSPPPPDAPPAPS----PPPPSPDAPPPS 1061

Query: 328  PTPTTPSTPTTPSGGYYNSPPQDSSP--PSDPLP 423
            P P  P  P+ P      SPP  ++P  PS P P
Sbjct: 1062 PPPLAPPAPSPPPPPVVPSPPPPNAPTAPSPPPP 1095

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 55/146 (37%), Positives = 68/146 (46%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYD-PTPSPPSGDGSYNPT 180
            P P+PP    +  P P   P      P PSPP      PP + D P PSPP  D    P 
Sbjct: 912  PAPSPPEAPDAPAPPPPDAPDA----PAPSPP------PPDAPDAPAPSPPPPDAPDAPA 961

Query: 181  PSTPPSSDCTP-PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTD----PTPTTP 345
            PS PP    +P P  D+PP+ P+P  P  P  PS    ++PP  S PP D    P+P  P
Sbjct: 962  PSPPPPDAPSPLPPPDAPPA-PSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPPAPSPPPP 1020

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
              P  P+    ++PP  S PP D  P
Sbjct: 1021 DAPDAPAPPPPDAPPAPSPPPPDAPP 1046

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 53/143 (37%), Positives = 66/143 (46%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPT-PSSPPGGGSYDPTPSPPSD--SGGSPPGSYDPTPSPPSGDGSYN 174
            P P+PP  D    P  PS PP      P+P PP    +   PP +    PSPP  D    
Sbjct: 1231 PAPSPPPPDAPPAPAEPSPPPPNAPTAPSPPPPDAPVAPSPPPPNAPVAPSPPPPDA--- 1287

Query: 175  PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            PT  +PP     PP   + PS P P  PS+P+ P     + PP D+  PT P+P  P+ P
Sbjct: 1288 PTSPSPP-----PPLAPTAPSPPPPDAPSSPSPPPPDAPSPPPPDA--PTAPSPPPPNAP 1340

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
            T PS      PP   + PS P P
Sbjct: 1341 TAPSP----PPPASPTAPSPPPP 1359

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 46/124 (37%), Positives = 58/124 (46%), Gaps = 2/124 (1%)
 Frame = +1

Query: 43   PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPT-PSPPSGDGSYNPTPSTPPSSDCTPPS 219
            P P+  P   S  P  +PP+ +  SPP    PT PSPP  D    P+P  P +     P 
Sbjct: 1224 PVPAPDPPAPSPPPPDAPPAPAEPSPPPPNAPTAPSPPPPDAPVAPSPPPPNAPVAPSPP 1283

Query: 220  QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTD-PTPTTPSTPTTPSGGYYNSPPQD 396
                P+ P+P  P  PT PS    ++P   S PP D P+P  P  PT PS    N+P   
Sbjct: 1284 PPDAPTSPSPPPPLAPTAPSPPPPDAPSSPSPPPPDAPSPPPPDAPTAPSPPPPNAPTAP 1343

Query: 397  SSPP 408
            S PP
Sbjct: 1344 SPPP 1347

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 47/141 (33%), Positives = 64/141 (45%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            +P+P PP+   + +P P   P   S  P  +P + S   P     P+P PP    + +P 
Sbjct: 1246 EPSPPPPNAPTAPSPPPPDAPVAPSPPPPNAPVAPSPPPPDAPTSPSPPPPLAPTAPSPP 1305

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            P   PSS   P     PP  P+P  P  PT PS       P   + PT P+P  P++PT 
Sbjct: 1306 PPDAPSSPSPP-----PPDAPSPPPPDAPTAPS-------PPPPNAPTAPSPPPPASPTA 1353

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            P      SPP   +P + PLP
Sbjct: 1354 P------SPPPPVAPQA-PLP 1367

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 53/157 (33%), Positives = 65/157 (41%), Gaps = 22/157 (14%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPS-SPPGGGS-------------YDPTPSPPSDSGGSPPGSYD-PTP 144
            P PP  D    PTP+  PP  G+               P P  P     SPP + D P P
Sbjct: 866  PEPPPPDAPTQPTPAPGPPLPGAPPAPVVVPQPDAPAPPPPDAPDAPAPSPPEAPDAPAP 925

Query: 145  SPPSGDGSYNPTPSTPPSSDC---TPPSQDSP----PSDPTPTTPSTPTTPSGGYYNSPP 303
             PP    +  P+P  P + D    +PP  D+P    PS P P  PS    P      SPP
Sbjct: 926  PPPDAPDAPAPSPPPPDAPDAPAPSPPPPDAPDAPAPSPPPPDAPSPLPPPDAPPAPSPP 985

Query: 304  QDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
               +PP  P+P  P  P  PS    ++PP  S PP D
Sbjct: 986  PPDAPPA-PSPPPPDAPPAPSPPPPDAPPAPSPPPPD 1021

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 47/132 (35%), Positives = 60/132 (45%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PP    + +P P   P   +  P  +PP+ S   P     P+P PPS D    P P
Sbjct: 1004 PSPPPPDAPPAPSPPPPDAPDAPAPPPPDAPPAPSPPPPDAPPAPSPPPPSPDA---PPP 1060

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            S PP +    PS   PP  P+P  P+ PT PS      PP D+  P  P+P  P  P  P
Sbjct: 1061 SPPPLAP-PAPSPPPPPVVPSPPPPNAPTAPS-----PPPPDA--PMAPSPPPPGAPAAP 1112

Query: 364  SGGYYNSPPQDS 399
            S      PP D+
Sbjct: 1113 S-----PPPPDA 1119

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 50/150 (33%), Positives = 58/150 (38%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYD--PTPSPPSG-DGSYN 174
            P P PP       P P  P  G    P   P  D+   PP      P PSPP   D    
Sbjct: 866  PEPPPPDAPTQPTPAPGPPLPGAPPAPVVVPQPDAPAPPPPDAPDAPAPSPPEAPDAPAP 925

Query: 175  PTPSTPPSSDCTPPSQDSP----PSDPTPTTPSTPT---TPSGGYYNSPPQDSSPPTDPT 333
            P P  P +   +PP  D+P    PS P P  P  P     P       PP D+ P   P+
Sbjct: 926  PPPDAPDAPAPSPPPPDAPDAPAPSPPPPDAPDAPAPSPPPPDAPSPLPPPDAPPA--PS 983

Query: 334  PTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P  P  P  PS    ++PP  S PP D  P
Sbjct: 984  PPPPDAPPAPSPPPPDAPPAPSPPPPDAPP 1013

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 53/156 (33%), Positives = 63/156 (40%), Gaps = 16/156 (10%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSY----DPTPSPPSGDGSY 171
            P PTP          P  PP      PTP+P     G+PP          P+PP  D   
Sbjct: 851  PAPTPTPAPVPEPSAPEPPPPDAPTQPTPAPGPPLPGAPPAPVVVPQPDAPAPPPPDAPD 910

Query: 172  NPTPSTPPSSDC-TPPSQDSP----PSDPTPTTPSTPTTPSGGYYNSP--PQDSSPPTD- 327
             P PS P + D   PP  D+P    PS P P  P  P  PS    ++P  P  S PP D 
Sbjct: 911  APAPSPPEAPDAPAPPPPDAPDAPAPSPPPPDAPDAPA-PSPPPPDAPDAPAPSPPPPDA 969

Query: 328  ----PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
                P P  P  P+ P     ++PP  S PP D  P
Sbjct: 970  PSPLPPPDAPPAPSPPPP---DAPPAPSPPPPDAPP 1002

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 40/101 (39%), Positives = 47/101 (46%), Gaps = 3/101 (2%)
 Frame = +1

Query: 121  PGSYDPTPSPPSGDGSYNPT-PSTPPSSDCTPPSQDSP--PSDPTPTTPSTPTTPSGGYY 291
            P    P PSPP  D    P  PS PP +  T PS   P  P  P+P  P+ P  PS    
Sbjct: 1226 PAPDPPAPSPPPPDAPPAPAEPSPPPPNAPTAPSPPPPDAPVAPSPPPPNAPVAPS---- 1281

Query: 292  NSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
              PP D+  PT P+P  P  PT PS    ++P   S PP D
Sbjct: 1282 -PPPPDA--PTSPSPPPPLAPTAPSPPPPDAPSSPSPPPPD 1319

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 41/122 (33%), Positives = 50/122 (40%), Gaps = 2/122 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG--SPPGSYDPTPSPPSGDGSYNP 177
            P P PP       P PS PP      P+P PPS      SPP    P PSPP      +P
Sbjct: 1026 PAPPPPDAP----PAPSPPPPDAPPAPSPPPPSPDAPPPSPPPLAPPAPSPPPPPVVPSP 1081

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
             P   P++  +PP  D+P + P+P  P  P  P      SPP   +P         S P 
Sbjct: 1082 PPPNAPTAP-SPPPPDAPMA-PSPPPPGAPAAP------SPPPPDAPVVVVLAPPISVPQ 1133

Query: 358  TP 363
             P
Sbjct: 1134 PP 1135

[30][TOP]
>UniRef100_UPI00019829A2 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019829A2
          Length = 726

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 58/157 (36%), Positives = 75/157 (47%), Gaps = 16/157 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS +      P SPP      P PS PS    +PP +  P P PP+      P P
Sbjct: 95  PSPPPPSPNAPPPTPPPSPPIAPV--PPPSNPSPPPLTPPPTSPPPPPPPTNPPRSPPPP 152

Query: 184 -------STPPSSDCTPPSQDSPPSDPTPTTPSTPT-----TPSGGYYNSPPQDSSPPTD 327
                  ++PP     PP    PPS+P  T+P  P+     +P     +SPP+DS PP  
Sbjct: 153 PPTEPPVTSPPPPSSNPPKSSPPPSEPPKTSPPPPSKPPPVSPPSPSPSSPPEDSPPPPV 212

Query: 328 PTPTTPSTP--TTPSGGYYNSPPQDSSPP--SDPLPR 426
           P P + STP   +PSG    +PP  +SPP  S P PR
Sbjct: 213 PVPPSNSTPPAPSPSGSQPATPPSPNSPPKGSPPPPR 249

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 53/141 (37%), Positives = 65/141 (46%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P PTP   +   +P P SPP      P P+PP     SPP +  P PS PS      P  
Sbjct: 79  PPPTPSLANSPSSPPPPSPPPPSPNAPPPTPPP----SPPIAPVPPPSNPSPPPLTPPPT 134

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP-TDPTPTTPSTPTT 360
           S PP    T P +  PP  PT    ++P  PS     S P  S PP T P P +   P +
Sbjct: 135 SPPPPPPPTNPPRSPPPPPPTEPPVTSPPPPSSNPPKSSPPPSEPPKTSPPPPSKPPPVS 194

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P     +SPP+DS PP  P+P
Sbjct: 195 PPSPSPSSPPEDSPPPPVPVP 215

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/149 (35%), Positives = 72/149 (48%), Gaps = 11/149 (7%)
 Frame = +1

Query: 4   PTPTPPSG--DGSYNPTPSSPPGGGSYDPTPSPP--------SDSGGSPPGSYDPTPSPP 153
           P   PP G    + +P P SPP   +  P  SPP        ++S  SPP    P+P PP
Sbjct: 44  PNADPPDGAAGSTSSPPPQSPPAVPAAPPPASPPPPPPTPSLANSPSSPP---PPSPPPP 100

Query: 154 SGDGSYNPTPSTPPSSDCTPPSQDSPPS-DPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP 330
           S +      P +PP +   PPS  SPP   P PT+P  P  P+    + PP    PPT+P
Sbjct: 101 SPNAPPPTPPPSPPIAPVPPPSNPSPPPLTPPPTSPPPPPPPTNPPRSPPP---PPPTEP 157

Query: 331 TPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
             T+P  P+       ++PP+ S PPS+P
Sbjct: 158 PVTSPPPPS-------SNPPKSSPPPSEP 179

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 55/138 (39%), Positives = 65/138 (47%), Gaps = 4/138 (2%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGG----SYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           P P S     +P PS PP       S  P  SPPS S  SPP    P P P     S  P
Sbjct: 163 PPPSSNPPKSSPPPSEPPKTSPPPPSKPPPVSPPSPSPSSPPEDSPPPPVPVPPSNSTPP 222

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            PS   S   TPPS +SPP   +P  P TPT P       PP  S PP  P P++P TP 
Sbjct: 223 APSPSGSQPATPPSPNSPPKG-SPPPPRTPTPP-------PPARSPPPLSP-PSSPQTPN 273

Query: 358 TPSGGYYNSPPQDSSPPS 411
           +PS    +SP  ++S P+
Sbjct: 274 SPS----DSPSVNNSTPN 287

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 59/145 (40%), Positives = 69/145 (47%), Gaps = 7/145 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG----SPPGSYDPTPSPPSGDGSY 171
           P P PP+     NP  S PP   +  P  SPP  S      SPP S  P  SPP      
Sbjct: 137 PPPPPPT-----NPPRSPPPPPPTEPPVTSPPPPSSNPPKSSPPPSEPPKTSPPPPS--- 188

Query: 172 NPTPSTPPSSDCTPPSQDSPPSD-PTPTTPSTPT--TPSGGYYNSPPQDSSPPTDPTPTT 342
            P P +PPS   + P +DSPP   P P + STP   +PSG    +PP  +SPP   +P  
Sbjct: 189 KPPPVSPPSPSPSSPPEDSPPPPVPVPPSNSTPPAPSPSGSQPATPPSPNSPPKG-SPPP 247

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDP 417
           P TPT P      SPP   SPPS P
Sbjct: 248 PRTPTPPPPA--RSPPP-LSPPSSP 269

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 49/146 (33%), Positives = 64/146 (43%), Gaps = 7/146 (4%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--DGSYNPT 180
           +P P S   +  PT ++ P      P  SPP     S P S  P   PP G    + +P 
Sbjct: 5   SPPPNSSPSAVPPTSAATPP----PPLSSPPPPPESSTPPSSQPNADPPDGAAGSTSSPP 60

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPT---TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
           P +PP+    PP    PP  PTP+   +PS+P  PS      PP  ++PP  P P+ P  
Sbjct: 61  PQSPPAVPAAPPPASPPPPPPTPSLANSPSSPPPPSP----PPPSPNAPPPTPPPSPPIA 116

Query: 352 PTTPSGGYYNSP--PQDSSPPSDPLP 423
           P  P       P  P  +SPP  P P
Sbjct: 117 PVPPPSNPSPPPLTPPPTSPPPPPPP 142

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 50/146 (34%), Positives = 64/146 (43%), Gaps = 9/146 (6%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
           TP PP       P  S+PP   S  P   PP  + GS   S  P  SPP+   +  P P+
Sbjct: 22  TPPPPLSSPPPPPESSTPP---SSQPNADPPDGAAGST--SSPPPQSPPAVPAA--PPPA 74

Query: 187 TPPSSDCTP-----PSQDSPPSDPTPT----TPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
           +PP    TP     PS   PPS P P+     P+ P +P       P   S PP  P PT
Sbjct: 75  SPPPPPPTPSLANSPSSPPPPSPPPPSPNAPPPTPPPSPPIAPVPPPSNPSPPPLTPPPT 134

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDP 417
           +P  P  P+    + PP    PP++P
Sbjct: 135 SPPPPPPPTNPPRSPPP---PPPTEP 157

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 41/116 (35%), Positives = 57/116 (49%), Gaps = 3/116 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDS---GGSPPGSYDPTPSPPSGDGSYN 174
           P P+ P      +P+PSSPP      P P PPS+S     SP GS   TP  P+     +
Sbjct: 185 PPPSKPPPVSPPSPSPSSPPEDSPPPPVPVPPSNSTPPAPSPSGSQPATPPSPNSPPKGS 244

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
           P P   P+    PP++  PP  P P++P TP +PS    +SP  ++S P     +T
Sbjct: 245 PPPPRTPTPP--PPARSPPPLSP-PSSPQTPNSPS----DSPSVNNSTPNGSPNST 293

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 40/95 (42%), Positives = 46/95 (48%), Gaps = 1/95 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTP-SPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P P PPS     N TP +P   GS   TP SP S   GSPP    PTP PP+     +P 
Sbjct: 211 PVPVPPS-----NSTPPAPSPSGSQPATPPSPNSPPKGSPPPPRTPTPPPPAR----SPP 261

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGG 285
           P +PPSS  TP S    PS    T   +P + S G
Sbjct: 262 PLSPPSSPQTPNSPSDSPSVNNSTPNGSPNSTSKG 296

[31][TOP]
>UniRef100_A8JFD4 Glyoxal or galactose oxidase (Fragment) n=1 Tax=Chlamydomonas
           reinhardtii RepID=A8JFD4_CHLRE
          Length = 898

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 59/143 (41%), Positives = 68/143 (47%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
           P P PPS      P+P SP       P+PSPPS S  SP  P    P+PSPPS      P
Sbjct: 199 PPPPPPS------PSPPSPSPPSPSPPSPSPPSPSPPSPRPPSPRPPSPSPPS------P 246

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
           +P +P      PPS   PP  P P +P  P+ P      SPP  S PP  P+P TPS P 
Sbjct: 247 SPPSPRPPSPRPPS--PPPPSPPPPSPPPPSPPP----PSPPPPSPPPPSPSPPTPSPPP 300

Query: 358 TPSGGYYN-SPPQDSSPPSDPLP 423
            PS    + SPP    PP  P P
Sbjct: 301 PPSTVLTSPSPPPSPPPPRPPSP 323

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 60/156 (38%), Positives = 71/156 (45%), Gaps = 16/156 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
           P+P+PPS     +P+P SP       P+PSPPS S  S  PP    P+P PPS      P
Sbjct: 214 PSPSPPSPSPP-SPSPPSPRPPSPRPPSPSPPSPSPPSPRPPSPRPPSPPPPSPPPPSPP 272

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYN-SPPQDSSPPTDPTPTTPSTP 354
            PS PP S   PP    PP  P+P TPS P  PS    + SPP    PP  P+P  P  P
Sbjct: 273 PPSPPPPS---PPPPSPPPPSPSPPTPSPPPPPSTVLTSPSPPPSPPPPRPPSPPPPRPP 329

Query: 355 -----------TTPSGGYYNSPPQDSS--PPSDPLP 423
                        PSG  +   P D+   PP  P P
Sbjct: 330 PPRPPLPGTGGPKPSGDAFPPTPPDAPLFPPLSPSP 365

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 56/141 (39%), Positives = 65/141 (46%), Gaps = 3/141 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
           P+P+PPS      P+P SP       P+PSPPS    SP  P    P+PSPPS       
Sbjct: 204 PSPSPPS------PSPPSPSPPSPSPPSPSPPSPRPPSPRPPSPSPPSPSPPSPRPPSPR 257

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP-TTPSTP 354
            PS PP S   PP    PP  P P +P  P+ P      SPP  S PP   T  T+PS P
Sbjct: 258 PPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPS--PSPPTPSPPPPPSTVLTSPSPP 312

Query: 355 TTPSGGYYNSPPQDSSPPSDP 417
            +P      SPP    PP  P
Sbjct: 313 PSPPPPRPPSPPPPRPPPPRP 333

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 55/141 (39%), Positives = 67/141 (47%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P+PPS     +P+P SP       P+P PPS S   PP    P+P PPS      P P
Sbjct: 209 PSPSPPSPSPP-SPSPPSPSPPSPRPPSPRPPSPS---PPSPSPPSPRPPSPRPPSPPPP 264

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT-PTTPSTPTT 360
           S PP S   PP    PP  P P +P  P +PS    + PP  S+  T P+ P +P  P  
Sbjct: 265 SPPPPS---PPPPSPPPPSPPPPSP-PPPSPSPPTPSPPPPPSTVLTSPSPPPSPPPPRP 320

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           PS      PP    PP  PLP
Sbjct: 321 PS-----PPPPRPPPPRPPLP 336

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 57/142 (40%), Positives = 64/142 (45%), Gaps = 3/142 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P+PPS     +P P SPP      P+P PPS    SPP    P PSP     S  P P
Sbjct: 244 PSPSPPS-PRPPSPRPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPTPSPPPPP 302

Query: 184 STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQ-DSSPPTDP-TPTTPSTP 354
           ST  +S   PPS   P P  P P  P  P  P  G     P  D+ PPT P  P  P  P
Sbjct: 303 STVLTSPSPPPSPPPPRPPSPPPPRPPPPRPPLPGTGGPKPSGDAFPPTPPDAPLFP--P 360

Query: 355 TTPSGGYYNSPPQDSSPPSDPL 420
            +P      SPP    PPS PL
Sbjct: 361 LSP------SPPALMRPPSPPL 376

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 48/143 (33%), Positives = 59/143 (41%), Gaps = 5/143 (3%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPT--PSPPSGDGSYNPTP 183
           P PP      +P+P  PP      P P PP  +  S P    P   P PP    S +P  
Sbjct: 152 PPPPPAQSPMSPSPPRPPPSPP-PPRPPPPVVTPASRPADSSPPLPPRPPPPPPSPSPPS 210

Query: 184 STPPSSDCTPPSQDSP-PSDPTPTT--PSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            +PPS     PS  SP P  P P +  P +P+ PS    +  P    PP+ P P+ P   
Sbjct: 211 PSPPSPSPPSPSPPSPSPPSPRPPSPRPPSPSPPSPSPPSPRPPSPRPPSPPPPSPPPPS 270

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
             P      SPP  S PP  P P
Sbjct: 271 PPPPSPPPPSPPPPSPPPPSPSP 293

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 52/146 (35%), Positives = 62/146 (42%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P    PP       +PSPP      PP    P P PP    +  P  
Sbjct: 135 PPPGPPLPPLPPRPQTPPPPPPAQSPMSPSPPRPPPSPPP----PRPPPPVVTPASRPAD 190

Query: 184 STPPSSDCTPPSQDSP----PSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
           S+PP     PP   SP    PS P+P+ PS +P +PS     SP   S  P  P+P +PS
Sbjct: 191 SSPPLPPRPPPPPPSPSPPSPSPPSPSPPSPSPPSPSP---PSPRPPSPRPPSPSPPSPS 247

Query: 349 TPT-TPSGGYYNSPPQDSSPPSDPLP 423
            P+  P      SPP  S PP  P P
Sbjct: 248 PPSPRPPSPRPPSPPPPSPPPPSPPP 273

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 53/150 (35%), Positives = 59/150 (39%), Gaps = 9/150 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPS----SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P P PPS               PP G    P P  P      PP     +PSPP    S 
Sbjct: 113 PPPKPPSPPKKKKKKVKVKKRPPPPGPPLPPLPPRPQTPPPPPPAQSPMSPSPPRPPPS- 171

Query: 172 NPTPSTPPSSDCTP---PSQDSPPSDP-TPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
            P P  PP    TP   P+  SPP  P  P  P +P+ PS     SPP  S P   P   
Sbjct: 172 -PPPPRPPPPVVTPASRPADSSPPLPPRPPPPPPSPSPPS----PSPPSPSPPSPSPPSP 226

Query: 340 TPSTPTTPSGGYYNSPPQDSSP-PSDPLPR 426
           +P +P  PS      PP  S P PS P PR
Sbjct: 227 SPPSPRPPS----PRPPSPSPPSPSPPSPR 252

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 52/175 (29%), Positives = 59/175 (33%), Gaps = 35/175 (20%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSY-DPTPSPPSDSGGSPPGSYD-----PTPSPPSGD- 162
           P P  P+      P P  P GG S     P PP      PP         P P+P  GD 
Sbjct: 30  PRPPSPAPVAPRPPLPRPPIGGASNATAVPRPPPLLATPPPSPLTVATPGPVPAPMPGDS 89

Query: 163 --------------GSYNPTPSTPPSSDCTPPSQ-------------DSPPSDPTPTTPS 261
                         G+ +P P  PP    +PP +               PP  P P  P 
Sbjct: 90  TDSADAPTAALIGGGNPSPRPPRPPPKPPSPPKKKKKKVKVKKRPPPPGPPLPPLPPRPQ 149

Query: 262 TPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP-TTPSGGYYNSPPQDSSPPSDPLP 423
           TP  P        P    PP  P P  P  P  TP+     S P DSSPP  P P
Sbjct: 150 TPPPPPPAQSPMSPSPPRPPPSPPPPRPPPPVVTPA-----SRPADSSPPLPPRP 199

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 50/172 (29%), Positives = 60/172 (34%), Gaps = 32/172 (18%)
 Frame = +1

Query: 4   PTPTPPSGDGSY-----NPTP--SSPPGGGSYDPTPSP-PSDSGGSPPGSYDPTPSPPSG 159
           P P PP G  S       P P  ++PP       TP P P+   G    S D   +   G
Sbjct: 43  PLPRPPIGGASNATAVPRPPPLLATPPPSPLTVATPGPVPAPMPGDSTDSADAPTAALIG 102

Query: 160 DGSYNPTPSTPPSSDCTPPSQDS-------------PPSDPTPTTPSTPTTPSGGYYNSP 300
            G+ +P P  PP    +PP +               PP  P P  P TP  P        
Sbjct: 103 GGNPSPRPPRPPPKPPSPPKKKKKKVKVKKRPPPPGPPLPPLPPRPQTPPPPPPAQSPMS 162

Query: 301 PQDSSPPTDPTPTTPSTPT-TPSGGYYNS----------PPQDSSPPSDPLP 423
           P    PP  P P  P  P  TP+    +S          PP   SPPS   P
Sbjct: 163 PSPPRPPPSPPPPRPPPPVVTPASRPADSSPPLPPRPPPPPPSPSPPSPSPP 214

[32][TOP]
>UniRef100_B9HWP9 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9HWP9_POPTR
          Length = 390

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 58/144 (40%), Positives = 69/144 (47%), Gaps = 3/144 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTP---SPPSDSGGSPPGSYDPTPSPPSGDGSYN 174
           P P PP    S  P  SS P   S  P P   +PP  S   PP S  P+ +PP    +  
Sbjct: 83  PQPPPPMTSRS-PPLSSSDPPSNSNSPPPLSATPPVSSPPPPPPSNPPSTAPPPPLLN-P 140

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           PT S+PPS   TPP    PPS   P   S+P+ P     +SPP  SSPP   +P  PS P
Sbjct: 141 PTSSSPPSPSTTPPQNSPPPSSTPPPQSSSPSPPQ---ISSPPPPSSPPPQSSPPPPSLP 197

Query: 355 TTPSGGYYNSPPQDSSPPSDPLPR 426
              S    ++PP  SSPPS P  R
Sbjct: 198 PQSSPPPPSTPPPQSSPPSQPSSR 221

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/138 (38%), Positives = 68/138 (49%), Gaps = 2/138 (1%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPP 195
           PPS   S  P  ++PP      P PS P  +   PP    PT S P    +  P  S PP
Sbjct: 101 PPSNSNSPPPLSATPPVSSPPPPPPSNPPSTAPPPPLLNPPTSSSPPSPSTTPPQNSPPP 160

Query: 196 SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP--TDPTPTTPSTPTTPSG 369
           SS  TPP Q S PS P  ++P  P++P     +SPP  S PP  + P P+TP   ++P  
Sbjct: 161 SS--TPPPQSSSPSPPQISSPPPPSSPPP--QSSPPPPSLPPQSSPPPPSTPPPQSSPPS 216

Query: 370 GYYNSPPQDSSPPSDPLP 423
              + PPQ+S PP  P P
Sbjct: 217 QPSSRPPQNSPPPPPPTP 234

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 56/149 (37%), Positives = 65/149 (43%), Gaps = 8/149 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTP--------SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSG 159
           P P PPS   S  P P        SSPP   +  P  SPP  S   P  S   +PSPP  
Sbjct: 120 PPPPPPSNPPSTAPPPPLLNPPTSSSPPSPSTTPPQNSPPPSSTPPPQSS---SPSPPQ- 175

Query: 160 DGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
             S  P  S PP S   PPS     S P P+TP   ++P     + PPQ+S PP  PTP 
Sbjct: 176 ISSPPPPSSPPPQSSPPPPSLPPQSSPPPPSTPPPQSSPPSQPSSRPPQNSPPPPPPTPP 235

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
             S P         SPP  +S P +  PR
Sbjct: 236 PASLPPP-----RRSPPPPASTPPENSPR 259

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 58/154 (37%), Positives = 72/154 (46%), Gaps = 14/154 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD-SGGSPPGSYDPTPSPPSGDGSYNPT 180
           P P+PP       PT S+PP      P P PP   +  SPP S   +  PPS   S  P 
Sbjct: 57  PAPSPPPQTPP--PTVSNPPPATPSTPPPQPPPPMTSRSPPLS---SSDPPSNSNSPPPL 111

Query: 181 PSTPPSSDCTPPSQDSPPSDP----------TPTTPSTPTTPSGGYYNSPPQDSSPPTD- 327
            +TPP S   PP    PPS+P           P T S+P +PS     +PPQ+S PP+  
Sbjct: 112 SATPPVSSPPPP----PPSNPPSTAPPPPLLNPPTSSSPPSPS----TTPPQNSPPPSST 163

Query: 328 --PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             P  ++PS P   S    +SPP  SSPP   LP
Sbjct: 164 PPPQSSSPSPPQISSPPPPSSPPPQSSPPPPSLP 197

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 54/162 (33%), Positives = 74/162 (45%), Gaps = 22/162 (13%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDP-TPSPPSGDGSYNPT 180
           P+ TPP  +G+  P+ +S P   S  P  SPP+    +PP    P  PSPP       P 
Sbjct: 12  PSATPPPLNGTPPPSSTSSPPQASSPPPTSPPTQPNANPPDPRTPPAPSPPP----QTPP 67

Query: 181 PST---PPSSDCTPPSQDSPP----------SDPTPTTPSTP--------TTPSGGYYNS 297
           P+    PP++  TPP Q  PP          SDP   + S P        ++P     ++
Sbjct: 68  PTVSNPPPATPSTPPPQPPPPMTSRSPPLSSSDPPSNSNSPPPLSATPPVSSPPPPPPSN 127

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PP  + PP    P T S+P +PS     +PPQ+S PPS   P
Sbjct: 128 PPSTAPPPPLLNPPTSSSPPSPS----TTPPQNSPPPSSTPP 165

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 55/147 (37%), Positives = 66/147 (44%), Gaps = 23/147 (15%)
 Frame = +1

Query: 40  NPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP-SPPSGDGSYNPTPSTPPSSDCTPP 216
           +P+P+SPP         +PP  S  SPP +  P P SPP+   +  P P TPP+   +PP
Sbjct: 5   SPSPNSPPSATPPPLNGTPPPSSTSSPPQASSPPPTSPPTQPNANPPDPRTPPAP--SPP 62

Query: 217 SQDSPP--SDPTPTTPSTPTT--PSGGYYNSPPQDSSPP------------TDPTPTTPS 348
            Q  PP  S+P P TPSTP    P      SPP  SS P            T P  + P 
Sbjct: 63  PQTPPPTVSNPPPATPSTPPPQPPPPMTSRSPPLSSSDPPSNSNSPPPLSATPPVSSPPP 122

Query: 349 TP------TTPSGGYYNSPPQDSSPPS 411
            P      T P     N PP  SSPPS
Sbjct: 123 PPPSNPPSTAPPPPLLN-PPTSSSPPS 148

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 56/146 (38%), Positives = 67/146 (45%), Gaps = 8/146 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGD---GSYN 174
           P+ TPP      +P PSS P   S   +PSPP  S   PP S  P  SPP       S  
Sbjct: 149 PSTTPPQN----SPPPSSTPPPQS--SSPSPPQISSPPPPSSPPPQSSPPPPSLPPQSSP 202

Query: 175 PTPSTPPSSDCTPPSQDS--PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP--TT 342
           P PSTPP    +PPSQ S  PP +  P  P TP   S      PP+ S PP   TP   +
Sbjct: 203 PPPSTPPPQS-SPPSQPSSRPPQNSPPPPPPTPPPAS----LPPPRRSPPPPASTPPENS 257

Query: 343 PSTPTTPSGGYYNSPPQDS-SPPSDP 417
           P  P + +    N PP    +PP+ P
Sbjct: 258 PRPPISIAPRPSNVPPPPRLTPPTSP 283

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 49/137 (35%), Positives = 58/137 (42%), Gaps = 3/137 (2%)
 Frame = +1

Query: 7   TPTPPS-GDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           +P PPS    S  P PS+PP      P  SPPS      P S  P  SPP       P P
Sbjct: 190 SPPPPSLPPQSSPPPPSTPP------PQSSPPSQ-----PSSRPPQNSPP-------PPP 231

Query: 184 STPPSSDCTPPSQDSPP--SDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            TPP +   PP +  PP  S P   +P  P + +    N PP    PP    PT+P    
Sbjct: 232 PTPPPASLPPPRRSPPPPASTPPENSPRPPISIAPRPSNVPP----PPRLTPPTSPQATP 287

Query: 358 TPSGGYYNSPPQDSSPP 408
            PS    +S P   SPP
Sbjct: 288 VPS----DSNPPALSPP 300

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 48/143 (33%), Positives = 62/143 (43%), Gaps = 6/143 (4%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP---PSGDGSYNP 177
           +P PPS      P  SSPP      P+  PP +S   PP    PTP P   P    S  P
Sbjct: 201 SPPPPSTP----PPQSSPPS----QPSSRPPQNSPPPPP----PTPPPASLPPPRRSPPP 248

Query: 178 TPSTPPSSDCTPPSQDSP-PSD-PTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
             STPP +   PP   +P PS+ P P   + PT+P        P DS+PP    P     
Sbjct: 249 PASTPPENSPRPPISIAPRPSNVPPPPRLTPPTSPQA---TPVPSDSNPPALSPPKIRLA 305

Query: 352 PTTPSGGYYNSP-PQDSSPPSDP 417
           P  P     + P P +++ P+ P
Sbjct: 306 P--PPRALVSPPSPTNNTAPNSP 326

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 42/100 (42%), Positives = 52/100 (52%), Gaps = 19/100 (19%)
 Frame = +1

Query: 172 NPTPSTPPSS-----DCTPP--SQDSPP--SDPTPTTPST-----PTTPSGGYYNSPPQD 309
           +P+P++PPS+     + TPP  S  SPP  S P PT+P T     P  P      SPP  
Sbjct: 5   SPSPNSPPSATPPPLNGTPPPSSTSSPPQASSPPPTSPPTQPNANPPDPRTPPAPSPPPQ 64

Query: 310 SSPPT--DPTPTTPST--PTTPSGGYYNSPPQDSS-PPSD 414
           + PPT  +P P TPST  P  P      SPP  SS PPS+
Sbjct: 65  TPPPTVSNPPPATPSTPPPQPPPPMTSRSPPLSSSDPPSN 104

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 37/104 (35%), Positives = 46/104 (44%), Gaps = 1/104 (0%)
 Frame = +1

Query: 115 SPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPST-PTTPSGGYY 291
           SP  +  P+ +PP  +G    TP  PPSS  +PP   SPP    PT P+  P  P     
Sbjct: 5   SPSPNSPPSATPPPLNG----TP--PPSSTSSPPQASSPPPTSPPTQPNANPPDP----- 53

Query: 292 NSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            +PP  S PP  P PT  + P          P   S+PP  P P
Sbjct: 54  RTPPAPSPPPQTPPPTVSNPP----------PATPSTPPPQPPP 87

[33][TOP]
>UniRef100_A8IGC9 Fibrocystin-L-like protein n=1 Tax=Chlamydomonas reinhardtii
            RepID=A8IGC9_CHLRE
          Length = 4806

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 56/146 (38%), Positives = 68/146 (46%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS----GDGSY 171
            P+P PPS      P P SP   G   P+P PP+    SPP    P+P+PPS       S 
Sbjct: 4549 PSPVPPS------PAPPSPAPPGPLPPSPRPPAPPSPSPPSPRPPSPNPPSPRPPAPPSP 4602

Query: 172  NPTPSTPPSSDCTPPSQDS-PPSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPTTP 345
             P P  PPS    PP   S PP+ P P  P +P+ PS    + PP+  SP P  P P  P
Sbjct: 4603 PPKPPVPPSPPPKPPVPPSPPPAPPMPPRPPSPSPPSPRPPSPPPRPPSPTPPSPKPPGP 4662

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
            S P  P     +  P   +PPS P P
Sbjct: 4663 SPPPAPP----SPSPPSPAPPSPPSP 4684

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 58/144 (40%), Positives = 67/144 (46%), Gaps = 6/144 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS      PTP SP   G   P P+PPS S  SP     P+P+PP       P+P
Sbjct: 4645 PPPRPPS------PTPPSPKPPGP-SPPPAPPSPSPPSPAPPSPPSPAPPVPPSPVPPSP 4697

Query: 184  STPPSSDCTPPSQDSP----PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP--TPTTP 345
            S PPS     PS  SP    P  P P  P +PT PS      PP+  SPP  P   P+ P
Sbjct: 4698 S-PPSPAPPSPSPPSPLPPVPPSPLPPRPPSPTPPS----PKPPRPPSPPPAPPVPPSPP 4752

Query: 346  STPTTPSGGYYNSPPQDSSPPSDP 417
             +P  P G     PP+  SPP  P
Sbjct: 4753 PSPPVPPG----PPPKPPSPPRPP 4772

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 52/150 (34%), Positives = 69/150 (46%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS--GDGSYNP 177
            P+P+PPS      P P +PP      P P  P+    +PP    P+P+PPS    G   P
Sbjct: 4516 PSPSPPS------PRPPAPPSPSPPSPRPPSPAPPSPAPPSPVPPSPAPPSPAPPGPLPP 4569

Query: 178  TPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPT-TPSGGYYNSPP-----QDSSPPTDPTP 336
            +P  P     +PPS   P P+ P+P  P+ P+  P      SPP       S PP  P P
Sbjct: 4570 SPRPPAPPSPSPPSPRPPSPNPPSPRPPAPPSPPPKPPVPPSPPPKPPVPPSPPPAPPMP 4629

Query: 337  TTPSTPTTPSGGYYNSPPQDSSP-PSDPLP 423
              P +P+ PS    + PP+  SP P  P P
Sbjct: 4630 PRPPSPSPPSPRPPSPPPRPPSPTPPSPKP 4659

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/148 (36%), Positives = 63/148 (42%), Gaps = 10/148 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDP---TPSPPSDSGGSPPGSYDPTPSPPSGDGSYN 174
            P P  P       P P SPP      P   +PSPPS    SPP    P+P+PPS      
Sbjct: 4604 PKPPVPPSPPPKPPVPPSPPPAPPMPPRPPSPSPPSPRPPSPPPR-PPSPTPPSPKPPGP 4662

Query: 175  PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT-------DPT 333
              P  PPS     P+  SPPS P P  P +P  PS    +  P   SPP+        P 
Sbjct: 4663 SPPPAPPSPSPPSPAPPSPPS-PAPPVPPSPVPPSPSPPSPAPPSPSPPSPLPPVPPSPL 4721

Query: 334  PTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
            P  P +PT PS      PP+  SPP  P
Sbjct: 4722 PPRPPSPTPPS----PKPPRPPSPPPAP 4745

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 49/143 (34%), Positives = 61/143 (42%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS      P+P SP       P+P PP+    SPP    P+P+PPS      P P
Sbjct: 4500 PRPLPPSPRPPRPPSPPSPS-----PPSPRPPAPPSPSPPSPRPPSPAPPS------PAP 4548

Query: 184  STPPSSDCTPPSQDSP---PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
             +P      PPS   P   P  P P  P +P+ PS    +  P    PP  P+P  P  P
Sbjct: 4549 PSPVPPSPAPPSPAPPGPLPPSPRPPAPPSPSPPSPRPPSPNPPSPRPPAPPSP--PPKP 4606

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
              P       P   S PP+ P+P
Sbjct: 4607 PVPPSPPPKPPVPPSPPPAPPMP 4629

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 54/136 (39%), Positives = 62/136 (45%), Gaps = 5/136 (3%)
 Frame = +1

Query: 31   GSYNPTPSSPP-----GGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPP 195
            G  +P P  PP         +DP P+PPS    SPP    P PSPP      +P P +PP
Sbjct: 4229 GQLSPPPMPPPMPVLLNMVVFDP-PAPPSPP--SPPLPPSPAPSPPPSPAPPSPAPPSPP 4285

Query: 196  SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGY 375
            S    PPS  +PP  P+P  PS    PS G   SPP     P  P P  PS P  P    
Sbjct: 4286 SP--APPSP-TPPGPPSPRLPSPAPPPSPGIAVSPPV----PPSPAPPRPSPPVPPPSPA 4338

Query: 376  YNSPPQDSSPPSDPLP 423
              SPPQ   PP+ P P
Sbjct: 4339 PPSPPQ---PPAPPSP 4351

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 51/136 (37%), Positives = 57/136 (41%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PP      N     PP   S    P PPS +   PP    P+P+PPS         
Sbjct: 4233 PPPMPPPMPVLLNMVVFDPPAPPSPPSPPLPPSPAPSPPPSPAPPSPAPPS--------- 4283

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
              PPS    PPS  +PP  P+P  PS    PS G   SPP     P  P P  PS P  P
Sbjct: 4284 --PPSP--APPS-PTPPGPPSPRLPSPAPPPSPGIAVSPP----VPPSPAPPRPSPPVPP 4334

Query: 364  SGGYYNSPPQDSSPPS 411
                  SPPQ  +PPS
Sbjct: 4335 PSPAPPSPPQPPAPPS 4350

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 52/137 (37%), Positives = 58/137 (42%), Gaps = 8/137 (5%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPT----PSPPSDSGGSPPGSYDPTPSPPS----G 159
            P+PTPPS      P PS PP   S  P     PSPPS +   PP    P+PSPPS     
Sbjct: 4650 PSPTPPSPKP---PGPSPPPAPPSPSPPSPAPPSPPSPAPPVPPSPVPPSPSPPSPAPPS 4706

Query: 160  DGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
                +P P  PPS     P   +PPS   P  PS P  P      SPP     P  P P 
Sbjct: 4707 PSPPSPLPPVPPSPLPPRPPSPTPPSPKPPRPPSPPPAPP--VPPSPPPSPPVPPGPPPK 4764

Query: 340  TPSTPTTPSGGYYNSPP 390
             PS P  P    Y+  P
Sbjct: 4765 PPSPPRPPRLRLYSPFP 4781

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 52/156 (33%), Positives = 66/156 (42%), Gaps = 16/156 (10%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG--SPPGSYDPTPSPPSGDGSYNP 177
            P+P PPS      P P SP       P+P+PPS      SPP    P P PPS      P
Sbjct: 4460 PSPRPPS------PRPPSPVPPSPVPPSPAPPSPRPPLPSPPAPRPPRPLPPSPRPPRPP 4513

Query: 178  TPSTPPSSDCTPPSQDSP---------PSDPTPTTPS----TPTTPSGGYYNSPPQDSSP 318
            +P +P      PP+  SP         P+ P+P  PS    +P  PS       P    P
Sbjct: 4514 SPPSPSPPSPRPPAPPSPSPPSPRPPSPAPPSPAPPSPVPPSPAPPSPAPPGPLPPSPRP 4573

Query: 319  PTDPTPTTPS-TPTTPSGGYYNSPPQDSSPPSDPLP 423
            P  P+P+ PS  P +P+      P   S PP  P+P
Sbjct: 4574 PAPPSPSPPSPRPPSPNPPSPRPPAPPSPPPKPPVP 4609

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 50/140 (35%), Positives = 60/140 (42%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SPP      P PSPP+     PP    P+P PPS      P P
Sbjct: 4431 PSPAPPS------PDPPSPPP----LPPPSPPTPPSPRPPSPRPPSPRPPS------PVP 4474

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             +P      PPS   P   P    P  P  PS      PP+  SPP+ P+P +P  P  P
Sbjct: 4475 PSPVPPSPAPPSPRPPLPSPPAPRPPRPLPPS----PRPPRPPSPPS-PSPPSPRPPAPP 4529

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
            S    +  P   +PPS   P
Sbjct: 4530 SPSPPSPRPPSPAPPSPAPP 4549

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 55/147 (37%), Positives = 65/147 (44%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGS-----YDPTPSPPSGDGS 168
            P+P PPS      P P SPP      P+P P      SPP +       P+PSPPS    
Sbjct: 4587 PSPNPPS---PRPPAPPSPPPKPPVPPSPPPKPPVPPSPPPAPPMPPRPPSPSPPS---- 4639

Query: 169  YNPTPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPTT 342
              P P +PP     PPS   P P  P P+ P  P +P      SPP  + P P  P P  
Sbjct: 4640 --PRPPSPPP---RPPSPTPPSPKPPGPSPPPAPPSP------SPPSPAPPSPPSPAPPV 4688

Query: 343  PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P +P  PS    +  P   SPPS PLP
Sbjct: 4689 PPSPVPPSPSPPSPAPPSPSPPS-PLP 4714

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 47/145 (32%), Positives = 60/145 (41%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSG----DGSY 171
            P+P PPS      P+P +PP      P P  P      PP    P+P+PPS         
Sbjct: 4436 PSPDPPSPPPLPPPSPPTPPSPRPPSPRPPSPRPPSPVPPSPVPPSPAPPSPRPPLPSPP 4495

Query: 172  NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPS 348
             P P  P      PP   SPPS P+P +P  P  PS    +  P   +PP+   P+  P 
Sbjct: 4496 APRPPRPLPPSPRPPRPPSPPS-PSPPSPRPPAPPSPSPPSPRPPSPAPPSPAPPSPVPP 4554

Query: 349  TPTTPSGGYYNSPPQDSSPPSDPLP 423
            +P  PS       P    PP+ P P
Sbjct: 4555 SPAPPSPAPPGPLPPSPRPPAPPSP 4579

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 45/120 (37%), Positives = 58/120 (48%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
            P+PPS     +P PS PP      P+P+PP     SPP    P+P+PP       P+P+ 
Sbjct: 4255 PSPPSPPLPPSPAPSPPPSPAP--PSPAPP-----SPPSPAPPSPTPPGPPSPRLPSPAP 4307

Query: 190  PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
            PPS    P    SPP  P+P  P  P+ P       PP   +PP+ P P  P +P  PSG
Sbjct: 4308 PPS----PGIAVSPPVPPSP-APPRPSPP------VPPPSPAPPSPPQPPAPPSP-NPSG 4355

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 45/126 (35%), Positives = 55/126 (43%), Gaps = 5/126 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PP       P+PS PP      P+PSPPS     PP    P P  P+      P P
Sbjct: 4682 PSPAPPVPPSPVPPSPS-PPSPAP--PSPSPPSPLPPVPPSPLPPRPPSPTPPSPKPPRP 4738

Query: 184  STPPSSDCTPPS-QDSP--PSDPTPTTPSTPTTPSGGYYNSPPQD--SSPPTDPTPTTPS 348
             +PP +   PPS   SP  P  P P  PS P  P    Y+  P    ++ P    PTT +
Sbjct: 4739 PSPPPAPPVPPSPPPSPPVPPGPPPKPPSPPRPPRLRLYSPFPSQPFAAQPAAAQPTT-A 4797

Query: 349  TPTTPS 366
             P T S
Sbjct: 4798 APITHS 4803

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 40/113 (35%), Positives = 48/113 (42%), Gaps = 7/113 (6%)
 Frame = +1

Query: 109  GGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGY 288
            G +PP    P+P PPS      P+P TPPS    PPS   P   P    P +P  PS   
Sbjct: 4427 GRAPPSPAPPSPDPPSPPPLPPPSPPTPPSP--RPPSPRPPSPRPPSPVPPSPVPPSPAP 4484

Query: 289  YN------SPPQDSSP-PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
             +      SPP    P P  P+P  P  P+ PS    +  P     PS P PR
Sbjct: 4485 PSPRPPLPSPPAPRPPRPLPPSPRPPRPPSPPSPSPPSPRPPAPPSPSPPSPR 4537

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 29/82 (35%), Positives = 40/82 (48%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P+P+ P       P+P+PP   G +      P+P+PP       P+P
Sbjct: 4277 PSPAPPSPPSPAPPSPTPPGPPSPRLPSPAPPPSPGIAVSPPVPPSPAPP------RPSP 4330

Query: 184  STPPSSDCTPPSQDSPPSDPTP 249
              PP S   PPS   PP+ P+P
Sbjct: 4331 PVPPPSP-APPSPPQPPAPPSP 4351

[34][TOP]
>UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas
           reinhardtii RepID=A8J1N3_CHLRE
          Length = 527

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 55/147 (37%), Positives = 62/147 (42%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS        PS PP  G   P+P+PPS S  SPP    P+P PP       PTP
Sbjct: 197 PSPLPPSPRPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPP---PPSPQPPVPPSPAPPTP 253

Query: 184 STPPSSDCTPPSQDSPPS-------DPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             PP     PP+   PPS        P+P  PS P  PS      PP    P  +P    
Sbjct: 254 PGPPPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPPPS----PEPPSPKPPSPEPPSPQ 309

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  P  P   Y  SP   S PP  P P
Sbjct: 310 PPLPPPPPSPYPPSPSPPSPPPPSPPP 336

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 50/141 (35%), Positives = 64/141 (45%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SP     Y P+P+PP      PP  Y P+P+PP+     +P P
Sbjct: 374 PSPAPPSPQPPLPPPPPSP-----YPPSPAPPVPPSPPPPSPYPPSPAPPAPP---SPPP 425

Query: 184 STPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
             PP     PP    PP  P P+  P +P  PS    + PP    PP  P P +P+ P  
Sbjct: 426 PPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPPLP 485

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           PS    +  P   +PP  P P
Sbjct: 486 PSPPPPSPYPPSPAPPVPPSP 506

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/146 (35%), Positives = 67/146 (45%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P  PP      P+PSPPS    SP     P+P+PP+  G   P+P
Sbjct: 202 PSPRPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTPPGPPPPSP 261

Query: 184 STP---PSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP-- 345
           + P   P     PPS   P P  P+P  P +P  PS    +  P    PP  P P +P  
Sbjct: 262 APPNPPPPPSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPPPSPYP 321

Query: 346 STPTTPSGGYYNSPPQDSSPPSDPLP 423
            +P+ PS    + PP   +PPS   P
Sbjct: 322 PSPSPPSPPPPSPPPPSPAPPSPAPP 347

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 56/143 (39%), Positives = 66/143 (46%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD-SGGSPPGSYDPTPSPPSGDGSYNPT 180
           P+P PPS      P P SPP    Y P+P+PP+  S   PP    P P PP     + P 
Sbjct: 390 PSPYPPS---PAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPFPPFPPP 446

Query: 181 PSTPPSSDCTP-PSQDSPPSDPTPTTPST-PTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           PS PP S   P P+  SPP  P P  PS  P +P+     SPP  S  P  P P  P +P
Sbjct: 447 PSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPPLPPSPPPPSPYPPSPAPPVPPSP 506

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
             PS       P   +PPS P P
Sbjct: 507 APPS-----PEPPSPAPPSPPPP 524

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 45/121 (37%), Positives = 59/121 (48%), Gaps = 1/121 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P+P+ P   G   P+P+PP+     PP    P+P PPS +    P P
Sbjct: 233 PSPPPPSPQPPVPPSPAPPTPPGPPPPSPAPPNPP--PPPSPAPPSPKPPSPEPPSPPPP 290

Query: 184 STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            +P      PPS + P P  P P  P +P  PS     SPP  S PP  P P +P+ P+ 
Sbjct: 291 PSPEPPSPKPPSPEPPSPQPPLPPPPPSPYPPSPSP-PSPPPPSPPPPSPAPPSPAPPSP 349

Query: 361 P 363
           P
Sbjct: 350 P 350

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 54/154 (35%), Positives = 63/154 (40%), Gaps = 14/154 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS +      P  PP    Y P+PSPPS    SPP    P+P+PPS        P
Sbjct: 296 PSPKPPSPEPPSPQPPLPPPPPSPYPPSPSPPSPPPPSPP---PPSPAPPSP-----APP 347

Query: 184 STPPSSDC-----------TPPSQDSP---PSDPTPTTPSTPTTPSGGYYNSPPQDSSPP 321
           S PP  +C            PPS   P   P  P P  P  P +P       P   S PP
Sbjct: 348 SPPPPCECLAGERELTCAFLPPSPLPPSPAPPSPQPPLPPPPPSPYPPSPAPPVPPSPPP 407

Query: 322 TDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             P P +P+ P  PS      PP    PP  P P
Sbjct: 408 PSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPFP 441

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 54/140 (38%), Positives = 62/140 (44%), Gaps = 1/140 (0%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
           TP+PPS      P P SP       P+P PPS     PPG   P+P+PPS      P+P 
Sbjct: 193 TPSPPS------PLPPSPR-----PPSPKPPSPP--PPPGPPPPSPAPPS------PSPP 233

Query: 187 TPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           +PP     PPS   P P  P P TP  P  PS    N PP  S  P  P P +P  P+ P
Sbjct: 234 SPP-----PPSPQPPVPPSPAPPTPPGPPPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPP 288

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PPS   P
Sbjct: 289 -------PPPSPEPPSPKPP 301

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 54/161 (33%), Positives = 64/161 (39%), Gaps = 21/161 (13%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPG-----GGSYD-------PTPSPPSDSGGS--------PP 123
           P+P PPS      P P SPP       G  +       P+P PPS +  S        PP
Sbjct: 337 PSPAPPS------PAPPSPPPPCECLAGERELTCAFLPPSPLPPSPAPPSPQPPLPPPPP 390

Query: 124 GSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPP 303
             Y P+P+PP       P+P  P  +   PPS   PP  P P  P  P  P      SPP
Sbjct: 391 SPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPFPPFPPPPSPP 450

Query: 304 QDS-SPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             S  PP+   P+ P  P  P    Y   P    PPS P P
Sbjct: 451 PPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPPLPPSPPPP 491

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 53/147 (36%), Positives = 63/147 (42%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P PS  P      P+P+PP+  G  PP    P P PP      +P P
Sbjct: 223 PSPAPPSPSPPSPPPPSPQP---PVPPSPAPPTPPGPPPPSPAPPNPPPPPSPAPPSPKP 279

Query: 184 STP-PSSDCTPPSQDSP------PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
            +P P S   PPS + P      P  P+P  P  P  PS   Y   P   SPP  P+P  
Sbjct: 280 PSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPPPSP--YPPSPSPPSPP-PPSPPP 336

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PS P  PS           +PPS P P
Sbjct: 337 PS-PAPPS----------PAPPSPPPP 352

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 40/112 (35%), Positives = 49/112 (43%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P+PP       P P  PP    + P PSPP  S G PP    P+P PP       P PS 
Sbjct: 421 PSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPG-PPSPAPPSPPPPPPP----PPPSP 475

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
            P S   P     PP  P P +P+ P  PS    +  P   +PP+ P P +P
Sbjct: 476 YPPSPAPPLPPSPPPPSPYPPSPAPPVPPSPAPPSPEPPSPAPPSPPPPPSP 527

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 46/126 (36%), Positives = 52/126 (41%), Gaps = 4/126 (3%)
 Frame = +1

Query: 58  PPGGGSYDPTPSPPSDSG-GSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPP 234
           PP G       +   DSG G  P     TPSPPS      P P +P      PPS   PP
Sbjct: 165 PPAGSPPGVCTAAIFDSGNGCCPQVQAGTPSPPS------PLPPSPRPPSPKPPSPPPPP 218

Query: 235 SDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT--TPSTPTTPSGGYYNSPPQDSSP 405
             P P+  P +P+ PS      PP    PP  P+P   TP  P  PS    N PP  S  
Sbjct: 219 GPPPPSPAPPSPSPPS-----PPPPSPQPPVPPSPAPPTPPGPPPPSPAPPNPPPPPSPA 273

Query: 406 PSDPLP 423
           P  P P
Sbjct: 274 PPSPKP 279

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 31/82 (37%), Positives = 39/82 (47%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P  PP    Y P+P+PP      PP  Y P+P+PP       P  
Sbjct: 452 PSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPPLPPSPPPPSPYPPSPAPPV------PPS 505

Query: 184 STPPSSDCTPPSQDSPPSDPTP 249
             PPS +   P+  SPP  P+P
Sbjct: 506 PAPPSPEPPSPAPPSPPPPPSP 527

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 41/146 (28%), Positives = 56/146 (38%), Gaps = 16/146 (10%)
 Frame = +1

Query: 34  SYNPTPSSPPGGGSYDPTP---------------SPPSDSGGSPPGSYDPTPSPPSGDGS 168
           +Y+  P  PPGG     T                   +   G+  G+ +    PP+G   
Sbjct: 112 AYDQPPDGPPGGTILRLTQLGLTAATANGARLCIKLTAGRNGTGCGTLEQMCVPPAGSPP 171

Query: 169 YNPTPSTPPSSD-CTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
              T +   S + C P  Q   PS P+P  PS P  PS    + PP    PP  P P +P
Sbjct: 172 GVCTAAIFDSGNGCCPQVQAGTPSPPSPLPPS-PRPPSPKPPSPPPPPGPPPPSPAPPSP 230

Query: 346 STPTTPSGGYYNSPPQDSSPPSDPLP 423
           S P+ P        P   +PP+ P P
Sbjct: 231 SPPSPPPPSPQPPVPPSPAPPTPPGP 256

[35][TOP]
>UniRef100_Q6SSE6 Plus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE6_CHLRE
          Length = 3409

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 53/141 (37%), Positives = 66/141 (46%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS        PS PP      P+P+PPS +   PP    P+P+PPS D    P  
Sbjct: 933  PSPAPPSPAPPSPEPPSPPPPPSPAPPSPAPPSPT---PPSPVPPSPAPPSPD----PPS 985

Query: 184  STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
              PPS D   P+  SP P  P P +P  PT PS G    PP    P   P+P  P+ PT+
Sbjct: 986  PAPPSPDPPSPAPPSPAPPSPNPPSPVPPTPPSPG----PPSPEPPSPAPSPPPPTPPTS 1041

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            P       P  +   P+ PLP
Sbjct: 1042 PPPPPPEPPSPEPPSPAPPLP 1062

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 56/144 (38%), Positives = 69/144 (47%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS     +PTP SP       P+P PPS +  SP  P    P+P+PPS +   +P
Sbjct: 954  PSPAPPS-PAPPSPTPPSPVPPSPAPPSPDPPSPAPPSPDPPSPAPPSPAPPSPNPP-SP 1011

Query: 178  TPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPTTPST 351
             P TPPS     P   SP PS P PT P++P  P       PP+  SP P  P P  P +
Sbjct: 1012 VPPTPPSPGPPSPEPPSPAPSPPPPTPPTSPPPP-------PPEPPSPEPPSPAPPLPPS 1064

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P    PPS   P
Sbjct: 1065 PEPPSPAPPSPAPPSPQPPSPAPP 1088

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 57/141 (40%), Positives = 70/141 (49%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS +      PS PP      P+P+PPS    SPP    P+P+PPS     +PTP
Sbjct: 912  PSPQPPSPEPPSPEPPSPPPPPSPAPPSPAPPSPEPPSPPP--PPSPAPPS-PAPPSPTP 968

Query: 184  STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
             +P      PPS D P P+ P+P  PS P  PS    +  P    PPT P+P  PS P  
Sbjct: 969  PSPVPPSPAPPSPDPPSPAPPSPDPPS-PAPPSPAPPSPNPPSPVPPTPPSPGPPS-PEP 1026

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            PS     SPP  + P S P P
Sbjct: 1027 PSPA--PSPPPPTPPTSPPPP 1045

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 53/144 (36%), Positives = 66/144 (45%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS     +P P SP       P+P+PPS +  S  PP    P+P+PPS      P
Sbjct: 1063 PSPEPPS-PAPPSPAPPSPQPPSPAPPSPAPPSPAPPSPAPPSPEPPSPAPPSPSPPAPP 1121

Query: 178  TPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS-T 351
            +P  P  +   PPS D P P+ P+P  P  PT+P       P    SPP  P+P  PS  
Sbjct: 1122 SPEPPSPAPLLPPSPDPPSPAPPSPMPPPLPTSPPSPEPVPPTPPPSPPAPPSPAPPSPQ 1181

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  P      SP   S  P  P P
Sbjct: 1182 PLEPPSPEPPSPAPPSPAPPSPAP 1205

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 49/147 (33%), Positives = 63/147 (42%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS----GDGSY 171
            P+P PP+   S  P P  PP      P+P+PP      PP    P+P+PPS         
Sbjct: 1031 PSPPPPTPPTSPPPPPPEPPS--PEPPSPAPPLPPSPEPPSPAPPSPAPPSPQPPSPAPP 1088

Query: 172  NPTPSTPPSSDCTPPSQDSP---PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
            +P P +P      PPS + P   P  P+P  P +P  PS      P  D   P  P+P  
Sbjct: 1089 SPAPPSPAPPSPAPPSPEPPSPAPPSPSPPAPPSPEPPSPAPLLPPSPDPPSPAPPSPMP 1148

Query: 343  PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PT+P       P    SPP+ P P
Sbjct: 1149 PPLPTSPPSPEPVPPTPPPSPPAPPSP 1175

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/143 (35%), Positives = 69/143 (48%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS +   +P P SP       P+P+PPS +  +PP    P+P+PPS +      P
Sbjct: 703  PSPAPPSPEPP-SPAPPSPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPEPPSPAPP 761

Query: 184  STPPSSDCTP---PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            S  P S   P   P   +PP+ P+P  PS P  PS    +  P   +PP+ P P +PS P
Sbjct: 762  SPAPPSPAPPSPAPPSPAPPAPPSPEPPS-PAPPSPEPPSPAPPSPAPPS-PEPPSPSPP 819

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
              PS    +  P    PPS   P
Sbjct: 820  APPSPEPPSPAPPSPFPPSPQPP 842

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/151 (33%), Positives = 71/151 (47%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGD---GSYN 174
            P+P PPS D   +P P SP       P+P+PPS +  SP     P+P PPS +    + +
Sbjct: 974  PSPAPPSPDPP-SPAPPSPDPPSPAPPSPAPPSPNPPSPVPPTPPSPGPPSPEPPSPAPS 1032

Query: 175  PTPSTPPSSDCTPPSQDSPPSDPTPT-------TPSTPTTPSGGYYNSPPQDSSPPTDPT 333
            P P TPP+S   PP +   P  P+P         P +P  PS    +  P   +PP+   
Sbjct: 1033 PPPPTPPTSPPPPPPEPPSPEPPSPAPPLPPSPEPPSPAPPSPAPPSPQPPSPAPPSPAP 1092

Query: 334  PT-TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P+  P +P  PS    +  P   SPP+ P P
Sbjct: 1093 PSPAPPSPAPPSPEPPSPAPPSPSPPAPPSP 1123

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 52/141 (36%), Positives = 62/141 (43%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SP       P+P PPS +  SP     P+P PPS      P P
Sbjct: 1083 PSPAPPS------PAPPSPAPPSPAPPSPEPPSPAPPSPSPPAPPSPEPPS------PAP 1130

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPTTPSTPTT 360
              PPS D   P+  SP   P PT+P +P         SPP   SP P  P P  P +P  
Sbjct: 1131 LLPPSPDPPSPAPPSPMPPPLPTSPPSPEPVPPTPPPSPPAPPSPAPPSPQPLEPPSPEP 1190

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            PS    +  P   +PPS   P
Sbjct: 1191 PSPAPPSPAPPSPAPPSPEPP 1211

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 51/144 (35%), Positives = 66/144 (45%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS      P P SP       P+P PPS +  S  PP    P+P+PPS +   +P
Sbjct: 852  PSPVPPS------PAPPSPAPPSPEPPSPEPPSPAPPSLEPPSPAPPSPAPPSPEPP-SP 904

Query: 178  TPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
             P +P      PPS + P P  P+P  P +P  PS    +  P    PP  P P +P+ P
Sbjct: 905  APPSPAPPSPQPPSPEPPSPEPPSPPPPPSPAPPSPAPPSPEPPSPPPPPSPAPPSPAPP 964

Query: 355  T-TPSGGYYNSPPQDSSPPSDPLP 423
            + TP      SP   S  P  P P
Sbjct: 965  SPTPPSPVPPSPAPPSPDPPSPAP 988

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/146 (36%), Positives = 70/146 (47%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS +   +P P SP       P+P+PPS    +PP    P+P PPS +    P P
Sbjct: 877  PSPAPPSLEPP-SPAPPSPAPPSPEPPSPAPPSP---APPSPQPPSPEPPSPEPPSPPPP 932

Query: 184  STPPSSDCTPPSQD--SPPSDPTPTTPS----TPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
             +P      PPS +  SPP  P+P  PS    +PT PS      PP  + P  DP    P
Sbjct: 933  PSPAPPSPAPPSPEPPSPPPPPSPAPPSPAPPSPTPPS----PVPPSPAPPSPDPPSPAP 988

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
             +P  PS    +  P   +PPS P+P
Sbjct: 989  PSPDPPSPAPPSPAPPSPNPPS-PVP 1013

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 51/145 (35%), Positives = 67/145 (46%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS +   +P P SP       P+P+PPS +  +PP    P+P+PPS      P P
Sbjct: 746  PSPAPPSPEPP-SPAPPSPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPS------PEP 798

Query: 184  STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSP----PTDPTPTTPS 348
             +P      PPS + P PS P P +P  P+      +   PQ  SP    P  P+P  PS
Sbjct: 799  PSPAPPSPAPPSPEPPSPSPPAPPSPEPPSPAPPSPFPPSPQPPSPEPPSPAPPSPVPPS 858

Query: 349  TPTTPSGGYYNSPPQDSSPPSDPLP 423
             P  PS    +  P    PPS   P
Sbjct: 859  -PAPPSPAPPSPEPPSPEPPSPAPP 882

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 52/145 (35%), Positives = 66/145 (45%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P P  PS     +P P SP     + P+P PPS    SP  P    P+P+PPS     +P
Sbjct: 811  PEPPSPSPPAPPSPEPPSPAPPSPFPPSPQPPSPEPPSPAPPSPVPPSPAPPS-PAPPSP 869

Query: 178  TPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT--DPTPTTPS 348
             P +P      PPS + P P+ P+P  PS P  PS    +  P    PP+   P+P  PS
Sbjct: 870  EPPSPEPPSPAPPSLEPPSPAPPSPAPPS-PEPPSPAPPSPAPPSPQPPSPEPPSPEPPS 928

Query: 349  TPTTPSGGYYNSPPQDSSPPSDPLP 423
             P  PS    +  P    PPS P P
Sbjct: 929  PPPPPSPAPPSPAPPSPEPPSPPPP 953

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 56/149 (37%), Positives = 69/149 (46%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP--------GSYDPTPSPPSG 159
            P+P PPS +   +P P SP       P+P PPS    SPP            P+P PPS 
Sbjct: 892  PSPAPPSPEPP-SPAPPSPAPPSPQPPSPEPPSPEPPSPPPPPSPAPPSPAPPSPEPPSP 950

Query: 160  DGSYNPTPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
                +P P +P     TPPS   P P+ P+P  PS P  PS    +  P   +PP+ P P
Sbjct: 951  PPPPSPAPPSPAPPSPTPPSPVPPSPAPPSPDPPS-PAPPSPDPPSPAPPSPAPPS-PNP 1008

Query: 337  TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             +P  PT PS G   SP   S  PS P P
Sbjct: 1009 PSPVPPTPPSPG-PPSPEPPSPAPSPPPP 1036

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 48/143 (33%), Positives = 62/143 (43%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS     +P P SP       P+P PPS     PP    P+P PPS      P P
Sbjct: 612  PSPAPPSPPPP-SPAPPSPAPPSPAPPSPQPPSPVPPQPPSPVPPSPKPPS------PAP 664

Query: 184  STPPSSDCTPPSQDSP---PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
             +P      PPS   P   P +P P +P+ P  PS      PP  + P  +P    P +P
Sbjct: 665  PSPVPPSPAPPSPAPPSPAPPNPAPPSPAPPLPPS----PEPPSPAPPSPEPPSPAPPSP 720

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
              PS    +  P   +PP+ P P
Sbjct: 721  APPSPAPPSPAPPSPAPPAPPSP 743

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/140 (35%), Positives = 64/140 (45%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SP       P P+PPS +   PP    P+P+PPS      P P
Sbjct: 665  PSPVPPS------PAPPSPAPPSPAPPNPAPPSPAPPLPPSPEPPSPAPPS------PEP 712

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             +P      PPS  +PPS P P +P+ P  PS      PP  + P  +P    P +P  P
Sbjct: 713  PSPAPPSPAPPS-PAPPS-PAPPSPAPPAPPS----PEPPSPAPPSPEPPSPAPPSPAPP 766

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
            S    +  P   +PP+ P P
Sbjct: 767  SPAPPSPAPPSPAPPAPPSP 786

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 55/144 (38%), Positives = 69/144 (47%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SP       P+P+PPS +  SP  P    P+P+PPS       
Sbjct: 862  PSPAPPSPEPP-SPEPPSPAPPSLEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPQPPSPE 920

Query: 178  TPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPTTPST 351
             PS  P S   PPS   P P+ P+P  PS P  PS     +PP  + P PT P+P  PS 
Sbjct: 921  PPSPEPPSPPPPPSPAPPSPAPPSPEPPSPPPPPS----PAPPSPAPPSPTPPSPVPPS- 975

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P    PPS   P
Sbjct: 976  PAPPSPDPPSPAPPSPDPPSPAPP 999

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/149 (32%), Positives = 62/149 (41%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS      P P  PP      P P  P     +PP    P+P+PPS     +P P
Sbjct: 685  PNPAPPS------PAPPLPPSPEPPSPAPPSPEPPSPAPPSPAPPSPAPPS-PAPPSPAP 737

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS----- 348
              PPS +  PPS   P  +P    P +P  PS    +  P   +PP  P+P  PS     
Sbjct: 738  PAPPSPE--PPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPS 795

Query: 349  ----TPTTPSGGYYNSPPQDSSPPSDPLP 423
                +P  PS    +  P   SPP+ P P
Sbjct: 796  PEPPSPAPPSPAPPSPEPPSPSPPAPPSP 824

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 50/145 (34%), Positives = 67/145 (46%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4    PTPTPPS----GDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
            P+P PPS         +P P SP       P+P PPS +   PP    P+P+PPS     
Sbjct: 1266 PSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPEPPSPAPPQPPSPVPPSPAPPS----- 1320

Query: 172  NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTPTTPS 348
             PTP  P  +   PP   S P+ P P  P++P  +PS      P   + PP  P P +P+
Sbjct: 1321 -PTPPAPAPAAALPPLPPS-PAPPLPVPPASPAPSPSPLRPPQPQTPAMPPPSPAPPSPA 1378

Query: 349  TPTTPSGGYYNSPPQDSSPPSDPLP 423
             P +P+      PP   +PP  PLP
Sbjct: 1379 -PPSPAPPGVPPPPPTPTPPLAPLP 1402

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 50/140 (35%), Positives = 63/140 (45%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SP       P+P+PPS +   PP    P P+PPS      P P
Sbjct: 650  PSPVPPS------PKPPSPAPPSPVPPSPAPPSPA---PPSPAPPNPAPPS------PAP 694

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
              PPS +  PPS   P  +P    P +P  PS    +  P   +PP  P+P  PS P  P
Sbjct: 695  PLPPSPE--PPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPAPPSPEPPS-PAPP 751

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
            S    +  P   +PPS   P
Sbjct: 752  SPEPPSPAPPSPAPPSPAPP 771

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 57/151 (37%), Positives = 71/151 (47%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPT--PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
            P+P PPS   S  P   P+SPP      P+P PPS +   PP    P+P+PPS      P
Sbjct: 1022 PSPEPPSPAPSPPPPTPPTSPPPPPPEPPSPEPPSPAPPLPPSPEPPSPAPPS------P 1075

Query: 178  TPSTPPSSDCTPPSQDSP---PSDPTPTTPS--TPTTPSGGYYNSPPQDSSP-PTDPTPT 339
             P +P      PPS   P   P  P P +P   +P  PS     SPP   SP P  P P 
Sbjct: 1076 APPSPQPPSPAPPSPAPPSPAPPSPAPPSPEPPSPAPPS----PSPPAPPSPEPPSPAPL 1131

Query: 340  TPSTPTTPSGGYYN--SPPQDSSPPS-DPLP 423
             P +P  PS    +   PP  +SPPS +P+P
Sbjct: 1132 LPPSPDPPSPAPPSPMPPPLPTSPPSPEPVP 1162

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 46/141 (32%), Positives = 61/141 (43%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTP-PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            P P P P+   S  P P +PP      P+P+PPS     PP    P+P+PPS      P 
Sbjct: 1146 PMPPPLPTSPPSPEPVPPTPPPSPPAPPSPAPPSPQPLEPPSPEPPSPAPPS------PA 1199

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            P +P      PPS + P  +P    P +P  PS     +PP  + P   P    P +P  
Sbjct: 1200 PPSPAPPSPEPPSPEPPSPEPPSPAPPSPAPPS----PAPPSPAPPSPAPPSPAPPSPQP 1255

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            PS    +  P   +PPS   P
Sbjct: 1256 PSPAPPSPEPPSPAPPSPAPP 1276

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 55/143 (38%), Positives = 66/143 (46%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP     + P+P SPP   S  P+P PPS     PP    P+P+PPS      P P
Sbjct: 576 PRPSPPF----HPPSPDSPPAS-SVPPSPEPPSPK---PPSPAPPSPAPPSP-----PPP 622

Query: 184 STPPSSDCTP-PSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPTTPSTP 354
           S  P S   P P+  SP P  P P  P +P  PS      PP  + P P  P+P  PS P
Sbjct: 623 SPAPPSPAPPSPAPPSPQPPSPVPPQPPSPVPPS----PKPPSPAPPSPVPPSPAPPS-P 677

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
             PS    N  P   +PP  P P
Sbjct: 678 APPSPAPPNPAPPSPAPPLPPSP 700

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 50/140 (35%), Positives = 62/140 (44%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS     +P P +PP      P P  P     +PP    P+P+PPS     +P P
Sbjct: 723  PSPAPPS-PAPPSPAPPAPPSPEPPSPAPPSPEPPSPAPPSPAPPSPAPPS-PAPPSPAP 780

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
              PPS +  PPS   P  +P    P +P  PS       P   SPP  P+P  PS P  P
Sbjct: 781  PAPPSPE--PPSPAPPSPEPPSPAPPSPAPPS-----PEPPSPSPPAPPSPEPPS-PAPP 832

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
            S  +  SP   S  P  P P
Sbjct: 833  S-PFPPSPQPPSPEPPSPAP 851

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 49/151 (32%), Positives = 65/151 (43%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS--------- 156
            P+P PPS +   +P P SP       P+PSPP+     PP    P+P PPS         
Sbjct: 789  PSPAPPSPEPP-SPAPPSPAPPSPEPPSPSPPAPPSPEPPSPAPPSPFPPSPQPPSPEPP 847

Query: 157  GDGSYNPTPSTPPSSDCTPPSQDSP-PSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDP 330
                 +P P +P      PPS + P P  P+P  PS  P +P      +PP  + P  +P
Sbjct: 848  SPAPPSPVPPSPAPPSPAPPSPEPPSPEPPSPAPPSLEPPSP------APPSPAPPSPEP 901

Query: 331  TPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
                P +P  PS    +  P    PPS P P
Sbjct: 902  PSPAPPSPAPPSPQPPSPEPPSPEPPSPPPP 932

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 54/145 (37%), Positives = 67/145 (46%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SP       P+P PPS +   PP    P+P+PPS     +P P
Sbjct: 597 PSPEPPS------PKPPSPAPPSPAPPSPPPPSPA---PPSPAPPSPAPPSPQPP-SPVP 646

Query: 184 STPPSSDCTPPSQDSP-PSDPTPTTPS----TPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
             PPS    PPS   P P+ P+P  PS    +P  PS    N  P   +PP  P+P  PS
Sbjct: 647 PQPPSP--VPPSPKPPSPAPPSPVPPSPAPPSPAPPSPAPPNPAPPSPAPPLPPSPEPPS 704

Query: 349 TPTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P   +PPS   P
Sbjct: 705 -PAPPSPEPPSPAPPSPAPPSPAPP 728

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 51/142 (35%), Positives = 63/142 (44%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SP       P+P PPS    +PP    P+P PPS +      P
Sbjct: 832  PSPFPPS------PQPPSPEPPSPAPPSPVPPSP---APPSPAPPSPEPPSPEPPSPAPP 882

Query: 184  STPPSSDCTP-PSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            S  P S   P P+  SP P  P P +P+ P+          P+  SPP  P+P  PS P 
Sbjct: 883  SLEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPQPPSPEPPSPEPPSPPPPPSPAPPS-PA 941

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             PS    + PP  S  P  P P
Sbjct: 942  PPSPEPPSPPPPPSPAPPSPAP 963

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 54/149 (36%), Positives = 73/149 (48%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SP       P+P+PPS +  S  PP    P+P+PPS +   +P
Sbjct: 1211 PSPEPPSPEPP-SPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPQPPSPAPPSPEPP-SP 1268

Query: 178  TPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPTTPST 351
             P +P      PPS   P P+ P+P  PS P  PS     +PPQ  SP P  P P +P+ 
Sbjct: 1269 APPSPAPPSPAPPSPAPPSPAPPSPAPPS-PEPPS----PAPPQPPSPVPPSPAPPSPTP 1323

Query: 352  PT-TPSGGYYNSPPQDSS----PPSDPLP 423
            P   P+      PP  +     PP+ P P
Sbjct: 1324 PAPAPAAALPPLPPSPAPPLPVPPASPAP 1352

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 49/141 (34%), Positives = 65/141 (46%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SP       P+P+PPS +   PP    P+P+PP+      P+P
Sbjct: 741  PSPEPPS------PAPPSPEPPSPAPPSPAPPSPA---PPSPAPPSPAPPAPPSPEPPSP 791

Query: 184  STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            + PPS +   P+  SP P  P P +PS P  PS      PP  + P   P    P +P  
Sbjct: 792  A-PPSPEPPSPAPPSPAPPSPEPPSPSPPAPPS----PEPPSPAPPSPFPPSPQPPSPEP 846

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            PS    +  P   +PPS   P
Sbjct: 847  PSPAPPSPVPPSPAPPSPAPP 867

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 50/151 (33%), Positives = 66/151 (43%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG----SPPGSYDPTPSPPSGDGSY 171
            P+P PPS +   +P P +PP  G   P+P PPS +      +PP S  P P  P      
Sbjct: 999  PSPAPPSPNPP-SPVPPTPPSPG--PPSPEPPSPAPSPPPPTPPTSPPPPPPEPPSPEPP 1055

Query: 172  NPTPSTPPSSDCTPPSQDSP------PSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDP 330
            +P P  PPS +   P+  SP      P  P P +P+ P+  P      SP   S  P  P
Sbjct: 1056 SPAPPLPPSPEPPSPAPPSPAPPSPQPPSPAPPSPAPPSPAPPSPAPPSPEPPSPAPPSP 1115

Query: 331  TPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            +P  P +P  PS      P  D   P+ P P
Sbjct: 1116 SPPAPPSPEPPSPAPLLPPSPDPPSPAPPSP 1146

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 52/149 (34%), Positives = 71/149 (47%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS-GDGSYNPT 180
            P+P PPS +   +P P SP       P+P+PPS +   PP    P+P+PPS    S  P 
Sbjct: 1201 PSPAPPSPEPP-SPEPPSPEPPSPAPPSPAPPSPA---PPSPAPPSPAPPSPAPPSPQPP 1256

Query: 181  PSTPPSSDCTPPSQDSP----PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
               PPS +   P+  SP    P+ P+P  PS P  PS    +  P   +PP  P+P  PS
Sbjct: 1257 SPAPPSPEPPSPAPPSPAPPSPAPPSPAPPS-PAPPSPAPPSPEPPSPAPPQPPSPVPPS 1315

Query: 349  ----TPTTPSGGYYNSPPQDSSPPSDPLP 423
                +PT P+     + P     P+ PLP
Sbjct: 1316 PAPPSPTPPAPAPAAALPPLPPSPAPPLP 1344

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 53/153 (34%), Positives = 69/153 (45%), Gaps = 13/153 (8%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS--------G 159
            P+P PPS +    P+P+ P       P+P PPS +   PP    P+P+PPS         
Sbjct: 1098 PSPAPPSPEP---PSPAPPSPSPPAPPSPEPPSPAPLLPPSPDPPSPAPPSPMPPPLPTS 1154

Query: 160  DGSYNPTPSTPPSSDCTPPSQDSPPSD-----PTPTTPSTPTTPSGGYYNSPPQDSSPPT 324
              S  P P TPP S   PPS  +PPS      P+P  PS P  PS     +PP  + P  
Sbjct: 1155 PPSPEPVPPTPPPSPPAPPSP-APPSPQPLEPPSPEPPS-PAPPS----PAPPSPAPPSP 1208

Query: 325  DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            +P    P +P  PS    +  P   +PPS   P
Sbjct: 1209 EPPSPEPPSPEPPSPAPPSPAPPSPAPPSPAPP 1241

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 51/143 (35%), Positives = 70/143 (48%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS     +P P SP       P+P PPS +  S  PP    P+P+PPS     +P
Sbjct: 1191 PSPAPPS-PAPPSPAPPSPEPPSPEPPSPEPPSPAPPSPAPPSPAPPSPAPPS-PAPPSP 1248

Query: 178  TPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
             P +P      PPS + P P+ P+P  PS P  PS    +  P   +PP+ P P +P+ P
Sbjct: 1249 APPSPQPPSPAPPSPEPPSPAPPSPAPPS-PAPPSPAPPSPAPPSPAPPS-PEPPSPAPP 1306

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
              PS    +  P   +PP+ P P
Sbjct: 1307 QPPSPVPPSPAPPSPTPPA-PAP 1328

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 48/149 (32%), Positives = 62/149 (41%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--------PGSYDPTPSPPSG 159
            P+P PPS      P+P  P       P+P PPS +  SP        P S +P P  P  
Sbjct: 1108 PSPAPPSPSPPAPPSPEPPSPAPLLPPSPDPPSPAPPSPMPPPLPTSPPSPEPVPPTPPP 1167

Query: 160  DGSYNPTPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
                 P+P+ P      PPS + P P+ P+P  PS P  PS      PP    P  +P  
Sbjct: 1168 SPPAPPSPAPPSPQPLEPPSPEPPSPAPPSPAPPS-PAPPS----PEPPSPEPPSPEPPS 1222

Query: 337  TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              P +P  PS    +  P   +PPS   P
Sbjct: 1223 PAPPSPAPPSPAPPSPAPPSPAPPSPAPP 1251

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 46/140 (32%), Positives = 58/140 (41%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SP       P+P PPS     PP    P+P+PPS     +P P
Sbjct: 1186 PSPEPPS------PAPPSPAPPSPAPPSPEPPSPE---PPSPEPPSPAPPS-PAPPSPAP 1235

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             +P      PPS   P   P    P +P  PS     +PP  + P   P    P +P  P
Sbjct: 1236 PSPAPPSPAPPSPAPPSPQPPSPAPPSPEPPS----PAPPSPAPPSPAPPSPAPPSPAPP 1291

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
            S    +  P   +PP  P P
Sbjct: 1292 SPAPPSPEPPSPAPPQPPSP 1311

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 54/146 (36%), Positives = 69/146 (47%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS     +P P SP       P+P+PPS +  SP  P    P+P+PPS +   +P
Sbjct: 1246 PSPAPPSPQPP-SPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPEPP-SP 1303

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPST----PTTPSGGYYNSPPQDSSPPTDPTPTTP 345
             P  PPS    PPS  +PPS PTP  P+     P  P       P   +SP   P+P  P
Sbjct: 1304 APPQPPSP--VPPSP-APPS-PTPPAPAPAAALPPLPPSPAPPLPVPPASPAPSPSPLRP 1359

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
              P TP+      PP   +PPS   P
Sbjct: 1360 PQPQTPA-----MPPPSPAPPSPAPP 1380

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 49/142 (34%), Positives = 64/142 (45%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS      P P SP       P+P PPS +  S  PP    P+PSPP+      P
Sbjct: 771  PSPAPPS---PAPPAPPSPEPPSPAPPSPEPPSPAPPSPAPPSPEPPSPSPPAPPSPEPP 827

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            +P+ PPS    PPS   P  +P    P +P  PS     +PP  + P  +P    P +P 
Sbjct: 828  SPA-PPSP--FPPSPQPPSPEPPSPAPPSPVPPS----PAPPSPAPPSPEPPSPEPPSPA 880

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             PS    +  P   +PPS   P
Sbjct: 881  PPSLEPPSPAPPSPAPPSPEPP 902

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 49/149 (32%), Positives = 62/149 (41%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS     +P P +PP      P P  P     +PP    P+P PPS      P+P
Sbjct: 766  PSPAPPS-PAPPSPAPPAPPSPEPPSPAPPSPEPPSPAPPSPAPPSPEPPSPSPPAPPSP 824

Query: 184  STP---PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTD--PTPTTPS 348
              P   P S   P  Q   P  P+P  PS P  PS    +  P    PP+   P+P  PS
Sbjct: 825  EPPSPAPPSPFPPSPQPPSPEPPSPAPPS-PVPPSPAPPSPAPPSPEPPSPEPPSPAPPS 883

Query: 349  ----TPTTPSGGYYNSPPQDSSPPSDPLP 423
                +P  PS    +  P   +PPS   P
Sbjct: 884  LEPPSPAPPSPAPPSPEPPSPAPPSPAPP 912

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 56/154 (36%), Positives = 68/154 (44%), Gaps = 14/154 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPP-----------GGGSYDPTPSPPSDSGGSPPGSYDPTPSP 150
           P P+PP    S  P P SPP           GG    P+P PPS     PP    P P P
Sbjct: 513 PPPSPPEPP-SPPPLPPSPPSPTPVARCIQVGGICDSPSPMPPSPRPPQPPSPPPPPPRP 571

Query: 151 PSGDGSYNPTPSTPPSSDCTPPSQDSPPS-DPTPTTPSTPTTPSGGYYNSPPQDSSPPTD 327
           P      +P P  PPS D +PP+   PPS +P    P +P  PS    + PP   +PP+ 
Sbjct: 572 PPRAPRPSP-PFHPPSPD-SPPASSVPPSPEPPSPKPPSPAPPSPAPPSPPPPSPAPPSP 629

Query: 328 PTPT-TPSTPTTPSGGYYNSPPQDSSP-PSDPLP 423
             P+  P +P  PS      PPQ  SP P  P P
Sbjct: 630 APPSPAPPSPQPPS----PVPPQPPSPVPPSPKP 659

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 50/151 (33%), Positives = 66/151 (43%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS     +P P SP       P+P+PPS    SP  P    P+P+PPS      P
Sbjct: 1231 PSPAPPS-PAPPSPAPPSPAPPSPQPPSPAPPSPEPPSPAPPSPAPPSPAPPS------P 1283

Query: 178  TPSTPPSSDCTPPSQDS----PPSDPTPTTPS----TPTTPSGGYYNSPPQDSSPPTDPT 333
             P +P      PPS +     PP  P+P  PS    +PT P+     + P     P  P 
Sbjct: 1284 APPSPAPPSPAPPSPEPPSPAPPQPPSPVPPSPAPPSPTPPAPAPAAALPPLPPSPAPPL 1343

Query: 334  PTTPSTPT-TPSGGYYNSPPQDSSPPSDPLP 423
            P  P++P  +PS      P   + PP  P P
Sbjct: 1344 PVPPASPAPSPSPLRPPQPQTPAMPPPSPAP 1374

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 50/138 (36%), Positives = 63/138 (45%), Gaps = 2/138 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS     +P P SP       P P  P     +PP    P+P+PPS      P+P
Sbjct: 756  PSPAPPS-PAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPEPPSPAPPS---PAPPSP 811

Query: 184  STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPTTPSTPT 357
              P  S   PPS + P P+ P+P  PS P  PS      PP  + P P  P+P  PS P 
Sbjct: 812  EPPSPSPPAPPSPEPPSPAPPSPFPPS-PQPPS----PEPPSPAPPSPVPPSPAPPS-PA 865

Query: 358  TPSGGYYNSPPQDSSPPS 411
             PS    +  P   +PPS
Sbjct: 866  PPSPEPPSPEPPSPAPPS 883

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 49/142 (34%), Positives = 61/142 (42%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            PTP PPS     +P P SP       P+P PPS +  S  PP    P+P PPS +     
Sbjct: 1163 PTP-PPSPPAPPSPAPPSPQP--LEPPSPEPPSPAPPSPAPPSPAPPSPEPPSPEPPSPE 1219

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
             PS  P S   P      P+ P+P  PS P  PS      PP  + P  +P    P +P 
Sbjct: 1220 PPSPAPPSPAPPSPAPPSPAPPSPAPPS-PAPPS----PQPPSPAPPSPEPPSPAPPSPA 1274

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             PS    +  P   +PPS   P
Sbjct: 1275 PPSPAPPSPAPPSPAPPSPAPP 1296

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 55/156 (35%), Positives = 61/156 (39%), Gaps = 15/156 (9%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS-PPGSYDPTPSPPSGDGSYNP 177
           DP      G+    P P SPP      P P PPS      PP    P PSPPS   S  P
Sbjct: 457 DPADHTQGGECLAPPPPPSPPSPRPPRPPPLPPSPPPPLLPPSPPVPPPSPPSPP-SPPP 515

Query: 178 TPSTPPSSDCTPPSQDSPPS--------------DPTPTTPSTPTTPSGGYYNSPPQDSS 315
           +P  PPS    PPS  SP                 P P +P  P  PS      PP    
Sbjct: 516 SPPEPPSPPPLPPSPPSPTPVARCIQVGGICDSPSPMPPSPRPPQPPS----PPPPPPRP 571

Query: 316 PPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PP  P P+ P  P +P     +SPP  S PPS   P
Sbjct: 572 PPRAPRPSPPFHPPSP-----DSPPASSVPPSPEPP 602

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 56/154 (36%), Positives = 67/154 (43%), Gaps = 14/154 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT---PSPPSDSGGS-PPGSYDPTPSPPSGDGSY 171
           P+P PP       P P  PP      P    PSP S    S PP    P+P PPS     
Sbjct: 554 PSPRPPQPPSPPPPPPRPPPRAPRPSPPFHPPSPDSPPASSVPPSPEPPSPKPPS-PAPP 612

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP----PTDPTPT 339
           +P P +PP     PPS    P+ P+P  PS P  PS      PPQ  SP    P  P+P 
Sbjct: 613 SPAPPSPPPPSPAPPS----PAPPSPAPPS-PQPPSP----VPPQPPSPVPPSPKPPSPA 663

Query: 340 TPS----TPTTPSGGYYNSPPQDSSPPS--DPLP 423
            PS    +P  PS    +  P + +PPS   PLP
Sbjct: 664 PPSPVPPSPAPPSPAPPSPAPPNPAPPSPAPPLP 697

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 40/125 (32%), Positives = 48/125 (38%), Gaps = 5/125 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P+P  PP      PTP  P+ +   PP    P P  P    S  P+P
Sbjct: 1296 PSPEPPSPAPPQPPSPV-PPSPAPPSPTPPAPAPAAALPPLPPSPAPPLPVPPASPAPSP 1354

Query: 184  ST-----PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
            S      P +    PPS   P   P P +P+ P                PP  PTPT P 
Sbjct: 1355 SPLRPPQPQTPAMPPPSPAPP--SPAPPSPAPP--------------GVPPPPPTPTPPL 1398

Query: 349  TPTTP 363
             P  P
Sbjct: 1399 APLPP 1403

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 45/130 (34%), Positives = 53/130 (40%), Gaps = 14/130 (10%)
 Frame = +1

Query: 76  YDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTT 255
           +DP          +PP    P PSPPS      P P  PP    +PP    PPS P P  
Sbjct: 456 HDPADHTQGGECLAPP----PPPSPPS------PRPPRPPPLPPSPPPPLLPPSPPVPP- 504

Query: 256 PSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPS--------GGYYNSP------PQ 393
           PS P+ PS      PP     P  P P  PS P +P+        GG  +SP      P+
Sbjct: 505 PSPPSPPS------PPPSPPEPPSPPPLPPS-PPSPTPVARCIQVGGICDSPSPMPPSPR 557

Query: 394 DSSPPSDPLP 423
              PPS P P
Sbjct: 558 PPQPPSPPPP 567

[36][TOP]
>UniRef100_B8PFG8 Predicted protein n=1 Tax=Postia placenta Mad-698-R
           RepID=B8PFG8_POSPM
          Length = 476

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 53/148 (35%), Positives = 67/148 (45%), Gaps = 10/148 (6%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP---SPPSGDGSYNPT 180
           P PP     + P P +PP   +  P PSPP  +  +PP S  PTP   + P+   S  PT
Sbjct: 228 PPPPPAPLRHRPPPQAPPPPPAAAPRPSPPRSAAPTPPRSAAPTPPRSAAPTPPRSAAPT 287

Query: 181 PS----TPPSSDCTPPSQDSPPSDPT---PTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
           P+     PP     PP+   PP+ P    P  P+ P  PSGG    PP   +P   P P 
Sbjct: 288 PAPPAPPPPRPTAAPPAPPPPPARPAVAPPPPPTRPAPPSGG--PPPPPPPAPSGGPPPP 345

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P  P  P+GG    PP    PPS  +P
Sbjct: 346 PPPPPPPPAGGAPPPPPPPPPPPSGGMP 373

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 48/142 (33%), Positives = 58/142 (40%), Gaps = 4/142 (2%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           PTPP       P  ++P    S  PTP+PP+     P  +    P PP+      P P T
Sbjct: 262 PTPPRSAAPTPPRSAAPTPPRSAAPTPAPPAPPPPRPTAAPPAPPPPPARPAVAPPPPPT 321

Query: 190 ---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
              PPS    PP   +P   P P  P  P  P+GG   +PP    PP  P+   P  P  
Sbjct: 322 RPAPPSGGPPPPPPPAPSGGPPPPPPPPPPPPAGG---APPPPPPPPPPPSGGMPPPPPP 378

Query: 361 PSGGYYNSPPQDSSP-PSDPLP 423
           P       PP   SP PS  LP
Sbjct: 379 P-------PPAGGSPGPSAGLP 393

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 44/130 (33%), Positives = 53/130 (40%), Gaps = 10/130 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPS----SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P P PP    +  P P     +PP GG   P P PP+ SGG PP    P P P  G    
Sbjct: 303 PAPPPPPARPAVAPPPPPTRPAPPSGGP--PPPPPPAPSGGPPPPPPPPPPPPAGGAPPP 360

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGG------YYNSPPQDSSPPTDPT 333
            P P  PPS    PP    PP+  +P   +    P+ G         S        TDP 
Sbjct: 361 PPPPPPPPSGGMPPPPPPPPPAGGSPGPSAGLPAPAPGRDALLASIQSAGVHMLRKTDPN 420

Query: 334 PTTPSTPTTP 363
             TP+ PT+P
Sbjct: 421 -ATPARPTSP 429

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 50/144 (34%), Positives = 58/144 (40%), Gaps = 6/144 (4%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP+        P  PP    + P P  P      PP +  P PSPP    S  PTP  
Sbjct: 219 PAPPAA----KKKPPPPPAPLRHRPPPQAPP-----PPPAAAPRPSPPR---SAAPTP-- 264

Query: 190 PPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT---PTTPSTPT 357
           P S+  TPP   +P P      TP+ P  P      +PP    PP  P    P  P+ P 
Sbjct: 265 PRSAAPTPPRSAAPTPPRSAAPTPAPPAPPPPRPTAAPPAPPPPPARPAVAPPPPPTRPA 324

Query: 358 TPSGGYYNSPPQDSS--PPSDPLP 423
            PSGG    PP   S  PP  P P
Sbjct: 325 PPSGGPPPPPPPAPSGGPPPPPPP 348

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 39/121 (32%), Positives = 48/121 (39%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PPSG G   P P +P GG    P P PP  +GG+PP    P P PP   G   P P  
Sbjct: 323 PAPPSG-GPPPPPPPAPSGGPPPPPPPPPPPPAGGAPPPP--PPPPPPPSGGMPPPPPPP 379

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           PP+     PS   P   P           +G +       ++ P  PT        + SG
Sbjct: 380 PPAGGSPGPSAGLPAPAPGRDALLASIQSAGVHMLRKTDPNATPARPTSPPAEESASSSG 439

Query: 370 G 372
           G
Sbjct: 440 G 440

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 41/125 (32%), Positives = 52/125 (41%), Gaps = 2/125 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPT--PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           PTP PP+      PT  P +PP   +      PP  +  +PP    P P PP+  G   P
Sbjct: 286 PTPAPPAPPPP-RPTAAPPAPPPPPARPAVAPPPPPTRPAPPSGGPPPPPPPAPSGGPPP 344

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            P  PP     PP+  +PP  P P  P     PSGG    PP    PP   +P   +   
Sbjct: 345 PPPPPPP----PPAGGAPPPPPPPPPP-----PSGGM--PPPPPPPPPAGGSPGPSAGLP 393

Query: 358 TPSGG 372
            P+ G
Sbjct: 394 APAPG 398

[37][TOP]
>UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO
          Length = 1765

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/140 (38%), Positives = 61/140 (43%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P+PPS     +P P  PP      P P PPS     PP    P PSPP     + P P
Sbjct: 1081 PPPSPPSPPSPPSPPPPPPPS----PPPPPPPSPPPPRPP----PPPSPP--PPVHEPPP 1130

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            S PP     PP+ D+PP  P P  PS P +P       PP    PP  P+P  P  P  P
Sbjct: 1131 SPPPPPSPPPPTPDAPPPSPPPPPPSPPPSPPPS--PPPPPSPMPPPPPSPPPPRPPPPP 1188

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
            S      PP    PPS P P
Sbjct: 1189 S----PPPPVHEPPPSPPPP 1204

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 52/145 (35%), Positives = 58/145 (40%), Gaps = 7/145 (4%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
            P+PPS      P P SPP      P P  P      PP  ++P PSPP       PTP  
Sbjct: 1086 PSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPDA 1145

Query: 190  PPSSDCTPPSQ---DSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP----TDPTPTTPS 348
            PP S   PP       PPS P P +P  P  PS      PP  S PP      P+P  P 
Sbjct: 1146 PPPSPPPPPPSPPPSPPPSPPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPP 1205

Query: 349  TPTTPSGGYYNSPPQDSSPPSDPLP 423
             P+ P       PP    PP  P P
Sbjct: 1206 NPSPPPPSPMPPPPSPMPPPPSPPP 1230

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 56/145 (38%), Positives = 61/145 (42%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPP-----GGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGS 168
            P P PPS      P P SPP        S  P PSPP  +  +PP S  P P PPS   S
Sbjct: 1103 PPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPDAPPPS--PPPPPPSPPPS 1160

Query: 169  YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
              P+P  PPS    PP    PP  P P +P  P          PP  S PP  P P  PS
Sbjct: 1161 PPPSPPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPS 1220

Query: 349  TPTTPSGGYYNSPPQDSSPPSDPLP 423
                P      SPP  S PP  P+P
Sbjct: 1221 PMPPPP-----SPPPPSPPPPSPMP 1240

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 53/142 (37%), Positives = 59/142 (41%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            +P P+PP       PTP +PP      P PSPP     SPP    P P PP       P 
Sbjct: 1127 EPPPSPPPPPSPPPPTPDAPPPSPP-PPPPSPPPSPPPSPPPPPSPMPPPPPSP----PP 1181

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            P  PP     PP  + PPS P P  PS P  PS      PP    PP  P P +P  P+ 
Sbjct: 1182 PRPPPPPSPPPPVHEPPPSPPPPPNPS-PPPPSP--MPPPPSPMPPPPSPPPPSPPPPSP 1238

Query: 361  PSGGYYNSPPQDSSPPSDPLPR 426
                    PP  S PP  P PR
Sbjct: 1239 MPPPPSPPPPIPSPPPPPPTPR 1260

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 50/139 (35%), Positives = 57/139 (41%), Gaps = 1/139 (0%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
            P PP+      P    PP        PSPPS     PP    P PSPP       P P  
Sbjct: 1065 PAPPAAAMDNRPCEKPPPPS-----PPSPPSPPSPPPP----PPPSPPPPPPPSPPPPRP 1115

Query: 190  PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT-TPS 366
            PP     PP  + PPS P P +P  P TP     + PP   SPP  P P+ P  P+  P 
Sbjct: 1116 PPPPSPPPPVHEPPPSPPPPPSP-PPPTPDAPPPSPPPPPPSPPPSPPPSPPPPPSPMPP 1174

Query: 367  GGYYNSPPQDSSPPSDPLP 423
                  PP+   PPS P P
Sbjct: 1175 PPPSPPPPRPPPPPSPPPP 1193

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 50/137 (36%), Positives = 58/137 (42%), Gaps = 2/137 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P+PP       P P SPP      P P PP      PP  ++P PSPP       P P
Sbjct: 1161 PPPSPPPPPSPMPPPPPSPP-----PPRPPPPPSP---PPPVHEPPPSPPPPPNPSPPPP 1212

Query: 184  ST--PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            S   PP S   PP    PPS P P+    P +P       PP  S PP  PTP +P    
Sbjct: 1213 SPMPPPPSPMPPPPSPPPPSPPPPSPMPPPPSPP------PPIPSPPPPPPTPRSPPPAP 1266

Query: 358  TPSGGYYNSPPQDSSPP 408
             P  G  +  P  +SPP
Sbjct: 1267 PPLPG--DVDPTPASPP 1281

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 47/130 (36%), Positives = 51/130 (39%), Gaps = 4/130 (3%)
 Frame = +1

Query: 49   PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDS 228
            P+ P       P   PP  S  SPP    P P PP       P+P  PP     PP    
Sbjct: 1065 PAPPAAAMDNRPCEKPPPPSPPSPPSPPSPPPPPP-------PSPPPPPPPSPPPPRPPP 1117

Query: 229  PPSDPTPT---TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSP-PQD 396
            PPS P P     PS P  PS      PP   +PP  P P  PS P +P       P P  
Sbjct: 1118 PPSPPPPVHEPPPSPPPPPS----PPPPTPDAPPPSPPPPPPSPPPSPPPSPPPPPSPMP 1173

Query: 397  SSPPSDPLPR 426
              PPS P PR
Sbjct: 1174 PPPPSPPPPR 1183

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 50/143 (34%), Positives = 54/143 (37%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PP       P P   P    ++P PSPP     SPP    P P PPS      P P
Sbjct: 1171 PMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPP-SPMPPPPSP----MPPP 1225

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP---PTDPTPTTPSTP 354
             +PP     PPS   PP  P P  PS P  P      SPP    P     DPTP +P   
Sbjct: 1226 PSPPPPSPPPPSPMPPPPSPPPPIPSPPPPPPTP--RSPPPAPPPLPGDVDPTPASPPVT 1283

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
                 GY    P       D LP
Sbjct: 1284 GRAVDGYLARCPVFVDVDGDGLP 1306

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 44/128 (34%), Positives = 48/128 (37%), Gaps = 3/128 (2%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPSS-PPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
            +P P+PP       P PS  PP      P PSPP  S   PP    P PSPP    S  P
Sbjct: 1196 EPPPSPPPPPNPSPPPPSPMPPPPSPMPPPPSPPPPSP-PPPSPMPPPPSPPPPIPSPPP 1254

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP--TTPST 351
             P TP S    PP       DPTP +P        GY    P       D  P    P  
Sbjct: 1255 PPPTPRSPPPAPPPLPG-DVDPTPASPPVTGRAVDGYLARCPVFVDVDGDGLPGRDEPRA 1313

Query: 352  PTTPSGGY 375
             T   GG+
Sbjct: 1314 TTDRLGGF 1321

[38][TOP]
>UniRef100_A0N015 Vegetative cell wall protein n=1 Tax=Chlamydomonas incerta
           RepID=A0N015_CHLIN
          Length = 613

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 50/149 (33%), Positives = 68/149 (45%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGS----- 168
           P+P PPS      P+P+ P       P+P PPS +  +PP    P+P+PPS   S     
Sbjct: 122 PSPVPPSPAPPVPPSPAPPSPAPPLPPSPVPPSPAPPAPPSPAPPSPAPPSPPPSPAPPS 181

Query: 169 ---YNPTPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
               +P P +PPS     P+  SP P  P P  P +P  PS    + PP  + P  +P  
Sbjct: 182 PEPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPVPPSPAPPSPAPPSPPPSPAPPSPEPPS 241

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             P +P  PS    +  P    PPS P+P
Sbjct: 242 PVPPSPAPPSPVPPSPAPPSPVPPSPPIP 270

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 53/144 (36%), Positives = 71/144 (49%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP   +  P+P PPS +  SPP    P+P+PPS     +P P
Sbjct: 161 PSPAPPS------PAPPSPPPSPA-PPSPEPPSPAPPSPPSPAPPSPAPPS-PAPPSPAP 212

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPTD--PTPTTPST 351
             PPS     P+  SPP  P P +P   +P  PS    +  P   +PP+   P+P  P +
Sbjct: 213 PVPPSPAPPSPAPPSPPPSPAPPSPEPPSPVPPSPAPPSPVPPSPAPPSPVPPSPPIPPS 272

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLP 423
           P  PS    +  P   +PPS P+P
Sbjct: 273 PAPPSPAPPSPVPPSPAPPS-PVP 295

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 57/152 (37%), Positives = 73/152 (48%), Gaps = 11/152 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS +   +P P SPP      P+P+PPS +  SP     P+P+PPS      P P
Sbjct: 175 PSPAPPSPEPP-SPAPPSPPSPAP--PSPAPPSPAPPSPAPPVPPSPAPPS------PAP 225

Query: 184 STPPSSDCTPPSQDSP------PSDPTPTTPS----TPTTPSGGYYNSPPQDSSPPTDPT 333
            +PP S   PPS + P      P+ P+P  PS    +P  PS     SP   S  P  P 
Sbjct: 226 PSPPPSP-APPSPEPPSPVPPSPAPPSPVPPSPAPPSPVPPSPPIPPSPAPPSPAPPSPV 284

Query: 334 PTTPSTPT-TPSGGYYNSPPQDSSPPSDPLPR 426
           P +P+ P+  P      SPP   SPP  P PR
Sbjct: 285 PPSPAPPSPVPPSPVPPSPPPPPSPPPPPPPR 316

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 57/150 (38%), Positives = 70/150 (46%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP-PGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYN 174
           P+P PPS      P+P+ P P   S  P+P+PPS    SP  P    P+P PPS     +
Sbjct: 203 PSPAPPSPAPPVPPSPAPPSPAPPSPPPSPAPPSPEPPSPVPPSPAPPSPVPPS-PAPPS 261

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTP----- 336
           P P +PP      P   +PPS P P +P+ P+  P      SPP   SPP  P P     
Sbjct: 262 PVPPSPPIPPSPAPPSPAPPS-PVPPSPAPPSPVPPSPVPPSPPPPPSPPPPPPPRPPFP 320

Query: 337 -TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             TP  P+ PS      PP   SPPS P P
Sbjct: 321 ANTPMPPSPPSPPPSPPPPTPPSPPSPPPP 350

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 53/151 (35%), Positives = 69/151 (45%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGG----GSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P+PTPPS +   +P P SPP          P+P PPS +   PP    P+P+PPS     
Sbjct: 70  PSPTPPSPEPP-SPAPPSPPPSPAPPSPAPPSPVPPSPAPPLPPSPVPPSPAPPS-PVPP 127

Query: 172 NPTPSTPPSSDCTPPSQDSPPS----DPTPTTPSTPTTPSGGYYNSPPQDSSP---PTDP 330
           +P P  PPS     P+   PPS     P P  P +P  PS    + PP  + P   P  P
Sbjct: 128 SPAPPVPPSPAPPSPAPPLPPSPVPPSPAPPAPPSPAPPSPAPPSPPPSPAPPSPEPPSP 187

Query: 331 TPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P +P +P  PS    +  P   +PP  P P
Sbjct: 188 APPSPPSPAPPSPAPPSPAPPSPAPPVPPSP 218

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 52/140 (37%), Positives = 62/140 (44%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS +   +P P SP       P+P+PPS    SPP    P P  P+      P+P
Sbjct: 230 PSPAPPSPEPP-SPVPPSPAPPSPVPPSPAPPSPVPPSPPIPPSPAPPSPAPPSPVPPSP 288

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           + PPS     P   SPP  P+P  P  P  P       PP   SPP  P P TP  P+ P
Sbjct: 289 A-PPSPVPPSPVPPSPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPPPPTP--PSPP 345

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S  P  P P
Sbjct: 346 ------SPPPPSPVPPSPAP 359

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 46/138 (33%), Positives = 69/138 (50%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P+P  P       P+P+PPS +   PP    P+P+PP+      P+P
Sbjct: 112 PSPVPPS---PAPPSPVPPSPAPPVPPSPAPPSPAPPLPPSPVPPSPAPPA-----PPSP 163

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           + P  +  +PP   +PPS P P +P+ P+ PS    +  P   +PP+ P P  P +P  P
Sbjct: 164 APPSPAPPSPPPSPAPPS-PEPPSPAPPSPPSPAPPSPAPPSPAPPS-PAPPVPPSPAPP 221

Query: 364 SGGYYNSPPQDSSPPSDP 417
           S    + PP  + P  +P
Sbjct: 222 SPAPPSPPPSPAPPSPEP 239

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 56/145 (38%), Positives = 64/145 (44%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP-PGSYDPTPSPPSGDGSYNPT 180
           P+P PPS     +P P SP       P+P+PPS    SP P S  P PSPP       P 
Sbjct: 260 PSPVPPSPPIPPSPAPPSPAPPSPVPPSPAPPSPVPPSPVPPSPPPPPSPPPPPPPRPPF 319

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT--PSTP 354
           P+  P     PPS  SPP  P P TP +P         SPP  S  P  P P T  P +P
Sbjct: 320 PANTPM----PPSPPSPPPSPPPPTPPSPP--------SPPPPSPVPPSPAPGTPVPPSP 367

Query: 355 TTPSGGYYNSPPQDS--SPPSDPLP 423
             PS      PP  +  SPP  P P
Sbjct: 368 APPSPAPSPIPPSPAPPSPPPSPAP 392

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 54/155 (34%), Positives = 67/155 (43%), Gaps = 15/155 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGS-YDPTPSPPS----GDGS 168
           P+P PPS      P+P+ P       P+P+PPS +  SPP S   P+P PPS        
Sbjct: 193 PSPAPPS---PAPPSPAPPSPAPPVPPSPAPPSPAPPSPPPSPAPPSPEPPSPVPPSPAP 249

Query: 169 YNPTPSTPPSSDCTPPSQDSPPS---------DPTPTTPSTPT-TPSGGYYNSPPQDSSP 318
            +P P +P      PPS   PPS          P P +P+ P+  P      SPP   SP
Sbjct: 250 PSPVPPSPAPPSPVPPSPPIPPSPAPPSPAPPSPVPPSPAPPSPVPPSPVPPSPPPPPSP 309

Query: 319 PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  P P  P    TP      SPP    PP+ P P
Sbjct: 310 PPPPPPRPPFPANTPMPPSPPSPPPSPPPPTPPSP 344

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 54/144 (37%), Positives = 68/144 (47%), Gaps = 6/144 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSY---NPTPSSPPGGGSYDPTPSPPSDSGGSPPGS-YDPTPSPPSGDGSY 171
           P+P PPS   S    +P P SP       P+P PPS +  SPP S   P+P+PPS     
Sbjct: 46  PSPAPPSPPPSPLPPSPAPPSPAPPSPTPPSPEPPSPAPPSPPPSPAPPSPAPPS-PVPP 104

Query: 172 NPTPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPTTP 345
           +P P  PPS     P+  SP P  P P  P +P  PS     +PP   SP P  P P  P
Sbjct: 105 SPAPPLPPSPVPPSPAPPSPVPPSPAPPVPPSPAPPS----PAPPLPPSPVPPSPAPPAP 160

Query: 346 STPTTPSGGYYNSPPQDSSPPSDP 417
            +P  PS    + PP  + P  +P
Sbjct: 161 PSPAPPSPAPPSPPPSPAPPSPEP 184

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 56/145 (38%), Positives = 63/145 (43%), Gaps = 4/145 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP--GSYDPTPSPPSGDGSYNP 177
           P+P PPS      P P SPP      P PSPP      PP   +    PSPPS   S  P
Sbjct: 291 PSPVPPS------PVPPSPP------PPPSPPPPPPPRPPFPANTPMPPSPPSPPPS--P 336

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTT--PSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            P TPPS    PP    PPS P P T  P +P  PS      PP  + P   P+P  PS 
Sbjct: 337 PPPTPPSPPSPPPPSPVPPS-PAPGTPVPPSPAPPSPAPSPIPPSPAPPSPPPSPAPPSP 395

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLPR 426
             +PS     SP    SP   P P+
Sbjct: 396 SPSPSPSPSPSPSPSPSPSPSPSPK 420

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 48/141 (34%), Positives = 62/141 (43%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SP       P+P PPS +   PP    P+P+PP       P+P
Sbjct: 99  PSPVPPS---PAPPLPPSPVPPSPAPPSPVPPSPAPPVPPSPAPPSPAPPLPPSPVPPSP 155

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPST-PTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           + P      PPS   P   P+P  PS  P +P+     SP   S  P  P P +P+ P  
Sbjct: 156 APPAPPSPAPPSPAPPSPPPSPAPPSPEPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPVP 215

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           PS     +PP  + P   P P
Sbjct: 216 PSP----APPSPAPPSPPPSP 232

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 53/144 (36%), Positives = 65/144 (45%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGD--GSYNP 177
           P+P PPS      P P SP       P+P PPS    SPP    P P PP      +  P
Sbjct: 271 PSPAPPS------PAPPSPVPPSPAPPSPVPPSPVPPSPPPPPSPPPPPPPRPPFPANTP 324

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSP-PQDSSPPTDPTPTTPST 351
            P +PPS   +PP   +PPS P+P  PS  P +P+ G    P P   SP   P P +P+ 
Sbjct: 325 MPPSPPSPPPSPP-PPTPPSPPSPPPPSPVPPSPAPGTPVPPSPAPPSPAPSPIPPSPAP 383

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLP 423
           P+ P      SP    SP   P P
Sbjct: 384 PSPPPSPAPPSPSPSPSPSPSPSP 407

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 52/143 (36%), Positives = 65/143 (45%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P+P PPS    +PP    P+P+PPS +      P
Sbjct: 41  PSPAPPS------PAPPSPP------PSPLPPSP---APPSPAPPSPTPPSPEPPSPAPP 85

Query: 184 STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS--TP 354
           S PPS     P+  SP P  P P  P +P  PS    +  P   +PP  P+P  PS   P
Sbjct: 86  SPPPSPAPPSPAPPSPVPPSPAPPLPPSPVPPSPAPPSPVPPSPAPPVPPSPAPPSPAPP 145

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
             PS       P   +PP+ P P
Sbjct: 146 LPPS-----PVPPSPAPPAPPSP 163

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 52/141 (36%), Positives = 60/141 (42%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYN-PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P P PP      N P P SPP      P PSPP  +  SPP    P+P PPS      P 
Sbjct: 310 PPPPPPRPPFPANTPMPPSPPS-----PPPSPPPPTPPSPPSPPPPSPVPPS------PA 358

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           P TP      PPS    P  P+P  PS P +P+       P   SP   P+P +PS   +
Sbjct: 359 PGTPVPPSPAPPSPAPSPIPPSPAPPSPPPSPA-------PPSPSPSPSPSP-SPSPSPS 410

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           PS     SP    SP   P P
Sbjct: 411 PSPSPSPSPKPSPSPSPSPSP 431

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 47/125 (37%), Positives = 64/125 (51%), Gaps = 4/125 (3%)
 Frame = +1

Query: 61  PGG-GSYDPTPSPPSDSGGSPPGS-YDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPP 234
           PGG  +  P+P+PPS +  SPP S   P+P+PPS     +PTP +P      PPS    P
Sbjct: 33  PGGIFNCPPSPAPPSPAPPSPPPSPLPPSPAPPS-PAPPSPTPPSPEPPSPAPPSPPPSP 91

Query: 235 SDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSP-P 408
           + P+P  PS  P +P+     SP   S  P  P P +P+ P  PS     +PP  + P P
Sbjct: 92  APPSPAPPSPVPPSPAPPLPPSPVPPSPAPPSPVPPSPAPPVPPS----PAPPSPAPPLP 147

Query: 409 SDPLP 423
             P+P
Sbjct: 148 PSPVP 152

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/95 (36%), Positives = 48/95 (50%), Gaps = 5/95 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG----SP-PGSYDPTPSPPSGDGS 168
           PTP  P      +P P SP  G    P+P+PPS +      SP P S  P+P+PPS   S
Sbjct: 339 PTPPSPPSPPPPSPVPPSPAPGTPVPPSPAPPSPAPSPIPPSPAPPSPPPSPAPPSPSPS 398

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTT 273
            +P+PS  PS   +P    SP   P+P+   +P +
Sbjct: 399 PSPSPSPSPSPSPSPSPSPSPKPSPSPSPSPSPVS 433

[39][TOP]
>UniRef100_UPI0001791C54 PREDICTED: hypothetical protein n=1 Tax=Acyrthosiphon pisum
           RepID=UPI0001791C54
          Length = 1046

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 64/149 (42%), Positives = 78/149 (52%), Gaps = 10/149 (6%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD----SGGSPPGSYDP--TPSPPSGDGS 168
           T TPPS      P+  +PP  G+   T +PPS     S G+PP +  P  T +PPS    
Sbjct: 556 TGTPPSTGTP--PSTGTPPSTGTPPSTGTPPSTGTPPSSGTPPSTGTPPSTGTPPSSGTP 613

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTP----TTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
             P+  TPPSS  TPPS  +PPS  TP    T PST T PS G   +PP   +PP+  TP
Sbjct: 614 --PSSGTPPSSG-TPPSSGTPPSTGTPPSSGTPPSTGTPPSTG---TPPSSGTPPSTGTP 667

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             PST T PS G   +PP   +PPS   P
Sbjct: 668 --PSTGTPPSSG---TPPSTGTPPSTGTP 691

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 61/147 (41%), Positives = 74/147 (50%), Gaps = 8/147 (5%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
           T TPPS      P+  +PP  G+   T +PPS   G+PP +  P  S         P+  
Sbjct: 550 TGTPPSTGTP--PSTGTPPSTGTPPSTGTPPST--GTPPSTGTPPSSGTPPSTGTPPSTG 605

Query: 187 TPPSSDCTPPSQDSPPSDPTP----TTPSTPTTPSGGYYNSPPQDSSPPTDPTP----TT 342
           TPPSS  TPPS  +PPS  TP    T PST T PS G   +PP   +PP+  TP    T 
Sbjct: 606 TPPSSG-TPPSSGTPPSSGTPPSSGTPPSTGTPPSSG---TPPSTGTPPSTGTPPSSGTP 661

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PST T PS G   +PP   +PPS   P
Sbjct: 662 PSTGTPPSTG---TPPSSGTPPSTGTP 685

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 61/143 (42%), Positives = 76/143 (53%), Gaps = 6/143 (4%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDP--TPSPPSGDGSYNPTPS 186
           TPPS      P+  +PP  G+   T +PPS   G+PP +  P  T +PPS      P+  
Sbjct: 528 TPPSSGTP--PSSGTPPSSGTPPSTGTPPST--GTPPSTGTPPSTGTPPSTGTP--PSTG 581

Query: 187 TPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP----TTPSTP 354
           TPPS+  TPPS  +PPS  TP  PST T PS G   +PP   +PP+  TP    T PST 
Sbjct: 582 TPPSTG-TPPSSGTPPSTGTP--PSTGTPPSSG---TPPSSGTPPSSGTPPSSGTPPSTG 635

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
           T PS G   +PP   +PPS   P
Sbjct: 636 TPPSSG---TPPSTGTPPSTGTP 655

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 55/131 (41%), Positives = 68/131 (51%), Gaps = 4/131 (3%)
 Frame = +1

Query: 43  PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQ 222
           PT  +PP  G+   + +PPS   G+PP S  P  S         P+  TPPS+  TPPS 
Sbjct: 506 PTSGTPPSSGTPPSSGTPPSS--GTPPSSGTPPSSGTPPSSGTPPSTGTPPSTG-TPPST 562

Query: 223 DSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP----TTPSTPTTPSGGYYNSPP 390
            +PPS  TP  PST T PS G   +PP   +PP+  TP    T PST T PS G   +PP
Sbjct: 563 GTPPSTGTP--PSTGTPPSTG---TPPSTGTPPSSGTPPSTGTPPSTGTPPSSG---TPP 614

Query: 391 QDSSPPSDPLP 423
              +PPS   P
Sbjct: 615 SSGTPPSSGTP 625

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 61/147 (41%), Positives = 73/147 (49%), Gaps = 8/147 (5%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD----SGGSPPGSYDPTPSPPSGDGSYN 174
           T TPPS      P+  +PP  G+   T +PPS     S G+PP S  P  S         
Sbjct: 574 TGTPPSTGTP--PSTGTPPSSGTPPSTGTPPSTGTPPSSGTPPSSGTPPSSGTPPSSGTP 631

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTP----TTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
           P+  TPPSS  TPPS  +PPS  TP    T PST T PS G   +PP   +PP+  TP  
Sbjct: 632 PSTGTPPSSG-TPPSTGTPPSTGTPPSSGTPPSTGTPPSTG---TPPSSGTPPSTGTP-- 685

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PST T PS G   +P    +PPS   P
Sbjct: 686 PSTGTPPSTG---TPSSSGTPPSTGTP 709

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 61/151 (40%), Positives = 78/151 (51%), Gaps = 10/151 (6%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD----SGGSPPGSYDP--TPSPPSGD 162
           D   TPP+      P+  +PP  G+   + +PPS     S G+PP S  P  T +PPS  
Sbjct: 500 DKPKTPPTSGTP--PSSGTPPSSGTPPSSGTPPSSGTPPSSGTPPSSGTPPSTGTPPS-- 555

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP-- 336
               P+  TPPS+  TPPS  +PPS  TP  PST T PS G   +PP   +PP+  TP  
Sbjct: 556 TGTPPSTGTPPSTG-TPPSTGTPPSTGTP--PSTGTPPSSG---TPPSTGTPPSTGTPPS 609

Query: 337 --TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             T PS+ T PS G   +PP   +PPS   P
Sbjct: 610 SGTPPSSGTPPSSG---TPPSSGTPPSTGTP 637

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 61/147 (41%), Positives = 77/147 (52%), Gaps = 10/147 (6%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD----SGGSPPGSYDP--TPSPPSGDGSYN 174
           TPPS      P+  +PP  G+   T +PPS     S G+PP +  P  T +PPS      
Sbjct: 540 TPPSSGTP--PSTGTPPSTGTPPSTGTPPSTGTPPSTGTPPSTGTPPSTGTPPSSGTP-- 595

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP----TT 342
           P+  TPPS+  TPPS  +PPS  TP  PS+ T PS G   +PP   +PP+  TP    T 
Sbjct: 596 PSTGTPPSTG-TPPSSGTPPSSGTP--PSSGTPPSSG---TPPSTGTPPSSGTPPSTGTP 649

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PST T PS G   +PP   +PPS   P
Sbjct: 650 PSTGTPPSSG---TPPSTGTPPSTGTP 673

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 60/150 (40%), Positives = 78/150 (52%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD----SGGSPPGSYDP--TPSPPSGDG 165
           PT   P   G+  P+  +PP  G+   + +PPS     S G+PP +  P  T +PPS   
Sbjct: 506 PTSGTPPSSGT-PPSSGTPPSSGTPPSSGTPPSSGTPPSSGTPPSTGTPPSTGTPPSTGT 564

Query: 166 SYNPTPSTPPSSDCTPPSQDSPPSDPTP----TTPSTPTTPSGGYYNSPPQDSSPPTDPT 333
              P+  TPPS+  TPPS  +PPS  TP    T PST T PS G   +PP   +PP+  T
Sbjct: 565 P--PSTGTPPSTG-TPPSTGTPPSTGTPPSSGTPPSTGTPPSTG---TPPSSGTPPSSGT 618

Query: 334 PTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  PS+ T PS G   +PP   +PPS   P
Sbjct: 619 P--PSSGTPPSSG---TPPSTGTPPSSGTP 643

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 61/142 (42%), Positives = 75/142 (52%), Gaps = 9/142 (6%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDP--TPSPPSGDGSYNPT 180
           T TPPS      P+  +PP  G+   + +PPS   G+PP S  P  T +PPS      P+
Sbjct: 604 TGTPPSSGTP--PSSGTPPSSGTPPSSGTPPST--GTPPSSGTPPSTGTPPSTGTP--PS 657

Query: 181 PSTPPSSDCTPPSQDSPPSDPTP----TTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
             TPPS+  TPPS  +PPS  TP    T PST T PS G   +P    +PP+  TP+T  
Sbjct: 658 SGTPPSTG-TPPSTGTPPSSGTPPSTGTPPSTGTPPSTG---TPSSSGTPPSTGTPSTSG 713

Query: 349 TPT---TPSGGYYNSPPQDSSP 405
           TPT   TPS G Y   PQ  SP
Sbjct: 714 TPTTSGTPSTGNY---PQPGSP 732

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 58/138 (42%), Positives = 68/138 (49%), Gaps = 9/138 (6%)
 Frame = +1

Query: 37  YNPT-PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTP 213
           Y P  P +PP  G+      PPS   G+PP S  P  S         P+  TPPSS  TP
Sbjct: 497 YKPDKPKTPPTSGT------PPSS--GTPPSSGTPPSSGTPPSSGTPPSSGTPPSSG-TP 547

Query: 214 PSQDSPPSDPTP----TTPSTPTTPSGGYYNSPPQDSSPPTDPTP----TTPSTPTTPSG 369
           PS  +PPS  TP    T PST T PS G   +PP   +PP+  TP    T PST T PS 
Sbjct: 548 PSTGTPPSTGTPPSTGTPPSTGTPPSTG---TPPSTGTPPSTGTPPSSGTPPSTGTPPST 604

Query: 370 GYYNSPPQDSSPPSDPLP 423
           G   +PP   +PPS   P
Sbjct: 605 G---TPPSSGTPPSSGTP 619

[40][TOP]
>UniRef100_Q58NA5 Plus agglutinin (Fragment) n=1 Tax=Chlamydomonas incerta
            RepID=Q58NA5_CHLIN
          Length = 2371

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 55/144 (38%), Positives = 73/144 (50%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+PTPPS     +P P SPP      P+P+PPS    S  PP    P+P PPS +   +P
Sbjct: 718  PSPTPPSPQPP-SPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPP-SP 775

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPST 351
             P +PP     PPS  +PPS P P+  P +P  PS    +  P   +PP+ P P+  P +
Sbjct: 776  APPSPPPPSPEPPS-PAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 834

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P   +PPS P P
Sbjct: 835  PAPPSPPPPSPEPPSPAPPSPPPP 858

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 52/143 (36%), Positives = 69/143 (48%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS    S  PP    P+P PPS +   +P
Sbjct: 853  PSPPPPSPEPP-SPAPPSPPSPSPEPPSPAPPSPPPPSPAPPSPAPPSPPPPSPEPP-SP 910

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPSTP 354
             P +PP     PPS  SP   P    P +P  PS    +  P   +PP+ P P+  P +P
Sbjct: 911  APPSPPPPSPEPPSPASPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSP 970

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
              PS    +  P   +PPS P P
Sbjct: 971  APPSPPPPSPEPPSPAPPSPPPP 993

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 54/144 (37%), Positives = 74/144 (51%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS    S  PP    P+P+PPS +   +P
Sbjct: 958  PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPTPPSPEPP-SP 1015

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPST 351
             P +PP     PPS  +PPS P P+  P +P  PS    +  P   +PP+ P P+  P +
Sbjct: 1016 APPSPPPPSPEPPS-PAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 1074

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P   +PPS P P
Sbjct: 1075 PAPPSPPPPSPEPSSPAPPSPPPP 1098

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 55/144 (38%), Positives = 71/144 (49%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+PTPPS      P P SPP      P+P PPS    SP  P    P+P+PPS     +P
Sbjct: 678  PSPTPPS------PAPPSPPPPSPAPPSPRPPSPEPPSPKPPSPEPPSPTPPSPQPP-SP 730

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTT-PSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPST 351
             P +PP     PPS  +PPS P P+  P +P  PS    +  P   +PP+ P P+  P +
Sbjct: 731  APPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 789

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P   +PPS P P
Sbjct: 790  PAPPSPPPPSPEPPSPAPPSPPPP 813

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 54/144 (37%), Positives = 74/144 (51%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS    SP  P    P+P PPS +   +P
Sbjct: 763  PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPP-SP 820

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTT-PSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPST 351
             P +PP     PPS  +PPS P P+  P +P  PS    +  P   +PP+ P+P+  P +
Sbjct: 821  APPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPSPSPEPPS 879

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P   +PPS P P
Sbjct: 880  PAPPSPPPPSPAPPSPAPPSPPPP 903

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 54/144 (37%), Positives = 73/144 (50%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS    SP  P    P+P PPS +   +P
Sbjct: 778  PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPP-SP 835

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPST 351
             P +PP     PPS  +PPS P P+  P +P  PS    +  P   +PP+ P P+  P +
Sbjct: 836  APPSPPPPSPEPPS-PAPPSPPPPSPEPPSPAPPSPPSPSPEPPSPAPPSPPPPSPAPPS 894

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P   +PPS P P
Sbjct: 895  PAPPSPPPPSPEPPSPAPPSPPPP 918

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 55/148 (37%), Positives = 74/148 (50%), Gaps = 8/148 (5%)
 Frame = +1

Query: 4    PTPTPPS----GDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDG 165
            P+P PPS         +P P SPP      P+P+PPS    S  PP    P+P PPS + 
Sbjct: 803  PSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEP 862

Query: 166  SYNPTPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT- 339
              +P P +PPS    PPS  +PPS P P+  P +P  PS    +  P   +PP+ P P+ 
Sbjct: 863  P-SPAPPSPPSPSPEPPS-PAPPSPPPPSPAPPSPAPPSPPPPSPEPPSPAPPSPPPPSP 920

Query: 340  TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             P +P +PS    +  P   +PPS P P
Sbjct: 921  EPPSPASPSPPPPSPEPPSPAPPSPPPP 948

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 54/144 (37%), Positives = 73/144 (50%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS    S  PP    P+P PPS     +P
Sbjct: 838  PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPSPSPEPPSPAPPSPPPPS-PAPPSP 895

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPST 351
             P +PP     PPS  +PPS P P+  P +P +PS    +  P   +PP+ P P+  P +
Sbjct: 896  APPSPPPPSPEPPS-PAPPSPPPPSPEPPSPASPSPPPPSPEPPSPAPPSPPPPSPEPPS 954

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P   +PPS P P
Sbjct: 955  PAPPSPPPPSPEPPSPAPPSPPPP 978

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 54/144 (37%), Positives = 73/144 (50%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS    S  PP    P+P PPS +   +P
Sbjct: 733  PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPP-SP 790

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPST 351
             P +PP     PPS  +PPS P P+  P +P  PS    +  P   +PP+ P P+  P +
Sbjct: 791  APPSPPPPSPEPPS-PAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 849

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P   +PPS P P
Sbjct: 850  PAPPSPPPPSPEPPSPAPPSPPSP 873

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 54/146 (36%), Positives = 71/146 (48%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS    SP  P    P+P PPS +   +P
Sbjct: 748  PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPP-SP 805

Query: 178  TPSTPPSSDCTPPSQ---DSPPSDPTPTTPSTPTTPSGGYYN-SPPQDSSPPTDPTPTTP 345
             P +PP     PPS      PP  P P +P+ P+ P       SP   S PP  P P +P
Sbjct: 806  APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSP 865

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
            + P+ PS    +  P   +PPS P P
Sbjct: 866  APPSPPSP---SPEPPSPAPPSPPPP 888

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 54/144 (37%), Positives = 73/144 (50%), Gaps = 8/144 (5%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS +  SP  P    P+P PPS +   +P
Sbjct: 973  PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPTPPSPEPPSPAPPSPPPPSPEPP-SP 1030

Query: 178  TPSTPPSSDCTPPSQ---DSPPSDPTPTTPSTPTTPSGGYYN-SPPQDSSPPTDPTPTTP 345
             P +PP     PPS      PP  P P +P+ P+ P       SP   S PP  P P++P
Sbjct: 1031 APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPSSP 1090

Query: 346  STPTTP--SGGYYNSPPQDSSPPS 411
            + P+ P  S    +  PQ S+PPS
Sbjct: 1091 APPSPPPPSPAPPSPEPQSSAPPS 1114

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 52/143 (36%), Positives = 69/143 (48%), Gaps = 7/143 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+PTPPS +   +P P SPP      P+P+PPS    SP  P    P+P PPS +     
Sbjct: 1003 PSPTPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 1061

Query: 178  TPSTPPSS----DCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT-DPTPTT 342
             PS PP S       PPS   P  +P+   P +P  PS    +  PQ S+PP+ +P  + 
Sbjct: 1062 PPSPPPPSPEPPSPAPPSPPPPSPEPSSPAPPSPPPPSPAPPSPEPQSSAPPSPEPQSSA 1121

Query: 343  PSTPTTPSGGYYNSPPQDSSPPS 411
            P +P  PS    +  P    PPS
Sbjct: 1122 PPSPVPPSPAPPSPAPPSPEPPS 1144

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 54/152 (35%), Positives = 70/152 (46%), Gaps = 12/152 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS    SP  P    P+P PPS +   +P
Sbjct: 808  PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPP-SP 865

Query: 178  TPSTPPSSDCTPPSQDSP------PSDPTPTTPS----TPTTPSGGYYNSPPQDSSPPTD 327
             P +PPS    PPS   P      P+ P+P  PS    +P  PS    + PP    PP+ 
Sbjct: 866  APPSPPSPSPEPPSPAPPSPPPPSPAPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSP 925

Query: 328  PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             +P+ P     P      SPP  S  P  P P
Sbjct: 926  ASPSPPPPSPEPPSPAPPSPPPPSPEPPSPAP 957

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 54/144 (37%), Positives = 71/144 (49%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS      P P SPP      P+P+PPS    S  PP    P+P PPS +   +P
Sbjct: 888  PSPAPPS------PAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPASPSPPPPSPEPP-SP 940

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPST 351
             P +PP     PPS  +PPS P P+  P +P  PS    +  P   +PP+ P P+  P +
Sbjct: 941  APPSPPPPSPEPPS-PAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 999

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P   +PPS P P
Sbjct: 1000 PAPPSPTPPSPEPPSPAPPSPPPP 1023

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 53/142 (37%), Positives = 67/142 (47%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS    SP  P    P+P PPS +   +P
Sbjct: 928  PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPP-SP 985

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
             P +PP     PPS    P+ P+PT PS P  PS    + PP    PP+   P+ P    
Sbjct: 986  APPSPPPPSPEPPS----PAPPSPTPPS-PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSP 1040

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             P      SPP  S  P  P P
Sbjct: 1041 EPPSPAPPSPPPPSPEPPSPAP 1062

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/145 (37%), Positives = 71/145 (48%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS    SP  P    P+P PPS +   +P
Sbjct: 793  PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPP-SP 850

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTT--PS 348
             P +PP     PPS  +PPS P+P+  P +P  P      SPP  S  P  P P +  P 
Sbjct: 851  APPSPPPPSPEPPSP-APPSPPSPSPEPPSPAPP------SPPPPSPAPPSPAPPSPPPP 903

Query: 349  TPTTPSGGYYNSPPQDSSPPSDPLP 423
            +P  PS    + PP    PPS   P
Sbjct: 904  SPEPPSPAPPSPPPPSPEPPSPASP 928

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/141 (36%), Positives = 67/141 (47%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS +   +P P SPP      P+P+PPS     PP    P+P+PPS     +P P
Sbjct: 943  PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPP---PPSPEPPSPAPPSPPPP-SPEP 997

Query: 184  STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
             +P     TPPS + P P+ P+P  PS P  PS    + PP    PP+   P+ P     
Sbjct: 998  PSPAPPSPTPPSPEPPSPAPPSPPPPS-PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPE 1056

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            P      SPP  S  P  P P
Sbjct: 1057 PPSPAPPSPPPPSPEPPSPAP 1077

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 54/144 (37%), Positives = 71/144 (49%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS    SP  P    P+P PPS +     
Sbjct: 1018 PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 1076

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPST 351
             PS PP S    PS  +PPS P P+  P +P   S    +  PQ S+PP+   P+  P +
Sbjct: 1077 PPSPPPPSP--EPSSPAPPSPPPPSPAPPSPEPQSSAPPSPEPQSSAPPSPVPPSPAPPS 1134

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS      PP  S  P+ P+P
Sbjct: 1135 PAPPS----PEPPSPSPSPAPPIP 1154

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 59/144 (40%), Positives = 67/144 (46%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS      P P SP       PTP+PPS    SP  P    P P PPS      P
Sbjct: 1177 PSPAPPS------PAPPSPVPPSPIPPTPAPPSPEPPSPVPPSPTPPAPQPPS------P 1224

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYN-SPPQDSSP-PTDPTPTTPST 351
             P  P      PPS  +PPS P PTTP++P  PS    + SPP   SP P  P P  P +
Sbjct: 1225 APPAPQPPSPAPPS-PNPPS-PAPTTPASPEPPSPQPPSPSPPVPPSPAPPSPAPLPPPS 1282

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS      PP  + PPS P P
Sbjct: 1283 PDPPS----PVPPSPAPPPSPPAP 1302

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 53/142 (37%), Positives = 71/142 (50%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS +   +PTP SP       P+P PPS     PP    P+P PPS +   +P P
Sbjct: 708  PSPKPPSPEPP-SPTPPSPQPPSPAPPSPPPPSP---EPPSPAPPSPPPPSPEPP-SPAP 762

Query: 184  STPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPSTPT 357
             +PP     PPS  +PPS P P+  P +P  PS    +  P   +PP+ P P+  P +P 
Sbjct: 763  PSPPPPSPEPPS-PAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 821

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             PS    +  P   +PPS P P
Sbjct: 822  PPSPPPPSPEPPSPAPPSPPPP 843

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 54/141 (38%), Positives = 64/141 (45%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS +   +P P SPP      P+P PPS +  SPP    P+P PPS      P P
Sbjct: 898  PSPPPPSPEPP-SPAPPSPP-----PPSPEPPSPASPSPP---PPSPEPPSPAPPSPPPP 948

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT-T 360
            S  P S   P      P  P+P  PS P  P      SP   S PP  P P +P+ P+ T
Sbjct: 949  SPEPPSPAPPSPPPPSPEPPSPAPPSPP--PPSPEPPSPAPPSPPPPSPEPPSPAPPSPT 1006

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            P      SP   S PP  P P
Sbjct: 1007 PPSPEPPSPAPPSPPPPSPEP 1027

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/146 (36%), Positives = 70/146 (47%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P   SPP      P+P+PPS    S  PP    P+P PPS +   +P
Sbjct: 913  PSPPPPSPEPP-SPASPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPP-SP 970

Query: 178  TPSTPPSSDCTPPS---QDSPPSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTPTTP 345
             P +PP     PPS      PP  P P +P+ P+ TP      SP   S PP  P P +P
Sbjct: 971  APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPTPPSPEPPSPAPPSPPPPSPEPPSP 1030

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
            + P+ P     +  P   +PPS P P
Sbjct: 1031 APPSPPPP---SPEPPSPAPPSPPPP 1053

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 52/146 (35%), Positives = 66/146 (45%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS    SP  P    P+P PPS + S   
Sbjct: 1033 PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPSSPA 1091

Query: 178  TPSTPPSSDCTP---PSQDSPPS-DPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
             PS PP S   P   P   +PPS +P  + P +P  PS    +  P    PP+      P
Sbjct: 1092 PPSPPPPSPAPPSPEPQSSAPPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPAP 1151

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
              P  PS    +  PQ   PPS   P
Sbjct: 1152 PIPAPPSPQPPSPAPQTPQPPSPDPP 1177

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 49/141 (34%), Positives = 69/141 (48%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+PTPP+     +P P +P       P+P+PPS +  +P     P+P PPS      P+P
Sbjct: 1212 PSPTPPAPQPP-SPAPPAPQPPSPAPPSPNPPSPAPTTPASPEPPSPQPPSPSPPVPPSP 1270

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            + P  +   PPS D PPS P P +P+ P +P       P   + PP+ P P +P+ P+  
Sbjct: 1271 APPSPAPLPPPSPD-PPS-PVPPSPAPPPSPPAPPSPEPIPPAPPPSPPEPPSPAPPSP- 1327

Query: 364  SGGYYNSPPQDSSP-PSDPLP 423
                   PPQ  SP P  P P
Sbjct: 1328 ------QPPQPPSPSPPSPAP 1342

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 52/141 (36%), Positives = 65/141 (46%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SPP      P+P+PPS     PP    P+P+PPS     +P P
Sbjct: 873  PSPEPPS------PAPPSPPPPSPAPPSPAPPSPP---PPSPEPPSPAPPSPPPP-SPEP 922

Query: 184  STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
             +P S    PPS + P P+ P+P  PS P  PS    + PP    PP+   P+ P     
Sbjct: 923  PSPASPSPPPPSPEPPSPAPPSPPPPS-PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPE 981

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            P      SPP  S  P  P P
Sbjct: 982  PPSPAPPSPPPPSPEPPSPAP 1002

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 54/144 (37%), Positives = 74/144 (51%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SP       P+P+PPS    S  PP    P+P PPS +   +P
Sbjct: 988  PSPPPPSPEPP-SPAPPSPTPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPP-SP 1045

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPST 351
             P +PP     PPS  +PPS P P+  P +P  PS    +  P   +PP+ P P+  P +
Sbjct: 1046 APPSPPPPSPEPPS-PAPPSPPPPSPEPPSPAPPSPPPPSPEPSSPAPPSPPPPSPAPPS 1104

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P   S    +  PQ S+PPS P+P
Sbjct: 1105 PEPQSSAPPSPEPQSSAPPS-PVP 1127

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 51/147 (34%), Positives = 68/147 (46%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD-------SGGSPPGSYDPTPSPPSGD 162
            P+P PPS +   +P P SPP      P+P+PPS        S  +PP    P+P+PPS +
Sbjct: 1048 PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPPPSPEPSSPAPPSPPPPSPAPPSPE 1106

Query: 163  GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
               +  PS  P S   P      P+ P+P  PS P  PS     +PP  + P   P    
Sbjct: 1107 PQSSAPPSPEPQSSAPPSPVPPSPAPPSPAPPS-PEPPSPSPSPAPPIPAPPSPQPPSPA 1165

Query: 343  PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P TP  PS    +  P   +PPS P+P
Sbjct: 1166 PQTPQPPSPDPPSPAPPSPAPPS-PVP 1191

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 52/140 (37%), Positives = 65/140 (46%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            PTP PPS +   +P P SP       P+P+PP+     PP    P+P+PPS      P P
Sbjct: 1197 PTPAPPSPEPP-SPVPPSPTPPAPQPPSPAPPAP---QPPSPAPPSPNPPS------PAP 1246

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            +TP S +  PPS   PPS P+P  P +P  PS      P  D   P  P+P  P +P  P
Sbjct: 1247 TTPASPE--PPS-PQPPS-PSPPVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPPSPPAP 1302

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
                   P    SPP  P P
Sbjct: 1303 PSPEPIPPAPPPSPPEPPSP 1322

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 53/142 (37%), Positives = 70/142 (49%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS +   +P P SP       P+P PPS +  SPP    P+P PPS      P P
Sbjct: 698  PSPRPPSPEPP-SPKPPSPEPPSPTPPSPQPPSPAPPSPP---PPSPEPPS------PAP 747

Query: 184  STPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPSTPT 357
             +PP     PPS  +PPS P P+  P +P  PS    +  P   +PP+ P P+  P +P 
Sbjct: 748  PSPPPPSPEPPS-PAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 806

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             PS    +  P   +PPS P P
Sbjct: 807  PPSPPPPSPEPPSPAPPSPPPP 828

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/140 (34%), Positives = 62/140 (44%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SP       P+P PP+    +PP    P+P+PPS      P P
Sbjct: 1431 PSPRPPS------PAPPSPAPPSPVPPSPQPPAPPSPAPPSPAPPSPAPPS------PAP 1478

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             +P S    PP    P   P PTT   P +P+     +PP   +PP +P P  P  P  P
Sbjct: 1479 PSPASPSPVPPLPTPPSPAPAPTTSPLPPSPTPAL-PAPPASPAPPPNP-PRPPQPPAAP 1536

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
                   PP  ++PP  P P
Sbjct: 1537 -------PPSPAAPPPSPAP 1549

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 53/143 (37%), Positives = 65/143 (45%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPT-PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            P+P PPS D    P  P SP       PTP+PPS     PP    P+P+PPS      P 
Sbjct: 619  PSPDPPSPDPPSPPALPPSPKPPSPKPPTPAPPSPL---PPSPLPPSPAPPS------PA 669

Query: 181  PSTPPSSDCTP-PSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            P  PP +  +P P   +PPS P P+  P +P  PS      PP    P  +P   TP +P
Sbjct: 670  PPQPPPAPPSPTPPSPAPPSPPPPSPAPPSPRPPS----PEPPSPKPPSPEPPSPTPPSP 725

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
              PS    + PP    PPS   P
Sbjct: 726  QPPSPAPPSPPPPSPEPPSPAPP 748

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 49/146 (33%), Positives = 60/146 (41%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP       P P  PP        PSPP+      P +  P+P PPS +    P+P
Sbjct: 559 PLPSPPRPPSPQPPVPRPPPRAPRPPRPPSPPAPPAPPDPPTAPPSPDPPSPEPPSQPSP 618

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPT------TPSGGYYNSPPQDSSPPTDPTPTTP 345
            +P      PPS  + P  P P +P  PT       P      SP   S  P  P P  P
Sbjct: 619 PSPDPPSPDPPSPPALPPSPKPPSPKPPTPAPPSPLPPSPLPPSPAPPSPAPPQPPPAPP 678

Query: 346 STPTTPSGGYYNSPPQDSSPPSDPLP 423
           S PT PS    + PP   +PPS   P
Sbjct: 679 S-PTPPSPAPPSPPPPSPAPPSPRPP 703

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 51/144 (35%), Positives = 60/144 (41%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS   S  P   +PP      P P  P      PP    P+P+PPS      P P
Sbjct: 1138 PSPEPPSPSPSPAPPIPAPPSPQPPSPAPQTPQPPSPDPPSPAPPSPAPPS------PVP 1191

Query: 184  STPPSSDCTPPSQDSP---PSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTPTTPST 351
             +P      PPS + P   P  PTP  P  P+  P      SP   S  P  P PTTP++
Sbjct: 1192 PSPIPPTPAPPSPEPPSPVPPSPTPPAPQPPSPAPPAPQPPSPAPPSPNPPSPAPTTPAS 1251

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS       P   SPP  P P
Sbjct: 1252 PEPPS-----PQPPSPSPPVPPSP 1270

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 52/144 (36%), Positives = 67/144 (46%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SP       P+P+PPS +   PP +  P+P+PPS      P P
Sbjct: 636  PSPKPPSPKPP-TPAPPSPLPPSPLPPSPAPPSPAPPQPPPA-PPSPTPPS------PAP 687

Query: 184  STPPSSDCTPPSQDSP---PSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTPTTPST 351
             +PP     PPS   P   P  P P +P  P+ TP      SP   S PP  P P +P+ 
Sbjct: 688  PSPPPPSPAPPSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPSPAPPSPPPPSPEPPSPAP 747

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P+ P     +  P   +PPS P P
Sbjct: 748  PSPPPP---SPEPPSPAPPSPPPP 768

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/140 (33%), Positives = 62/140 (44%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P+PP+   S  P P +PP      P+P+PPS     PP    P+P+PPS      P P
Sbjct: 1295 PPPSPPAPP-SPEPIPPAPPPSPPEPPSPAPPSPQPPQPPSPSPPSPAPPS------PEP 1347

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             +P      PPS   P   P    P +P  PS    +  P   +PP+ P P  P +P  P
Sbjct: 1348 PSPIPPSPAPPSPAPPSPQPPSPEPPSPAPPSPAPLSPAPPSPAPPS-PIPPAPPSPEPP 1406

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
            S    +  P   +PPS   P
Sbjct: 1407 SPAPPSPAPPSPAPPSPQPP 1426

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 54/143 (37%), Positives = 65/143 (45%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SP       P+P PPS     PP    P+P PPS +   +P P
Sbjct: 908  PSPAPPS------PPPPSPEPPSPASPSPPPPSP---EPPSPAPPSPPPPSPEPP-SPAP 957

Query: 184  STPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTP--TTPSTP 354
             +PP     PPS  +PPS P P+  P +P  P      SPP  S  P  P P   TP +P
Sbjct: 958  PSPPPPSPEPPS-PAPPSPPPPSPEPPSPAPP------SPPPPSPEPPSPAPPSPTPPSP 1010

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
              PS    + PP    PPS   P
Sbjct: 1011 EPPSPAPPSPPPPSPEPPSPAPP 1033

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 49/141 (34%), Positives = 59/141 (41%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSG-DGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            PTP PPS    S  P   +PP      P P+PPS +   PP    P+P PPS      P 
Sbjct: 646  PTPAPPSPLPPSPLPPSPAPPSPAPPQPPPAPPSPT---PPSPAPPSPPPPS------PA 696

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            P +P      PPS   P  +P   TP +P  PS    + PP    PP+   P+ P     
Sbjct: 697  PPSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPSPAPPSPPPPSPEPPSPAPPSPPPPSPE 756

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            P      SPP  S  P  P P
Sbjct: 757  PPSPAPPSPPPPSPEPPSPAP 777

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 49/144 (34%), Positives = 64/144 (44%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P P +      P+P  P       P+P+PPS +   PP    P+P PPS   +  P+P
Sbjct: 1242 PSPAPTTPASPEPPSPQPPSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPS--PAPPPSP 1299

Query: 184  STPPSSD----CTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
              PPS +      PPS   PPS P P +P  P  PS     SPP  + P  +P    P +
Sbjct: 1300 PAPPSPEPIPPAPPPSPPEPPS-PAPPSPQPPQPPS----PSPPSPAPPSPEPPSPIPPS 1354

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P    PPS   P
Sbjct: 1355 PAPPSPAPPSPQPPSPEPPSPAPP 1378

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 51/147 (34%), Positives = 61/147 (41%), Gaps = 6/147 (4%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPS----DSGGSPPGSYDPTPSPPSGDGS 168
            DP   PPS D      PS P       P+P PPS         PP    PTP+PPS    
Sbjct: 597  DPPTAPPSPDPPSPEPPSQPSPPSPDPPSPDPPSPPALPPSPKPPSPKPPTPAPPS-PLP 655

Query: 169  YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPTTP 345
             +P P +P      PP     P  PTP +P+ P+ P        P+  SP P  P P +P
Sbjct: 656  PSPLPPSPAPPSPAPPQPPPAPPSPTPPSPAPPSPPPPSPAPPSPRPPSPEPPSPKPPSP 715

Query: 346  STPT-TPSGGYYNSPPQDSSPPSDPLP 423
              P+ TP      SP   S PP  P P
Sbjct: 716  EPPSPTPPSPQPPSPAPPSPPPPSPEP 742

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 52/145 (35%), Positives = 65/145 (44%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS----GDGSY 171
            P+P PPS      P P  PP      P+P+PPS +  SPP    P+P+PPS         
Sbjct: 661  PSPAPPS------PAPPQPPPA---PPSPTPPSPAPPSPP---PPSPAPPSPRPPSPEPP 708

Query: 172  NPTPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
            +P P +P     TPPS   P P+ P+P  PS P  PS    + PP    PP+   P+ P 
Sbjct: 709  SPKPPSPEPPSPTPPSPQPPSPAPPSPPPPS-PEPPSPAPPSPPPPSPEPPSPAPPSPPP 767

Query: 349  TPTTPSGGYYNSPPQDSSPPSDPLP 423
                P      SPP  S  P  P P
Sbjct: 768  PSPEPPSPAPPSPPPPSPEPPSPAP 792

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 52/145 (35%), Positives = 70/145 (48%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS      P P SP       P+P+PPS    S  PP    P+P PPS      P
Sbjct: 1406 PSPAPPS------PAPPSPAPPSPQPPSPAPPSPRPPSPAPPSPAPPSPVPPSPQPPAPP 1459

Query: 178  TPSTP-PSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSP-PTDPTPTTPS 348
            +P+ P P+     P   +PPS  +P+  P  PT PS     +P   +SP P  PTP  P+
Sbjct: 1460 SPAPPSPAPPSPAPPSPAPPSPASPSPVPPLPTPPS----PAPAPTTSPLPPSPTPALPA 1515

Query: 349  TPTTPSGGYYNSPPQDSSPPSDPLP 423
             P +P+     +PP+   PP+ P P
Sbjct: 1516 PPASPAPP--PNPPRPPQPPAAPPP 1538

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 53/150 (35%), Positives = 69/150 (46%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDS--GGSPPGSYDPTPSPPSGDGSYNP 177
            P+P PPS      P P SP       P+P+PPS +    +PP    P+P PP+      P
Sbjct: 1353 PSPAPPS------PAPPSPQPPSPEPPSPAPPSPAPLSPAPPSPAPPSPIPPAPPSPEPP 1406

Query: 178  TPSTP---PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
            +P+ P   P S   P  Q   P+ P+P  PS P  PS    +  P    PP  P+P  PS
Sbjct: 1407 SPAPPSPAPPSPAPPSPQPPSPAPPSPRPPS-PAPPSPAPPSPVPPSPQPPAPPSPAPPS 1465

Query: 349  ----TPTTPSGGYYNSPPQDSSP-PSDPLP 423
                +P  PS     +PP  +SP P  PLP
Sbjct: 1466 PAPPSPAPPS----PAPPSPASPSPVPPLP 1491

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 49/141 (34%), Positives = 61/141 (43%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS      P+P+ P    +   +P PPS    SP     P+P+PPS      P P
Sbjct: 1227 PAPQPPS---PAPPSPNPPSPAPTTPASPEPPSPQPPSPSPPVPPSPAPPS------PAP 1277

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPTTPSTPTT 360
              PPS D   P   SP   P+P  P +P         SPP+  SP P  P P  P +P+ 
Sbjct: 1278 LPPPSPDPPSPVPPSPAPPPSPPAPPSPEPIPPAPPPSPPEPPSPAPPSPQPPQPPSPSP 1337

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            PS    +  P    PPS   P
Sbjct: 1338 PSPAPPSPEPPSPIPPSPAPP 1358

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 51/153 (33%), Positives = 66/153 (43%), Gaps = 13/153 (8%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPS------- 156
            P+P+PPS      P P SP       P+P+PPS +  SP  P    P+P+PPS       
Sbjct: 1333 PSPSPPS------PAPPSPEPPSPIPPSPAPPSPAPPSPQPPSPEPPSPAPPSPAPLSPA 1386

Query: 157  --GDGSYNPTPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPT 324
                   +P P  PPS +   P+  SP P  P P +P  P+  P      SP   S  P 
Sbjct: 1387 PPSPAPPSPIPPAPPSPEPPSPAPPSPAPPSPAPPSPQPPSPAPPSPRPPSPAPPSPAPP 1446

Query: 325  DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             P P +P  P  PS    +  P   +PPS   P
Sbjct: 1447 SPVPPSPQPPAPPSPAPPSPAPPSPAPPSPAPP 1479

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 52/149 (34%), Positives = 70/149 (46%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SP       P P  P+    +PP    P+P+PPS   S +P P
Sbjct: 1436 PSPAPPS------PAPPSPVPPSPQPPAPPSPAPPSPAPPSPAPPSPAPPS-PASPSPVP 1488

Query: 184  --STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
               TPPS    P +   PPS PTP  P+ P +P+     +PP+   PP  P P+  + P 
Sbjct: 1489 PLPTPPSPAPAPTTSPLPPS-PTPALPAPPASPAPP--PNPPRPPQPPAAPPPSPAAPPP 1545

Query: 358  TPSGGYYNSPPQD-------SSPPSDPLP 423
            +P+      PPQ        ++ PS PLP
Sbjct: 1546 SPA-PLAPPPPQPQPQPTPAAAAPSPPLP 1573

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 51/140 (36%), Positives = 60/140 (42%), Gaps = 2/140 (1%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP+   S +P    PP   S  P+P PPS    SPP +  P+P PPS      P P T
Sbjct: 596 PDPPTAPPSPDPPSPEPPSQPS-PPSPDPPSPDPPSPP-ALPPSPKPPS------PKPPT 647

Query: 190 PPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT-TP 363
           P      PPS   P P+ P+P  P  P  P      SP   S PP  P P +P  P+  P
Sbjct: 648 PAPPSPLPPSPLPPSPAPPSPAPPQPPPAPPSPTPPSPAPPSPPPPSPAPPSPRPPSPEP 707

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SP   S  P  P P
Sbjct: 708 PSPKPPSPEPPSPTPPSPQP 727

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 51/149 (34%), Positives = 68/149 (45%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-----PSGDGS 168
            P+P PPS +   +P P++P       P+P PPS S   PP    P+P+P     P     
Sbjct: 1232 PSPAPPSPNPP-SPAPTTP--ASPEPPSPQPPSPSPPVPPSPAPPSPAPLPPPSPDPPSP 1288

Query: 169  YNPTPSTPPSSDCTPPSQDSPPS-DPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPTT 342
              P+P+ PPS    P  +  PP+  P+P  P +P  PS      PPQ  SP P  P P +
Sbjct: 1289 VPPSPAPPPSPPAPPSPEPIPPAPPPSPPEPPSPAPPS----PQPPQPPSPSPPSPAPPS 1344

Query: 343  PS--TPTTPSGGYYNSPPQDSSPPSDPLP 423
            P   +P  PS    +  P    PPS   P
Sbjct: 1345 PEPPSPIPPSPAPPSPAPPSPQPPSPEPP 1373

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 48/144 (33%), Positives = 61/144 (42%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P+PS PP      P P  P     +PP    P+P PPS +      P
Sbjct: 1320 PSPAPPSPQPPQPPSPS-PPSPAPPSPEPPSPIPPSPAPPSPAPPSPQPPSPEPPSPAPP 1378

Query: 184  STPPSSDCTP---PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPST 351
            S  P S   P   P    PP+ P+P  PS P  PS    +  P    PP+   P+  P +
Sbjct: 1379 SPAPLSPAPPSPAPPSPIPPAPPSPEPPS-PAPPSPAPPSPAPPSPQPPSPAPPSPRPPS 1437

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P    PP+ P P
Sbjct: 1438 PAPPSPAPPSPVPPSPQPPAPPSP 1461

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 48/152 (31%), Positives = 66/152 (43%), Gaps = 12/152 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS----GDGSY 171
            P+P PPS      P P +PP      P P  P+    +PP    P+P+PPS         
Sbjct: 1388 PSPAPPS------PIPPAPPSPEPPSPAPPSPAPPSPAPPSPQPPSPAPPSPRPPSPAPP 1441

Query: 172  NPTPSTPPSSDCTPPSQDSP----PSDPTPTTPS----TPTTPSGGYYNSPPQDSSPPTD 327
            +P P +P      PP+  SP    P+ P+P  PS    +P +PS      PP  + P   
Sbjct: 1442 SPAPPSPVPPSPQPPAPPSPAPPSPAPPSPAPPSPAPPSPASPS----PVPPLPTPPSPA 1497

Query: 328  PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P PTT   P +P+      P   + PP+ P P
Sbjct: 1498 PAPTTSPLPPSPTPALPAPPASPAPPPNPPRP 1529

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 50/150 (33%), Positives = 65/150 (43%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS     +P P SP       P P  P     +PP    P+P+PPS     +P P
Sbjct: 1373 PSPAPPS-PAPLSPAPPSPAPPSPIPPAPPSPEPPSPAPPSPAPPSPAPPSPQPP-SPAP 1430

Query: 184  STPPSSDCTPPSQDSP---PSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPTTPS- 348
             +P      PPS   P   P  P P  P +P  PS     +PP  + P P  P+P +PS 
Sbjct: 1431 PSPRPPSPAPPSPAPPSPVPPSPQPPAPPSPAPPS----PAPPSPAPPSPAPPSPASPSP 1486

Query: 349  -----TPTTPSGGYYNSPPQDSSPPSDPLP 423
                 TP +P+     SP   S  P+ P P
Sbjct: 1487 VPPLPTPPSPAPAPTTSPLPPSPTPALPAP 1516

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 51/151 (33%), Positives = 64/151 (42%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSP-------PSDSGGSPPGSYDPTPSPPSG- 159
            P+P PPS + S +P P SPP      P+P P       P     +PP    P+P+PPS  
Sbjct: 1078 PSPPPPSPEPS-SPAPPSPPPPSPAPPSPEPQSSAPPSPEPQSSAPPSPVPPSPAPPSPA 1136

Query: 160  -DGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPT 333
                  P+PS  P+     P    PPS P P TP  P+  P      SP   S  P  P 
Sbjct: 1137 PPSPEPPSPSPSPAPPIPAPPSPQPPS-PAPQTPQPPSPDPPSPAPPSPAPPSPVPPSPI 1195

Query: 334  PTTPSTPT-TPSGGYYNSPPQDSSPPSDPLP 423
            P TP+ P+  P      SP   +  P  P P
Sbjct: 1196 PPTPAPPSPEPPSPVPPSPTPPAPQPPSPAP 1226

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 48/142 (33%), Positives = 60/142 (42%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNPT 180
            P+P PPS      P P SP       P+P PPS +  SP       PSP P      +P 
Sbjct: 1073 PSPAPPS------PPPPSPEPSSPAPPSPPPPSPAPPSPEPQSSAPPSPEPQSSAPPSPV 1126

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT-DPTPTTPSTPT 357
            P +P      PPS + P   P+P  P  P  PS    +  PQ   PP+ DP    P +P 
Sbjct: 1127 PPSPAPPSPAPPSPEPPSPSPSP-APPIPAPPSPQPPSPAPQTPQPPSPDPPSPAPPSPA 1185

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             PS    +  P   +PPS   P
Sbjct: 1186 PPSPVPPSPIPPTPAPPSPEPP 1207

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 50/146 (34%), Positives = 68/146 (46%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGS----YDPTPSPPSDSGGSP-PGSYDPTPSPPSGDGS 168
            P+P PPS +   +  PS  P   +      P+P+PPS +  SP P S  P+P+PP     
Sbjct: 1098 PSPAPPSPEPQSSAPPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPAPPI-PAP 1156

Query: 169  YNPTPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
             +P P +P      PPS D P P+ P+P  PS P  PS      PP  + P  +P    P
Sbjct: 1157 PSPQPPSPAPQTPQPPSPDPPSPAPPSPAPPS-PVPPS----PIPPTPAPPSPEPPSPVP 1211

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
             +PT P+    +  P    PPS   P
Sbjct: 1212 PSPTPPAPQPPSPAPPAPQPPSPAPP 1237

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 51/159 (32%), Positives = 57/159 (35%), Gaps = 19/159 (11%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP       P P SPP      P P PPS     PP    P P+PPS   +    P
Sbjct: 475 PSPAPPRPP----PFPPSPP------PNPRPPS-----PPVPPSPPPTPPSPPPTPPAPP 519

Query: 184 STPPSSDCTPPSQDSPPS-----------------DPTPTTPSTPTTPS--GGYYNSPPQ 306
             PP     PPS   PP                   P P  PS P  PS        PP+
Sbjct: 520 PVPPLPPAPPPSPPLPPEPPFIALCIRAGVLCAMPSPVPPLPSPPRPPSPQPPVPRPPPR 579

Query: 307 DSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              PP  P+P  P  P  P     +  P    PPS P P
Sbjct: 580 APRPPRPPSPPAPPAPPDPPTAPPSPDPPSPEPPSQPSP 618

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 52/155 (33%), Positives = 60/155 (38%), Gaps = 17/155 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYD----PTPSPP------ 153
           P P PPS     NP P SPP   S  PTP  P  +  +PP        P PSPP      
Sbjct: 482 PPPFPPSPPP--NPRPPSPPVPPSPPPTPPSPPPTPPAPPPVPPLPPAPPPSPPLPPEPP 539

Query: 154 -------SGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDS 312
                  +G     P+P  P  S   PPS   P   P P  P  P  PS     +PP   
Sbjct: 540 FIALCIRAGVLCAMPSPVPPLPSPPRPPSPQPPVPRPPPRAPRPPRPPSPPAPPAPPDPP 599

Query: 313 SPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
           + P  P P +P  P+ P      SPP    P  DP
Sbjct: 600 TAPPSPDPPSPEPPSQP------SPPSPDPPSPDP 628

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 55/166 (33%), Positives = 61/166 (36%), Gaps = 26/166 (15%)
 Frame = +1

Query: 4   PTPTPPSGD--GSYNPTPSSPPGGGSYDP--TPSPPSDSGGSP----------------- 120
           P P PPS     S  PTP SPP      P   P PP+     P                 
Sbjct: 491 PNPRPPSPPVPPSPPPTPPSPPPTPPAPPPVPPLPPAPPPSPPLPPEPPFIALCIRAGVL 550

Query: 121 ---PGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPST-PTTPSGGY 288
              P    P PSPP       P P  PP +   PP   SPP+ P P  P T P +P    
Sbjct: 551 CAMPSPVPPLPSPPRPPSPQPPVPRPPPRAP-RPPRPPSPPAPPAPPDPPTAPPSPDPPS 609

Query: 289 YNSPPQDSSP-PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              P Q S P P  P+P  PS P  P      SP   +  P  PLP
Sbjct: 610 PEPPSQPSPPSPDPPSPDPPSPPALPPSPKPPSPKPPTPAPPSPLP 655

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 48/146 (32%), Positives = 63/146 (43%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG-SPPGSYDPTPSPPSGDGSYNPT 180
            P+P+PP       P+P+  P      P+P PPS +   SPP    P P PP+   S    
Sbjct: 1260 PSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPPSPPAPPSPEPIPPAPPPSPPEP 1319

Query: 181  PS-TPPSSDCTPPSQDSPPS----DPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
            PS  PPS     P   SPPS     P P +P  P+        +PP  + P   P    P
Sbjct: 1320 PSPAPPSPQPPQPPSPSPPSPAPPSPEPPSPIPPSP-------APPSPAPPSPQPPSPEP 1372

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
             +P  PS    +  P   +PPS P+P
Sbjct: 1373 PSPAPPSPAPLSPAPPSPAPPS-PIP 1397

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 44/130 (33%), Positives = 57/130 (43%), Gaps = 10/130 (7%)
 Frame = +1

Query: 4    PTPTPPSGD--GSYNPTPSSPPGGGSYDPTPSPPSDSGGSP----PGSYDPTPSPPSGDG 165
            P+P PPS       +P P SP       P+P+PPS +  SP    P    P P+P +   
Sbjct: 1446 PSPVPPSPQPPAPPSPAPPSPAPPSPAPPSPAPPSPASPSPVPPLPTPPSPAPAPTTSPL 1505

Query: 166  SYNPTPS--TPPSSDCTPPSQDSPPSDPT--PTTPSTPTTPSGGYYNSPPQDSSPPTDPT 333
              +PTP+   PP+S   PP+   PP  P   P +P+ P  PS      PP    P   P 
Sbjct: 1506 PPSPTPALPAPPASPAPPPNPPRPPQPPAAPPPSPAAPP-PSPAPLAPPPPQPQPQPTPA 1564

Query: 334  PTTPSTPTTP 363
               PS P  P
Sbjct: 1565 AAAPSPPLPP 1574

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 51/156 (32%), Positives = 56/156 (35%), Gaps = 16/156 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPP--------GGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSG 159
           P P  P       P P  PP        G     P+P PP  S   PP    P P PP  
Sbjct: 520 PVPPLPPAPPPSPPLPPEPPFIALCIRAGVLCAMPSPVPPLPSPPRPPSPQPPVPRPPPR 579

Query: 160 DGS-----YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSP 318
                     P P  PP     PPS D PPS   P+ PS  +P  PS      PP   + 
Sbjct: 580 APRPPRPPSPPAPPAPPDPPTAPPSPD-PPSPEPPSQPSPPSPDPPS----PDPPSPPAL 634

Query: 319 PTDPTPTTPSTPT-TPSGGYYNSPPQDSSPPSDPLP 423
           P  P P +P  PT  P      SP   S  P  P P
Sbjct: 635 PPSPKPPSPKPPTPAPPSPLPPSPLPPSPAPPSPAP 670

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 46/136 (33%), Positives = 47/136 (34%), Gaps = 16/136 (11%)
 Frame = +1

Query: 64  GGGSYDPTPSPPSDSGGSPP--GSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPS 237
           GG    P PSP       PP   S  P P PPS      P P +PP    TPPS    P 
Sbjct: 465 GGQCLAPPPSPSPAPPRPPPFPPSPPPNPRPPSP-----PVPPSPPP---TPPSPPPTPP 516

Query: 238 DPTPTTPSTPTTPSGGYYNSPPQDSSPP--------------TDPTPTTPSTPTTPSGGY 375
            P P  P  P  P      SPP    PP                P P  PS P  PS   
Sbjct: 517 APPPVPPLPPAPPP-----SPPLPPEPPFIALCIRAGVLCAMPSPVPPLPSPPRPPS--- 568

Query: 376 YNSPPQDSSPPSDPLP 423
              PP    PP  P P
Sbjct: 569 -PQPPVPRPPPRAPRP 583

[41][TOP]
>UniRef100_O10341 Uncharacterized 29.3 kDa protein n=1 Tax=Orgyia pseudotsugata MNPV
           RepID=Y091_NPVOP
          Length = 279

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 59/148 (39%), Positives = 72/148 (48%), Gaps = 8/148 (5%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP---PSGDGSY 171
           PTPTP PS   +  PTP+  P   +  PTP+P      +P  +  PTPSP   PS   S 
Sbjct: 45  PTPTPTPSPTPTPTPTPTPTPTP-TPSPTPTPALSPTPTPSPTLSPTPSPTPTPSPTPSP 103

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTPT--- 339
            P+P+  PS   +P    SP   PTPT   TPT +P+     SP    SP   PTPT   
Sbjct: 104 TPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSP 163

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           TPS   TPS     +PP   +PP  P P
Sbjct: 164 TPSPTPTPSPTPSPTPPPSPTPPPSPSP 191

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 57/146 (39%), Positives = 69/146 (47%), Gaps = 7/146 (4%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPSSPPGGG---SYDPTPSPPSDSGGSPPGSYDPTPSP---PSGD 162
           PTPTP P+   + +PTP+  P      S  PTPSP      SP  +  PTPSP   PS  
Sbjct: 65  PTPTPSPTPTPALSPTPTPSPTLSPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPT 124

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
            S  PTPS  P+   TP    SP   P+PT   TP TPS     +P    +P   P+PT 
Sbjct: 125 PSPTPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTP-TPS----PTPSPTPTPSPTPSPTP 179

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDPL 420
           P +PT         PP   SP  DP+
Sbjct: 180 PPSPT---------PPPSPSPLGDPM 196

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 53/144 (36%), Positives = 66/144 (45%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+PTP        PTPS  P      PTPSP      +P  +  PTPSP +   + +PTP
Sbjct: 35  PSPTP-------TPTPSPTP-----TPTPSPTPTPTPTPTPTPTPTPSP-TPTPALSPTP 81

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPT---TPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           +  P+   TP    +P   P+PT   TPT   TPS     SP    +P   PTPT   TP
Sbjct: 82  TPSPTLSPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPTPSPTP 141

Query: 355 T-TPSGGYYNSPPQDSSPPSDPLP 423
           + TPS     SP    +P   P P
Sbjct: 142 SPTPSPTPTPSPTPSPTPTPSPTP 165

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 52/124 (41%), Positives = 59/124 (47%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   PTPTP---PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSY 171
           PTPTP   PS   S  PTPS  P      PTP+P      +P  S  PTPSP PS   S 
Sbjct: 93  PTPTPSPTPSPTPSPTPTPSPTPS-----PTPTPSPTPSPTPTPSPTPTPSPTPSPTPSP 147

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
            PTPS  PS   TP    SP   P+PT +P+ P +P+      PP   SP  DP     S
Sbjct: 148 TPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPPPSPT------PPPSPSPLGDPMYFPSS 201

Query: 349 TPTT 360
             TT
Sbjct: 202 VGTT 205

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 48/125 (38%), Positives = 53/125 (42%), Gaps = 11/125 (8%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPS---SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP------- 150
           P+PTP PS   S  PTPS   SP    S  PTPSP      SP  +  PTPSP       
Sbjct: 105 PSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPT 164

Query: 151 PSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP 330
           PS   + +PTPS  P    TPP   SP  DP     S  TT     Y  P  +  P    
Sbjct: 165 PSPTPTPSPTPSPTPPPSPTPPPSPSPLGDPMYFPSSVGTTDQLRDYIRPLCNGWPRPRE 224

Query: 331 TPTTP 345
           T   P
Sbjct: 225 TYAVP 229

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 40/104 (38%), Positives = 48/104 (46%), Gaps = 2/104 (1%)
 Frame = +1

Query: 118 PPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYN 294
           P  S  PTP+P       +PTP+  PS   TP    +P   PTPT TPS   TP+     
Sbjct: 33  PLPSPTPTPTP-------SPTPTPTPSPTPTP----TPTPTPTPTPTPSPTPTPALSPTP 81

Query: 295 SPPQDSSPPTDPTPTTPSTPT-TPSGGYYNSPPQDSSPPSDPLP 423
           +P    SP   PTPT   TP+ TPS     SP    +P   P P
Sbjct: 82  TPSPTLSPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTP 125

[42][TOP]
>UniRef100_UPI00005A1EA0 PREDICTED: similar to Bile-salt-activated lipase precursor (BAL)
           (Bile-salt-stimulated lipase) (BSSL) (Carboxyl ester
           lipase) (Sterol esterase) (Cholesterol esterase)
           (Pancreatic lysophospholipase) isoform 6 n=1 Tax=Canis
           lupus familiaris RepID=UPI00005A1EA0
          Length = 715

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 59/152 (38%), Positives = 77/152 (50%), Gaps = 14/152 (9%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP----GSYDPTPSPPSGDGS 168
           + TP PPSGD +  P   +PP G S  P P+PPS    +PP    G  +  P+PPSGD +
Sbjct: 562 EATPAPPSGDSNATP---APPSGDSNAP-PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSN 617

Query: 169 YNPTPSTPPSSDC----TPPSQDS--PPSDPTPTTPSTPTTPSGGYYNSPPQ----DSSP 318
               P  PPS D      PPS DS  PP+ P+  + + P  PSG   N+PP     DS+ 
Sbjct: 618 ---APPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGD-SNAPPAPPSGDSNA 673

Query: 319 PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
           P  P     + P  P  G  N+PP   +PPS+
Sbjct: 674 PPAPPSGDSNAPPVPPSGDSNAPP---APPSE 702

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 46/128 (35%), Positives = 62/128 (48%), Gaps = 15/128 (11%)
 Frame = +1

Query: 79  DPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDC----TPPSQDS--PPSD 240
           + TP+PPS       G  + TP+PPSGD +    P  PPS D      PPS DS  PP+ 
Sbjct: 562 EATPAPPS-------GDSNATPAPPSGDSN---APPAPPSGDSNAPPAPPSGDSNAPPAP 611

Query: 241 PTPTTPSTPTTPSGGYYNSPPQ----DSSPPTDPTPTTPSTPTTPSGGYYNSPP-----Q 393
           P+  + + P  PSG   N+PP     DS+ P  P     + P  P  G  N+PP      
Sbjct: 612 PSGDSNAPPAPPSGD-SNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGD 670

Query: 394 DSSPPSDP 417
            ++PP+ P
Sbjct: 671 SNAPPAPP 678

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 37/89 (41%), Positives = 44/89 (49%), Gaps = 16/89 (17%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSS--------PPGGGSYDPTPSPPSDSGGSPP----GSYDPTPSPP 153
           P PPSGD +  P P S        PP G S  P P+PPS    +PP    G  +  P+PP
Sbjct: 620 PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAP-PAPPSGDSNAPPAPPSGDSNAPPAPP 678

Query: 154 SGDGSYNPTPSTPPSSDC----TPPSQDS 228
           SGD +    P  PPS D      PPS+DS
Sbjct: 679 SGDSN---APPVPPSGDSNAPPAPPSEDS 704

[43][TOP]
>UniRef100_UPI00005A1E9F PREDICTED: similar to Bile-salt-activated lipase precursor (BAL)
           (Bile-salt-stimulated lipase) (BSSL) (Carboxyl ester
           lipase) (Sterol esterase) (Cholesterol esterase)
           (Pancreatic lysophospholipase) isoform 5 n=1 Tax=Canis
           lupus familiaris RepID=UPI00005A1E9F
          Length = 709

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 59/152 (38%), Positives = 77/152 (50%), Gaps = 14/152 (9%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP----GSYDPTPSPPSGDGS 168
           + TP PPSGD +  P   +PP G S  P P+PPS    +PP    G  +  P+PPSGD +
Sbjct: 556 EATPAPPSGDSNATP---APPSGDSNAP-PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSN 611

Query: 169 YNPTPSTPPSSDC----TPPSQDS--PPSDPTPTTPSTPTTPSGGYYNSPPQ----DSSP 318
               P  PPS D      PPS DS  PP+ P+  + + P  PSG   N+PP     DS+ 
Sbjct: 612 ---APPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGD-SNAPPAPPSGDSNA 667

Query: 319 PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
           P  P     + P  P  G  N+PP   +PPS+
Sbjct: 668 PPAPPSGDSNAPPVPPSGDSNAPP---APPSE 696

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 46/128 (35%), Positives = 62/128 (48%), Gaps = 15/128 (11%)
 Frame = +1

Query: 79  DPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDC----TPPSQDS--PPSD 240
           + TP+PPS       G  + TP+PPSGD +    P  PPS D      PPS DS  PP+ 
Sbjct: 556 EATPAPPS-------GDSNATPAPPSGDSN---APPAPPSGDSNAPPAPPSGDSNAPPAP 605

Query: 241 PTPTTPSTPTTPSGGYYNSPPQ----DSSPPTDPTPTTPSTPTTPSGGYYNSPP-----Q 393
           P+  + + P  PSG   N+PP     DS+ P  P     + P  P  G  N+PP      
Sbjct: 606 PSGDSNAPPAPPSGD-SNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGD 664

Query: 394 DSSPPSDP 417
            ++PP+ P
Sbjct: 665 SNAPPAPP 672

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 37/89 (41%), Positives = 44/89 (49%), Gaps = 16/89 (17%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSS--------PPGGGSYDPTPSPPSDSGGSPP----GSYDPTPSPP 153
           P PPSGD +  P P S        PP G S  P P+PPS    +PP    G  +  P+PP
Sbjct: 614 PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAP-PAPPSGDSNAPPAPPSGDSNAPPAPP 672

Query: 154 SGDGSYNPTPSTPPSSDC----TPPSQDS 228
           SGD +    P  PPS D      PPS+DS
Sbjct: 673 SGDSN---APPVPPSGDSNAPPAPPSEDS 698

[44][TOP]
>UniRef100_UPI00005A1E9E PREDICTED: similar to Bile-salt-activated lipase precursor (BAL)
           (Bile-salt-stimulated lipase) (BSSL) (Carboxyl ester
           lipase) (Sterol esterase) (Cholesterol esterase)
           (Pancreatic lysophospholipase) isoform 4 n=1 Tax=Canis
           lupus familiaris RepID=UPI00005A1E9E
          Length = 710

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 59/152 (38%), Positives = 77/152 (50%), Gaps = 14/152 (9%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP----GSYDPTPSPPSGDGS 168
           + TP PPSGD +  P   +PP G S  P P+PPS    +PP    G  +  P+PPSGD +
Sbjct: 557 EATPAPPSGDSNATP---APPSGDSNAP-PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSN 612

Query: 169 YNPTPSTPPSSDC----TPPSQDS--PPSDPTPTTPSTPTTPSGGYYNSPPQ----DSSP 318
               P  PPS D      PPS DS  PP+ P+  + + P  PSG   N+PP     DS+ 
Sbjct: 613 ---APPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGD-SNAPPAPPSGDSNA 668

Query: 319 PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
           P  P     + P  P  G  N+PP   +PPS+
Sbjct: 669 PPAPPSGDSNAPPVPPSGDSNAPP---APPSE 697

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 46/128 (35%), Positives = 62/128 (48%), Gaps = 15/128 (11%)
 Frame = +1

Query: 79  DPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDC----TPPSQDS--PPSD 240
           + TP+PPS       G  + TP+PPSGD +    P  PPS D      PPS DS  PP+ 
Sbjct: 557 EATPAPPS-------GDSNATPAPPSGDSN---APPAPPSGDSNAPPAPPSGDSNAPPAP 606

Query: 241 PTPTTPSTPTTPSGGYYNSPPQ----DSSPPTDPTPTTPSTPTTPSGGYYNSPP-----Q 393
           P+  + + P  PSG   N+PP     DS+ P  P     + P  P  G  N+PP      
Sbjct: 607 PSGDSNAPPAPPSGD-SNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGD 665

Query: 394 DSSPPSDP 417
            ++PP+ P
Sbjct: 666 SNAPPAPP 673

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 37/89 (41%), Positives = 44/89 (49%), Gaps = 16/89 (17%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSS--------PPGGGSYDPTPSPPSDSGGSPP----GSYDPTPSPP 153
           P PPSGD +  P P S        PP G S  P P+PPS    +PP    G  +  P+PP
Sbjct: 615 PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAP-PAPPSGDSNAPPAPPSGDSNAPPAPP 673

Query: 154 SGDGSYNPTPSTPPSSDC----TPPSQDS 228
           SGD +    P  PPS D      PPS+DS
Sbjct: 674 SGDSN---APPVPPSGDSNAPPAPPSEDS 699

[45][TOP]
>UniRef100_UPI00005A1E9D PREDICTED: similar to Bile-salt-activated lipase precursor (BAL)
           (Bile-salt-stimulated lipase) (BSSL) (Carboxyl ester
           lipase) (Sterol esterase) (Cholesterol esterase)
           (Pancreatic lysophospholipase) isoform 3 n=1 Tax=Canis
           lupus familiaris RepID=UPI00005A1E9D
          Length = 710

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 59/152 (38%), Positives = 77/152 (50%), Gaps = 14/152 (9%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP----GSYDPTPSPPSGDGS 168
           + TP PPSGD +  P   +PP G S  P P+PPS    +PP    G  +  P+PPSGD +
Sbjct: 557 EATPAPPSGDSNATP---APPSGDSNAP-PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSN 612

Query: 169 YNPTPSTPPSSDC----TPPSQDS--PPSDPTPTTPSTPTTPSGGYYNSPPQ----DSSP 318
               P  PPS D      PPS DS  PP+ P+  + + P  PSG   N+PP     DS+ 
Sbjct: 613 ---APPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGD-SNAPPAPPSGDSNA 668

Query: 319 PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
           P  P     + P  P  G  N+PP   +PPS+
Sbjct: 669 PPAPPSGDSNAPPVPPSGDSNAPP---APPSE 697

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 46/128 (35%), Positives = 62/128 (48%), Gaps = 15/128 (11%)
 Frame = +1

Query: 79  DPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDC----TPPSQDS--PPSD 240
           + TP+PPS       G  + TP+PPSGD +    P  PPS D      PPS DS  PP+ 
Sbjct: 557 EATPAPPS-------GDSNATPAPPSGDSN---APPAPPSGDSNAPPAPPSGDSNAPPAP 606

Query: 241 PTPTTPSTPTTPSGGYYNSPPQ----DSSPPTDPTPTTPSTPTTPSGGYYNSPP-----Q 393
           P+  + + P  PSG   N+PP     DS+ P  P     + P  P  G  N+PP      
Sbjct: 607 PSGDSNAPPAPPSGD-SNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGD 665

Query: 394 DSSPPSDP 417
            ++PP+ P
Sbjct: 666 SNAPPAPP 673

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 37/89 (41%), Positives = 44/89 (49%), Gaps = 16/89 (17%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSS--------PPGGGSYDPTPSPPSDSGGSPP----GSYDPTPSPP 153
           P PPSGD +  P P S        PP G S  P P+PPS    +PP    G  +  P+PP
Sbjct: 615 PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAP-PAPPSGDSNAPPAPPSGDSNAPPAPP 673

Query: 154 SGDGSYNPTPSTPPSSDC----TPPSQDS 228
           SGD +    P  PPS D      PPS+DS
Sbjct: 674 SGDSN---APPVPPSGDSNAPPAPPSEDS 699

[46][TOP]
>UniRef100_UPI0000EB2391 Bile salt-activated lipase precursor (EC 3.1.1.3) (EC 3.1.1.13)
           (BAL) (Bile salt-stimulated lipase) (BSSL) (Carboxyl
           ester lipase) (Sterol esterase) (Cholesterol esterase)
           (Pancreatic lysophospholipase). n=2 Tax=Canis lupus
           familiaris RepID=UPI0000EB2391
          Length = 712

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 59/152 (38%), Positives = 77/152 (50%), Gaps = 14/152 (9%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP----GSYDPTPSPPSGDGS 168
           + TP PPSGD +  P   +PP G S  P P+PPS    +PP    G  +  P+PPSGD +
Sbjct: 559 EATPAPPSGDSNATP---APPSGDSNAP-PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSN 614

Query: 169 YNPTPSTPPSSDC----TPPSQDS--PPSDPTPTTPSTPTTPSGGYYNSPPQ----DSSP 318
               P  PPS D      PPS DS  PP+ P+  + + P  PSG   N+PP     DS+ 
Sbjct: 615 ---APPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGD-SNAPPAPPSGDSNA 670

Query: 319 PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
           P  P     + P  P  G  N+PP   +PPS+
Sbjct: 671 PPAPPSGDSNAPPVPPSGDSNAPP---APPSE 699

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 46/128 (35%), Positives = 62/128 (48%), Gaps = 15/128 (11%)
 Frame = +1

Query: 79  DPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDC----TPPSQDS--PPSD 240
           + TP+PPS       G  + TP+PPSGD +    P  PPS D      PPS DS  PP+ 
Sbjct: 559 EATPAPPS-------GDSNATPAPPSGDSN---APPAPPSGDSNAPPAPPSGDSNAPPAP 608

Query: 241 PTPTTPSTPTTPSGGYYNSPPQ----DSSPPTDPTPTTPSTPTTPSGGYYNSPP-----Q 393
           P+  + + P  PSG   N+PP     DS+ P  P     + P  P  G  N+PP      
Sbjct: 609 PSGDSNAPPAPPSGD-SNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGD 667

Query: 394 DSSPPSDP 417
            ++PP+ P
Sbjct: 668 SNAPPAPP 675

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 37/89 (41%), Positives = 44/89 (49%), Gaps = 16/89 (17%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSS--------PPGGGSYDPTPSPPSDSGGSPP----GSYDPTPSPP 153
           P PPSGD +  P P S        PP G S  P P+PPS    +PP    G  +  P+PP
Sbjct: 617 PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAP-PAPPSGDSNAPPAPPSGDSNAPPAPP 675

Query: 154 SGDGSYNPTPSTPPSSDC----TPPSQDS 228
           SGD +    P  PPS D      PPS+DS
Sbjct: 676 SGDSN---APPVPPSGDSNAPPAPPSEDS 701

[47][TOP]
>UniRef100_Q948Y7 VMP3 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q948Y7_VOLCA
          Length = 687

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/138 (38%), Positives = 59/138 (42%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP    S  P P  PP   S  P P  PS    SPP S   +PSPP    +  PT   
Sbjct: 515 PNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPPSPP-SPPTSPSPPDPAWANLPTSPD 573

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           PPS +  PPS D P  DP    P +P  PS    N PP    PP  P P+ P     P  
Sbjct: 574 PPSPN--PPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPS 631

Query: 370 GYYNSPPQDSSPPSDPLP 423
               +PP  S PP  P P
Sbjct: 632 PPPPNPPPPSPPPPSPRP 649

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 58/145 (40%), Positives = 66/145 (45%), Gaps = 4/145 (2%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPSSPPGGGSYDPT-PSPPSDSGGSPPGSYDP-TPSPPSGDGSYN 174
           P P P PS      P PS PP      PT PSPP  +  + P S DP +P+PPS D    
Sbjct: 528 PRPPPRPSSPRPPPPDPSPPPPSPPSPPTSPSPPDPAWANLPTSPDPPSPNPPSPDPPSP 587

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
             PS PP S   PP    PP +P P +P  P  P      SPP  S PP  P P  P  P
Sbjct: 588 DPPSAPPPS---PPPPSPPPPNPPPPSPPPPNPPPP----SPPPPSPPPPSPPPPNPPPP 640

Query: 355 TTPSGGYYN-SPPQDSSPPSDPLPR 426
           + P       +PP  S PP  P PR
Sbjct: 641 SPPPPSPRPPTPPPPSPPPPRPPPR 665

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 50/141 (35%), Positives = 60/141 (42%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNPT 180
           P P PPS      P P +PP      P+P PP+     P     P P P PS      P 
Sbjct: 490 PRPPPPS------PVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPD 543

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           PS PP S  +PP+  SPP       P++P  PS     +PP    P  DP    P +P  
Sbjct: 544 PSPPPPSPPSPPTSPSPPDPAWANLPTSPDPPS----PNPPSPDPPSPDPPSAPPPSPPP 599

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           PS    N PP    PP+ P P
Sbjct: 600 PSPPPPNPPPPSPPPPNPPPP 620

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 54/143 (37%), Positives = 64/143 (44%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P  PP      PTP PPS      P   +P P PPS      P P
Sbjct: 480 PSPPPPS------PPPPRPPPPSPVPPTP-PPSPRPPPSPRPPNPPPRPPSPRPPPRPPP 532

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSP--PQDSSP-PTDPTPTTPSTP 354
              PSS   PP   SPP    P+ P++P+ P   + N P  P   SP P  P P +P  P
Sbjct: 533 R--PSSPRPPPPDPSPPPPSPPSPPTSPSPPDPAWANLPTSPDPPSPNPPSPDPPSPDPP 590

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
           + P      SPP  S PP +P P
Sbjct: 591 SAPP----PSPPPPSPPPPNPPP 609

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 53/135 (39%), Positives = 58/135 (42%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS D    P PS PP      P+P PP+    SPP    P PSPP         P
Sbjct: 580 PSPDPPSPDPPSAPPPSPPP------PSPPPPNPPPPSPPPPNPPPPSPPP--------P 625

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP S   PP  + PP  P P +P  PT         PP  S PP  P P  P T    
Sbjct: 626 SPPPPS---PPPPNPPPPSPPPPSPRPPT---------PPPPSPPPPRPPPRPPPT---- 669

Query: 364 SGGYYNSPPQDSSPP 408
                 SPP  SSPP
Sbjct: 670 ----RRSPPPTSSPP 680

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 50/130 (38%), Positives = 62/130 (47%), Gaps = 5/130 (3%)
 Frame = +1

Query: 49  PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNPTPSTPPSSDCTPPSQD 225
           P SPP      P P PPS    +PP S  P PSP P       P+P  PP     P S  
Sbjct: 479 PPSPPPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPR 538

Query: 226 SPPSDPTPTTPSTPTTPSGGYYNSPPQD--SSPPTDPTPTTPS--TPTTPSGGYYNSPPQ 393
            PP DP+P  PS P+ P+     SPP    ++ PT P P +P+  +P  PS    ++PP 
Sbjct: 539 PPPPDPSPPPPSPPSPPTS---PSPPDPAWANLPTSPDPPSPNPPSPDPPSPDPPSAPPP 595

Query: 394 DSSPPSDPLP 423
              PPS P P
Sbjct: 596 SPPPPSPPPP 605

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 51/132 (38%), Positives = 59/132 (44%), Gaps = 7/132 (5%)
 Frame = +1

Query: 49  PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST-PPSSDCTPPSQD 225
           PS+PP      P PSPP      PP    P+P PP+   S  P PS  PP+    PPS  
Sbjct: 476 PSAPPS----PPPPSPP------PPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPR 525

Query: 226 SPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP---STPTTPSGGYYNSP--- 387
            PP  P    PS+P  P       PP   SPPT P+P  P   + PT+P     N P   
Sbjct: 526 PPPRPPP--RPSSPRPPPPDPSPPPPSPPSPPTSPSPPDPAWANLPTSPDPPSPNPPSPD 583

Query: 388 PQDSSPPSDPLP 423
           P    PPS P P
Sbjct: 584 PPSPDPPSAPPP 595

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 47/132 (35%), Positives = 56/132 (42%), Gaps = 3/132 (2%)
 Frame = +1

Query: 37  YNPTPSSPPGGGSYDPTPS-PPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTP 213
           Y+ +P   P     +  PS PPS    SPP    P P PPS      P P TPP S   P
Sbjct: 459 YDVSPDECPPLSVLETLPSAPPSPPPPSPP---PPRPPPPS------PVPPTPPPSPRPP 509

Query: 214 PSQDSPPSDPTPTTPSTPTTPSG--GYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSP 387
           PS   P   P P +P  P  P         PP D SPP  P+P +P T  +P    + + 
Sbjct: 510 PSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPP-PSPPSPPTSPSPPDPAWANL 568

Query: 388 PQDSSPPSDPLP 423
           P    PPS   P
Sbjct: 569 PTSPDPPSPNPP 580

[48][TOP]
>UniRef100_C5Y027 Putative uncharacterized protein Sb04g010730 n=1 Tax=Sorghum
           bicolor RepID=C5Y027_SORBI
          Length = 569

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 56/143 (39%), Positives = 70/143 (48%), Gaps = 6/143 (4%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTP-----SPPSDSGGSPPGSYDPTPSPPSGDGSY 171
           +P PPS      PT S PP   S  P+P     +PP  S   PP S  PT +PP+   ++
Sbjct: 201 SPPPPSSPPIAPPTYSQPP---SLIPSPPPHQATPPQQSSSPPPPSSTPT-TPPTYPPNH 256

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT-DPTPTTPS 348
            PTPS  PSS  T P Q SPP++  P  PS+P      Y   PP  SSPP    TP  PS
Sbjct: 257 QPTPS--PSSPPTMPPQSSPPTNNLPPPPSSPPIAPPTYSQPPPLHSSPPPHQATPPQPS 314

Query: 349 TPTTPSGGYYNSPPQDSSPPSDP 417
           +   P      +PP ++ PP  P
Sbjct: 315 SSLPPPSSTPTTPPPNNQPPLSP 337

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 59/155 (38%), Positives = 68/155 (43%), Gaps = 22/155 (14%)
 Frame = +1

Query: 10  PTPPSGDGSYNPT-------PSSPPGGGSYDPTPSPP---SDSGGSPPGSYDPTP--SPP 153
           P PPS   +  P        PSSP    +  P  SPP   S     PP +  P P  SPP
Sbjct: 150 PPPPSSTPTTAPIYPPNNQPPSSPSSPPTMPPHKSPPPQQSSPPAKPPTNNSPPPPSSPP 209

Query: 154 SGDGSYNPTPS---TPPSSDCTPPSQDS--PPSDPTPTTPST-----PTTPSGGYYNSPP 303
               +Y+  PS   +PP    TPP Q S  PP   TPTTP T       TPS     + P
Sbjct: 210 IAPPTYSQPPSLIPSPPPHQATPPQQSSSPPPPSSTPTTPPTYPPNHQPTPSPSSPPTMP 269

Query: 304 QDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPP 408
             SSPPT+  P  PS+P      Y   PP  SSPP
Sbjct: 270 PQSSPPTNNLPPPPSSPPIAPPTYSQPPPLHSSPP 304

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 59/160 (36%), Positives = 71/160 (44%), Gaps = 22/160 (13%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPT--PSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT- 180
           P PPS      PT S PP   S  P    +PP  S   PP S  PT  PP+     +P+ 
Sbjct: 280 PPPPSSPPIAPPTYSQPPPLHSSPPPHQATPPQPSSSLPPPSSTPTTPPPNNQPPLSPSI 339

Query: 181 -PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTP-------SGGYYNSPPQDSS--PPTDP 330
            P+ PP     PP    P ++  P +PS PT P          Y  +PPQ SS  PP   
Sbjct: 340 PPTMPPYKSPVPPLSSPPTNNLPPPSPSAPTAPPTYTQPSPPPYQATPPQPSSSPPPPSS 399

Query: 331 TPTTP--------STPTTPSGGYYNSP-PQDSSPPSDPLP 423
           TPTTP        S    P+   Y SP P  SSPP++ LP
Sbjct: 400 TPTTPPPNNQPPLSPSIPPTMPPYKSPMPPQSSPPTNNLP 439

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 61/159 (38%), Positives = 77/159 (48%), Gaps = 24/159 (15%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPS--SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP- 183
           TPP+   ++ PTPS  SPP   +  P  SPP+++   PP       SPP    +Y+  P 
Sbjct: 248 TPPTYPPNHQPTPSPSSPP---TMPPQSSPPTNNLPPPPS------SPPIAPPTYSQPPP 298

Query: 184 --STPPSSDCTPPSQDS--PPSDPTPTTP--------STPTTPSGGYYNSP-PQDSSPPT 324
             S+PP    TPP   S  PP   TPTTP        S    P+   Y SP P  SSPPT
Sbjct: 299 LHSSPPPHQATPPQPSSSLPPPSSTPTTPPPNNQPPLSPSIPPTMPPYKSPVPPLSSPPT 358

Query: 325 D----PTPTTPSTP---TTPS-GGYYNSPPQDSSPPSDP 417
           +    P+P+ P+ P   T PS   Y  +PPQ SS P  P
Sbjct: 359 NNLPPPSPSAPTAPPTYTQPSPPPYQATPPQPSSSPPPP 397

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 57/168 (33%), Positives = 66/168 (39%), Gaps = 31/168 (18%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGS-------YDPTPSPPSGDGSY 171
           TPP         P   P      P  +PPS+S   PP S       Y P   PPS   S 
Sbjct: 117 TPPQSSSPQETPPQQYPPPPKSSPPVTPPSNSFPPPPSSTPTTAPIYPPNNQPPSSPSS- 175

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDP----TPTTPSTPTTPSGGYYN-------------SP 300
              P T P     PP Q SPP+ P    +P  PS+P      Y               +P
Sbjct: 176 ---PPTMPPHKSPPPQQSSPPAKPPTNNSPPPPSSPPIAPPTYSQPPSLIPSPPPHQATP 232

Query: 301 PQDSS--PPTDPTPTTPST-----PTTPSGGYYNSPPQDSSPPSDPLP 423
           PQ SS  PP   TPTTP T       TPS     + P  SSPP++ LP
Sbjct: 233 PQQSSSPPPPSSTPTTPPTYPPNHQPTPSPSSPPTMPPQSSPPTNNLP 280

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 54/149 (36%), Positives = 71/149 (47%), Gaps = 18/149 (12%)
 Frame = +1

Query: 19  PSGDGSYNPTPSSPPGGGSYDPTPS-----PPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P GDG  +P      G     P+PS     PPS SG +PP S  P  +PP     Y P P
Sbjct: 82  PHGDGHGHPKKDDC-GHDQESPSPSNDSSGPPSSSG-TPPQSSSPQETPPQ---QYPPPP 136

Query: 184 S-----TPPSSDCTPPSQDSP-------PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT- 324
                 TPPS+   PP   +P       P++  P++PS+P T    + + PPQ SSPP  
Sbjct: 137 KSSPPVTPPSNSFPPPPSSTPTTAPIYPPNNQPPSSPSSPPT-MPPHKSPPPQQSSPPAK 195

Query: 325 DPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
            PT  +P  P++P      +PP  S PPS
Sbjct: 196 PPTNNSPPPPSSPP----IAPPTYSQPPS 220

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 55/156 (35%), Positives = 66/156 (42%), Gaps = 20/156 (12%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPTPSP---PSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
           PPS   +  P  + PP   S  PT  P   P     SPP +  P PSP +       T  
Sbjct: 319 PPSSTPTTPPPNNQPPLSPSIPPTMPPYKSPVPPLSSPPTNNLPPPSPSAPTAPPTYTQP 378

Query: 187 TPPSSDCTP--PSQDSPPSDPTPTTP--------STPTTPSGGYYNSP-PQDSSPPTD-- 327
           +PP    TP  PS   PP   TPTTP        S    P+   Y SP P  SSPPT+  
Sbjct: 379 SPPPYQATPPQPSSSPPPPSSTPTTPPPNNQPPLSPSIPPTMPPYKSPMPPQSSPPTNNL 438

Query: 328 PTPTTPSTPTTPSGGYYNSPPQD----SSPPSDPLP 423
           P P    T  TPS     +PP +     +PPS  +P
Sbjct: 439 PPPPPSYTQPTPSPSAPTTPPTEQDHGQTPPSYGVP 474

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 53/167 (31%), Positives = 72/167 (43%), Gaps = 29/167 (17%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPS---SPPGGGSYDP----TPSPPSDSGGSPPG---SYDPTPSP- 150
           P  +PP    +Y+  PS   SPP   +  P    +P PPS +  +PP    ++ PTPSP 
Sbjct: 204 PPSSPPIAPPTYSQPPSLIPSPPPHQATPPQQSSSPPPPSSTPTTPPTYPPNHQPTPSPS 263

Query: 151 ------PSGDGSYNPTPSTPPSSDCTPPSQDSPP---SDP-----TPTTPSTPTTPSGGY 288
                 P      N  P  P S    PP+   PP   S P     TP  PS+   P    
Sbjct: 264 SPPTMPPQSSPPTNNLPPPPSSPPIAPPTYSQPPPLHSSPPPHQATPPQPSSSLPPPSST 323

Query: 289 YNSPPQDSSPPTDPT--PTTP--STPTTPSGGYYNSPPQDSSPPSDP 417
             +PP ++ PP  P+  PT P   +P  P     +SPP ++ PP  P
Sbjct: 324 PTTPPPNNQPPLSPSIPPTMPPYKSPVPP----LSSPPTNNLPPPSP 366

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 48/149 (32%), Positives = 65/149 (43%), Gaps = 8/149 (5%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           D     PS D S  P+ S  P   S  P  +PP      PP    P  +PPS   S+ P 
Sbjct: 98  DQESPSPSNDSSGPPSSSGTPPQSS-SPQETPPQQY--PPPPKSSPPVTPPSN--SFPPP 152

Query: 181 PSTPPSSDCTPPSQDSPPSDPT--PTTP--STPTTPSGGYYNSPPQDSSPPTDPT-PTTP 345
           PS+ P++    P  + PPS P+  PT P   +P          PP ++SPP   + P  P
Sbjct: 153 PSSTPTTAPIYPPNNQPPSSPSSPPTMPPHKSPPPQQSSPPAKPPTNNSPPPPSSPPIAP 212

Query: 346 STPTTPSGGYYNSPPQDSSPP---SDPLP 423
            T + P     + PP  ++PP   S P P
Sbjct: 213 PTYSQPPSLIPSPPPHQATPPQQSSSPPP 241

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 45/130 (34%), Positives = 55/130 (42%), Gaps = 2/130 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT- 180
           P+P+ P+   +Y   PS PP    Y  TP  PS S   PP S  PT  PP+     +P+ 
Sbjct: 364 PSPSAPTAPPTYTQ-PSPPP----YQATPPQPSSS--PPPPSSTPTTPPPNNQPPLSPSI 416

Query: 181 -PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            P+ PP     PP Q SPP   T   P  P +     Y  P    S PT P        T
Sbjct: 417 PPTMPPYKSPMPP-QSSPP---TNNLPPPPPS-----YTQPTPSPSAPTTPPTEQDHGQT 467

Query: 358 TPSGGYYNSP 387
            PS G  + P
Sbjct: 468 PPSYGVPDGP 477

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 49/137 (35%), Positives = 55/137 (40%), Gaps = 6/137 (4%)
 Frame = +1

Query: 25  GDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGS---YDPTPSPPSGDGSYNPTPSTPP 195
           GDGS    P   P        P P  D  G P      +D     PS D S       PP
Sbjct: 59  GDGSNGVGPVKNPHCQKPGKGPDPHGDGHGHPKKDDCGHDQESPSPSNDSS------GPP 112

Query: 196 SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS-TPTT-PSG 369
           SS  TPP   SP   P    P  P +       SPP   +PP++  P  PS TPTT P  
Sbjct: 113 SSSGTPPQSSSPQETPPQQYPPPPKS-------SPPV--TPPSNSFPPPPSSTPTTAPIY 163

Query: 370 GYYNSPPQD-SSPPSDP 417
              N PP   SSPP+ P
Sbjct: 164 PPNNQPPSSPSSPPTMP 180

[49][TOP]
>UniRef100_A7RAH3 Putative uncharacterized protein C024L n=1 Tax=Paramecium bursaria
           Chlorella virus AR158 RepID=A7RAH3_PBCVA
          Length = 360

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 58/140 (41%), Positives = 75/140 (53%), Gaps = 3/140 (2%)
 Frame = +1

Query: 1   DP-TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           DP TPT P+      PT  + P   +    P+ P+D   +P     PTPS PS       
Sbjct: 161 DPNTPTDPN-----TPTDPNTPTDPNTPTDPNTPTDPN-TPTDPNTPTPSTPSTPS---- 210

Query: 178 TPSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
           TPSTP  PS+  TP +  +P +  TP+TPSTP+TPS     +P   S+P T  TP+TPST
Sbjct: 211 TPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPS-----TPSTPSTPSTPSTPSTPST 265

Query: 352 PTTPSGGYYNSPPQDSSPPS 411
           P+TPS     S   DSS P+
Sbjct: 266 PSTPSTPSTPSTSDDSSSPN 285

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 53/128 (41%), Positives = 70/128 (54%), Gaps = 4/128 (3%)
 Frame = +1

Query: 40  NPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDP-TPSPPSGDGSYN-PTPSTP--PSSDC 207
           +PT  + P   +    P+ P+D    P    DP TP+ P+     N PTPSTP  PS+  
Sbjct: 158 DPTDPNTPTDPNTPTDPNTPTD----PNTPTDPNTPTDPNTPTDPNTPTPSTPSTPSTPS 213

Query: 208 TPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSP 387
           TP +  +P +  TP+TPSTP+TPS     +P   S+P T  TP+TPSTP+TPS     S 
Sbjct: 214 TPSTPSTPSTPSTPSTPSTPSTPS-----TPSTPSTPSTPSTPSTPSTPSTPSTPSTPST 268

Query: 388 PQDSSPPS 411
           P   S PS
Sbjct: 269 PSTPSTPS 276

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 49/115 (42%), Positives = 62/115 (53%), Gaps = 2/115 (1%)
 Frame = +1

Query: 79  DPT-PSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDP-TPT 252
           DPT P+ P+D   +P     PT      D +    P+TP   +   PS  S PS P TP+
Sbjct: 158 DPTDPNTPTDPN-TPTDPNTPTDPNTPTDPNTPTDPNTPTDPNTPTPSTPSTPSTPSTPS 216

Query: 253 TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
           TPSTP+TPS    ++P   S+P T  TP+TPSTP+TPS     S P   S PS P
Sbjct: 217 TPSTPSTPSTP--STPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTP 269

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 46/105 (43%), Positives = 58/105 (55%), Gaps = 4/105 (3%)
 Frame = +1

Query: 115 SPPGSYDP-TPSPPSGDGSYN-PTPSTPPSSDCTPPSQDSP--PSDPTPTTPSTPTTPSG 282
           SP    DP TP+ P+     N PT    P+   TP   ++P  P+ PTP+TPSTP+TPS 
Sbjct: 155 SPEDPTDPNTPTDPNTPTDPNTPTDPNTPTDPNTPTDPNTPTDPNTPTPSTPSTPSTPS- 213

Query: 283 GYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
               +P   S+P T  TP+TPSTP+TPS     S P   S PS P
Sbjct: 214 ----TPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTP 254

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 36/77 (46%), Positives = 44/77 (57%), Gaps = 6/77 (7%)
 Frame = +1

Query: 205 CTP--PSQDSPPSDP-TPTTPSTPTTPSGGYYNSPPQDSSPPTDP-TPTTPSTPT--TPS 366
           C+P  P+  + P+DP TPT P+TPT P+       P D + PTDP TPT P+TPT  TPS
Sbjct: 154 CSPEDPTDPNTPTDPNTPTDPNTPTDPN------TPTDPNTPTDPNTPTDPNTPTPSTPS 207

Query: 367 GGYYNSPPQDSSPPSDP 417
                S P   S PS P
Sbjct: 208 TPSTPSTPSTPSTPSTP 224

[50][TOP]
>UniRef100_Q01AC1 Meltrins, fertilins and related Zn-dependent metalloproteinases of
           the ADAMs family (ISS) n=1 Tax=Ostreococcus tauri
           RepID=Q01AC1_OSTTA
          Length = 872

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 58/140 (41%), Positives = 63/140 (45%), Gaps = 5/140 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P+PP       P PS PP      P PSPPS     PP S  P PSPP       P P
Sbjct: 503 PSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSP----PPPSPSPPPSPP-------PPP 551

Query: 184 STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           S PP S   PPS   P P  P+P  PS P  P      SPP   SPP  P+P  PS P  
Sbjct: 552 SPPPGSAARPPSPPPPSPPPPSPPPPSPPPPP------SPP--PSPPPPPSPPPPSPPPP 603

Query: 361 PSGGYYNSPP----QDSSPP 408
           P     +SPP     D  PP
Sbjct: 604 PVVVVPSSPPPVLVNDMYPP 623

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 53/135 (39%), Positives = 63/135 (46%)
 Frame = +1

Query: 19  PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPS 198
           PS +    P  SSPP   S  P+P PPS    SPP S  P+P PPS        PS PP 
Sbjct: 488 PSSELPTAPPVSSPPPSPSPPPSP-PPSPPPPSPPPSPPPSPPPPS-------PPSPPPP 539

Query: 199 SDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYY 378
           S   PPS   PPS P P + + P +P       PP    PP+ P P+ P  P+ P     
Sbjct: 540 SPSPPPSPPPPPS-PPPGSAARPPSP-------PPPSPPPPSPPPPSPPPPPSPPP---- 587

Query: 379 NSPPQDSSPPSDPLP 423
           + PP  S PP  P P
Sbjct: 588 SPPPPPSPPPPSPPP 602

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/115 (40%), Positives = 50/115 (43%), Gaps = 1/115 (0%)
 Frame = +1

Query: 82  PTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS 261
           PT  P S    SPP S  P PSPP      +P PS PPS     P    PPS   P +P 
Sbjct: 493 PTAPPVS----SPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPP 548

Query: 262 TPTTPSGGYYNSPPQDSSP-PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P +P  G    PP    P P  P+P  PS P  PS      PP    PPS P P
Sbjct: 549 PPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPP 603

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 41/103 (39%), Positives = 47/103 (45%)
 Frame = +1

Query: 115 SPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYN 294
           S P S  PT  P S   S  P+PS PPS   +PP    PPS P    P +P +P      
Sbjct: 486 SVPSSELPTAPPVS---SPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSP------ 536

Query: 295 SPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            PP   SPP  P+P  P +P   S     SPP  S PP  P P
Sbjct: 537 -PPPSPSPP--PSPPPPPSPPPGSAARPPSPPPPSPPPPSPPP 576

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 43/122 (35%), Positives = 53/122 (43%), Gaps = 7/122 (5%)
 Frame = +1

Query: 79  DPTPSPPSDSGGSPP-----GSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDP 243
           D  P   ++S G+ P     G+     S PS +    P  S+PP S   PPS   PPS P
Sbjct: 459 DGFPCSNANSDGTFPKVCYNGACTLLSSVPSSELPTAPPVSSPPPSPSPPPSP--PPSPP 516

Query: 244 TPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSS--PPSDP 417
            P+ P            SPP    PP+ P+P  PS    PS     SPP  S+  PPS P
Sbjct: 517 PPSPPP-----------SPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPP 565

Query: 418 LP 423
            P
Sbjct: 566 PP 567

[51][TOP]
>UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f.
           nagariensis RepID=Q9SBM1_VOLCA
          Length = 409

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 53/141 (37%), Positives = 59/141 (41%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNPT 180
           P P PP      NP P  PP   S  P PSPP     SPP S  P+P P P      +P 
Sbjct: 126 PPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 185

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           P  PPS   +PP   SPP  P P  P +P  PS    +  P    PP    P  P +P  
Sbjct: 186 PRPPPSPPPSPPP--SPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPP 243

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P       PP    PPS P P
Sbjct: 244 PRPPPPAPPPPRPPPPSPPPP 264

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 56/143 (39%), Positives = 61/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP    S  P P  PP      P PSPP      PP   +P P PP    S +P P
Sbjct: 100 PPPPPPPPPPSPPPPPPPPP-----PPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPP 154

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQD--SSPPTDPTPTTPSTPT 357
           S PPS   +PP    PPS P    PS P +P      SPP     SPP  P P  P +P 
Sbjct: 155 SPPPSPPPSPP-PSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPN 213

Query: 358 TPSGGYYNSPPQDSSPPSDPLPR 426
            PS      PP  S P   P PR
Sbjct: 214 PPS----PRPPSPSPPSPRPPPR 232

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 59/161 (36%), Positives = 66/161 (40%), Gaps = 21/161 (13%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNPT 180
           P P PPS     +P PS PP      P PSPP     SPP S  P+P P P      +P 
Sbjct: 143 PPPPPPSPSPPPSPPPSPPPS-----PPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPP 197

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPT--------------------TPSGGYYNSP 300
           PS PPS    PP   +PPS P P +PS P+                     P       P
Sbjct: 198 PSPPPSPPPRPPPSPNPPS-PRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRP 256

Query: 301 PQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  S PP  P P +P  P  P      SPP  S PP  PLP
Sbjct: 257 PPPSPPPPLPPPPSPPPPLPPP----PSPPPPSPPPPSPLP 293

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 54/143 (37%), Positives = 59/143 (41%), Gaps = 2/143 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P+PS PP      P P PP      PP    P P PP    S  P P
Sbjct: 70  PPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPP 129

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P +PS P +P      SPP  S PP+ P    PS P +P
Sbjct: 130 PPPP----PPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPP-PSPPPSPPPSPPPSPPPSP 184

Query: 364 SGGYYNSPPQD--SSPPSDPLPR 426
                 SPP     SPP  P PR
Sbjct: 185 PPRPPPSPPPSPPPSPPPSPPPR 207

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/142 (37%), Positives = 61/142 (42%), Gaps = 1/142 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P+PP       P P  PP      P+P PP      PP S  P P PP       P P
Sbjct: 83  PSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPP-----PPP 137

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           + PP     PPS   PPS P    PS P +P      SPP  S PP+ P    PS P +P
Sbjct: 138 NPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPRPPPSPPPSP 196

Query: 364 SGGYYNSPPQDSSP-PSDPLPR 426
                 SPP    P P+ P PR
Sbjct: 197 PPSPPPSPPPRPPPSPNPPSPR 218

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 52/141 (36%), Positives = 57/141 (40%), Gaps = 3/141 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPP---GGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYN 174
           P   PP       P P  PP    G  + P P PP      PP    P+PSPP       
Sbjct: 38  PAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPP--LPPSPSPPPPPPPPV 95

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           P P  PP     PPS   PP  P P  PS P  P       PP +  PP  P P +PS P
Sbjct: 96  PPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPP--PPPPPNPPPPPPPPPPSPSPP 153

Query: 355 TTPSGGYYNSPPQDSSPPSDP 417
            +P      SPP  S PPS P
Sbjct: 154 PSPPPSPPPSPP-PSPPPSPP 173

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 52/141 (36%), Positives = 57/141 (40%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P   PP+  G  +P P  PP      P P PPS S   PP    P P PP       P+P
Sbjct: 53  PGVPPPTPSGPEHPPPPPPPPPPPPQP-PLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSP 111

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP  S PP+ P    PS P +P
Sbjct: 112 PPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPP---PPPSPSPPPSPPPSPPPSPPPSP 168

Query: 364 SGGYYNSPPQDSSPPSDPLPR 426
                 SPP   SPP  P PR
Sbjct: 169 PPSPPPSPP--PSPPPSPPPR 187

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 54/150 (36%), Positives = 64/150 (42%), Gaps = 9/150 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS------GD 162
           P   PPS   S  P+P  SPP      P PSPP     SPP    P+P+PPS        
Sbjct: 165 PPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSP 224

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
            S  P P  PP    +PP    PP  P P  P  P+ P       PP  S PP  P P +
Sbjct: 225 PSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPP----LPPPPSPPPPLPPPPS 280

Query: 343 PSTPTTPSGGYY--NSPPQDSSPPSDPLPR 426
           P  P+ P       +  P   SPP++P PR
Sbjct: 281 PPPPSPPPPSPLPPSPRPPKPSPPNNPFPR 310

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 53/143 (37%), Positives = 62/143 (43%), Gaps = 2/143 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNPT 180
           P P PP    S  P P  PP      P P PP     SPP S  P+P P P      +P 
Sbjct: 114 PPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPP 173

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP-STPT 357
           PS PPS   +PP +  PPS P    PS P +P      SP   S  P  P+P +P   P 
Sbjct: 174 PSPPPSPPPSPPPR-PPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPR 232

Query: 358 TPSGGYYNSPPQDSSPPSDPLPR 426
            P     + PP    PP+ P PR
Sbjct: 233 RPPFPPPSPPPPRPPPPAPPPPR 255

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 51/138 (36%), Positives = 55/138 (39%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P PS PP      P PSPP  S   PP    P+P PP      NP P
Sbjct: 254 PRPPPPSPPPPLPPPPSPPP---PLPPPPSPPPPSP-PPPSPLPPSPRPPKPSPPNNPFP 309

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP +   PP    PP  P P  P  P         SPP    PP  P P  P  P+  
Sbjct: 310 RPPPPN---PPPPRPPPPSPNPPRPPPP---------SPPPPRPPPPSPNPPRPPPPSP- 356

Query: 364 SGGYYNSPPQDSSPPSDP 417
                 SPP+   PPS P
Sbjct: 357 ------SPPKPPPPPSPP 368

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 51/144 (35%), Positives = 59/144 (40%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4   PTPTPPS-GDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P+P PPS    S  P P  PP      P P PP      PP    P P PPS      P 
Sbjct: 215 PSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPP------PPAPPPPRPPPPSPPPPLPPP 268

Query: 181 PSTPP--SSDCTPPSQDSPPSDPTPTTPSTP-TTPSGGYYNSPPQDSSPPTDPTPTTPST 351
           PS PP      +PP    PP  P P +P  P  +P    +  PP  + PP  P P +P+ 
Sbjct: 269 PSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNP 328

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLP 423
           P  P      SPP    PP  P P
Sbjct: 329 PRPPP----PSPPPPRPPPPSPNP 348

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 50/142 (35%), Positives = 57/142 (40%), Gaps = 4/142 (2%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP       P P +PP      P+P PP     SPP    P PSPP         PS 
Sbjct: 235 PFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPP--------PSP 286

Query: 190 PPSSDCTP---PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPSTPT 357
           PP S   P   P + SPP++P P  P     P       PP   +PP  P P+  P  P 
Sbjct: 287 PPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPP----RPPPPSPNPPRPPPPSPPPPRPP 342

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
            PS      PP   SPP  P P
Sbjct: 343 PPSPNPPRPPPPSPSPPKPPPP 364

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 51/145 (35%), Positives = 63/145 (43%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP      +P PS PP      P+P+PPS     PP    P+P PP     + P P
Sbjct: 192 PPPSPPP-----SPPPSPPPRP---PPSPNPPSPR---PPSPSPPSPRPPPRRPPF-PPP 239

Query: 184 STP---PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT--PS 348
           S P   P     PP +  PPS P P  P     P      SPP  S PP  P P +  P 
Sbjct: 240 SPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPP 299

Query: 349 TPTTPSGGYYNSPPQDSSPPSDPLP 423
            P+ P+  +   PP +  PP  P P
Sbjct: 300 KPSPPNNPFPRPPPPNPPPPRPPPP 324

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 54/149 (36%), Positives = 58/149 (38%), Gaps = 8/149 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP------PGSYDPTPSPPSGDG 165
           P   PPS   S  P+P   P      P+P PPS S  SP      P    P+P PP    
Sbjct: 189 PPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPP 248

Query: 166 SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
              P P  PP S   PP    PP  P P  P  P+ P      SPP  S  P  P P  P
Sbjct: 249 PAPPPPRPPPPS---PPPPLPPPPSPPPPLPPPPSPPPP----SPPPPSPLPPSPRPPKP 301

Query: 346 STPTTP--SGGYYNSPPQDSSPPSDPLPR 426
           S P  P       N PP    PPS   PR
Sbjct: 302 SPPNNPFPRPPPPNPPPPRPPPPSPNPPR 330

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 47/130 (36%), Positives = 53/130 (40%), Gaps = 4/130 (3%)
 Frame = +1

Query: 46  TPSSPPGG----GSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTP 213
           TP++PP G    G+  P   PP+ SG   P    P P PP       P P  PPS   +P
Sbjct: 37  TPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPP-------PQPPLPPSP--SP 87

Query: 214 PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQ 393
           P    PP  P P  P  P  P      SPP    PP  P P+ P  P  P     N PP 
Sbjct: 88  PPPPPPPVPPPPPPPPPPPPPP-----SPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPP 142

Query: 394 DSSPPSDPLP 423
              PP  P P
Sbjct: 143 PPPPPPSPSP 152

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 43/133 (32%), Positives = 52/133 (39%)
 Frame = +1

Query: 25  GDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSD 204
           G  +  P P   P     +   +PP   G  PPG+  P   PP+  G  +P P  PP   
Sbjct: 18  GAPARKPPPRRSPVVALVETPAAPPP--GSPPPGTPPPGVPPPTPSGPEHPPPPPPP--- 72

Query: 205 CTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNS 384
             PP    PP  P+P+ P  P  P       PP    PP  P P +P  P  P       
Sbjct: 73  --PPPPPQPPLPPSPSPPPPPPPPV------PPPPPPPPPPPPPPSPPPPPPPP------ 118

Query: 385 PPQDSSPPSDPLP 423
           PP   SPP  P P
Sbjct: 119 PPPPPSPPPPPPP 131

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 45/127 (35%), Positives = 50/127 (39%), Gaps = 7/127 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS-------PPGSYDPTPSPPSGD 162
           P P PPS      P P SPP      P+P PP  S  +       PP    P P PPS +
Sbjct: 274 PLPPPPS------PPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPN 327

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
               P PS PP     PP   +PP  P P +PS P          PP   SPP  P    
Sbjct: 328 PPRPPPPSPPPPRP--PPPSPNPPR-PPPPSPSPP---------KPPPPPSPPPRPPRRP 375

Query: 343 PSTPTTP 363
           P  P  P
Sbjct: 376 PRPPRRP 382

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 44/124 (35%), Positives = 48/124 (38%), Gaps = 2/124 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SP       P PSPP++    PP    P P PP      +P P
Sbjct: 279 PSPPPPS------PPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPP----SPNP 328

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP--TPTTPSTPT 357
             PP     PPS   P   P    P  P  PS      PP  S PP  P   P  P  P 
Sbjct: 329 PRPP-----PPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSPPPRPPRRPPRPPRRPP 383

Query: 358 TPSG 369
           T  G
Sbjct: 384 TAPG 387

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 35/92 (38%), Positives = 39/92 (42%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           +P P PP      NP P  PP      P+P+PP     SPP    P P PPS      P 
Sbjct: 306 NPFPRPPPP----NPPPPRPP-----PPSPNPPRPPPPSPP---PPRPPPPS------PN 347

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTP 276
           P  PP    +PP    PPS P P  P  P  P
Sbjct: 348 PPRPPPPSPSPPKPPPPPS-PPPRPPRRPPRP 378

[52][TOP]
>UniRef100_B9RZI2 Protein binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RZI2_RICCO
          Length = 829

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 59/164 (35%), Positives = 78/164 (47%), Gaps = 25/164 (15%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPS-------------PPSDSGGSPPGSYDPTPS 147
           TP+ P+    Y PTPS+PP   SY PTPS              PS    SPP    PTP 
Sbjct: 410 TPSVPTPSTPYVPTPSTPPST-SYGPTPSTPYVPTPSTPYVPTPSTPSPSPPQQEVPTPQ 468

Query: 148 PPS--------GDGSYNPTPSTPPSSDCTPPSQDSPPSDPT-PTTPSTPTTPSGGYYNSP 300
            PS        G    +PTPS  PS   +P +  SP  +P+ PT P+T  +PS    + P
Sbjct: 469 TPSSEPYNPSPGGHRESPTPSPEPSKPTSPTTSPSPSPEPSEPTPPATSPSPS----SEP 524

Query: 301 PQDSSPPTDPTPTT---PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            + +SP T P+P++    STP T S      P + +SP + P P
Sbjct: 525 SEPTSPTTSPSPSSEPLESTPPTTSPSLSPEPSEPTSPTTSPSP 568

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 56/148 (37%), Positives = 74/148 (50%), Gaps = 10/148 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPP-----GGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG- 165
           P+P+PP  +     TPSS P     GG    PTPSP      SP  S  P+P P      
Sbjct: 455 PSPSPPQQEVPTPQTPSSEPYNPSPGGHRESPTPSPEPSKPTSPTTSPSPSPEPSEPTPP 514

Query: 166 SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQD--SSPPTDPTPT 339
           + +P+PS+ PS   +P +  SP S+P  +TP T T+PS     S P    +SP   P P+
Sbjct: 515 ATSPSPSSEPSEPTSPTTSPSPSSEPLESTPPT-TSPSLSPEPSEPTSPTTSPSPSPEPS 573

Query: 340 TPSTPTTPSGGYYNS--PPQDSSPPSDP 417
            P++PTT     YNS  P    SP S+P
Sbjct: 574 EPTSPTTSPSPEYNSSEPSPTPSPESEP 601

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 66/170 (38%), Positives = 84/170 (49%), Gaps = 30/170 (17%)
 Frame = +1

Query: 4   PTP-TPPSGDGSYNPTPSSP---PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
           PTP TPPS   SY PTPS+P        Y PTPS PS S   PP    PTP  PS +  Y
Sbjct: 422 PTPSTPPST--SYGPTPSTPYVPTPSTPYVPTPSTPSPS---PPQQEVPTPQTPSSE-PY 475

Query: 172 NPTP-------------------STPPS-----SDCTPP-SQDSPPSDPT-PTTPSTPTT 273
           NP+P                   +T PS     S+ TPP +  SP S+P+ PT+P+T  +
Sbjct: 476 NPSPGGHRESPTPSPEPSKPTSPTTSPSPSPEPSEPTPPATSPSPSSEPSEPTSPTTSPS 535

Query: 274 PSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PS     S P  +SP   P P+ P++PTT S      P + +SP + P P
Sbjct: 536 PSSEPLESTPPTTSPSLSPEPSEPTSPTT-SPSPSPEPSEPTSPTTSPSP 584

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 61/147 (41%), Positives = 71/147 (48%), Gaps = 10/147 (6%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
           TP+ P       PTPS+P     Y PTPS P      P  SY PTPS P     Y PTPS
Sbjct: 402 TPSSPRPSTPSVPTPSTP-----YVPTPSTP------PSTSYGPTPSTP-----YVPTPS 445

Query: 187 TPPSSDCTPPSQDSPPSD-PTPTTPST-PTTPSGGYYNSPPQDSSPPTDPT-PTT----- 342
           TP     + PS   P  + PTP TPS+ P  PS G +   P  S  P+ PT PTT     
Sbjct: 446 TPYVPTPSTPSPSPPQQEVPTPQTPSSEPYNPSPGGHRESPTPSPEPSKPTSPTTSPSPS 505

Query: 343 --PSTPTTPSGGYYNSPPQDSSPPSDP 417
             PS PT P+     + P  SS PS+P
Sbjct: 506 PEPSEPTPPA-----TSPSPSSEPSEP 527

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 57/149 (38%), Positives = 76/149 (51%), Gaps = 13/149 (8%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSP-PGGGSYDPT--PSPPSDSGGSPPGSYDPTPS-PPSGDGSYNP 177
           PT P+   S +P PS P P   S  P+  PS P+    SP  S +P  S PP+   S +P
Sbjct: 495 PTSPTTSPSPSPEPSEPTPPATSPSPSSEPSEPTSPTTSPSPSSEPLESTPPTTSPSLSP 554

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPP--------QDSSPPTDPT 333
            PS P +S  T PS    PS+PT  T    T+PS  Y +S P        +  SP + P+
Sbjct: 555 EPSEP-TSPTTSPSPSPEPSEPTSPT----TSPSPEYNSSEPSPTPSPESEPQSPTSTPS 609

Query: 334 PTTP-STPTTPSGGYYNSPPQDSSPPSDP 417
           P +P S+PT+P+     SPP  S PP+ P
Sbjct: 610 PESPLSSPTSPTLEQSPSPPGQSPPPTTP 638

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 52/127 (40%), Positives = 60/127 (47%), Gaps = 7/127 (5%)
 Frame = +1

Query: 64  GGGSYDPT-PSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTP----PSSDCTPPSQDS 228
           GGGS  P+ P P + S  +P   Y PTPS P    SY PTPSTP    PS+   P     
Sbjct: 397 GGGSSTPSSPRPSTPSVPTPSTPYVPTPSTPPST-SYGPTPSTPYVPTPSTPYVPTPSTP 455

Query: 229 PPSDPTPTTPSTPTTPSGGYYNSPP--QDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSS 402
            PS P    P TP TPS   YN  P     SP   P P+ P++PTT         P  S 
Sbjct: 456 SPSPPQQEVP-TPQTPSSEPYNPSPGGHRESPTPSPEPSKPTSPTT--------SPSPSP 506

Query: 403 PPSDPLP 423
            PS+P P
Sbjct: 507 EPSEPTP 513

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 54/153 (35%), Positives = 67/153 (43%), Gaps = 16/153 (10%)
 Frame = +1

Query: 13   TPPSGDGSYNPTPS---SPPGGGSYDPTPSPPSDSGGSPPGSYD-----PTPSPPSGDGS 168
            TPP+   S +P PS   SP    S  P PS P+    SP   Y+     PTPSP S   S
Sbjct: 544  TPPTTSPSLSPEPSEPTSPTTSPSPSPEPSEPTSPTTSPSPEYNSSEPSPTPSPESEPQS 603

Query: 169  --YNPTPSTPPSSDCTPPSQDSPP---SDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT 333
                P+P +P SS  +P  + SP      P PTTP    +P G     P Q   PP +  
Sbjct: 604  PTSTPSPESPLSSPTSPTLEQSPSPPGQSPPPTTPEQSPSPPGQSPPPPTQSPPPPVNSP 663

Query: 334  PT---TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P    +P  P+ P   +   PP  S PP  P P
Sbjct: 664  PPPVYSPPPPSPPPPVHSPPPPVYSPPPPSPPP 696

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 54/160 (33%), Positives = 71/160 (44%), Gaps = 21/160 (13%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPS-----SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGS 168
            PTP+P S   S   TPS     S P   + + +PSPP  S   PP + + +PSPP G   
Sbjct: 593  PTPSPESEPQSPTSTPSPESPLSSPTSPTLEQSPSPPGQS--PPPTTPEQSPSPP-GQSP 649

Query: 169  YNPTPSTPPSSDCTPPSQDSPP---------SDPTPTTPSTPTTPSGGYYNSPPQDSSPP 321
              PT S PP  +  PP   SPP         S P P     P +P    ++ PP   SPP
Sbjct: 650  PPPTQSPPPPVNSPPPPVYSPPPPSPPPPVHSPPPPVYSPPPPSPPPPVHSPPPPVHSPP 709

Query: 322  ----TDPTPT---TPSTPTTPSGGYYNSPPQDSSPPSDPL 420
                + P P     P +P +P    ++ PP   SPP  P+
Sbjct: 710  PPVHSPPPPVYSPPPPSPPSPPPPMHSPPPPVYSPPPPPV 749

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 58/163 (35%), Positives = 70/163 (42%), Gaps = 21/163 (12%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPS---SPPGGGSYDPTPSPPSDSGGSPPGSYD-PTPSPPSGDGS 168
            + +P+PP G      TP    SPPG     PT SPP      PP  Y  P PSPP    S
Sbjct: 623  EQSPSPP-GQSPPPTTPEQSPSPPGQSPPPPTQSPPPPVNSPPPPVYSPPPPSPPPPVHS 681

Query: 169  -----YN-PTPSTPPSSDCTPPSQDSPP----SDPTPT---TPSTPTTPSGGYYNSPPQD 309
                 Y+ P PS PP     PP   SPP    S P P     P +P +P    ++ PP  
Sbjct: 682  PPPPVYSPPPPSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPSPPSPPPPMHSPPPPV 741

Query: 310  SSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPP----SDPLPR 426
             SPP  P  + P    +P    ++ PP   SPP    S P PR
Sbjct: 742  YSPPPPPVRSPPPPVHSPPPPVHSPPPPIYSPPPPRFSPPPPR 784

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 52/157 (33%), Positives = 66/157 (42%), Gaps = 17/157 (10%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP---SPPSGDGSYN 174
            P+P   S + S  P+P S P   +  P+P  P  S  SP     P+P   SPP      +
Sbjct: 582  PSPEYNSSEPSPTPSPESEPQSPTSTPSPESPLSSPTSPTLEQSPSPPGQSPPPTTPEQS 641

Query: 175  PTPSTPPSSDCTPPSQDSPP---SDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
            P+P   P     PP+Q  PP   S P P  +P  P+ P   +   PP  S PP  P P  
Sbjct: 642  PSP---PGQSPPPPTQSPPPPVNSPPPPVYSPPPPSPPPPVHSPPPPVYSPPPPSPPPPV 698

Query: 343  PSTPT----------TPSGGYYNSPPQDSSPPSDPLP 423
             S P           +P    Y+ PP   SPPS P P
Sbjct: 699  HSPPPPVHSPPPPVHSPPPPVYSPPP--PSPPSPPPP 733

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 48/146 (32%), Positives = 62/146 (42%), Gaps = 11/146 (7%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPSSPPGGGSYDPTPSPPSD--SGGSPPGSYDPTPSPPSGDGSYN 174
           P+P+P PS   S   +PS         PTPSP S+  S  S P    P  SP S     +
Sbjct: 566 PSPSPEPSEPTSPTTSPSPEYNSSEPSPTPSPESEPQSPTSTPSPESPLSSPTSPTLEQS 625

Query: 175 PT------PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP--TDP 330
           P+      P T P    +PP Q  PP  PT + P    +P    Y+ PP    PP  + P
Sbjct: 626 PSPPGQSPPPTTPEQSPSPPGQSPPP--PTQSPPPPVNSPPPPVYSPPPPSPPPPVHSPP 683

Query: 331 TPTTPSTPTTPSGGYYNSPPQDSSPP 408
            P     P +P    ++ PP   SPP
Sbjct: 684 PPVYSPPPPSPPPPVHSPPPPVHSPP 709

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 45/138 (32%), Positives = 56/138 (40%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P+PP    S  P   SPP      P  SPP      PP  + P P        Y+P P
Sbjct: 671  PPPSPPPPVHSPPPPVYSPPPPSPPPPVHSPPPPVHSPPPPVHSPPPP------VYSPPP 724

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             +PPS    PP    PP   +P  P   + P   +   PP  S PP  P  + P    +P
Sbjct: 725  PSPPSP--PPPMHSPPPPVYSPPPPPVRSPPPPVHSPPPPVHSPPP--PIYSPPPPRFSP 780

Query: 364  SGGYYNSPPQDSSPPSDP 417
                ++ PP  SSPP  P
Sbjct: 781  PPPRFSPPPPTSSPPPTP 798

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 49/143 (34%), Positives = 58/143 (40%), Gaps = 9/143 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSG---GSPPGSYDPTPSPPSGDGSYN 174
            P  +PP    S  P   SPP      P PSPPS        PP  Y P P          
Sbjct: 697  PVHSPPPPVHSPPPPVHSPPPPVYSPPPPSPPSPPPPMHSPPPPVYSPPPP--------- 747

Query: 175  PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            P  S PP     PP   SPP  P  + P    +P    ++ PP  SSPP  PTPT  + P
Sbjct: 748  PVRSPPPPVHSPPPPVHSPP-PPIYSPPPPRFSPPPPRFSPPPPTSSPP--PTPTVAAPP 804

Query: 355  -----TTPSGGY-YNSPPQDSSP 405
                   P+ G+ Y+SPP    P
Sbjct: 805  PEDFILPPNIGFQYSSPPPPMFP 827

[53][TOP]
>UniRef100_UPI000034F3D3 protein kinase family protein n=1 Tax=Arabidopsis thaliana
           RepID=UPI000034F3D3
          Length = 720

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 62/173 (35%), Positives = 75/173 (43%), Gaps = 32/173 (18%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPT---PSSPPGGGSYDPTPS--------PPSDSGGSPPGSYDPTPS 147
           D +P  P  D S  P    PS+PP      P PS        PP  S  SPP    P+P 
Sbjct: 36  DSSPPSPPADSSSTPPLSEPSTPPPDSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPP 95

Query: 148 PPSGDGSYNP-----TPSTPP---SSDCTPPSQD---SPPSDPT----PTTP------ST 264
           PP+ + S +P     TP  PP   + +  PPSQD    PPS P+    PT P      S 
Sbjct: 96  PPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPPPSSPSPNVGPTNPESPPLQSP 155

Query: 265 PTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  P+    NSPP     PT+P P  PS P T       SPP + + P  P P
Sbjct: 156 PAPPASDPTNSPPASPLDPTNPPPIQPSGPAT-------SPPANPNAPPSPFP 201

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 60/175 (34%), Positives = 77/175 (44%), Gaps = 35/175 (20%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT----PSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P+ +PP+      P P +P    +  P     PSPP+DS  +PP S   TP P   D   
Sbjct: 8   PSSSPPAPPADTAPPPETPSENSALPPVDSSPPSPPADSSSTPPLSEPSTPPP---DSQL 64

Query: 172 NPTPST-PPSSDCTPPSQDS-PPSDPTPTTP---------------STPTTPSGGYYNSP 300
            P PS  PP +D  PP  DS PP D TP+ P               + P  P+    N+P
Sbjct: 65  PPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNP 124

Query: 301 P--QD--SSPPTDPTP----TTP------STPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  QD  S PP+ P+P    T P      S P  P+    NSPP     P++P P
Sbjct: 125 PPSQDLQSPPPSSPSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPP 179

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 58/162 (35%), Positives = 73/162 (45%), Gaps = 21/162 (12%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPT--------PSPPSDSG-GSPPGSYD---PTP 144
           D  P P       + TPS PP   +  P+        P+PP++S   +PP S D   P P
Sbjct: 76  DSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPPP 135

Query: 145 SPPSGD-GSYNP------TPSTPPSSDCT--PPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
           S PS + G  NP      +P  PP+SD T  PP+    P++P P  PS P T       S
Sbjct: 136 SSPSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPAT-------S 188

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PP + + P  P PT P  P TPS G   SP   S     P P
Sbjct: 189 PPANPNAPPSPFPTVP--PKTPSSGPVVSPSLTSPSKGTPTP 228

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 48/123 (39%), Positives = 56/123 (45%), Gaps = 2/123 (1%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSP-PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGD-GSYNPTPST 189
           PP      +P PSSP P  G  +P  SPP  S  +PP S DPT SPP+      NP P  
Sbjct: 124 PPPSQDLQSPPPSSPSPNVGPTNPE-SPPLQSPPAPPAS-DPTNSPPASPLDPTNPPPIQ 181

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           P     +PP+  + P  P PT P  P TPS G   SP   S     PTP   +      G
Sbjct: 182 PSGPATSPPANPNAPPSPFPTVP--PKTPSSGPVVSPSLTSPSKGTPTPNQGNGDGGGGG 239

Query: 370 GYY 378
           G Y
Sbjct: 240 GGY 242

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 46/135 (34%), Positives = 59/135 (43%), Gaps = 7/135 (5%)
 Frame = +1

Query: 40  NPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT--PSTPPSSDCTP 213
           +P+ S P       P P  PS++   PP    P PSPP+   S  P   PSTPP     P
Sbjct: 7   SPSSSPPAPPADTAPPPETPSENSALPPVDSSP-PSPPADSSSTPPLSEPSTPPPDSQLP 65

Query: 214 PSQDS-PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPP 390
           P     PP   +P  PS  + P     + PP  S+    P   + + P  P+    N+PP
Sbjct: 66  PLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNPP 125

Query: 391 --QD--SSPPSDPLP 423
             QD  S PPS P P
Sbjct: 126 PSQDLQSPPPSSPSP 140

[54][TOP]
>UniRef100_Q9ZUE0 F5O8.10 protein n=1 Tax=Arabidopsis thaliana RepID=Q9ZUE0_ARATH
          Length = 731

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 62/173 (35%), Positives = 75/173 (43%), Gaps = 32/173 (18%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPT---PSSPPGGGSYDPTPS--------PPSDSGGSPPGSYDPTPS 147
           D +P  P  D S  P    PS+PP      P PS        PP  S  SPP    P+P 
Sbjct: 36  DSSPPSPPADSSSTPPLSEPSTPPPDSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPP 95

Query: 148 PPSGDGSYNP-----TPSTPP---SSDCTPPSQD---SPPSDPT----PTTP------ST 264
           PP+ + S +P     TP  PP   + +  PPSQD    PPS P+    PT P      S 
Sbjct: 96  PPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPPPSSPSPNVGPTNPESPPLQSP 155

Query: 265 PTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  P+    NSPP     PT+P P  PS P T       SPP + + P  P P
Sbjct: 156 PAPPASDPTNSPPASPLDPTNPPPIQPSGPAT-------SPPANPNAPPSPFP 201

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 60/175 (34%), Positives = 77/175 (44%), Gaps = 35/175 (20%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT----PSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P+ +PP+      P P +P    +  P     PSPP+DS  +PP S   TP P   D   
Sbjct: 8   PSSSPPAPPADTAPPPETPSENSALPPVDSSPPSPPADSSSTPPLSEPSTPPP---DSQL 64

Query: 172 NPTPST-PPSSDCTPPSQDS-PPSDPTPTTP---------------STPTTPSGGYYNSP 300
            P PS  PP +D  PP  DS PP D TP+ P               + P  P+    N+P
Sbjct: 65  PPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNP 124

Query: 301 P--QD--SSPPTDPTP----TTP------STPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  QD  S PP+ P+P    T P      S P  P+    NSPP     P++P P
Sbjct: 125 PPSQDLQSPPPSSPSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPP 179

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 58/162 (35%), Positives = 73/162 (45%), Gaps = 21/162 (12%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPT--------PSPPSDSG-GSPPGSYD---PTP 144
           D  P P       + TPS PP   +  P+        P+PP++S   +PP S D   P P
Sbjct: 76  DSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPPP 135

Query: 145 SPPSGD-GSYNP------TPSTPPSSDCT--PPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
           S PS + G  NP      +P  PP+SD T  PP+    P++P P  PS P T       S
Sbjct: 136 SSPSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPAT-------S 188

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PP + + P  P PT P  P TPS G   SP   S     P P
Sbjct: 189 PPANPNAPPSPFPTVP--PKTPSSGPVVSPSLTSPSKGTPTP 228

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 48/123 (39%), Positives = 56/123 (45%), Gaps = 2/123 (1%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSP-PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGD-GSYNPTPST 189
           PP      +P PSSP P  G  +P  SPP  S  +PP S DPT SPP+      NP P  
Sbjct: 124 PPPSQDLQSPPPSSPSPNVGPTNPE-SPPLQSPPAPPAS-DPTNSPPASPLDPTNPPPIQ 181

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           P     +PP+  + P  P PT P  P TPS G   SP   S     PTP   +      G
Sbjct: 182 PSGPATSPPANPNAPPSPFPTVP--PKTPSSGPVVSPSLTSPSKGTPTPNQGNGDGGGGG 239

Query: 370 GYY 378
           G Y
Sbjct: 240 GGY 242

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 46/135 (34%), Positives = 59/135 (43%), Gaps = 7/135 (5%)
 Frame = +1

Query: 40  NPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT--PSTPPSSDCTP 213
           +P+ S P       P P  PS++   PP    P PSPP+   S  P   PSTPP     P
Sbjct: 7   SPSSSPPAPPADTAPPPETPSENSALPPVDSSP-PSPPADSSSTPPLSEPSTPPPDSQLP 65

Query: 214 PSQDS-PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPP 390
           P     PP   +P  PS  + P     + PP  S+    P   + + P  P+    N+PP
Sbjct: 66  PLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNPP 125

Query: 391 --QD--SSPPSDPLP 423
             QD  S PPS P P
Sbjct: 126 PSQDLQSPPPSSPSP 140

[55][TOP]
>UniRef100_Q9LT74 Similarity to late embryogenesis abundant protein n=2
           Tax=Arabidopsis thaliana RepID=Q9LT74_ARATH
          Length = 631

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 54/145 (37%), Positives = 69/145 (47%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+PTPP       PTPS P        +P+PP       P    P+P+PP       PTP
Sbjct: 163 PSPTPPVSPPPPTPTPSVP--------SPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 214

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDPTPTTPS---- 348
           S P     TPP    PP+ PTP+ PS TP  P+    + PP  S PP  PTP+ PS    
Sbjct: 215 SVPSP---TPPVSPPPPT-PTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDV 270

Query: 349 TPTTPSGGYYNSPPQDSSPPSDPLP 423
           TPT P+    + P    +PP+  +P
Sbjct: 271 TPTPPTPSVPSPPDVTPTPPTPSVP 295

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 61/143 (42%), Positives = 70/143 (48%), Gaps = 6/143 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP-PGGGSYDPTPSP-PSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           P+PTPP       PTPS P P      P P+P PS    +PP   DP PSPP      +P
Sbjct: 199 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPP---PVSP 255

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPS----TPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
            P TP  S  +PP  D  P+ PTP+ PS    TPT P      +P   S P   PTP TP
Sbjct: 256 PPPTPTPSVPSPP--DVTPTPPTPSVPSPPDVTPTPP------TPSVPSPPDVTPTPPTP 307

Query: 346 STPTTPSGGYYNSPPQDSSPPSD 414
            +  TPSG    SPP    PPSD
Sbjct: 308 PSVPTPSG----SPPY-VPPPSD 325

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 53/144 (36%), Positives = 64/144 (44%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P   PPS         S    GG   P P PP      PP    P+P+PP       PTP
Sbjct: 121 PICGPPSPGDDGGGDDSGGDDGGYTPPAPVPPVSP--PPPTPSVPSPTPPVSPPPPTPTP 178

Query: 184 STP-PSSDCTPPSQDSPPSDPTPTTPSTPT--TPSGGYYNSPPQDSSPPTDPTPTTPS-T 351
           S P P+   +PP     PS P+PT P +P   TP+    +  P  S PP  PTP+ PS T
Sbjct: 179 SVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPT 238

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLP 423
           P  P+    + PP  S PP  P P
Sbjct: 239 PPVPTDPMPSPPPPVSPPPPTPTP 262

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 57/154 (37%), Positives = 64/154 (41%), Gaps = 14/154 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP-----PGSYDPTPSPPSGDGS 168
           P+PTPP       PTPS P       P P  P+ S  SP     P    PTPS PS    
Sbjct: 181 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPS---- 236

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPT---------TPSTPTTPSGGYYNSPPQDSSPP 321
             PTP  P     +PP   SPP  PTPT         TP+ PT         P   S P 
Sbjct: 237 --PTPPVPTDPMPSPPPPVSPPP-PTPTPSVPSPPDVTPTPPT---------PSVPSPPD 284

Query: 322 TDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             PTP TPS P+ P     +  P   +PPS P P
Sbjct: 285 VTPTPPTPSVPSPP-----DVTPTPPTPPSVPTP 313

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 52/139 (37%), Positives = 56/139 (40%), Gaps = 8/139 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPS--SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           P+PTPP       PTPS  SP      DP PSPP      PP      PSPP    +  P
Sbjct: 217 PSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPT-PP 275

Query: 178 TPSTPPSSDCTP----PSQDSPPS-DPTPTTP-STPTTPSGGYYNSPPQDSSPPTDPTPT 339
           TPS P   D TP    PS  SPP   PTP TP S PT      Y  PP D          
Sbjct: 276 TPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVPPPSDEEEAAGAKRV 335

Query: 340 TPSTPTTPSGGYYNSPPQD 396
                 +P  G   + P D
Sbjct: 336 RCKKQRSPCYGVEYTCPAD 354

[56][TOP]
>UniRef100_Q9LQC5 F28C11.17 n=1 Tax=Arabidopsis thaliana RepID=Q9LQC5_ARATH
          Length = 752

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 62/173 (35%), Positives = 75/173 (43%), Gaps = 32/173 (18%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPT---PSSPPGGGSYDPTPS--------PPSDSGGSPPGSYDPTPS 147
           D +P  P  D S  P    PS+PP      P PS        PP  S  SPP    P+P 
Sbjct: 36  DSSPPSPPADSSSTPPLSEPSTPPPDSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPP 95

Query: 148 PPSGDGSYNP-----TPSTPP---SSDCTPPSQD---SPPSDPT----PTTP------ST 264
           PP+ + S +P     TP  PP   + +  PPSQD    PPS P+    PT P      S 
Sbjct: 96  PPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPPPSSPSPNVGPTNPESPPLQSP 155

Query: 265 PTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  P+    NSPP     PT+P P  PS P T       SPP + + P  P P
Sbjct: 156 PAPPASDPTNSPPASPLDPTNPPPIQPSGPAT-------SPPANPNAPPSPFP 201

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 60/175 (34%), Positives = 77/175 (44%), Gaps = 35/175 (20%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT----PSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P+ +PP+      P P +P    +  P     PSPP+DS  +PP S   TP P   D   
Sbjct: 8   PSSSPPAPPADTAPPPETPSENSALPPVDSSPPSPPADSSSTPPLSEPSTPPP---DSQL 64

Query: 172 NPTPST-PPSSDCTPPSQDS-PPSDPTPTTP---------------STPTTPSGGYYNSP 300
            P PS  PP +D  PP  DS PP D TP+ P               + P  P+    N+P
Sbjct: 65  PPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNP 124

Query: 301 P--QD--SSPPTDPTP----TTP------STPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  QD  S PP+ P+P    T P      S P  P+    NSPP     P++P P
Sbjct: 125 PPSQDLQSPPPSSPSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPP 179

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 58/162 (35%), Positives = 73/162 (45%), Gaps = 21/162 (12%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPT--------PSPPSDSG-GSPPGSYD---PTP 144
           D  P P       + TPS PP   +  P+        P+PP++S   +PP S D   P P
Sbjct: 76  DSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPPP 135

Query: 145 SPPSGD-GSYNP------TPSTPPSSDCT--PPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
           S PS + G  NP      +P  PP+SD T  PP+    P++P P  PS P T       S
Sbjct: 136 SSPSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPAT-------S 188

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PP + + P  P PT P  P TPS G   SP   S     P P
Sbjct: 189 PPANPNAPPSPFPTVP--PKTPSSGPVVSPSLTSPSKGTPTP 228

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 48/123 (39%), Positives = 56/123 (45%), Gaps = 2/123 (1%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSP-PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGD-GSYNPTPST 189
           PP      +P PSSP P  G  +P  SPP  S  +PP S DPT SPP+      NP P  
Sbjct: 124 PPPSQDLQSPPPSSPSPNVGPTNPE-SPPLQSPPAPPAS-DPTNSPPASPLDPTNPPPIQ 181

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           P     +PP+  + P  P PT P  P TPS G   SP   S     PTP   +      G
Sbjct: 182 PSGPATSPPANPNAPPSPFPTVP--PKTPSSGPVVSPSLTSPSKGTPTPNQGNGDGGGGG 239

Query: 370 GYY 378
           G Y
Sbjct: 240 GGY 242

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 46/135 (34%), Positives = 59/135 (43%), Gaps = 7/135 (5%)
 Frame = +1

Query: 40  NPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT--PSTPPSSDCTP 213
           +P+ S P       P P  PS++   PP    P PSPP+   S  P   PSTPP     P
Sbjct: 7   SPSSSPPAPPADTAPPPETPSENSALPPVDSSP-PSPPADSSSTPPLSEPSTPPPDSQLP 65

Query: 214 PSQDS-PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPP 390
           P     PP   +P  PS  + P     + PP  S+    P   + + P  P+    N+PP
Sbjct: 66  PLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNPP 125

Query: 391 --QD--SSPPSDPLP 423
             QD  S PPS P P
Sbjct: 126 PSQDLQSPPPSSPSP 140

[57][TOP]
>UniRef100_Q0E1A9 Os02g0467200 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group
           RepID=Q0E1A9_ORYSJ
          Length = 144

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 52/120 (43%), Positives = 63/120 (52%), Gaps = 1/120 (0%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           PTPP       PTP  PP      PTP  P  +  +PP +   TP P +      PT  T
Sbjct: 15  PTPP-------PTPPIPPS----TPTPPTPPSTPPTPPSTPTTTPPPTT-----TPTVLT 58

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP-TPTTPSTPTTPS 366
           PPS+  TPPS  +PP+ PTP  P+TPTTP      S P   +PPT P TPT P+ P TP+
Sbjct: 59  PPSTPQTPPSTPTPPTPPTP--PTTPTTPIPQIPPSTPTPPTPPTTPMTPTPPTAPPTPT 116

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 41/95 (43%), Positives = 49/95 (51%), Gaps = 1/95 (1%)
 Frame = +1

Query: 136 PTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSS 315
           PTP P        PTP TPPS+  TPPS  +P + P PTT  T  TP       P    +
Sbjct: 15  PTPPPTPPIPPSTPTPPTPPSTPPTPPS--TPTTTPPPTTTPTVLTP-------PSTPQT 65

Query: 316 PPTDPTPTTPST-PTTPSGGYYNSPPQDSSPPSDP 417
           PP+ PTP TP T PTTP+      PP   +PP+ P
Sbjct: 66  PPSTPTPPTPPTPPTTPTTPIPQIPPSTPTPPTPP 100

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 44/113 (38%), Positives = 58/113 (51%)
 Frame = +1

Query: 82  PTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS 261
           P P+PP      PP     TP+PP+        PSTPP+   TP +  +PP   TPT  +
Sbjct: 17  PPPTPPI-----PPS----TPTPPT-------PPSTPPTPPSTPTT--TPPPTTTPTVLT 58

Query: 262 TPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
            P+TP      +PP   +PPT PTP  P+TPTTP      S P   +PP+ P+
Sbjct: 59  PPSTP-----QTPPSTPTPPTPPTP--PTTPTTPIPQIPPSTPTPPTPPTTPM 104

[58][TOP]
>UniRef100_Q0GYD2 Putative uncharacterized protein n=1 Tax=Plutella xylostella
           multiple nucleopolyhedrovirus RepID=Q0GYD2_9ABAC
          Length = 250

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 55/140 (39%), Positives = 69/140 (49%), Gaps = 1/140 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+PTPP       PTPS PP      PTP+PP       P    PTPSP     +  PTP
Sbjct: 42  PSPTPPPSPLPPTPTPSPPPSPIPPTPTPTPPPS-----PSPIFPTPSPSPIPPT--PTP 94

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT-DPTPTTPSTPTT 360
           + PPS    PP+    P  PTPT P +P  P+     +PP    PPT  PTPT P++P  
Sbjct: 95  TPPPSP--IPPTPTPSPIPPTPTPPPSPIPPTP--TPTPPPSPIPPTPTPTPTPPASPIP 150

Query: 361 PSGGYYNSPPQDSSPPSDPL 420
           P+     SPP   +P  +P+
Sbjct: 151 PTP--TPSPPPSPNPLGEPM 168

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 53/143 (37%), Positives = 66/143 (46%), Gaps = 2/143 (1%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           DP   PP       P+P+ PP      PTPSPP            P+P PP+      PT
Sbjct: 33  DPPIVPP-----LPPSPTPPPSPLPPTPTPSPP------------PSPIPPT------PT 69

Query: 181 PSTPPS-SDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           P+ PPS S   P    SP P  PTPT P +P  P+      PP  + PP+ P P TP TP
Sbjct: 70  PTPPPSPSPIFPTPSPSPIPPTPTPTPPPSPIPPTPTPSPIPPTPTPPPS-PIPPTP-TP 127

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
           T P      +P    +PP+ P+P
Sbjct: 128 TPPPSPIPPTPTPTPTPPASPIP 150

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 47/118 (39%), Positives = 56/118 (47%), Gaps = 10/118 (8%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP-PGSYDPTPSPPSGDGSYNPT 180
           PTPTPP       PTPS  P   +  PTP PPS    +P P    PTP+PP       PT
Sbjct: 68  PTPTPPPSPSPIFPTPSPSPIPPTPTPTP-PPSPIPPTPTPSPIPPTPTPPPSPIPPTPT 126

Query: 181 PSTPPSS-------DCTPPSQDSPPSDPTPTTPSTPTTPSGG--YYNSPPQDSSPPTD 327
           P+ PPS          TPP+   PP+ PTP+ P +P  P G   YY S    +   TD
Sbjct: 127 PTPPPSPIPPTPTPTPTPPASPIPPT-PTPSPPPSP-NPLGEPMYYPSNIDTNEALTD 182

[59][TOP]
>UniRef100_Q8VKN7 Putative uncharacterized protein n=1 Tax=Mycobacterium tuberculosis
           RepID=Q8VKN7_MYCTU
          Length = 598

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 54/153 (35%), Positives = 67/153 (43%), Gaps = 12/153 (7%)
 Frame = +1

Query: 1   DPTPTPPSGDG-----SYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG 165
           DP P PP+        ++ P P +PP      PTP  P +    PP    P P+PP   G
Sbjct: 302 DPPPAPPAPPAPLSRPAFPPAPPAPPASKPSPPTPPAPPEPNNVPPSPPIP-PAPPPPSG 360

Query: 166 SYNPTPSTPPSSD--CTPPSQDSPPSDPT-----PTTPSTPTTPSGGYYNSPPQDSSPPT 324
              P P  PP++     P S  +PP  PT     P  P  P  P     NSPP+  SPP 
Sbjct: 361 LDPPLPPAPPAAPRLSMPASPPAPPFPPTLIMLVPPLPPVPPAP-----NSPPEPPSPPA 415

Query: 325 DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P P  P+ P  P     NSPP    PP+ P+P
Sbjct: 416 PP-PKMPNPPGPPVPPAPNSPPFPPDPPAPPVP 447

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/141 (34%), Positives = 65/141 (46%), Gaps = 2/141 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT--PSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           P P  P+      P P +PP     DP   P+PP+    S P S    P PP+      P
Sbjct: 337 PAPPEPNNVPPSPPIPPAPPPPSGLDPPLPPAPPAAPRLSMPASPPAPPFPPTLIMLVPP 396

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            P  PP+ + +PP   SPP+ P P  P+ P  P     NSPP    PP  P P + + P 
Sbjct: 397 LPPVPPAPN-SPPEPPSPPAPP-PKMPNPPGPPVPPAPNSPPFPPDPPAPPVPASVAPPA 454

Query: 358 TPSGGYYNSPPQDSSPPSDPL 420
            P+    NSPP   +PP+ P+
Sbjct: 455 PPTPPSANSPPFPPAPPAPPV 475

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 48/146 (32%), Positives = 62/146 (42%), Gaps = 8/146 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P  P+  G+  P P  PP     DP P+PP+        ++ P P  P       PTP
Sbjct: 279 PLPALPTSPGA-PPAPPVPPAPAK-DPPPAPPAPPAPLSRPAFPPAPPAPPASKPSPPTP 336

Query: 184 STPPSSDCTPPSQDSPPSDPTPT---TPSTPTTPSGGYYNSPPQDSSPPTDPT-----PT 339
             PP  +  PPS   PP+ P P+    P  P  P+    + P    +PP  PT     P 
Sbjct: 337 PAPPEPNNVPPSPPIPPAPPPPSGLDPPLPPAPPAAPRLSMPASPPAPPFPPTLIMLVPP 396

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDP 417
            P  P  P     NSPP+  SPP+ P
Sbjct: 397 LPPVPPAP-----NSPPEPPSPPAPP 417

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 47/141 (33%), Positives = 60/141 (42%), Gaps = 3/141 (2%)
 Frame = +1

Query: 10  PTPPSGDGS-YNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT-P 183
           P PP+ +   + P P +PP   S  P   P   S  SPP    P   P +   + NP  P
Sbjct: 427 PVPPAPNSPPFPPDPPAPPVPASVAPPAPPTPPSANSPPFPPAPPAPPVAPKAAANPPGP 486

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP-TPTTPSTPTT 360
            TP + +  P +  +PP+ P P     P  P+     SPP    PP  P TP  P  P  
Sbjct: 487 PTPAAPNSMPAAPPAPPAPPVPVLALPPAPPAPPLPMSPPAPPLPPAPPLTPAAPDPPAP 546

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P     N PP   SPP  P+P
Sbjct: 547 PLP--INQPP---SPPLAPVP 562

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 50/147 (34%), Positives = 64/147 (43%), Gaps = 9/147 (6%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPS--DSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P PP+ +    P P SPP      P P  P    +  SPP   DP P+PP       P P
Sbjct: 399 PVPPAPNSP--PEPPSPPAPPPKMPNPPGPPVPPAPNSPPFPPDP-PAPPVPASVAPPAP 455

Query: 184 STPPSSDCTPPSQDSPPSDPT-------PTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
            TPPS++ +PP   +PP+ P        P  P TP  P+    + P    +PP  P P  
Sbjct: 456 PTPPSAN-SPPFPPAPPAPPVAPKAAANPPGPPTPAAPN----SMPAAPPAPPAPPVPVL 510

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              P  P+      PP   SPP+ PLP
Sbjct: 511 ALPPAPPA------PPLPMSPPAPPLP 531

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 45/142 (31%), Positives = 58/142 (40%), Gaps = 4/142 (2%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP+      P P  PP   S    PSPP+     PP      P PP       P P++
Sbjct: 385 PFPPTLIMLVPPLPPVPPAPNSPPEPPSPPA-----PPPKMPNPPGPP-----VPPAPNS 434

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP----TPTTPSTPT 357
           PP     PP   +PP   +   P+ PT PS      PP   +PP  P     P  P TP 
Sbjct: 435 PPF----PPDPPAPPVPASVAPPAPPTPPSANSPPFPPAPPAPPVAPKAAANPPGPPTPA 490

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
            P+    + P    +PP+ P+P
Sbjct: 491 APN----SMPAAPPAPPAPPVP 508

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 47/139 (33%), Positives = 60/139 (43%), Gaps = 16/139 (11%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD-----SGGSPPGSYDPTPSPPSGDG 165
           DP P PP       P P +PP   S    P+PP+      +  +PPG   PTP+ P+   
Sbjct: 440 DP-PAPPVPASVAPPAPPTPPSANSPPFPPAPPAPPVAPKAAANPPGP--PTPAAPNSMP 496

Query: 166 SYNPTPSTPP-------SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPP----QDS 312
           +  P P  PP        +   PP   SPP+ P P  P+ P TP+     +PP    Q  
Sbjct: 497 AAPPAPPAPPVPVLALPPAPPAPPLPMSPPAPPLP--PAPPLTPAAPDPPAPPLPINQPP 554

Query: 313 SPPTDPTPTTPSTPTTPSG 369
           SPP  P P  P  P   SG
Sbjct: 555 SPPLAPVPGAPLVPLPISG 573

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 47/141 (33%), Positives = 61/141 (43%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P  P+G     P P  PP       TP PP+     PP    P P+ P+  G+  P P
Sbjct: 246 PAPAVPAGA----PVPPLPPLPPLPISTPLPPA-----PP--LPPLPALPTSPGA-PPAP 293

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTP-STPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
             PP+     P++D PP+ P P  P S P  P       P   + P + P+P TP  P  
Sbjct: 294 PVPPA-----PAKDPPPAPPAPPAPLSRPAFP-------PAPPAPPASKPSPPTPPAPPE 341

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P+    N PP    PP+ P P
Sbjct: 342 PN----NVPPSPPIPPAPPPP 358

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 44/155 (28%), Positives = 58/155 (37%), Gaps = 17/155 (10%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP------GSYDPTPSPPSGDGSY 171
           P PP     + P P +PP     +  P PP+ +    P       ++ P P+ P    + 
Sbjct: 46  PVPP-----FAPNPPAPPAPPLANSPPVPPAPAVPPAPIKFWERAAWPPVPAAPRNKPAS 100

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQ-------DSSPPTDP 330
            P P  PP S   PP    PP   +   P  P  P       PP        D  PP  P
Sbjct: 101 PPRPPAPPVSRPNPPLPPVPPEPISKAAPPVPPVPPWPVVPMPPDPPVPPIPDRIPPAPP 160

Query: 331 TPTTPSTPTTPSGGYYNSPP----QDSSPPSDPLP 423
            P  PS P+ P   +   PP       +PPS P+P
Sbjct: 161 DP--PSPPSAPVAPWPPLPPLPNNHPPAPPSAPVP 193

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 45/145 (31%), Positives = 58/145 (40%), Gaps = 8/145 (5%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGD------GSY 171
           P PP+     NP P  PP   +    P+PP     SPP    P P+ P          ++
Sbjct: 34  PVPPAPKS--NPFPPVPPFAPNPPAPPAPPL--ANSPP--VPPAPAVPPAPIKFWERAAW 87

Query: 172 NPTPSTPPSSDCTPPSQDSPP-SDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
            P P+ P +   +PP   +PP S P P  P  P  P      +PP    PP    P  P 
Sbjct: 88  PPVPAAPRNKPASPPRPPAPPVSRPNPPLPPVPPEPISKA--APPVPPVPPWPVVPMPPD 145

Query: 349 TPTTP-SGGYYNSPPQDSSPPSDPL 420
            P  P       +PP   SPPS P+
Sbjct: 146 PPVPPIPDRIPPAPPDPPSPPSAPV 170

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 42/125 (33%), Positives = 50/125 (40%), Gaps = 3/125 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD--SGGSPPGSYDPTPSPPSGDGSYNP 177
           P P  P    +  P P +PP      P P  P +  S  +PP      P PP       P
Sbjct: 89  PVPAAPRNKPASPPRPPAPPVSRPNPPLPPVPPEPISKAAPP----VPPVPPWPVVPMPP 144

Query: 178 TPSTPPSSDCTPPSQDSPPSDPT-PTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            P  PP  D  PP+   PPS P+ P  P  P  P     N PP   +PP+ P P  P  P
Sbjct: 145 DPPVPPIPDRIPPAPPDPPSPPSAPVAPWPPLPPLPN--NHPP---APPSAPVPGVPLAP 199

Query: 355 TTPSG 369
              SG
Sbjct: 200 LPISG 204

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 44/139 (31%), Positives = 59/139 (42%), Gaps = 8/139 (5%)
 Frame = +1

Query: 31  GSYNPT-PSSPPGGGSYDPTPSPPSDSGGSPPGSYDP-------TPSPPSGDGSYNPTPS 186
           G+ NP+ PSS P      P P  P+   G+P     P       TP PP+      P   
Sbjct: 231 GALNPSRPSSCP------PKPPAPAVPAGAPVPPLPPLPPLPISTPLPPAPPLPPLPALP 284

Query: 187 TPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPS 366
           T P +   PP   +P  DP P  P+ P   S   +  PP   +PP     + PS PT P+
Sbjct: 285 TSPGAPPAPPVPPAPAKDPPPAPPAPPAPLSRPAF--PPAPPAPPA----SKPSPPTPPA 338

Query: 367 GGYYNSPPQDSSPPSDPLP 423
                 P  ++ PPS P+P
Sbjct: 339 -----PPEPNNVPPSPPIP 352

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 43/139 (30%), Positives = 56/139 (40%), Gaps = 12/139 (8%)
 Frame = +1

Query: 43  PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQ 222
           P P  PP   S    P+PPS    +P     P P  P      NP P  PP +   PP+ 
Sbjct: 7   PAPPVPPAPNSPPCPPAPPS----APSVPAPPVPPAPKS----NPFPPVPPFAP-NPPAP 57

Query: 223 DSPP---SDPTPTTPSTPTTPSGGYYNS--PP-------QDSSPPTDPTPTTPSTPTTPS 366
            +PP   S P P  P+ P  P   +  +  PP       + +SPP  P P   S P  P 
Sbjct: 58  PAPPLANSPPVPPAPAVPPAPIKFWERAAWPPVPAAPRNKPASPPRPPAPPV-SRPNPPL 116

Query: 367 GGYYNSPPQDSSPPSDPLP 423
                 P   ++PP  P+P
Sbjct: 117 PPVPPEPISKAAPPVPPVP 135

[60][TOP]
>UniRef100_Q6SSE8 Minus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE8_CHLRE
          Length = 3889

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/143 (36%), Positives = 66/143 (46%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P P PP+      P+P  PP      P+P PPS    SP  P +  P+P PPS     +P
Sbjct: 758  PPPLPPNPPSPAPPSPPPPPSPSIPPPSPGPPSPEPPSPAPPSAAPPSPMPPS-PAPPSP 816

Query: 178  TPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
             P +P      PPS   P P  P+P  PS P  P+     SP   S PP  P P +P+ P
Sbjct: 817  DPPSPKPPSPVPPSPLPPSPEPPSPVPPSPP--PASPEPTSPAPPSPPPPSPEPPSPAPP 874

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
            + P     +  P   +PPS PLP
Sbjct: 875  SPPPP---SPEPPSPAPPSPPLP 894

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 58/161 (36%), Positives = 71/161 (44%), Gaps = 21/161 (13%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG--SPPGSYDPTPSPPS------- 156
            PTP  P      +PTP SP       P+PSPPS +    SPP    P+P PPS       
Sbjct: 1282 PTPHAPPSPEPPSPTPPSPLPPSPEPPSPSPPSPAPSVPSPPSPAPPSPMPPSPAPLAPQ 1341

Query: 157  --GDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS-------TPTTPSGGYYNSPPQD 309
                   +P P  PPS +   P    PP  P+PT PS       +PT PS    +  P  
Sbjct: 1342 PPSPTPPSPAPPVPPSPEPPVPPGPDPPLPPSPTPPSPQPPVPPSPTPPSPQPPSPAPPS 1401

Query: 310  SSP--PTDPTPTTPS-TPTTPSGGYYNSPPQDSSPPSDPLP 423
             +P  P  P+P  PS  P +P+ G   SPP   S PS P P
Sbjct: 1402 PAPSAPLQPSPDPPSPQPPSPAPGPPPSPPSPPSTPSPPSP 1442

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 52/146 (35%), Positives = 68/146 (46%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP       +P+PPS    S  PP    P+P PPS +   +P
Sbjct: 829  PSPLPPSPEPP-SPVPPSPPPASPEPTSPAPPSPPPPSPEPPSPAPPSPPPPSPEPP-SP 886

Query: 178  TPSTPPSSDCTPPSQD---SPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
             P +PP     PPS      PP  P P +P+ P+ P        P  S PP  P P +P+
Sbjct: 887  APPSPPLPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPA 946

Query: 349  TPTTPSGGYYNSPPQDSSP-PSDPLP 423
             P+ P       PP    P P+ PLP
Sbjct: 947  PPSPP-------PPSPEPPSPAPPLP 965

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 52/143 (36%), Positives = 67/143 (46%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS +  SP  P    P+P+PPS      P
Sbjct: 1022 PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPS------P 1074

Query: 178  TPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
             P +P      PPS + P P+ P+P  PS P  PS    + PP    PP+   P+ P   
Sbjct: 1075 EPPSPAPPSPAPPSPEPPSPAPPSPRPPS-PEPPSPVPPSPPPPSPEPPSPAPPSPPPPS 1133

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
              P      SPP  S  P  P P
Sbjct: 1134 LEPPSPAPPSPPPPSPEPPSPAP 1156

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 53/143 (37%), Positives = 67/143 (46%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SP       P+P+PPS +  S  PP    P+P PPS +   +P
Sbjct: 1052 PSPAPPSPEPP-SPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPSPRPPSPEPP-SP 1109

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
             P +PP     PPS  +PPS P P+  P +P  P      SPP  S  P  P P+ P   
Sbjct: 1110 VPPSPPPPSPEPPS-PAPPSPPPPSLEPPSPAPP------SPPPPSPEPPSPAPSPPPPS 1162

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
              P      SPP  S  P  P P
Sbjct: 1163 PEPPSPVPPSPPPPSPEPPSPAP 1185

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 62/163 (38%), Positives = 73/163 (44%), Gaps = 23/163 (14%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSP-----PSDSGGSPPGSYDPTPSPPSGDGS 168
            P+P+PPS   S  P+P SP       P+P+P     PS +  SP     P+P PP   G 
Sbjct: 1308 PSPSPPSPAPSV-PSPPSPAPPSPMPPSPAPLAPQPPSPTPPSPAPPVPPSPEPPVPPG- 1365

Query: 169  YNPTPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPT------TPSGGYYNSP----PQDSS 315
              P P  PPS   TPPS   P P  PTP +P  P+       PS     SP    PQ  S
Sbjct: 1366 --PDPPLPPSP--TPPSPQPPVPPSPTPPSPQPPSPAPPSPAPSAPLQPSPDPPSPQPPS 1421

Query: 316  PPTDPTPTTPSTPTTPS-------GGYYNSPPQDSSPPSDPLP 423
            P   P P+ PS P+TPS             PP    PPS PLP
Sbjct: 1422 PAPGPPPSPPSPPSTPSPPSPAPLAPAPPVPPMAPQPPSPPLP 1464

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/144 (36%), Positives = 64/144 (44%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD--SGGSPPGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS       PP    P P PPS +     
Sbjct: 859  PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPLPSPEPPSPAPPLPPPPSPEPPSPA 917

Query: 178  TPSTPPSSDCTP-PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
             PS PP S   P P+   PP  P P +P+ P+ P       PP    P   P    P +P
Sbjct: 918  PPSPPPPSPEPPSPAPSPPPPSPEPPSPAPPSPP-------PPSPEPPSPAPPLPPPPSP 970

Query: 355  TTPSGGYYNSPPQDSSPPSD-PLP 423
              PS    + PP    PPS  PLP
Sbjct: 971  EPPSPAPPSPPPPSPEPPSPAPLP 994

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 57/147 (38%), Positives = 69/147 (46%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSY----NPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
            P+PTPPS +       +PTP +PP      P+P+PPS     PP    P+PSPPS   S 
Sbjct: 1265 PSPTPPSPEPPAPQPPSPTPHAPPS--PEPPSPTPPSPL---PPSPEPPSPSPPSPAPSV 1319

Query: 172  NPTPSTPPSSDCTP---PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
               PS  P S   P   P    PPS PTP +P+ P  PS      P  D   P  PTP +
Sbjct: 1320 PSPPSPAPPSPMPPSPAPLAPQPPS-PTPPSPAPPVPPSPEPPVPPGPDPPLPPSPTPPS 1378

Query: 343  PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P  P  PS    +  P   +PPS P P
Sbjct: 1379 PQPPVPPSPTPPSPQPPSPAPPS-PAP 1404

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 54/146 (36%), Positives = 63/146 (43%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGG---SYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYN 174
            P+PTPPS      P+P  P   G      P+P+PPS     PP    P+P PPS     +
Sbjct: 1343 PSPTPPSPAPPVPPSPEPPVPPGPDPPLPPSPTPPSPQPPVPPSPTPPSPQPPS-PAPPS 1401

Query: 175  PTPSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
            P PS P  PS D   P   SP   P P+ PS P+TPS             P  P P  P+
Sbjct: 1402 PAPSAPLQPSPDPPSPQPPSPAPGPPPSPPSPPSTPS-------------PPSPAPLAPA 1448

Query: 349  TPTTPSGGYYNSPPQDSSP-PSDPLP 423
             P  P      SPP  S P P  P P
Sbjct: 1449 PPVPPMAPQPPSPPLPSPPFPPQPSP 1474

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/144 (35%), Positives = 66/144 (45%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP-PGSYDPTPSPPSGDGSYNPT 180
            P+P PPS      P P  PP      P+P+PPS    SP P S  P+P PPS +   +P 
Sbjct: 894  PSPEPPS------PAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPP-SPA 946

Query: 181  PSTPPSSDCTPPSQD---SPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            P +PP     PPS      PP  P P +P+ P+ P        P    PP  P P +P+ 
Sbjct: 947  PPSPPPPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPLPPPPSPEPPSPAP 1006

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P+ P     +  P   +PPS P P
Sbjct: 1007 PSPPPP---SPEPPSPAPPSPPPP 1027

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 53/145 (36%), Positives = 71/145 (48%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS    SP  P    P+P+PPS +     
Sbjct: 1007 PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPAPPSPEPPSPA 1065

Query: 178  TPS-TPPSSDCTPPSQDSP-PSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTPTTPS 348
             PS  PPS +   P+  SP P  P P +P+ P+  P      SP   S PP  P P +P+
Sbjct: 1066 PPSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPSPRPPSPEPPSPVPPSPPPPSPEPPSPA 1125

Query: 349  TPTTPSGGYYNSPPQDSSPPSDPLP 423
             P+ P     +  P   +PPS P P
Sbjct: 1126 PPSPPPP---SLEPPSPAPPSPPPP 1147

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 56/150 (37%), Positives = 75/150 (50%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP-PGSYDPTPSPPSGDGSYNPT 180
            P+P PPS +   +P P SPP      P+P+PPS    SP P S  P+P PPS +   +P 
Sbjct: 1112 PSPPPPSPEPP-SPAPPSPPPPSLEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPP-SPV 1169

Query: 181  PSTPPSSDCTPPSQDSP---PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT--DPTPTTP 345
            P +PP     PPS   P   P  P P +P T + PS    +  P   SPP+   P+P  P
Sbjct: 1170 PPSPPPPSPEPPSPAPPSPAPPLPLPPSPHTQSPPSPVPPSPAPSAPSPPSPQPPSPLAP 1229

Query: 346  STPT----TPSGGYYNSPPQDSSPPSDPLP 423
            S P+     PS  +   PPQ ++P + P P
Sbjct: 1230 SPPSPAPQAPSSPF--PPPQPTAPTAPPPP 1257

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 53/140 (37%), Positives = 66/140 (47%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS +   +P PS PP      P+P PPS +  SPP    P+P PPS      P P
Sbjct: 919  PSPPPPSPEPP-SPAPSPPP------PSPEPPSPAPPSPP---PPSPEPPSPAPPLPPPP 968

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            S  P S   PPS   PP  P P +P+    P      SP   S PP  P P +P+ P+ P
Sbjct: 969  SPEPPSP-APPS--PPPPSPEPPSPAPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 1025

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
                 +  P   +PPS P P
Sbjct: 1026 PP---SPEPPSPAPPSPPPP 1042

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 48/140 (34%), Positives = 65/140 (46%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS +   +P P SP       P+P+PPS    +PP    P+P+PPS     +P P
Sbjct: 1037 PSPPPPSPEPP-SPAPPSPAPPSPEPPSPAPPSP---APPSPEPPSPAPPS-PAPPSPEP 1091

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             +P      PPS + P   P    P +P  PS    + PP    PP+ P P +P  P+  
Sbjct: 1092 PSPAPPSPRPPSPEPPSPVPPSPPPPSPEPPSPAPPSPPPPSLEPPS-PAPPSPPPPSPE 1150

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
                  SPP  S  P  P+P
Sbjct: 1151 PPSPAPSPPPPSPEPPSPVP 1170

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 51/145 (35%), Positives = 66/145 (45%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SP       P+P+PPS    S  PP    P+P PPS +   +P
Sbjct: 1067 PSPAPPSPEPP-SPAPPSPAPPSPEPPSPAPPSPRPPSPEPPSPVPPSPPPPSPEPP-SP 1124

Query: 178  TPSTPPSSDCTPPS---QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
             P +PP     PPS      PP  P P +P+    P      SP   S PP  P P +P+
Sbjct: 1125 APPSPPPPSLEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPVPPSPPPPSPEPPSPA 1184

Query: 349  TPTTPSGGYYNSPPQDSSPPSDPLP 423
             P+          P   SPPS P+P
Sbjct: 1185 PPSPAPPLPLPPSPHTQSPPS-PVP 1208

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 49/147 (33%), Positives = 62/147 (42%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS----GDGSY 171
            P   PP+     +P P SPP      P+P+PPS     PP    P+P+PPS         
Sbjct: 843  PPSPPPASPEPTSPAPPSPPPPSPEPPSPAPPSPP---PPSPEPPSPAPPSPPLPSPEPP 899

Query: 172  NPTPSTPPSSDCTPPS---QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
            +P P  PP     PPS      PP  P P +P+    P      SP   S PP  P P +
Sbjct: 900  SPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPAPPSPPPPSPEPPS 959

Query: 343  PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P+ P  P     +  P   +PPS P P
Sbjct: 960  PAPPLPPPP---SPEPPSPAPPSPPPP 983

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 53/151 (35%), Positives = 69/151 (45%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PPS    S  PP    P+P PPS +   +P
Sbjct: 1097 PSPRPPSPEPP-SPVPPSPPPPSPEPPSPAPPSPPPPSLEPPSPAPPSPPPPSPEPP-SP 1154

Query: 178  TPSTPPSSDCTPPS---QDSPPSDPTPTTPSTPT------TPSGGYYNSPPQDSSPPTDP 330
             PS PP S   PPS      PP  P P +P+ P+       P   +  SPP    P   P
Sbjct: 1155 APSPPPPSP-EPPSPVPPSPPPPSPEPPSPAPPSPAPPLPLPPSPHTQSPPSPVPPSPAP 1213

Query: 331  TPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            +  +P +P  PS    + P      PS P P
Sbjct: 1214 SAPSPPSPQPPSPLAPSPPSPAPQAPSSPFP 1244

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 51/144 (35%), Positives = 68/144 (47%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPT-PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYN 174
            P+P+ PP   G  +P P SP    +  P+P PPS +  SP  P    P+P PPS      
Sbjct: 777  PSPSIPPPSPGPPSPEPPSPAPPSAAPPSPMPPSPAPPSPDPPSPKPPSPVPPS------ 830

Query: 175  PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTPTTPST 351
            P P +P      PPS   PP+ P PT+P+ P+  P      SP   S PP  P P +P+ 
Sbjct: 831  PLPPSPEPPSPVPPS--PPPASPEPTSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAP 888

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P+ P       P  +   P+ PLP
Sbjct: 889  PSPP------LPSPEPPSPAPPLP 906

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 54/143 (37%), Positives = 68/143 (47%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP-PGSYDPTPSPPSGDGSYNPT 180
            P+P PPS +   +P P  PP      P+P+PPS    SP P S  P P PPS +   +P 
Sbjct: 948  PSPPPPSPEPP-SPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPLPPPPSPEPP-SPA 1005

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            P +PP     PPS  +PPS P P+  P +P  P      SPP  S  P  P P +P+ P+
Sbjct: 1006 PPSPPPPSPEPPS-PAPPSPPPPSPEPPSPAPP------SPPPPSPEPPSPAPPSPAPPS 1058

Query: 358  -TPSGGYYNSPPQDSSPPSDPLP 423
              P      SP   S  P  P P
Sbjct: 1059 PEPPSPAPPSPAPPSPEPPSPAP 1081

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 51/121 (42%), Positives = 62/121 (51%), Gaps = 4/121 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+PTPPS      P P SP       P+P+PPS +  +P  P    P+P PPS      P
Sbjct: 1372 PSPTPPSPQP---PVPPSPTPPSPQPPSPAPPSPAPSAPLQPSPDPPSPQPPS------P 1422

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPT-TPST 351
             P  PPS   +PPS  SPPS P P  P+ P  P      SPP  S P P  P+PT TP++
Sbjct: 1423 APGPPPSPP-SPPSTPSPPS-PAPLAPAPPVPPMAPQPPSPPLPSPPFPPQPSPTITPAS 1480

Query: 352  P 354
            P
Sbjct: 1481 P 1481

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 54/146 (36%), Positives = 66/146 (45%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PP     SP  P    P+P PPS +   +P
Sbjct: 874  PSPPPPSPEPP-SPAPPSPPLPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPP-SP 931

Query: 178  TPSTPPSSDCTPPSQ---DSPPSDPTPTTPSTPTTPSGGYYN-SPPQDSSPPTDPTPTTP 345
             PS PP S   PPS      PP  P P +P+ P  P       SP   S PP  P P +P
Sbjct: 932  APSPPPPSP-EPPSPAPPSPPPPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSP 990

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
            +    P      SP   S PP  P P
Sbjct: 991  APLPPPPSPEPPSPAPPSPPPPSPEP 1016

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 51/146 (34%), Positives = 70/146 (47%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS +   +P P SPP      P+P+PPS     PP    P+P+PPS     +P P
Sbjct: 992  PLPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPSPP---PPSPEPPSPAPPSPPPP-SPEP 1046

Query: 184  STPPSSDCTPPSQDSP-PSDPTPTTPS----TPTTPSGGYYNSPPQDSSPPTDPTPT-TP 345
             +P      PPS + P P+ P+P  PS    +P  PS    +  P   +PP+   P+  P
Sbjct: 1047 PSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPSPRPPSPEP 1106

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
             +P  PS    +  P   +PPS P P
Sbjct: 1107 PSPVPPSPPPPSPEPPSPAPPSPPPP 1132

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 53/144 (36%), Positives = 71/144 (49%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--PPGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SPP      P+P+PP     S  PP    P+P PPS +   +P
Sbjct: 933  PSPPPPSPEPP-SPAPPSPPPPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPP-SP 990

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPST 351
             P  PP S   PPS  +PPS P P+  P +P  PS    +  P   +PP+ P P+  P +
Sbjct: 991  APLPPPPSP-EPPS-PAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 1048

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P   +PPS   P
Sbjct: 1049 PAPPSPAPPSPEPPSPAPPSPAPP 1072

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 53/140 (37%), Positives = 63/140 (45%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PP      +P P SPP      P+PS P  S G PP    P+P+PPS      P  
Sbjct: 755  PPPPPPLPPNPPSPAPPSPPP----PPSPSIPPPSPG-PPSPEPPSPAPPSAA----PPS 805

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
              PPS    PPS D P   P    P +P  PS     SP   S PP  P PT+P+ P+ P
Sbjct: 806  PMPPSP--APPSPDPPSPKPPSPVPPSPLPPS-PEPPSPVPPSPPPASPEPTSPAPPSPP 862

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
                 +  P   +PPS P P
Sbjct: 863  PP---SPEPPSPAPPSPPPP 879

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 50/143 (34%), Positives = 68/143 (47%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSP-PSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            P P PPS +   +P P SPP      P+P+P P      PP    P+P PPS +   +P 
Sbjct: 963  PLPPPPSPEPP-SPAPPSPPPPSPEPPSPAPLPPPPSPEPPSPAPPSPPPPSPEPP-SPA 1020

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPSTP 354
            P +PP     PPS  +PPS P P+  P +P  PS    +  P   +PP+   P+  P +P
Sbjct: 1021 PPSPPPPSPEPPS-PAPPSPPPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSP 1079

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
              PS    +  P   +PPS   P
Sbjct: 1080 APPSPAPPSPEPPSPAPPSPRPP 1102

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 54/149 (36%), Positives = 63/149 (42%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP--PSGDGSYNP 177
            P+P PPS     +P P SP       P P PPS    SPP    P+P+P  PS      P
Sbjct: 1166 PSPVPPSPPPP-SPEPPSPAPPSPAPPLPLPPSPHTQSPPSPVPPSPAPSAPSPPSPQPP 1224

Query: 178  TP--STPPSSDCTPPSQDSPPSDPT-PTTPSTPTTPSGGYYNSPPQDSSPPT----DPTP 336
            +P   +PPS     PS   PP  PT PT P  P  PS    +  P    PP      PTP
Sbjct: 1225 SPLAPSPPSPAPQAPSSPFPPPQPTAPTAPPPPFPPSPAPPSPTPPSPEPPAPQPPSPTP 1284

Query: 337  TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              P +P  PS    +  P    PPS   P
Sbjct: 1285 HAPPSPEPPSPTPPSPLPPSPEPPSPSPP 1313

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 54/146 (36%), Positives = 66/146 (45%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P SP       P+P PPS    SP  P    P+P PPS +   +P
Sbjct: 1082 PSPAPPSPEPP-SPAPPSPRPPSPEPPSPVPPSPPPPSPEPPSPAPPSPPPPSLEPP-SP 1139

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP- 354
             P +PP     PPS    P  P+P  PS P  P      SPP  S  P  P P +P+ P 
Sbjct: 1140 APPSPPPPSPEPPSPAPSPPPPSPEPPS-PVPP------SPPPPSPEPPSPAPPSPAPPL 1192

Query: 355  TTPSGGYYNSPPQDSSP---PSDPLP 423
              P   +  SPP    P   PS P P
Sbjct: 1193 PLPPSPHTQSPPSPVPPSPAPSAPSP 1218

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 53/144 (36%), Positives = 59/144 (40%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGD-GSYN 174
            P+P PPS     +P P SP       P+P PPS    SP  P    P+P PPS    S  
Sbjct: 794  PSPAPPSA-APPSPMPPSPAPPSPDPPSPKPPSPVPPSPLPPSPEPPSPVPPSPPPASPE 852

Query: 175  PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            PT   PPS    PP    PPS   P+ P     P      SPP  S  P  P P  P  P
Sbjct: 853  PTSPAPPS---PPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPLPSPEPPSPAPPLPPPP 909

Query: 355  T-TPSGGYYNSPPQDSSPPSDPLP 423
            +  P      SPP  S  P  P P
Sbjct: 910  SPEPPSPAPPSPPPPSPEPPSPAP 933

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 52/144 (36%), Positives = 69/144 (47%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P PPS +   +P P  PP      P+P+PPS    SP  P    P+P PPS +   +P
Sbjct: 978  PSPPPPSPEPP-SPAPLPPPPSPE-PPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPP-SP 1034

Query: 178  TPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPST 351
             P +PP     PPS   P P+ P+P  PS P  PS    +  P   +PP+   P+  P +
Sbjct: 1035 APPSPPPPSPEPPSPAPPSPAPPSPEPPS-PAPPSPAPPSPEPPSPAPPSPAPPSPEPPS 1093

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS    +  P    PPS P P
Sbjct: 1094 PAPPSPRPPSPEPPSPVPPSPPPP 1117

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 53/141 (37%), Positives = 62/141 (43%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SP       P P  P+ S  SPP    P+P  PS        P
Sbjct: 1181 PSPAPPSPAPPL-PLPPSPHTQSPPSPVPPSPAPSAPSPPSPQPPSPLAPSPPSPAPQAP 1239

Query: 184  STP-PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            S+P P    T P+   PP  P+P  PS PT PS       P   +P   P+P  PS PT 
Sbjct: 1240 SSPFPPPQPTAPTAPPPPFPPSPAPPS-PTPPSPEPPAPQPPSPTPHAPPSPEPPS-PTP 1297

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            PS    +  P   SPPS P P
Sbjct: 1298 PSPLPPSPEPPSPSPPS-PAP 1317

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 51/154 (33%), Positives = 65/154 (42%), Gaps = 14/154 (9%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP--PGSYDPTPSPPSGDGSYNP 177
            P+P  P+     +P P   P   +  P P PPS +  SP  P    P P PPS      P
Sbjct: 1229 PSPPSPAPQAPSSPFPPPQPTAPTAPPPPFPPSPAPPSPTPPSPEPPAPQPPS------P 1282

Query: 178  TPSTPPSSDCTPPSQDSP----PSDPTPT----TPSTPTTPSGGYYNSPPQDSSP----P 321
            TP  PPS +   P+  SP    P  P+P+     PS P+ PS    +  P   +P    P
Sbjct: 1283 TPHAPPSPEPPSPTPPSPLPPSPEPPSPSPPSPAPSVPSPPSPAPPSPMPPSPAPLAPQP 1342

Query: 322  TDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              PTP +P+ P  PS      P  D   P  P P
Sbjct: 1343 PSPTPPSPAPPVPPSPEPPVPPGPDPPLPPSPTP 1376

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/141 (33%), Positives = 58/141 (41%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP-PGSYDPTPSPPSGDGSYNPT 180
            P+P PPS      P PS  P   +  P+P PPS    SP P    P+P PPS      P 
Sbjct: 953  PSPEPPSPAPPLPPPPSPEPPSPA-PPSPPPPSPEPPSPAPLPPPPSPEPPSPAPPSPPP 1011

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            PS  P S   P      P  P+P  PS P         +PP  + P  +P    P +P  
Sbjct: 1012 PSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAP 1071

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            PS    +  P   +PPS   P
Sbjct: 1072 PSPEPPSPAPPSPAPPSPEPP 1092

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 53/156 (33%), Positives = 66/156 (42%), Gaps = 16/156 (10%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS--------- 156
            P+P PPS      P+P SP       P P P   +  +PP  + P+P+PPS         
Sbjct: 1219 PSPQPPS---PLAPSPPSPAPQAPSSPFPPPQPTAPTAPPPPFPPSPAPPSPTPPSPEPP 1275

Query: 157  GDGSYNPTPSTPPSSDCTPPSQDSP-PSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDP 330
                 +PTP  PPS +   P+  SP P  P P +PS P+  PS     SP   S  P  P
Sbjct: 1276 APQPPSPTPHAPPSPEPPSPTPPSPLPPSPEPPSPSPPSPAPSVPSPPSPAPPSPMPPSP 1335

Query: 331  TPTTPSTPT-TPSGGYYNSPPQDSSP----PSDPLP 423
             P  P  P+ TP       PP    P    P  PLP
Sbjct: 1336 APLAPQPPSPTPPSPAPPVPPSPEPPVPPGPDPPLP 1371

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 51/138 (36%), Positives = 60/138 (43%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
            P+PP    + +P P  PP      P PSPP     SPP    P P PPS      P P  
Sbjct: 708  PSPPLPPVTPSPPPRPPPPKSPPPPKPSPPPRP--SPPPRPPPRPLPPSPP----PPPPL 761

Query: 190  PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
            PP+    PPS  +PPS P P +PS P    G     PP  + P   P    P +P  PS 
Sbjct: 762  PPN----PPSP-APPSPPPPPSPSIPPPSPGPPSPEPPSPAPPSAAPPSPMPPSPAPPSP 816

Query: 370  GYYNSPPQDSSPPSDPLP 423
               +  P    PPS PLP
Sbjct: 817  DPPSPKPPSPVPPS-PLP 833

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 53/151 (35%), Positives = 59/151 (39%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS----PPSGDGSY 171
            P P  P      +P P SP       P+P PPS    SPP      PS    PP      
Sbjct: 1193 PLPPSPHTQSPPSPVPPSPAPSAPSPPSPQPPSPLAPSPPSPAPQAPSSPFPPPQPTAPT 1252

Query: 172  NPTPSTPPS---SDCTPPSQDSP---PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT 333
             P P  PPS      TPPS + P   P  PTP  P +P  P      SP   S  P  P 
Sbjct: 1253 APPPPFPPSPAPPSPTPPSPEPPAPQPPSPTPHAPPSPEPP------SPTPPSPLPPSPE 1306

Query: 334  PTTPSTPT-TPSGGYYNSPPQDSSPPSDPLP 423
            P +PS P+  PS     SP   S  P  P P
Sbjct: 1307 PPSPSPPSPAPSVPSPPSPAPPSPMPPSPAP 1337

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 55/155 (35%), Positives = 69/155 (44%), Gaps = 15/155 (9%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP--GSYDPTPSPPS------- 156
            P+P PPS +   +P PS PP      P+P PPS    SPP      P+P+PPS       
Sbjct: 1142 PSPPPPSPEPP-SPAPSPPP------PSPEPPSPVPPSPPPPSPEPPSPAPPSPAPPLPL 1194

Query: 157  -----GDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSP 318
                      +P P +P  S  +PPS   PPS   P+ PS  P  PS  +   PP   + 
Sbjct: 1195 PPSPHTQSPPSPVPPSPAPSAPSPPS-PQPPSPLAPSPPSPAPQAPSSPF---PPPQPTA 1250

Query: 319  PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            PT P P  P +P  PS    +  P    PPS P P
Sbjct: 1251 PTAPPPPFPPSPAPPSPTPPSPEPPAPQPPS-PTP 1284

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 50/142 (35%), Positives = 59/142 (41%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PP       P PS PP      P+P P       PP    P P PP+      P+P
Sbjct: 719  PPPRPPPPKSPPPPKPSPPPR-----PSPPPRPPPRPLPPSPPPPPPLPPNPPSPAPPSP 773

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTPTTPSTPT- 357
              PPS    PPS   PPS P P +P+ P+  P      SP   S  P  P P +P  P+ 
Sbjct: 774  PPPPSPSIPPPS-PGPPS-PEPPSPAPPSAAPPSPMPPSPAPPSPDPPSPKPPSPVPPSP 831

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             P      SP   S PP+ P P
Sbjct: 832  LPPSPEPPSPVPPSPPPASPEP 853

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 51/143 (35%), Positives = 64/143 (44%), Gaps = 3/143 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS      P+P  P    S    PSPPS    SP     P+P+P +    + P  
Sbjct: 1191 PLPLPPSPHTQSPPSPVPPSPAPS---APSPPSPQPPSPLAPSPPSPAPQAPSSPFPPPQ 1247

Query: 184  STPPSSDCTP-PSQDSPPSDPTPTTPSTPT-TPSGGYYNSPPQDSSP-PTDPTPTTPSTP 354
             T P++   P P   +PPS PTP +P  P   P     ++PP    P PT P+P  PS P
Sbjct: 1248 PTAPTAPPPPFPPSPAPPS-PTPPSPEPPAPQPPSPTPHAPPSPEPPSPTPPSPLPPS-P 1305

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
              PS    +  P   SPPS   P
Sbjct: 1306 EPPSPSPPSPAPSVPSPPSPAPP 1328

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 49/145 (33%), Positives = 60/145 (41%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P   P   +G++   P  PP      P P PPS     PP +  P P PP       P P
Sbjct: 677  PPTWPGKWEGAWPFRPPIPPRPPRPPPPPLPPSPP--LPPVTPSPPPRPPPPKSPPPPKP 734

Query: 184  STP--PSSDCTPPSQDSPPS-DPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS-- 348
            S P  PS    PP +  PPS  P P  P  P +P+      PP  S PP  P P +P   
Sbjct: 735  SPPPRPSPPPRPPPRPLPPSPPPPPPLPPNPPSPAPPSPPPPPSPSIPPPSPGPPSPEPP 794

Query: 349  TPTTPSGGYYNSPPQDSSPPSDPLP 423
            +P  PS    +  P   +PPS   P
Sbjct: 795  SPAPPSAAPPSPMPPSPAPPSPDPP 819

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 55/162 (33%), Positives = 61/162 (37%), Gaps = 22/162 (13%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PP       P+P SPP   + D  P PPS    SPP    P P+PP       P P
Sbjct: 617  PQPPPPPAP----PSPPSPP--TTPDVPPMPPS----SPPAPVMP-PAPP-------PQP 658

Query: 184  STPPSSDCTPPSQDSPPSDPT----------------------PTTPSTPTTPSGGYYNS 297
              PP+S  TP +   PP  PT                      P  P  P+ P      S
Sbjct: 659  PIPPASPLTPAAPPRPPLPPTWPGKWEGAWPFRPPIPPRPPRPPPPPLPPSPPLPPVTPS 718

Query: 298  PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            PP    PP  P P  PS P  PS      PP    PPS P P
Sbjct: 719  PPPRPPPPKSPPPPKPSPPPRPSPP--PRPPPRPLPPSPPPP 758

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 44/126 (34%), Positives = 52/126 (41%), Gaps = 1/126 (0%)
 Frame = +1

Query: 49  PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDS 228
           P+SPP      P P P   S  SPP + D  P PPS   +    P+ PP     P S  +
Sbjct: 613 PTSPP-----QPPPPPAPPSPPSPPTTPDVPPMPPSSPPAPVMPPAPPPQPPIPPASPLT 667

Query: 229 PPSDPTPTTPST-PTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSP 405
           P + P P  P T P    G +   PP    PP  P P  P +P  P      SPP    P
Sbjct: 668 PAAPPRPPLPPTWPGKWEGAWPFRPPIPPRPPRPPPPPLPPSPPLPP--VTPSPPPRPPP 725

Query: 406 PSDPLP 423
           P  P P
Sbjct: 726 PKSPPP 731

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 48/143 (33%), Positives = 55/143 (38%), Gaps = 2/143 (1%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            D  P PPS      P P  PP      P P     +  +PP    P   P   +G++   
Sbjct: 636  DVPPMPPSSP----PAPVMPPAPPPQPPIPPASPLTPAAPPRPPLPPTWPGKWEGAWPFR 691

Query: 181  PSTPPSSDCTPPSQDSPPSDPTP-TTPSTPTTPSGGYYNSPPQDSSPP-TDPTPTTPSTP 354
            P  PP     PP    PPS P P  TPS P  P       PP+ S PP   P P  P  P
Sbjct: 692  PPIPPRPP-RPPPPPLPPSPPLPPVTPSPPPRPPPPKSPPPPKPSPPPRPSPPPRPPPRP 750

Query: 355  TTPSGGYYNSPPQDSSPPSDPLP 423
              PS      PP    PP+ P P
Sbjct: 751  LPPS-----PPPPPPLPPNPPSP 768

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 49/164 (29%), Positives = 58/164 (35%), Gaps = 24/164 (14%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSP-PSDSGGSP--PGSYDPTPSPPSGDGSYN 174
            P+P  P       P P S P      P P P P     SP  P +    P PP+  G + 
Sbjct: 626  PSPPSPPTTPDVPPMPPSSPPAPVMPPAPPPQPPIPPASPLTPAAPPRPPLPPTWPGKWE 685

Query: 175  -------------------PTPSTPPSSDCTP--PSQDSPPSDPTPTTPSTPTTPSGGYY 291
                               P P +PP    TP  P +  PP  P P  PS P  PS    
Sbjct: 686  GAWPFRPPIPPRPPRPPPPPLPPSPPLPPVTPSPPPRPPPPKSPPPPKPSPPPRPSPP-P 744

Query: 292  NSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              PP+   P   P P  P  P +P+      PP  S PP  P P
Sbjct: 745  RPPPRPLPPSPPPPPPLPPNPPSPAPPSPPPPPSPSIPPPSPGP 788

[61][TOP]
>UniRef100_Q1EP18 Protein kinase family protein n=1 Tax=Musa balbisiana
           RepID=Q1EP18_MUSBA
          Length = 637

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 51/149 (34%), Positives = 67/149 (44%), Gaps = 13/149 (8%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGG-------SYDPTPSPPSDSGGSPPGSYDPTPS---PP 153
           P PTPPS   + +P P+ PP          +  P P PP  S   PP +  P P+   PP
Sbjct: 40  PPPTPPSPPPASSPPPTPPPPADVPPPPVVTSPPPPDPPPPSVSPPPPALSPPPASTPPP 99

Query: 154 SGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSP---PQDSSPPT 324
               S  P  + PP    TPP  +SPP  P+ T P T + P  G  + P   P +S+  T
Sbjct: 100 PPSASPPPAAAPPPPPFATPPPTNSPPPPPSATPPPTISPPPPGSQSPPARAPSNSTGGT 159

Query: 325 DPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
            P P  P +P +PS    +  P D   PS
Sbjct: 160 PPAPPKPPSPPSPSPSASHRAPADPISPS 188

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 54/142 (38%), Positives = 63/142 (44%), Gaps = 6/142 (4%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP---S 186
           PP+ +    PTP SPP   S  PTP PP+D    P  +  P P PP    S +P P   S
Sbjct: 33  PPAPNAPPPPTPPSPPPASSPPPTPPPPADVPPPPVVTSPPPPDPP--PPSVSPPPPALS 90

Query: 187 TPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT--DPTPTTPSTPT- 357
            PP+S   PP   SPP    P  P   T P       PP  + PPT   P P + S P  
Sbjct: 91  PPPASTPPPPPSASPPPAAAPPPPPFATPPPTNSPPPPPSATPPPTISPPPPGSQSPPAR 150

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
            PS     +PP    PPS P P
Sbjct: 151 APSNSTGGTPPAPPKPPSPPSP 172

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 49/137 (35%), Positives = 58/137 (42%), Gaps = 2/137 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           P+ TPPS       + S PP   S  P P+  PP      PP S  P   PP  D    P
Sbjct: 8   PSATPPSTSPPPPSSLSPPPASNSPPPAPNAPPPPTPPSPPPASSPPPTPPPPADVPPPP 67

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
             ++PP  D  PPS   PP   +P   STP  P      SPP  ++PP  P  T P T +
Sbjct: 68  VVTSPPPPDPPPPSVSPPPPALSPPPASTPPPPPSA---SPPPAAAPPPPPFATPPPTNS 124

Query: 358 TPSGGYYNSPPQDSSPP 408
            P       PP  S PP
Sbjct: 125 PPPPPSATPPPTISPPP 141

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 46/137 (33%), Positives = 62/137 (45%), Gaps = 2/137 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+P     S  P  +SPP   S  P   PP+ +   P  +  P P+PPS   + +P P
Sbjct: 4   PPPSP-----SATPPSTSPPPPSSLSP---PPASNSPPPAPNAPPPPTPPSPPPASSPPP 55

Query: 184 STPPSSDCTPPS--QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
           + PP +D  PP      PP DP P + S P         SPP  S+PP  P+ + P    
Sbjct: 56  TPPPPADVPPPPVVTSPPPPDPPPPSVSPPPPAL-----SPPPASTPPPPPSASPPPAAA 110

Query: 358 TPSGGYYNSPPQDSSPP 408
            P   +   PP +S PP
Sbjct: 111 PPPPPFATPPPTNSPPP 127

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 43/121 (35%), Positives = 50/121 (41%), Gaps = 12/121 (9%)
 Frame = +1

Query: 91  SPPSDSGGSPPGSYDPTPS---PPSGDGSYNPTPSTPPSSDCTPPSQDSPP--SDPTPTT 255
           SPP     +PP +  P PS   PP    S  P P+ PP     PP+  SPP  S P PT 
Sbjct: 3   SPPPSPSATPPSTSPPPPSSLSPPPASNSPPPAPNAPP-----PPTPPSPPPASSPPPTP 57

Query: 256 PSTPTTPSGGYYNSPPQDSSPPTDPTPTTP-------STPTTPSGGYYNSPPQDSSPPSD 414
           P     P      SPP    PP   +P  P       STP  P      SPP  ++PP  
Sbjct: 58  PPPADVPPPPVVTSPPPPDPPPPSVSPPPPALSPPPASTPPPPPSA---SPPPAAAPPPP 114

Query: 415 P 417
           P
Sbjct: 115 P 115

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 48/139 (34%), Positives = 62/139 (44%), Gaps = 8/139 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP---SPPSGDGSYN 174
           P P PP    S  P   SPP       TP PP  S   PP +  P P   +PP       
Sbjct: 73  PPPDPPPPSVSPPPPALSPPPAS----TPPPPP-SASPPPAAAPPPPPFATPP------- 120

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDPTPT---- 339
           PT S PP    TPP   SPP   + + P+  P+  +GG   +PP+  SPP+ P+P+    
Sbjct: 121 PTNSPPPPPSATPPPTISPPPPGSQSPPARAPSNSTGGTPPAPPKPPSPPS-PSPSASHR 179

Query: 340 TPSTPTTPSGGYYNSPPQD 396
            P+ P +PS      P  D
Sbjct: 180 APADPISPSSNGSGIPTSD 198

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 42/107 (39%), Positives = 49/107 (45%), Gaps = 4/107 (3%)
 Frame = +1

Query: 115 SPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYN 294
           SPP S  P+ +PPS       T   PPSS   PP+ +SPP  P P  P  PT PS    +
Sbjct: 3   SPPPS--PSATPPS-------TSPPPPSSLSPPPASNSPP--PAPNAPPPPTPPSPPPAS 51

Query: 295 SPPQDSSPPTD----PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           SPP    PP D    P  T+P  P  P       PP  S PP+   P
Sbjct: 52  SPPPTPPPPADVPPPPVVTSPPPPDPPPPSVSPPPPALSPPPASTPP 98

[62][TOP]
>UniRef100_Q9ARH1 Receptor protein kinase PERK1 n=1 Tax=Brassica napus
           RepID=Q9ARH1_BRANA
          Length = 647

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 55/136 (40%), Positives = 66/136 (48%), Gaps = 2/136 (1%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P+PPS   +  P P+S P          PP+     PP S  PT  PPS       TPS 
Sbjct: 13  PSPPSNSTTTTPPPASAP----------PPTTPSSPPPPSTIPTSPPPSS----RSTPSA 58

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT-DPTPTTPSTPTTPS 366
           PP S  TP +  SPP  P P+ P+ PTTP      SPP   +PPT +P P+ P  P+ PS
Sbjct: 59  PPPSPPTPSTPGSPPPLPQPSPPA-PTTP-----GSPPAPVTPPTRNPPPSVPGPPSNPS 112

Query: 367 -GGYYNSPPQDSSPPS 411
             G    PP   SPPS
Sbjct: 113 REGGSPRPPSSPSPPS 128

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 52/124 (41%), Positives = 63/124 (50%), Gaps = 2/124 (1%)
 Frame = +1

Query: 52  SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSP 231
           SS P  G+  P PSPPS+S  + P    P  +PP    S  P PST P+S   PPS  S 
Sbjct: 2   SSAPSPGTGSP-PSPPSNSTTTTP---PPASAPPPTTPSSPPPPSTIPTSP--PPSSRST 55

Query: 232 PS--DPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSP 405
           PS   P+P TPSTP +P      SPP  ++P + P P TP T         N PP    P
Sbjct: 56  PSAPPPSPPTPSTPGSPPPLPQPSPPAPTTPGSPPAPVTPPT--------RNPPPSVPGP 107

Query: 406 PSDP 417
           PS+P
Sbjct: 108 PSNP 111

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 46/124 (37%), Positives = 60/124 (48%), Gaps = 2/124 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P PT PS     +  P+SPP      P+  PPS    S PGS  P P P        P P
Sbjct: 30  PPPTTPSSPPPPSTIPTSPPPSSRSTPSAPPPSPPTPSTPGSPPPLPQPSP------PAP 83

Query: 184 STP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
           +TP  P +  TPP+++ PPS P P  PS P+   G    SP     PP+ P+P +PS+  
Sbjct: 84  TTPGSPPAPVTPPTRNPPPSVPGP--PSNPSREGG----SP----RPPSSPSPPSPSSDG 133

Query: 358 TPSG 369
             +G
Sbjct: 134 LSTG 137

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 45/114 (39%), Positives = 53/114 (46%), Gaps = 3/114 (2%)
 Frame = +1

Query: 91  SPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPT 270
           S PS   GSPP       SPPS     N T +TPP           P S P PTTPS+P 
Sbjct: 3   SAPSPGTGSPP-------SPPS-----NSTTTTPP-----------PASAPPPTTPSSPP 39

Query: 271 TPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGG---YYNSPPQDSSPPSDPLP 423
            PS    + PP   S P+ P P+ P TP+TP         SPP  ++P S P P
Sbjct: 40  PPSTIPTSPPPSSRSTPSAPPPSPP-TPSTPGSPPPLPQPSPPAPTTPGSPPAP 92

[63][TOP]
>UniRef100_C5XK46 Putative uncharacterized protein Sb03g034710 n=1 Tax=Sorghum
           bicolor RepID=C5XK46_SORBI
          Length = 731

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 55/139 (39%), Positives = 72/139 (51%), Gaps = 4/139 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP-PGSYDPTPSP-PSGDGSYNP 177
           P PTPP+      P+PS P       PTPSPPS +   P P    PTP+P P    +  P
Sbjct: 4   PAPTPPA-----TPSPSPP---APVTPTPSPPSPAPVPPTPSPQPPTPAPVPPTPSTIPP 55

Query: 178 TPS-TPPSSDCTPPSQDSPPSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTPTTPST 351
           TP+  PP+    PP+    P  PTP+ P  P+ +P      SPP  +S PT P+PT P++
Sbjct: 56  TPAPVPPTPSPIPPTPAPVPPTPTPSPPPPPSPSPPPPVTPSPPPPASVPT-PSPTLPAS 114

Query: 352 PTTPSGGYYNSPPQDSSPP 408
           P  P+     SPP  +SPP
Sbjct: 115 PPPPASVPTPSPPLPASPP 133

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 61/149 (40%), Positives = 73/149 (48%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPSS-PPGGGSYDPTPSP-PSDSGGSPPGSYDPTPSPPSGDGSYN 174
           PTP+P P       PTPS+ PP      PTPSP P      PP    PTPSPP       
Sbjct: 34  PTPSPQPPTPAPVPPTPSTIPPTPAPVPPTPSPIPPTPAPVPP---TPTPSPPPP----- 85

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTD---PTPTTP 345
           P+PS PP    +PP   S P+ P+PT P++P  P+     SPP  +SPP     PTP+ P
Sbjct: 86  PSPSPPPPVTPSPPPPASVPT-PSPTLPASPPPPASVPTPSPPLPASPPPPASVPTPSPP 144

Query: 346 ST---PTTPSGGYYNSPPQDSSPPSDPLP 423
                P  PS    + PP DS P S P P
Sbjct: 145 PPVRRPPPPSSVPASPPPPDSVPSSPPPP 173

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 53/152 (34%), Positives = 66/152 (43%), Gaps = 12/152 (7%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           PTP P P       PTP+  P      PTPSPP     SPP    P+P PP+   + +PT
Sbjct: 55  PTPAPVPPTPSPIPPTPAPVPP----TPTPSPPPPPSPSPPPPVTPSPPPPASVPTPSPT 110

Query: 181 -PSTPPSSDC----TPPSQDSPP---SDPTPTTPST---PTTPSGGYYNSPPQDSSPPTD 327
            P++PP        +PP   SPP   S PTP+ P     P  PS    + PP DS P + 
Sbjct: 111 LPASPPPPASVPTPSPPLPASPPPPASVPTPSPPPPVRRPPPPSSVPASPPPPDSVPSSP 170

Query: 328 PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P P        P   + + PP     PS   P
Sbjct: 171 PPPNGVPASPAPPPSHLSVPPPPPPAPSTSSP 202

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 50/127 (39%), Positives = 61/127 (48%), Gaps = 13/127 (10%)
 Frame = +1

Query: 82  PTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST-PPSSDCTPPSQDSPPSDPTPTTP 258
           P P+PP+    SPP    PTPSPPS      PTPS  PP+    PP+  + P  P P  P
Sbjct: 4   PAPTPPATPSPSPPAPVTPTPSPPS-PAPVPPTPSPQPPTPAPVPPTPSTIPPTPAPVPP 62

Query: 259 ST---PTTPS---GGYYNSPPQDSS----PPTDPTPTTPSTPTTPSGGYYNSPPQDSS-- 402
           +    P TP+        SPP   S    PP  P+P  P++  TPS     SPP  +S  
Sbjct: 63  TPSPIPPTPAPVPPTPTPSPPPPPSPSPPPPVTPSPPPPASVPTPSPTLPASPPPPASVP 122

Query: 403 PPSDPLP 423
            PS PLP
Sbjct: 123 TPSPPLP 129

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 50/132 (37%), Positives = 59/132 (44%), Gaps = 9/132 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG----SY 171
           P+P PP       P   SPP   S  PTPSP   +   PP S  PTPSPP        + 
Sbjct: 80  PSPPPPPSPSPPPPVTPSPPPPASV-PTPSPTLPASPPPPASV-PTPSPPLPASPPPPAS 137

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTP-TTPSTPTTPSGGYYNSPPQDS----SPPTDPTP 336
            PTPS PP     PP    P S P P + PS+P  P+G   +  P  S     PP  P P
Sbjct: 138 VPTPSPPPPVRRPPPPSSVPASPPPPDSVPSSPPPPNGVPASPAPPPSHLSVPPPPPPAP 197

Query: 337 TTPSTPTTPSGG 372
           +T S   + S G
Sbjct: 198 STSSPSKSSSNG 209

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 50/125 (40%), Positives = 64/125 (51%), Gaps = 3/125 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPT-PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P+P PP+   + +PT P+SPP   S  PTPSPP  +   PP S  PTPSPP       P 
Sbjct: 96  PSPPPPASVPTPSPTLPASPPPPASV-PTPSPPLPASPPPPASV-PTPSPPP-PVRRPPP 152

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTT--PSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           PS+ P+S   PP  DS PS P P    P++P  P       PP   +P T  +P+  S+ 
Sbjct: 153 PSSVPAS---PPPPDSVPSSPPPPNGVPASPAPPPSHLSVPPPPPPAPSTS-SPSKSSSN 208

Query: 355 TTPSG 369
            T  G
Sbjct: 209 GTAVG 213

[64][TOP]
>UniRef100_C4J5K1 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C4J5K1_MAIZE
          Length = 231

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 48/136 (35%), Positives = 66/136 (48%), Gaps = 1/136 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           PTP  P      N  P +PP G   +P P+P +   G+PP +  PT +PP    +  P P
Sbjct: 29  PTPNAPPA----NSPPQAPPAG---NPPPAPQAPPAGNPPPA--PTATPPPAPTTPPPAP 79

Query: 184 STPPSSDCTPP-SQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           +TPP +  TPP +  +PP  PT   PS P +P       PP  ++PP  P  + P  P T
Sbjct: 80  TTPPPAPTTPPPAPTTPPPAPTTPPPSPPASP-------PPAPTTPPPSPPASPPPAPAT 132

Query: 361 PSGGYYNSPPQDSSPP 408
           P      +PP  + PP
Sbjct: 133 PPPSPPMAPPPATPPP 148

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 53/149 (35%), Positives = 65/149 (43%), Gaps = 11/149 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           PT TPP    +  P P++PP      P P+ P  +  +PP +  PT  PPS   S  P P
Sbjct: 64  PTATPPPAPTTPPPAPTTPP------PAPTTPPPAPTTPPPA--PTTPPPSPPASPPPAP 115

Query: 184 STPPSS--------DCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
           +TPP S          TPP   SPP  P P TP  P TP      +P    +P   P  T
Sbjct: 116 TTPPPSPPASPPPAPATPP--PSPPMAPPPATPPPPATPPPPAAPTPAPSVAPTPPPVAT 173

Query: 340 ---TPSTPTTPSGGYYNSPPQDSSPPSDP 417
              +P +P TPS     SP    SP   P
Sbjct: 174 PAASPKSPKTPSPAAATSPAPSLSPAGTP 202

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 49/146 (33%), Positives = 64/146 (43%), Gaps = 8/146 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYD-PTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P   PP+G+    P P +PP G     PT +PP      PP    P P+P +      P 
Sbjct: 39  PPQAPPAGNPP--PAPQAPPAGNPPPAPTATPPPAPTTPPPAPTTPPPAPTTPP----PA 92

Query: 181 PSTPPSSDCTPPSQD--SPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           P+TPP +  TPP     SPP  PT   PS P +P       PP     P   TP  P+TP
Sbjct: 93  PTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPPSPPMAPPPATPPPPATP 152

Query: 355 -----TTPSGGYYNSPPQDSSPPSDP 417
                 TP+     +PP  ++P + P
Sbjct: 153 PPPAAPTPAPSVAPTPPPVATPAASP 178

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 48/130 (36%), Positives = 66/130 (50%), Gaps = 6/130 (4%)
 Frame = +1

Query: 49  PSSPPGGGSYDPTPS-PPSDSGGSPPGSYDPTP---SPPSGDGSYNPTPSTPPSSDCTPP 216
           P+ PP      PTP+ PP++S    P + +P P   +PP+G+    PT + PP+    PP
Sbjct: 24  PAQPP------PTPNAPPANSPPQAPPAGNPPPAPQAPPAGNPPPAPTATPPPAPTTPPP 77

Query: 217 SQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPP-- 390
           +  +PP  PT T P  PTTP       PP  ++PP  P  + P  PTTP      SPP  
Sbjct: 78  APTTPPPAPT-TPPPAPTTP-------PPAPTTPPPSPPASPPPAPTTPPPSPPASPPPA 129

Query: 391 QDSSPPSDPL 420
             + PPS P+
Sbjct: 130 PATPPPSPPM 139

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 37/102 (36%), Positives = 49/102 (48%), Gaps = 1/102 (0%)
 Frame = +1

Query: 115 SPPGSYDPTPS-PPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYY 291
           SPP    PTP+ PP+      P    PP +   PP+ + PP+ PT T P  PTTP     
Sbjct: 22  SPPAQPPPTPNAPPANSPPQAPPAGNPPPAPQAPPAGNPPPA-PTATPPPAPTTPPPAPT 80

Query: 292 NSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
             PP  ++PP  PT   P+  T P     + PP  ++PP  P
Sbjct: 81  TPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSP 122

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 44/123 (35%), Positives = 56/123 (45%)
 Frame = +1

Query: 55  SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPP 234
           SPP      P P+P +    SPP       +PP+G+    P P  PP+ +  P    +PP
Sbjct: 22  SPPA----QPPPTPNAPPANSPP------QAPPAGNPP--PAPQAPPAGNPPPAPTATPP 69

Query: 235 SDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
             PT T P  PTTP       PP  ++PP  PT   PS P +P       PP   SPP+ 
Sbjct: 70  PAPT-TPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPP---SPPAS 125

Query: 415 PLP 423
           P P
Sbjct: 126 PPP 128

[65][TOP]
>UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO
          Length = 538

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 55/150 (36%), Positives = 61/150 (40%), Gaps = 11/150 (7%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
           +P PP    S  P P SPP      P P PP  S   PP  Y P P PPS      P P 
Sbjct: 257 SPPPPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPS------PPPP 310

Query: 187 TPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDS-----SPPTDPTPTTPS- 348
            PP     PP    PPS P P     P  PS    + PP         PP  P P +P  
Sbjct: 311 PPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPP 370

Query: 349 -----TPTTPSGGYYNSPPQDSSPPSDPLP 423
                +P  P+  YY+SPP  S P S P P
Sbjct: 371 PPPLFSPPPPTPYYYSSPPPPSPPHSPPPP 400

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 56/139 (40%), Positives = 63/139 (45%), Gaps = 4/139 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS        P  PP   S  P PSPP  S   PP  Y P P PPS      P P
Sbjct: 300 PPPPPPS-------PPPPPPPVYSPPPPPSPPPPS--PPPPVYSPPPPPPSP-----PPP 345

Query: 184 STPPSSD---CTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
           S PP S    C  P    PP+ P P  P  +P  P+  YY+SPP  S P + P P  P +
Sbjct: 346 SPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPP--PHS 403

Query: 352 PTTPSGGYYNSPPQDSSPP 408
           P  PS  +   PP  S PP
Sbjct: 404 PPPPSPPHSPPPPPHSPPP 422

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 52/140 (37%), Positives = 58/140 (41%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP    S  P P SPP      P+P PP      PP    P P PP     ++P P
Sbjct: 324 PPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPL----FSPPP 379

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            TP      PP   SPP  P P  P +P  PS  +   PP  S PP  P     S P  P
Sbjct: 380 PTPYYYSSPPPP--SPPHSPPPP-PHSPPPPSPPHSPPPPPHSPPP--PIYPYLSPPPPP 434

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
              Y   PP   SPP  P P
Sbjct: 435 HPVYSPPPPPVYSPPPPPSP 454

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 56/150 (37%), Positives = 64/150 (42%), Gaps = 11/150 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGS----YDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P+P PP       P P SPP        Y P P PPS    SPP    P+P PP      
Sbjct: 305 PSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPP---PPSPLPPC----V 357

Query: 172 NPTPSTPPSSDCTPPSQDS-PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP---TPT 339
            P P  PP+S   PP   S PP  PTP   S+P  PS  +   PP  S PP  P    P 
Sbjct: 358 RPPPPPPPNSPPPPPPLFSPPP--PTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPP 415

Query: 340 TPSTPTTPSGGYYNSPPQDS---SPPSDPL 420
            P +P  P   Y + PP      SPP  P+
Sbjct: 416 PPHSPPPPIYPYLSPPPPPHPVYSPPPPPV 445

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 53/144 (36%), Positives = 61/144 (42%), Gaps = 6/144 (4%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP-SPPSGDGSY-NPT 180
           +P PP+     +P P SPP    + P P P S    SPP S  P P SPP     Y +P 
Sbjct: 376 SPPPPTPYYYSSPPPPSPP----HSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPP 431

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT----PTTPS 348
           P   P     PP   SPP  P+P     P  P      SPP  S  P  PT    P +PS
Sbjct: 432 PPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPS 491

Query: 349 TPTTPSGGYYNSPPQDSSPPSDPL 420
            P  P   Y   PP  S PP  P+
Sbjct: 492 PPPPPVHYYSPPPPSQSPPPPAPV 515

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 52/142 (36%), Positives = 55/142 (38%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTP--SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           P P+PP     Y P P  S PP    Y P P PPS     PP  Y P P PP       P
Sbjct: 243 PVPSPPV----YLPPPVYSPPPPPPVYSPPPPPPSP----PPPVYSPPPPPP-------P 287

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
             S PP     PP    PP  P+P  P  P       Y+ PP  S PP  P P   S P 
Sbjct: 288 VYSPPPP----PPVYSPPPPPPSPPPPPPPV------YSPPPPPSPPPPSPPPPVYSPP- 336

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
                    PP  S PP  P P
Sbjct: 337 ---------PPPPSPPPPSPPP 349

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 50/134 (37%), Positives = 55/134 (41%), Gaps = 6/134 (4%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           +P PPS   S  P P SPP        P P P       PP  Y P P PPS      P 
Sbjct: 403 SPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSP-PPPPSPPPCIEP- 460

Query: 181 PSTPPSSDCTPPSQDSPPSDPT----PTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
           P  PP ++ +PP     P  PT    P +PS P  P   Y   PP  S PP  P    P 
Sbjct: 461 PPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPPPPSQSPPPPAPVYEGPL 520

Query: 349 TPTTPSGGYYNSPP 390
            P T  G  Y SPP
Sbjct: 521 PPIT--GVSYASPP 532

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 54/142 (38%), Positives = 58/142 (40%), Gaps = 7/142 (4%)
 Frame = +1

Query: 4   PTPTPPSG-DGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P+P PPS       P P  PP      P P PP  S   P   Y  +P PPS   S  P 
Sbjct: 345 PSPPPPSPLPPCVRPPPPPPPNS----PPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPP 400

Query: 181 P-STPPSSDCTPPSQDSPP--SDPTPTTP--STPTTPSGGYYNSPPQDSSPPTDPT-PTT 342
           P S PP S   PP    PP  S P P  P  S P  P   Y   PP   SPP  P+ P  
Sbjct: 401 PHSPPPPS---PPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPC 457

Query: 343 PSTPTTPSGGYYNSPPQDSSPP 408
              P  P    Y+ PP   SPP
Sbjct: 458 IEPPPPPPCAEYSPPPPSPSPP 479

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 48/159 (30%), Positives = 54/159 (33%), Gaps = 24/159 (15%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP+      P  S PP    Y  +P PPS     PP  +  +P PPS      P  
Sbjct: 360 PPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPH--SPPPPS------PPH 411

Query: 184 STPPSSDCTPPS-----------------------QDSPPSDPTPTTPSTPTTPSGGYYN 294
           S PP     PP                           PP  P P     P  P   Y  
Sbjct: 412 SPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSP 471

Query: 295 SPPQDS-SPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPP 408
            PP  S  PPT   P    +P  P   YY+ PP   SPP
Sbjct: 472 PPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPPPPSQSPP 510

[66][TOP]
>UniRef100_C2BVJ8 Putative uncharacterized protein n=1 Tax=Mobiluncus curtisii ATCC
            43063 RepID=C2BVJ8_9ACTO
          Length = 1525

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 54/144 (37%), Positives = 68/144 (47%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNPT 180
            P PTPP+      P P++PP      PTP P +    +P  +  P P+P P+   +  P 
Sbjct: 1325 PAPTPPAP----TPGPTTPPA-----PTPGPTTPPAPTPGPTTPPAPTPGPTTPPAPTPG 1375

Query: 181  PSTPPSSDCTPPSQDSPPSD-PTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            P+TPP+     P   +PP+  P PTTP  PT   GG         S P  P P TPSTPT
Sbjct: 1376 PTTPPAP---APGPTTPPAPTPGPTTPPAPTPGGGG--------PSTPVSPAPNTPSTPT 1424

Query: 358  TPSGGYYNSPPQDSSP--PSDPLP 423
            TP     + P Q S P  P  P P
Sbjct: 1425 TPKPSQPSEPSQPSEPSQPETPAP 1448

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 47/156 (30%), Positives = 69/156 (44%), Gaps = 18/156 (11%)
 Frame = +1

Query: 4    PTPTP-PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNP 177
            P PTP P+   +  P P++PP      PTP P +    +P  +  P P+P P+   +  P
Sbjct: 1330 PAPTPGPTTPPAPTPGPTTPPA-----PTPGPTTPPAPTPGPTTPPAPTPGPTTPPAPAP 1384

Query: 178  TPSTPPSSDCTPPSQDSP------PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
             P+TPP+    P +  +P      PS P    P+TP+TP+    + P + S P     P 
Sbjct: 1385 GPTTPPAPTPGPTTPPAPTPGGGGPSTPVSPAPNTPSTPTTPKPSQPSEPSQPSEPSQPE 1444

Query: 340  TPSTPTTPSG----------GYYNSPPQDSSPPSDP 417
            TP+ P +P            G   +P Q  S P  P
Sbjct: 1445 TPAPPRSPDNLGKPATPALPGRSLTPSQAPSAPISP 1480

[67][TOP]
>UniRef100_Q7XQY2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=Q7XQY2_ORYSJ
          Length = 360

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 62/168 (36%), Positives = 77/168 (45%), Gaps = 27/168 (16%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS--------- 156
           PTPTPP    +Y PTP   P    Y P P+PP+ +    P +Y PTP+PP          
Sbjct: 78  PTPTPP----TYTPTPKPTP--PPYTPKPTPPAHT--PTPPTYTPTPTPPKPTPPTYKPQ 129

Query: 157 ---GDGSYNPTPSTP---PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP 318
                  Y PTP+ P   P    TPP    P   PTP TP TP TP+   Y   P+ +  
Sbjct: 130 PKPTPAPYTPTPTPPTYKPQPKPTPPPTYKPQPKPTP-TPYTP-TPTPPSYKPQPKPTPT 187

Query: 319 PTDPTPTTPS-------TPT----TPSGGYYNSPPQDSSPPS-DPLPR 426
           P  PTPT PS       TPT    TP+   Y   P+ + PP+  P P+
Sbjct: 188 PYTPTPTPPSYKPQPKPTPTPYTPTPTPPSYKPQPKPNPPPTYKPQPK 235

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 61/170 (35%), Positives = 77/170 (45%), Gaps = 29/170 (17%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTP------SSPPGGGSYDPTPSPPS--DSGGSPPGSYDPTPSPPSG 159
           PTPTPP+      PTP         P    Y PTP+PPS        P  Y PTP+PPS 
Sbjct: 139 PTPTPPTYKPQPKPTPPPTYKPQPKPTPTPYTPTPTPPSYKPQPKPTPTPYTPTPTPPSY 198

Query: 160 DGSYNPTPSTPPSSDCTPPS-QDSPPSDPTPT-----TPSTPTT--PSGGYYNSPPQDSS 315
                PTP TP +   TPPS +  P  +P PT      P+ P T  P+   Y   P+ + 
Sbjct: 199 KPQPKPTP-TPYTPTPTPPSYKPQPKPNPPPTYKPQPKPNPPPTYKPAPPTYKPQPKPNP 257

Query: 316 PPT-----DPTPTTPSTPT-------TPSGGYYNSPPQDSSPPS-DPLPR 426
           PPT      PTPT  + PT       TP+   Y   P+ + PP+  P P+
Sbjct: 258 PPTYKPQPKPTPTPYTPPTYKPQPKPTPTPTPYTPTPKPNPPPTYKPQPK 307

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 61/168 (36%), Positives = 72/168 (42%), Gaps = 32/168 (19%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPS---DSGGSPPGSYDPTPSPPSGDGSYN 174
           PTPTPPS    Y P P   P    Y PTP+PPS       +PP +Y P P P +   +Y 
Sbjct: 191 PTPTPPS----YKPQPKPTPT--PYTPTPTPPSYKPQPKPNPPPTYKPQPKP-NPPPTYK 243

Query: 175 PTPST-PPSSDCTPPSQDSPPSDPTPTTPSTPT-------TPSGGYYNSPPQDSSPPT-- 324
           P P T  P     PP    P   PTPT  + PT       TP+   Y   P+ + PPT  
Sbjct: 244 PAPPTYKPQPKPNPPPTYKPQPKPTPTPYTPPTYKPQPKPTPTPTPYTPTPKPNPPPTYK 303

Query: 325 ---DPTPT----------TPS------TPTTPSGGYYNSPPQDSSPPS 411
               PTPT          TPS      TPT P+     +PP    PPS
Sbjct: 304 PQPKPTPTPTPYKPQPKPTPSPYTPKPTPTPPTYTPTPTPPYHKPPPS 351

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 55/143 (38%), Positives = 66/143 (46%), Gaps = 7/143 (4%)
 Frame = +1

Query: 4   PTPTPPSGDG-SYNPTPSSPPGGGSYDPTPSPPS---DSGGSPPGSYDPTPSPPSGDGSY 171
           PTPTPP     +Y P P   P    Y PTP+PP+       +PP +Y P P P       
Sbjct: 114 PTPTPPKPTPPTYKPQPKPTPA--PYTPTPTPPTYKPQPKPTPPPTYKPQPKP------- 164

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            PTP TP     TPPS   P   PTP TP TP TP+   Y   P+ +  P  PTPT PS 
Sbjct: 165 TPTPYTPTP---TPPSY-KPQPKPTP-TPYTP-TPTPPSYKPQPKPTPTPYTPTPTPPSY 218

Query: 352 PTTPSGG---YYNSPPQDSSPPS 411
              P       Y   P+ + PP+
Sbjct: 219 KPQPKPNPPPTYKPQPKPNPPPT 241

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 55/151 (36%), Positives = 70/151 (46%), Gaps = 13/151 (8%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPP--SDSGGSPPGSYDPTPSPPS---GDGSYN 174
           P P      + P   +PP      PTP+PP  + +    P  Y P P+PP+      +Y 
Sbjct: 59  PKPEKPPKEHKPPAYTPP-----KPTPTPPTYTPTPKPTPPPYTPKPTPPAHTPTPPTYT 113

Query: 175 PTPSTPPSSDCTPPS-QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT-------DP 330
           PTP TPP    TPP+ +  P   P P TP TPT P+   Y   P+ + PPT        P
Sbjct: 114 PTP-TPPKP--TPPTYKPQPKPTPAPYTP-TPTPPT---YKPQPKPTPPPTYKPQPKPTP 166

Query: 331 TPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           TP TP TPT PS   Y   P+ +  P  P P
Sbjct: 167 TPYTP-TPTPPS---YKPQPKPTPTPYTPTP 193

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 53/165 (32%), Positives = 63/165 (38%), Gaps = 27/165 (16%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPS-SPPGGGSYDPTPSPPS-----------DSGGSPPGSYDPTPS 147
           PTPTPPS    Y P P  +PP      P P+PP                +PP +Y P P 
Sbjct: 211 PTPTPPS----YKPQPKPNPPPTYKPQPKPNPPPTYKPAPPTYKPQPKPNPPPTYKPQPK 266

Query: 148 P-----------PSGDGSYNPTPSTPPSSDCTPPS---QDSPPSDPTPTTPSTPTTPSGG 285
           P           P    +  PTP TP      PP+   Q  P   PTP  P    TP   
Sbjct: 267 PTPTPYTPPTYKPQPKPTPTPTPYTPTPKPNPPPTYKPQPKPTPTPTPYKPQPKPTP--- 323

Query: 286 YYNSPPQDSSPPT-DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
                    SP T  PTPT P+   TP+  Y+  PP  +  P  P
Sbjct: 324 ---------SPYTPKPTPTPPTYTPTPTPPYHKPPPSYTPGPPPP 359

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 45/138 (32%), Positives = 60/138 (43%), Gaps = 18/138 (13%)
 Frame = +1

Query: 67  GGSYDPTPSP--PSDSGGSPPGSYDPT----PSPPSGDGSYNPTPSTPPSSDCTPPSQDS 228
           GG Y PTP+P  P+     PP  + P     P P      + P   TPP    TPP+  +
Sbjct: 28  GGGYTPTPTPVKPAPKPEKPPKEHKPPHHHEPKPEKPPKEHKPPAYTPPKPTPTPPTY-T 86

Query: 229 PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS-------TPT----TPSGGY 375
           P   PTP  P TP      +  +PP  +  PT P PT P+       TP     TP+   
Sbjct: 87  PTPKPTPP-PYTPKPTPPAHTPTPPTYTPTPTPPKPTPPTYKPQPKPTPAPYTPTPTPPT 145

Query: 376 YNSPPQDSSPPS-DPLPR 426
           Y   P+ + PP+  P P+
Sbjct: 146 YKPQPKPTPPPTYKPQPK 163

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 40/116 (34%), Positives = 54/116 (46%), Gaps = 7/116 (6%)
 Frame = +1

Query: 100 SDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTP----PSQDSPPSDPTPT--TPS 261
           +D+GG   G Y PTP+P        P P  PP     P    P  + PP +  P   TP 
Sbjct: 22  ADAGGYG-GGYTPTPTPVKPA----PKPEKPPKEHKPPHHHEPKPEKPPKEHKPPAYTPP 76

Query: 262 TPTTPSGGYYNSPPQDSSPPTDPTPTTPS-TPTTPSGGYYNSPPQDSSPPSDPLPR 426
            P TP+   Y   P+ + PP  P PT P+ TPT P+     +PP+ + P   P P+
Sbjct: 77  KP-TPTPPTYTPTPKPTPPPYTPKPTPPAHTPTPPTYTPTPTPPKPTPPTYKPQPK 131

[68][TOP]
>UniRef100_Q0JDA0 Os04g0418800 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q0JDA0_ORYSJ
          Length = 315

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 62/168 (36%), Positives = 77/168 (45%), Gaps = 27/168 (16%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS--------- 156
           PTPTPP    +Y PTP   P    Y P P+PP+ +    P +Y PTP+PP          
Sbjct: 78  PTPTPP----TYTPTPKPTP--PPYTPKPTPPAHT--PTPPTYTPTPTPPKPTPPTYKPQ 129

Query: 157 ---GDGSYNPTPSTP---PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP 318
                  Y PTP+ P   P    TPP    P   PTP TP TP TP+   Y   P+ +  
Sbjct: 130 PKPTPAPYTPTPTPPTYKPQPKPTPPPTYKPQPKPTP-TPYTP-TPTPPSYKPQPKPTPT 187

Query: 319 PTDPTPTTPS-------TPT----TPSGGYYNSPPQDSSPPS-DPLPR 426
           P  PTPT PS       TPT    TP+   Y   P+ + PP+  P P+
Sbjct: 188 PYTPTPTPPSYKPQPKPTPTPYTPTPTPPSYKPQPKPNPPPTYKPQPK 235

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 61/170 (35%), Positives = 77/170 (45%), Gaps = 29/170 (17%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTP------SSPPGGGSYDPTPSPPS--DSGGSPPGSYDPTPSPPSG 159
           PTPTPP+      PTP         P    Y PTP+PPS        P  Y PTP+PPS 
Sbjct: 139 PTPTPPTYKPQPKPTPPPTYKPQPKPTPTPYTPTPTPPSYKPQPKPTPTPYTPTPTPPSY 198

Query: 160 DGSYNPTPSTPPSSDCTPPS-QDSPPSDPTPT-----TPSTPTT--PSGGYYNSPPQDSS 315
                PTP TP +   TPPS +  P  +P PT      P+ P T  P+   Y   P+ + 
Sbjct: 199 KPQPKPTP-TPYTPTPTPPSYKPQPKPNPPPTYKPQPKPNPPPTYKPAPPTYKPQPKPNP 257

Query: 316 PPT-----DPTPTTPSTPT-------TPSGGYYNSPPQDSSPPS-DPLPR 426
           PPT      PTPT  + PT       TP+   Y   P+ + PP+  P P+
Sbjct: 258 PPTYKPQPKPTPTPYTPPTYKPQPKPTPTPTPYTPTPKPNPPPTYKPQPK 307

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 55/143 (38%), Positives = 66/143 (46%), Gaps = 7/143 (4%)
 Frame = +1

Query: 4   PTPTPPSGDG-SYNPTPSSPPGGGSYDPTPSPPS---DSGGSPPGSYDPTPSPPSGDGSY 171
           PTPTPP     +Y P P   P    Y PTP+PP+       +PP +Y P P P       
Sbjct: 114 PTPTPPKPTPPTYKPQPKPTPA--PYTPTPTPPTYKPQPKPTPPPTYKPQPKP------- 164

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            PTP TP     TPPS   P   PTP TP TP TP+   Y   P+ +  P  PTPT PS 
Sbjct: 165 TPTPYTPTP---TPPSY-KPQPKPTP-TPYTP-TPTPPSYKPQPKPTPTPYTPTPTPPSY 218

Query: 352 PTTPSGG---YYNSPPQDSSPPS 411
              P       Y   P+ + PP+
Sbjct: 219 KPQPKPNPPPTYKPQPKPNPPPT 241

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 50/130 (38%), Positives = 59/130 (45%), Gaps = 16/130 (12%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPS---DSGGSPPGSYDPTPSPPSGDGSYN 174
           PTPTPPS    Y P P   P    Y PTP+PPS       +PP +Y P P P +   +Y 
Sbjct: 191 PTPTPPS----YKPQPKPTPT--PYTPTPTPPSYKPQPKPNPPPTYKPQPKP-NPPPTYK 243

Query: 175 PTPST-PPSSDCTPPSQDSPPSDPTPTTPSTPT-------TPSGGYYNSPPQDSSPPT-- 324
           P P T  P     PP    P   PTPT  + PT       TP+   Y   P+ + PPT  
Sbjct: 244 PAPPTYKPQPKPNPPPTYKPQPKPTPTPYTPPTYKPQPKPTPTPTPYTPTPKPNPPPTYK 303

Query: 325 ---DPTPTTP 345
               PTPT P
Sbjct: 304 PQPKPTPTPP 313

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 55/151 (36%), Positives = 70/151 (46%), Gaps = 13/151 (8%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPP--SDSGGSPPGSYDPTPSPPS---GDGSYN 174
           P P      + P   +PP      PTP+PP  + +    P  Y P P+PP+      +Y 
Sbjct: 59  PKPEKPPKEHKPPAYTPP-----KPTPTPPTYTPTPKPTPPPYTPKPTPPAHTPTPPTYT 113

Query: 175 PTPSTPPSSDCTPPS-QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT-------DP 330
           PTP TPP    TPP+ +  P   P P TP TPT P+   Y   P+ + PPT        P
Sbjct: 114 PTP-TPPKP--TPPTYKPQPKPTPAPYTP-TPTPPT---YKPQPKPTPPPTYKPQPKPTP 166

Query: 331 TPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           TP TP TPT PS   Y   P+ +  P  P P
Sbjct: 167 TPYTP-TPTPPS---YKPQPKPTPTPYTPTP 193

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 45/138 (32%), Positives = 60/138 (43%), Gaps = 18/138 (13%)
 Frame = +1

Query: 67  GGSYDPTPSP--PSDSGGSPPGSYDPT----PSPPSGDGSYNPTPSTPPSSDCTPPSQDS 228
           GG Y PTP+P  P+     PP  + P     P P      + P   TPP    TPP+  +
Sbjct: 28  GGGYTPTPTPVKPAPKPEKPPKEHKPPHHHEPKPEKPPKEHKPPAYTPPKPTPTPPTY-T 86

Query: 229 PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS-------TPT----TPSGGY 375
           P   PTP  P TP      +  +PP  +  PT P PT P+       TP     TP+   
Sbjct: 87  PTPKPTPP-PYTPKPTPPAHTPTPPTYTPTPTPPKPTPPTYKPQPKPTPAPYTPTPTPPT 145

Query: 376 YNSPPQDSSPPS-DPLPR 426
           Y   P+ + PP+  P P+
Sbjct: 146 YKPQPKPTPPPTYKPQPK 163

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 40/116 (34%), Positives = 54/116 (46%), Gaps = 7/116 (6%)
 Frame = +1

Query: 100 SDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTP----PSQDSPPSDPTPT--TPS 261
           +D+GG   G Y PTP+P        P P  PP     P    P  + PP +  P   TP 
Sbjct: 22  ADAGGYG-GGYTPTPTPVKPA----PKPEKPPKEHKPPHHHEPKPEKPPKEHKPPAYTPP 76

Query: 262 TPTTPSGGYYNSPPQDSSPPTDPTPTTPS-TPTTPSGGYYNSPPQDSSPPSDPLPR 426
            P TP+   Y   P+ + PP  P PT P+ TPT P+     +PP+ + P   P P+
Sbjct: 77  KP-TPTPPTYTPTPKPTPPPYTPKPTPPAHTPTPPTYTPTPTPPKPTPPTYKPQPK 131

[69][TOP]
>UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO
          Length = 2618

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 49/138 (35%), Positives = 55/138 (39%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PP       P P  PP      P+PSPP      PP    P P PP+        P
Sbjct: 2053 PPPPPPPAPLPPPPPPLPPPA-----PSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAP 2107

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
              PP S   PP    PP  P P  PS P  P      SPP    PP  P P+ P+ P  P
Sbjct: 2108 WPPPPSPSPPPPSPPPPPSPPPPPPSPPPAPLPPPPPSPPPSPPPPPSPPPSPPAPPPHP 2167

Query: 364  SGGYYNSPPQDSSPPSDP 417
                   PP+  +PPS P
Sbjct: 2168 -------PPEPPAPPSFP 2178

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 55/145 (37%), Positives = 61/145 (42%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PPS      P P SPP      P P PP      PP    P+PSPP     + P P
Sbjct: 2039 PSPPPPS------PPPLSPPPPPPPPPAPLPPPPPPLPPPA---PSPSPPPPPPPWPPPP 2089

Query: 184  STPPSSDCTPPSQDS-----PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
            S PP     PP   +     PP  P+P  PS P  PS      PP  S PP    P  PS
Sbjct: 2090 SPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSP----PPPPPSPPPAPLPPPPPS 2145

Query: 349  TPTTPSGGYYNSPPQDSSPPSDPLP 423
             P +P       PP  S PPS P P
Sbjct: 2146 PPPSP-------PPPPSPPPSPPAP 2163

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 50/140 (35%), Positives = 57/140 (40%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P+PP       P PS PP      P+P PPS    SPP    P P+P        P P
Sbjct: 2025 PPPSPP-------PLPSPPPL-----PSPPPPSPPPLSPPPPPPPPPAPLPPPPPPLPPP 2072

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            +  PS    PP    PPS P P  P+ P   +   +  PP  S PP  P P     P  P
Sbjct: 2073 APSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSPPPPPP 2132

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
            S      PP   SPP  P P
Sbjct: 2133 SPPPAPLPPPPPSPPPSPPP 2152

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 47/134 (35%), Positives = 61/134 (45%), Gaps = 1/134 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP-PGSYDPTPSPPSGDGSYNPT 180
            P+P+PP     + P PS PP      P P+PP  +  +P P    P+P PPS      P 
Sbjct: 2074 PSPSPPPPPPPWPPPPSPPP-----PPPPAPPPGAAQAPWPPPPSPSPPPPS-----PPP 2123

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            P +PP    +PP    PP  P+P  PS P  PS      PP   +PP  P P  P+ P+ 
Sbjct: 2124 PPSPPPPPPSPPPAPLPPPPPSP-PPSPPPPPS-----PPPSPPAPPPHPPPEPPAPPSF 2177

Query: 361  PSGGYYNSPPQDSS 402
            P    +   P D S
Sbjct: 2178 PPQFDFGDEPDDQS 2191

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 47/137 (34%), Positives = 56/137 (40%), Gaps = 4/137 (2%)
 Frame = +1

Query: 25   GDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSD 204
            GD +Y    ++ P    Y   P PP +    PP S  P PSPP       P PS PP S 
Sbjct: 1999 GDLTYADVNAAAPK--QYADAPRPPPNH---PPPSPPPLPSPP-------PLPSPPPPSP 2046

Query: 205  ---CTPPSQDSPPSD-PTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGG 372
                 PP    PP+  P P  P  P  PS      PP    PP+ P P  P+ P   +  
Sbjct: 2047 PPLSPPPPPPPPPAPLPPPPPPLPPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQA 2106

Query: 373  YYNSPPQDSSPPSDPLP 423
             +  PP  S PP  P P
Sbjct: 2107 PWPPPPSPSPPPPSPPP 2123

[70][TOP]
>UniRef100_Q18751 Putative uncharacterized protein C50F7.5 n=1 Tax=Caenorhabditis
           elegans RepID=Q18751_CAEEL
          Length = 309

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 59/168 (35%), Positives = 76/168 (45%), Gaps = 31/168 (18%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPT----PSSPPGGGSYDPTPSP-----PSD----SGGSPPGSYDPT 141
           +P+P+ P   G  NP+    PS PP  G  DP+  P     PS+    SG   PG  DP+
Sbjct: 98  EPSPSGPPSPGPVNPSEDPQPSGPPSPGPVDPSEDPQPSVEPSEDHQPSGPPSPGPVDPS 157

Query: 142 PSP-PSGDGSYNPTPSTPPSSDCTPPSQDSPP---SDPTPTTPSTPTTPSGGYYNSP--- 300
             P PS + S +P PS PPS     PS+D  P   S P P  PS   +PSG     P   
Sbjct: 158 EDPQPSVEPSEDPQPSGPPSPGPVDPSEDPQPSGSSSPGPVDPSDEPSPSGPPSPGPVDP 217

Query: 301 ---PQDSSPPT--------DPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
              P+ S PP+        +P+P+ P  P  P G     PP    PP+
Sbjct: 218 SEDPKPSEPPSPGPVDPSDEPSPSDPPGPPGPPGPPTRRPPGPPGPPT 265

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 57/158 (36%), Positives = 68/158 (43%), Gaps = 21/158 (13%)
 Frame = +1

Query: 1   DPTPTP-PSGDGSYNPTPSSPPGGGSYDPTPSP---------PSDSGGSPPGSYDPTPSP 150
           DP+  P PS + S +  PS PP  G  DP+  P         P  SG   PG  DP+  P
Sbjct: 128 DPSEDPQPSVEPSEDHQPSGPPSPGPVDPSEDPQPSVEPSEDPQPSGPPSPGPVDPSEDP 187

Query: 151 -PSG-------DGSYNPTPSTPPSSDCTPPSQDSPPSDPT---PTTPSTPTTPSGGYYNS 297
            PSG       D S  P+PS PPS     PS+D  PS+P    P  PS   +PS      
Sbjct: 188 QPSGSSSPGPVDPSDEPSPSGPPSPGPVDPSEDPKPSEPPSPGPVDPSDEPSPS-----D 242

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           PP    PP  PT   P  P  P+      PP    PP+
Sbjct: 243 PPGPPGPPGPPTRRPPGPPGPPT----RRPPGPPGPPT 276

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 52/142 (36%), Positives = 68/142 (47%), Gaps = 8/142 (5%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNPTPS 186
           P+P +   S  P+PS PP  G  +P+   P  SG   PG  DP+  P PS + S +  PS
Sbjct: 88  PSPGTVAPSDEPSPSGPPSPGPVNPS-EDPQPSGPPSPGPVDPSEDPQPSVEPSEDHQPS 146

Query: 187 TPPSSDCTPPSQDSPPS-----DPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPT-PTTP 345
            PPS     PS+D  PS     DP P+ P +P          P   SSP P DP+   +P
Sbjct: 147 GPPSPGPVDPSEDPQPSVEPSEDPQPSGPPSPGPVDPSEDPQPSGSSSPGPVDPSDEPSP 206

Query: 346 STPTTPSGGYYNSPPQDSSPPS 411
           S P +P     +  P+ S PPS
Sbjct: 207 SGPPSPGPVDPSEDPKPSEPPS 228

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 53/138 (38%), Positives = 62/138 (44%), Gaps = 13/138 (9%)
 Frame = +1

Query: 1   DPTPTP-PSGDGSYNPTPSSPPGGGSYDPTPSPPSD----SGGSPPGSYDPT-------- 141
           DP+  P PS + S +P PS PP      P P  PS+    SG S PG  DP+        
Sbjct: 155 DPSEDPQPSVEPSEDPQPSGPPS-----PGPVDPSEDPQPSGSSSPGPVDPSDEPSPSGP 209

Query: 142 PSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP 321
           PSP   D S +P PS PPS     PS +  PSDP P  P  P  P+      PP    PP
Sbjct: 210 PSPGPVDPSEDPKPSEPPSPGPVDPSDEPSPSDP-PGPPGPPGPPT----RRPPGPPGPP 264

Query: 322 TDPTPTTPSTPTTPSGGY 375
           T   P  P  PT    G+
Sbjct: 265 TRRPPGPPGPPTRRPPGH 282

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 49/131 (37%), Positives = 58/131 (44%), Gaps = 6/131 (4%)
 Frame = +1

Query: 43  PTPSSPPGGGSYDPTPSPPSDSGGSPPG----SYDPTPSPPSGDGSYNPTPSTPPSSDCT 210
           P PS+ P  G+  P+  P S SG   PG    S DP PS P   G  +P+    PS + +
Sbjct: 82  PQPSNEPSPGTVAPSDEP-SPSGPPSPGPVNPSEDPQPSGPPSPGPVDPSEDPQPSVEPS 140

Query: 211 PPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSP- 387
              Q S P  P P  PS    PS    +  PQ S PP+ P P  PS    PSG     P 
Sbjct: 141 EDHQPSGPPSPGPVDPSEDPQPS-VEPSEDPQPSGPPS-PGPVDPSEDPQPSGSSSPGPV 198

Query: 388 -PQDSSPPSDP 417
            P D   PS P
Sbjct: 199 DPSDEPSPSGP 209

[71][TOP]
>UniRef100_B3M929 GF25073 n=1 Tax=Drosophila ananassae RepID=B3M929_DROAN
          Length = 403

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/157 (33%), Positives = 65/157 (41%), Gaps = 22/157 (14%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS----PPSGDG---- 165
           P PP+   SY P PS PP      P+P PP     SPP    PTP     PP G+     
Sbjct: 217 PAPPAPTPSYGPPPSQPPPPRPQPPSPQPPRPQPPSPPAPR-PTPGNEYLPPPGENEVTP 275

Query: 166 ----------SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDS 312
                     SY P PS+PP+    P  Q  PP+ P P  P+  P  P+     +P    
Sbjct: 276 ALPQPTAPAPSYGPPPSSPPAPPPGPTYQPRPPTPPAPPAPTYQPRPPTPPAPPAPTYQP 335

Query: 313 SPPTDPTPT---TPSTPTTPSGGYYNSPPQDSSPPSD 414
            PP  P PT    P  PT P+  Y   PP   +P  +
Sbjct: 336 RPPAPPAPTYQPLPPAPTPPAPTYQPRPPAPPAPTQE 372

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/158 (34%), Positives = 63/158 (39%), Gaps = 18/158 (11%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPT---------PSPPS 156
           P PTPPSG       P   P      PTPS P      PP    PT         P+PP+
Sbjct: 165 PQPTPPSGQPGQEYLPPDQPRPR---PTPSRPQPPPPPPPSRPQPTPGYGPPPAPPAPPA 221

Query: 157 GDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
              SY P PS PP     PPS   PP    P+ P+   TP   Y   P ++   P  P P
Sbjct: 222 PTPSYGPPPSQPPPPRPQPPS-PQPPRPQPPSPPAPRPTPGNEYLPPPGENEVTPALPQP 280

Query: 337 TTP---------STPTTPSGGYYNSPPQDSSPPSDPLP 423
           T P         S P  P G  Y   P+  +PP+ P P
Sbjct: 281 TAPAPSYGPPPSSPPAPPPGPTYQ--PRPPTPPAPPAP 316

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 50/149 (33%), Positives = 64/149 (42%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP----PGSYDPTPSP-PSGDGS 168
           P PTP        P PS P     Y P P+PP+    +P    P S  P P P P     
Sbjct: 186 PRPTPSRPQPPPPPPPSRPQPTPGYGPPPAPPAPPAPTPSYGPPPSQPPPPRPQPPSPQP 245

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPTDPT--P 336
             P P +PP+   TP ++  PP      TP+   PT P+  Y   P    +PP  PT  P
Sbjct: 246 PRPQPPSPPAPRPTPGNEYLPPPGENEVTPALPQPTAPAPSYGPPPSSPPAPPPGPTYQP 305

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             P+ P  P+  Y   PP   +PP+ P P
Sbjct: 306 RPPTPPAPPAPTYQPRPP---TPPAPPAP 331

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 53/150 (35%), Positives = 62/150 (41%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP---PGSYDPTPSPPSGDGSYN 174
           P PTPP+   SY P  + PP      P P+PP+ S G P   P    P P+PP+   SY 
Sbjct: 81  PQPTPPAP--SYGPPQTQPP---RPPPQPTPPAPSYGPPQTQPPRPQPQPTPPA--PSYG 133

Query: 175 P---TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTD----PT 333
           P    P  PP     P     PP    P  P  PT PSG     P Q+  PP      PT
Sbjct: 134 PPQTLPPRPPPQPTPPAPSYGPPQTSPPRPPPQPTPPSG----QPGQEYLPPDQPRPRPT 189

Query: 334 PTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P+ P  P  P        P    PP+ P P
Sbjct: 190 PSRPQPPPPPPPSRPQPTPGYGPPPAPPAP 219

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 58/168 (34%), Positives = 71/168 (42%), Gaps = 27/168 (16%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP---PGSYDPTPSPPSGDGSYN 174
           P PTPP+   SY P  + PP      P P+PP+ S G P   P    P P+PP+   SY 
Sbjct: 102 PQPTPPAP--SYGPPQTQPP---RPQPQPTPPAPSYGPPQTLPPRPPPQPTPPA--PSYG 154

Query: 175 PTPSTPPSSDCTPPSQDSPPSD---------------PTPTTPSTPTTPSGGY------Y 291
           P  ++PP     PP Q +PPS                PTP+ P  P  P          Y
Sbjct: 155 PPQTSPP----RPPPQPTPPSGQPGQEYLPPDQPRPRPTPSRPQPPPPPPPSRPQPTPGY 210

Query: 292 NSPPQDSSPPTDPTPT---TPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
             PP   +PP  PTP+    PS P  P     +  P    PPS P PR
Sbjct: 211 GPPPAPPAPPA-PTPSYGPPPSQPPPPRPQPPSPQPPRPQPPSPPAPR 257

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 52/145 (35%), Positives = 62/145 (42%), Gaps = 6/145 (4%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP---PGSYDPTPSPPSGDGSYNPT 180
           P P +   SY P  + PP      P P+PP+ S G P   P    P P+PP+   SY P 
Sbjct: 60  PAPSAPAPSYGPPQTQPP---RPPPQPTPPAPSYGPPQTQPPRPPPQPTPPA--PSYGPP 114

Query: 181 PSTP--PSSDCTPPSQD-SPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            + P  P    TPP+    PP    P  P  PT P+  Y   PPQ S P   P PT PS 
Sbjct: 115 QTQPPRPQPQPTPPAPSYGPPQTLPPRPPPQPTPPAPSY--GPPQTSPPRPPPQPTPPS- 171

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLPR 426
                      P Q+  PP  P PR
Sbjct: 172 ---------GQPGQEYLPPDQPRPR 187

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 50/135 (37%), Positives = 59/135 (43%), Gaps = 12/135 (8%)
 Frame = +1

Query: 4   PTP----TPPSGDGSYNPTPSSPPGGG-SYDPTPS-PPSDSGGSPPG-SYDP-TPSPPSG 159
           PTP     PP G+    P    P     SY P PS PP+     PPG +Y P  P+PP+ 
Sbjct: 258 PTPGNEYLPPPGENEVTPALPQPTAPAPSYGPPPSSPPA----PPPGPTYQPRPPTPPAP 313

Query: 160 DG-SYNPTPSTPPSSDCTPPSQDSPPSDPTPT---TPSTPTTPSGGYYNSPPQDSSPPTD 327
              +Y P P TPP+    P  Q  PP+ P PT    P  PT P      +P     PP  
Sbjct: 314 PAPTYQPRPPTPPAPP-APTYQPRPPAPPAPTYQPLPPAPTPP------APTYQPRPPAP 366

Query: 328 PTPTTPSTPTTPSGG 372
           P PT    P   SGG
Sbjct: 367 PAPTQEYGPPPTSGG 381

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 50/151 (33%), Positives = 54/151 (35%), Gaps = 13/151 (8%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP G G  N    S  G G   P PS P+ S G PP +  P P P        PTP  
Sbjct: 41  PFPPPGSG--NGIEDSGIGSG---PAPSAPAPSYG-PPQTQPPRPPP-------QPTPPA 87

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS------- 348
           P            PP    P  P  PT P+  Y     Q   P   PTP  PS       
Sbjct: 88  PSYG---------PPQTQPPRPPPQPTPPAPSYGPPQTQPPRPQPQPTPPAPSYGPPQTL 138

Query: 349 ------TPTTPSGGYYNSPPQDSSPPSDPLP 423
                  PT P+  Y   PPQ S P   P P
Sbjct: 139 PPRPPPQPTPPAPSY--GPPQTSPPRPPPQP 167

[72][TOP]
>UniRef100_Q10I10 Os03g0568800 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q10I10_ORYSJ
          Length = 675

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 51/144 (35%), Positives = 64/144 (44%), Gaps = 3/144 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP+      P P  PP      P  SP  +   + P    P P       S  P P
Sbjct: 37  PPPPPPTPSSPQRPPPPPPPATPPPPPPASPGKNQSPASPSQDSPPPVASPSVSSPPPAP 96

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQD-SSPPTDPT--PTTPSTP 354
           +TPPS    PPS+  PP  P PTT STP +     + SPP++ +SPP  P+   TTPS P
Sbjct: 97  TTPPSPP--PPSKSPPPPSPPPTTSSTPPS-----HQSPPEEGTSPPPSPSSGATTPSPP 149

Query: 355 TTPSGGYYNSPPQDSSPPSDPLPR 426
                   +S P   +  S P PR
Sbjct: 150 PNAQSSSSSSTPPAGAGTSPPAPR 173

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 53/137 (38%), Positives = 68/137 (49%), Gaps = 1/137 (0%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP    S +P+PS PP      PTPS P      PP +  P P PP+  G  N +P++
Sbjct: 22  PEPPPQSSSASPSPSPPPP----PPTPSSPQRPPPPPPPA-TPPPPPPASPGK-NQSPAS 75

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           P        SQDSPP   +P+  S P  P+      PP  S PP  P PTT STP +   
Sbjct: 76  P--------SQDSPPPVASPSVSSPPPAPTTPPSPPPPSKSPPPPSPPPTTSSTPPS--- 124

Query: 370 GYYNSPPQD-SSPPSDP 417
             + SPP++ +SPP  P
Sbjct: 125 --HQSPPEEGTSPPPSP 139

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 57/148 (38%), Positives = 67/148 (45%), Gaps = 8/148 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP+  G  N +P+SP    S D  P   S S  SPP +    PSPP    S  P P
Sbjct: 59  PPPPPPASPGK-NQSPASP----SQDSPPPVASPSVSSPPPAPTTPPSPPPPSKS-PPPP 112

Query: 184 STPPSSDCTPPSQDSPPSD---PTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           S PP++  TPPS  SPP +   P P+  S  TTPS          SS P     T+P  P
Sbjct: 113 SPPPTTSSTPPSHQSPPEEGTSPPPSPSSGATTPSPPPNAQSSSSSSTPPAGAGTSPPAP 172

Query: 355 TT-PSGGYYNSPP----QDSSPPSDPLP 423
              PS G   SPP       +PP  P P
Sbjct: 173 REMPSPGTPPSPPTTLITTQAPPIQPPP 200

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 42/138 (30%), Positives = 61/138 (44%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           + T T P+G       P  PP   S  P+PSPP      PP    P   PP       P 
Sbjct: 11  EDTATAPAGG-----PPEPPPQSSSASPSPSPPPP----PPTPSSPQRPPPP------PP 55

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           P+TPP      P ++  P+ P+  +P    +PS    + PP  ++PP+ P P+    P +
Sbjct: 56  PATPPPPPPASPGKNQSPASPSQDSPPPVASPSVS--SPPPAPTTPPSPPPPSKSPPPPS 113

Query: 361 PSGGYYNSPPQDSSPPSD 414
           P     ++PP   SPP +
Sbjct: 114 PPPTTSSTPPSHQSPPEE 131

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 41/109 (37%), Positives = 48/109 (44%), Gaps = 2/109 (1%)
 Frame = +1

Query: 103 DSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSG 282
           D+  +P G     P PP    S +P+PS PP    TP S   PP  P P TP  P   S 
Sbjct: 12  DTATAPAGG---PPEPPPQSSSASPSPSPPPPPP-TPSSPQRPPPPPPPATPPPPPPASP 67

Query: 283 GYYNSP--PQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           G   SP  P   SPP   +P+  S P  P+      PP  S PP  P P
Sbjct: 68  GKNQSPASPSQDSPPPVASPSVSSPPPAPTTPPSPPPPSKSPPPPSPPP 116

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 50/139 (35%), Positives = 61/139 (43%), Gaps = 13/139 (9%)
 Frame = +1

Query: 46  TPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP---SPPSGDGSYNPTPSTPP-----SS 201
           TP SPP      P PSPP  +  +PP    P     SPP    S   TPS PP     SS
Sbjct: 98  TPPSPPPPSKSPPPPSPPPTTSSTPPSHQSPPEEGTSPPPSPSSGATTPSPPPNAQSSSS 157

Query: 202 DCTPPSQ--DSPPSD---PTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPS 366
             TPP+    SPP+    P+P TP +P T        P Q   PP   +   PS+ TT  
Sbjct: 158 SSTPPAGAGTSPPAPREMPSPGTPPSPPTTLITTQAPPIQPPPPPGGNSMIMPSSLTT-- 215

Query: 367 GGYYNSPPQDSSPPSDPLP 423
            G   SPP  ++  + P P
Sbjct: 216 AGTSQSPPDATTAGAPPPP 234

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 51/148 (34%), Positives = 62/148 (41%), Gaps = 14/148 (9%)
 Frame = +1

Query: 7   TPTPPSGDGS---YNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           +P  PS D      +P+ SSPP   +  P+P PPS S         P PSPP        
Sbjct: 72  SPASPSQDSPPPVASPSVSSPPPAPTTPPSPPPPSKS--------PPPPSPPP------T 117

Query: 178 TPSTPPSSDCTPPSQDSPPSDPT--PTTPSTP---------TTPSGGYYNSPPQDSSPPT 324
           T STPPS    P    SPP  P+   TTPS P         +TP  G   SPP     P+
Sbjct: 118 TSSTPPSHQSPPEEGTSPPPSPSSGATTPSPPPNAQSSSSSSTPPAGAGTSPPAPREMPS 177

Query: 325 DPTPTTPSTPTTPSGGYYNSPPQDSSPP 408
             TP +P T    +     +PP    PP
Sbjct: 178 PGTPPSPPTTLITT----QAPPIQPPPP 201

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 33/110 (30%), Positives = 45/110 (40%), Gaps = 11/110 (10%)
 Frame = +1

Query: 127 SYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQ 306
           S + T + P+G       P  PP S    PS   PP  PTP++P  P  P        P 
Sbjct: 9   STEDTATAPAGG-----PPEPPPQSSSASPSPSPPPPPPTPSSPQRPPPP--------PP 55

Query: 307 DSSPPTDP-----------TPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            ++PP  P           +P+  S P   S    + PP  ++PPS P P
Sbjct: 56  PATPPPPPPASPGKNQSPASPSQDSPPPVASPSVSSPPPAPTTPPSPPPP 105

[73][TOP]
>UniRef100_B9HIU4 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9HIU4_POPTR
          Length = 685

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 58/145 (40%), Positives = 72/145 (49%), Gaps = 16/145 (11%)
 Frame = +1

Query: 40  NPTPSSPPGGGS--YDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP----TPSTPPSS 201
           +P+P+SPP   S   + TP PPS +  SPP S  P P+ PS   + NP     PSTPP  
Sbjct: 1   SPSPNSPPLAVSSPSNSTPPPPSTTSSSPPASSPPPPTSPSSQPNANPPNPRNPSTPP-- 58

Query: 202 DCTPPSQDSPP--SDPTPTTPSTP---TTPSGGYYNSPPQDSSPP---TDPTPTTPSTPT 357
              PP Q +PP  S+P P TP TP   T+ S     S P  +SPP     P  ++P  P 
Sbjct: 59  ---PPPQPAPPALSNPPPATPLTPPPTTSQSPPLSGSAPNSNSPPPPSATPPVSSPPPPP 115

Query: 358 TPSGG--YYNSPPQDSSPPSDPLPR 426
            PS      + PP  SSPP  P  R
Sbjct: 116 PPSSNPPSISPPPPLSSPPPPPSSR 140

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 55/148 (37%), Positives = 68/148 (45%), Gaps = 9/148 (6%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPG----SYDPTPSPPSGDGSYN 174
           TP PPS   S +P  SSPP      P  SP S    +PP     S  P P  P+     N
Sbjct: 18  TPPPPSTTSS-SPPASSPP------PPTSPSSQPNANPPNPRNPSTPPPPPQPAPPALSN 70

Query: 175 PTPST----PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT-DPTPT 339
           P P+T    PP++  +PP   S P+  +P  PS  T P       PP  S+PP+  P P 
Sbjct: 71  PPPATPLTPPPTTSQSPPLSGSAPNSNSPPPPSA-TPPVSSPPPPPPPSSNPPSISPPPP 129

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             S P  PS    + PPQ+S PP  P P
Sbjct: 130 LSSPPPPPS----SRPPQNSPPPPPPTP 153

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 61/157 (38%), Positives = 72/157 (45%), Gaps = 17/157 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNP----TPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP----SPP-- 153
           P PT PS   + NP     PS+PP      P P+PP+ S   P     P P    SPP  
Sbjct: 35  PPPTSPSSQPNANPPNPRNPSTPPP----PPQPAPPALSNPPPATPLTPPPTTSQSPPLS 90

Query: 154 -SGDGSYNPTP--STPPSSDCTPPSQDS--PPS-DPTPTTPSTPTTPSGGYYNSPPQDSS 315
            S   S +P P  +TPP S   PP   S  PPS  P P   S P  PS    + PPQ+S 
Sbjct: 91  GSAPNSNSPPPPSATPPVSSPPPPPPPSSNPPSISPPPPLSSPPPPPS----SRPPQNSP 146

Query: 316 PPTDPTPTT-PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PP  PTP+  P+ P  P      SPP+ S PP    P
Sbjct: 147 PPPPPTPSQLPTNPPPPPASV--SPPRRSHPPPASTP 181

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 54/155 (34%), Positives = 62/155 (40%), Gaps = 15/155 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTP--------SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSG 159
           P P PP+       TP         SPP  GS   + SPP  S   P  S  P P P S 
Sbjct: 61  PQPAPPALSNPPPATPLTPPPTTSQSPPLSGSAPNSNSPPPPSATPPVSSPPPPPPPSSN 120

Query: 160 DGSYNPTP---STPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTD 327
             S +P P   S PP     PP    PP  PTP+  P+ P  P      SPP+ S PP  
Sbjct: 121 PPSISPPPPLSSPPPPPSSRPPQNSPPPPPPTPSQLPTNPPPPPASV--SPPRRSHPPPA 178

Query: 328 PTPTTPSTPTTPSGGYYNS---PPQDSSPPSDPLP 423
            TP   S P   S     S   PP   +PP+   P
Sbjct: 179 STPPENSPPPPASIAPLPSNVPPPPMLTPPTATAP 213

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/138 (34%), Positives = 57/138 (41%), Gaps = 4/138 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDP--TPSPPSGDGSYNP 177
           P+ TPP      +P P  PP       +P PP  S   PP S  P  +P PP    S  P
Sbjct: 102 PSATPPVS----SPPPPPPPSSNPPSISPPPPLSSPPPPPSSRPPQNSPPPPPPTPSQLP 157

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP--TDPTPTTPST 351
           T   PP +  +PP +  PP  P  T P     P       P     PP  T PT T P  
Sbjct: 158 TNPPPPPASVSPPRRSHPP--PASTPPENSPPPPASIAPLPSNVPPPPMLTPPTATAPLP 215

Query: 352 PTTPSGGYYNSPPQDSSP 405
           P  PS   Y++PP  S P
Sbjct: 216 PPVPS---YSTPPALSPP 230

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 44/137 (32%), Positives = 55/137 (40%), Gaps = 1/137 (0%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PPS     N  P  PP        P PP  S   P  S+ P  S P       P  S 
Sbjct: 134 PPPPSSRPPQNSPPPPPPTPSQLPTNPPPPPASVSPPRRSHPPPASTP-------PENSP 186

Query: 190 PPSSDCTP-PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPS 366
           PP +   P PS   PP   TP T + P  P    Y++PP  S P    +P  PS  + PS
Sbjct: 187 PPPASIAPLPSNVPPPPMLTPPTATAPLPPPVPSYSTPPALSPPTIRLSPPPPSLVSPPS 246

Query: 367 GGYYNSPPQDSSPPSDP 417
                  P +++ P+ P
Sbjct: 247 -------PTNNTAPNSP 256

[74][TOP]
>UniRef100_A4S1Y9 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901
           RepID=A4S1Y9_OSTLU
          Length = 1065

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 60/140 (42%), Positives = 65/140 (46%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           PTPTP        PTPS PP      P PSPP     SPP S  P PSPP      +P P
Sbjct: 471 PTPTP-------TPTPSPPP-----SPPPSPPPSPPPSPPPS--PPPSPPP-----SPPP 511

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PPS    PPS  SPP  P P+ P +P          PP  S PP+ P    PS P +P
Sbjct: 512 SPPPS---PPPSPPSPPPSPPPSPPPSP----------PP--SPPPSPPPSPPPSPPPSP 556

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP  S PPS P P
Sbjct: 557 PPSPPPSPP-PSPPPSPPPP 575

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 45/115 (39%), Positives = 51/115 (44%), Gaps = 1/115 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P   PPS   S  P+P  SPP      P PSPP  S  SPP S  P+P P       +P 
Sbjct: 486 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP-SPPSPPPSPPPSPPP-------SPP 537

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
           PS PPS   +PP   SPP  P P+ P +P         SPP    PP    P  P
Sbjct: 538 PSPPPSPPPSPP--PSPPPSPPPSPPPSPPP-------SPPPSPPPPPHFAPFVP 583

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 33/83 (39%), Positives = 39/83 (46%), Gaps = 2/83 (2%)
 Frame = +1

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQD--SSPPTDPTPTTPS 348
           PTP+  P+     P+   PPS P    PS P +P      SPP     SPP  P P+ PS
Sbjct: 469 PTPTPTPT-----PTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPS 523

Query: 349 TPTTPSGGYYNSPPQDSSPPSDP 417
            P +P      SPP  S PPS P
Sbjct: 524 PPPSPPPSPPPSPP-PSPPPSPP 545

[75][TOP]
>UniRef100_UPI0000E1257F Os05g0516400 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000E1257F
          Length = 827

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 54/147 (36%), Positives = 63/147 (42%), Gaps = 10/147 (6%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG-------- 165
           P PP    +  P P  PP  G+ DP P PP      PP +  P PSPP+           
Sbjct: 5   PPPPPNASTPAPAPPLPPSLGAPDPPPPPPPVMPSRPPPAA-PPPSPPAASPPPPPAPPV 63

Query: 166 SYNPTPSTPPSSDCTP--PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
           +  PTPS PP     P  P +  PPS P P     P +PS      PP    PPT   P 
Sbjct: 64  APRPTPSPPPPPPVMPSKPVKPVPPSSPPPPPVMQPPSPSPPLIPPPP----PPTPVMPV 119

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDPL 420
            P TP+ PS    N PP   SPP  P+
Sbjct: 120 LPPTPSPPSP--VNPPPPSPSPPPSPV 144

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 59/162 (36%), Positives = 69/162 (42%), Gaps = 22/162 (13%)
 Frame = +1

Query: 4   PTPTPP-------SGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGS----YDPTPSP 150
           PTP+PP       S      P  S PP      P+PSPP      PP        PTPSP
Sbjct: 67  PTPSPPPPPPVMPSKPVKPVPPSSPPPPPVMQPPSPSPPLIPPPPPPTPVMPVLPPTPSP 126

Query: 151 PSGDGSYNPTPSTPPSS-DCTPP--SQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP 321
           PS      P+PS PPS  +  PP  S  SP S P+P  P  P T      N  P  +SPP
Sbjct: 127 PSPVNPPPPSPSPPPSPVNPLPPITSPPSPVSPPSPANPLPPATSPPSPANPLPPATSPP 186

Query: 322 TDPTPTTPST--------PTTPSGGYYNSPPQDSSPPSDPLP 423
           +   P  P+T        PT PS     +P   + PP  PLP
Sbjct: 187 SPANPLPPTTSPPSPAPPPTVPSQPPEAAPAPTTKPPPTPLP 228

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 59/155 (38%), Positives = 65/155 (41%), Gaps = 14/155 (9%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPP-------SG 159
           DP P PP    S  P  + PP   +  P P P      +PP +  PTPSPP       S 
Sbjct: 28  DPPPPPPPVMPSRPPPAAPPPSPPAASPPPPP------APPVAPRPTPSPPPPPPVMPSK 81

Query: 160 DGSYNPTPSTPPSSDCTPPSQD----SPPSDPTPTTPSTPTTPS-GGYYNSPPQDSSPPT 324
                P  S PP     PPS       PP  PTP  P  P TPS     N PP   SPP 
Sbjct: 82  PVKPVPPSSPPPPPVMQPPSPSPPLIPPPPPPTPVMPVLPPTPSPPSPVNPPPPSPSPP- 140

Query: 325 DPTPTTPSTPTTPSGGYYNSPPQDSSPPS--DPLP 423
            P+P  P  P T       SPP   SPPS  +PLP
Sbjct: 141 -PSPVNPLPPIT-------SPPSPVSPPSPANPLP 167

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 59/168 (35%), Positives = 79/168 (47%), Gaps = 27/168 (16%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGS------YDPTP-SPPSDSGGSPPGSYDPTPSPPSGD 162
           PTP+PPS      P+PS PP   +        P+P SPPS +   PP +  P+P+ P   
Sbjct: 122 PTPSPPSPVNPPPPSPSPPPSPVNPLPPITSPPSPVSPPSPANPLPPATSPPSPANPLPP 181

Query: 163 GSYNPTPSTP------PSSDCTPPSQDSPPSD--PTPTT--PSTPTTPSGGYYNSPPQDS 312
            +  P+P+ P      P S   PP+  S P +  P PTT  P TP  P+     SPP  S
Sbjct: 182 ATSPPSPANPLPPTTSPPSPAPPPTVPSQPPEAAPAPTTKPPPTPLPPA----RSPPAPS 237

Query: 313 SPPTDPTPT-TPS---------TPTTPSGGYYNSPPQDSSPPSDPLPR 426
               +P+P+ +PS         TP+ P GG   + P  S P S P PR
Sbjct: 238 PASREPSPSPSPSVAPPSLPIFTPSPPGGGRGAATP--SPPSSRPSPR 283

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/145 (33%), Positives = 61/145 (42%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P   PPS   +  P P +PP      P+P PP     S P    P  SPP       P+P
Sbjct: 43  PAAPPPSPPAASPPPPPAPPVAPRPTPSPPPPPPVMPSKPVKPVPPSSPPPPPVMQPPSP 102

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP----TTPST 351
           S P      PP+   P   PTP+ PS    P       PP  S PP+   P    T+P +
Sbjct: 103 SPPLIPPPPPPTPVMPVLPPTPSPPSPVNPP-------PPSPSPPPSPVNPLPPITSPPS 155

Query: 352 PTTPSGGYYNSPPQDSSP-PSDPLP 423
           P +P       PP  S P P++PLP
Sbjct: 156 PVSPPSPANPLPPATSPPSPANPLP 180

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 57/151 (37%), Positives = 68/151 (45%), Gaps = 13/151 (8%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGG---SYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P PP+   +  PTPS PP      S    P PPS S   PP    P+PSPP       PT
Sbjct: 56  PPPPAPPVAPRPTPSPPPPPPVMPSKPVKPVPPS-SPPPPPVMQPPSPSPPLIPPPPPPT 114

Query: 181 P--------STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           P         +PPS    PP   SPP  P+P  P  P T       SPP   SPP+   P
Sbjct: 115 PVMPVLPPTPSPPSPVNPPPPSPSPP--PSPVNPLPPIT-------SPPSPVSPPSPANP 165

Query: 337 TTPST-PTTPSGGYYNSPPQDSSP-PSDPLP 423
             P+T P +P+      PP  S P P++PLP
Sbjct: 166 LPPATSPPSPANPL---PPATSPPSPANPLP 193

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 54/163 (33%), Positives = 65/163 (39%), Gaps = 24/163 (14%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPT------------PS 147
           P+P+PP       PTP  P       PTPSPPS     PP    P             PS
Sbjct: 100 PSPSPPLIPPPPPPTPVMPV----LPPTPSPPSPVNPPPPSPSPPPSPVNPLPPITSPPS 155

Query: 148 PPSGDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPST--------PTTPSGGYYNS 297
           P S     NP P  ++PPS     P   SPPS   P  P+T        PT PS     +
Sbjct: 156 PVSPPSPANPLPPATSPPSPANPLPPATSPPSPANPLPPTTSPPSPAPPPTVPSQPPEAA 215

Query: 298 PPQDSSPPTDPTP--TTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
           P   + PP  P P   +P  P+  S     SP    +PPS P+
Sbjct: 216 PAPTTKPPPTPLPPARSPPAPSPASREPSPSPSPSVAPPSLPI 258

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 47/144 (32%), Positives = 61/144 (42%), Gaps = 9/144 (6%)
 Frame = +1

Query: 4   PTP-TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPP----SGDGS 168
           P+P +PPS      P  S P       P  SPPS +   PP +  P+P+PP    S    
Sbjct: 154 PSPVSPPSPANPLPPATSPPSPANPLPPATSPPSPANPLPPTTSPPSPAPPPTVPSQPPE 213

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTD----PTP 336
             P P+T P     PP++  P   P    PS   +PS    + P    SPP       TP
Sbjct: 214 AAPAPTTKPPPTPLPPARSPPAPSPASREPSPSPSPSVAPPSLPIFTPSPPGGGRGAATP 273

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPP 408
           + PS+  +P      SPP  SS P
Sbjct: 274 SPPSSRPSP-----RSPPPPSSAP 292

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 45/142 (31%), Positives = 57/142 (40%), Gaps = 1/142 (0%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           +P P   S     NP P          P  SPPS +   PP +  P+P+PP       PT
Sbjct: 164 NPLPPATSPPSPANPLP----------PATSPPSPANPLPPTTSPPSPAPP-------PT 206

Query: 181 -PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            PS PP +   P ++  P   P   +P  P+  S     SP    +PP+ P   TPS P 
Sbjct: 207 VPSQPPEAAPAPTTKPPPTPLPPARSPPAPSPASREPSPSPSPSVAPPSLPI-FTPSPPG 265

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
              G    SPP     P  P P
Sbjct: 266 GGRGAATPSPPSSRPSPRSPPP 287

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 37/114 (32%), Positives = 44/114 (38%), Gaps = 2/114 (1%)
 Frame = +1

Query: 88  PSPPSDSGGSPPGSYDPTPSPPSGD--GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS 261
           P PP      PP +  P P+PP     G+ +P P  PP     PP    PPS P  + P 
Sbjct: 4   PPPP------PPNASTPAPAPPLPPSLGAPDPPPPPPPVMPSRPPPAAPPPSPPAASPPP 57

Query: 262 TPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P  P        P+ +  P  P P  PS P  P       PP    PPS   P
Sbjct: 58  PPAPPVA------PRPTPSPPPPPPVMPSKPVKPVPPSSPPPPPVMQPPSPSPP 105

[76][TOP]
>UniRef100_Q9WRM2 Latent nuclear antigen n=1 Tax=Macaca mulatta rhadinovirus 17577
           RepID=Q9WRM2_9GAMA
          Length = 448

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 57/156 (36%), Positives = 69/156 (44%), Gaps = 16/156 (10%)
 Frame = +1

Query: 4   PTPTPP-------SGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGD 162
           PTP+P        SG    N + SSP    S+ P PSPPS      PG +  +P+PPS  
Sbjct: 104 PTPSPSGSAPVLASGLSPQNTSGSSPASPASHSPPPSPPSH-----PGPH--SPAPPS-- 154

Query: 163 GSYNPTPSTPPSSDCTPPSQDS--PPSDPT-------PTTPSTPTTPSGGYYNSPPQDSS 315
            S+NP+P+  PSS   P   DS  PP  PT       P  P +PT  S     SPP    
Sbjct: 155 -SHNPSPNQQPSSFLQPSHHDSPEPPEPPTSLPPPDSPGPPQSPTPTSSPPPQSPPDSPG 213

Query: 316 PPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PP  PTP    +P T     +   P   S P  P P
Sbjct: 214 PPQSPTPQQAPSPNTQQAVSHTDHPTGPSRPGPPFP 249

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 49/160 (30%), Positives = 68/160 (42%), Gaps = 22/160 (13%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYD------PTPSPPSDSGGSPPGSYDPTPSPPSGDGSYN 174
           T  + +  +  +  SP G GS        PTPSP   SG +P  +   +P   SG    +
Sbjct: 75  TETATESRHGSSQGSPSGSGSESVIVLGSPTPSP---SGSAPVLASGLSPQNTSGSSPAS 131

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTT--------PSG----GYYNSP----PQ 306
           P   +PP S         PPS P P +P+ P++        PS      +++SP    P 
Sbjct: 132 PASHSPPPS---------PPSHPGPHSPAPPSSHNPSPNQQPSSFLQPSHHDSPEPPEPP 182

Query: 307 DSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
            S PP D +P  P +PT  S     SPP    PP  P P+
Sbjct: 183 TSLPPPD-SPGPPQSPTPTSSPPPQSPPDSPGPPQSPTPQ 221

[77][TOP]
>UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0K5_ARATH
          Length = 760

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 56/158 (35%), Positives = 65/158 (41%), Gaps = 18/158 (11%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGS---YN 174
           P+P PP     Y+P P  PP    Y P P PP      PP  Y P P PP        Y+
Sbjct: 429 PSPPPPV----YSPPPPPPPPPPVYSPPPPPPPPP---PPPVYSPPPPPPPPPPPPPVYS 481

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP---------PTD 327
           P P +PP     PP    PP  P P  P   + P    Y+SPP   SP         P  
Sbjct: 482 PPPPSPPPPP--PPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPP 539

Query: 328 PTPTTPS----TPTTPSGGYYNSPP--QDSSPPSDPLP 423
           P P +P     +P  P   YY+SPP    S PP  P P
Sbjct: 540 PPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPP 577

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 52/144 (36%), Positives = 61/144 (42%), Gaps = 5/144 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGS--YDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           P P PP     Y+P P SPP      Y P P PP      PP  Y P P P        P
Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP---PPPVYSPPPPPVYSSPPPPP 525

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
           +P+  P   CT P    P S P P    +P  P   YY+SPP   S P   +P  P +P 
Sbjct: 526 SPAPTPVY-CTRPPPPPPHSPPPPQF--SPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPP 582

Query: 358 TPSGGYYNSPPQD---SSPPSDPL 420
            P   Y + PP     SSPP  P+
Sbjct: 583 PPIYPYLSPPPPPTPVSSPPPTPV 606

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 55/150 (36%), Positives = 63/150 (42%), Gaps = 12/150 (8%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPG-SYDPTPSPPSGDGSYNPT 180
           P+P PP+   S  PT +SPP      P  SPP      PP  S  P P PP     Y+P 
Sbjct: 408 PSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPP 467

Query: 181 PSTPPSSDCTPPSQDSPPSDPTP------TTPSTPTTPSGGYYNSPPQD--SSPPTDPTP 336
           P  PP     P     PPS P P        P  P  P    Y+ PP    SSPP  P+P
Sbjct: 468 PPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527

Query: 337 T-TP--STPTTPSGGYYNSPPQDSSPPSDP 417
             TP   T   P   +   PPQ S PP +P
Sbjct: 528 APTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 55/158 (34%), Positives = 63/158 (39%), Gaps = 19/158 (12%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTP----SSPPGGGSYDPTP-----SPPSDSGGSPPGSYDPTPSPPS 156
           P P PP     Y+P P    SSPP   S  PTP      PP      PP  + P P  P 
Sbjct: 499 PPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPY 558

Query: 157 GDGSYNPTPSTPPSSDCTPPSQDSPP-----SDPTPTTPSTPTTPSGGYYNSPPQDSSPP 321
              S  P  S+PP     PP    PP     S P P TP +   P+  Y   PP     P
Sbjct: 559 YYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEP 618

Query: 322 TDPTPTTP-STPTTPSGGYYNSPPQD----SSPPSDPL 420
             P P    S P  P   +Y+SPP      SSPP  P+
Sbjct: 619 PPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPV 656

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 56/151 (37%), Positives = 62/151 (41%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS--PPSGDGSYNP 177
           P P PP    S  P P  PP    Y P P PP      PP  Y P P   PP     Y+P
Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPP--PPPPVYSPPPPSPPPPPPPVYSP 497

Query: 178 TPSTPPS------SDCTPPSQDSPPSDPTPT-TP--STPTTPSGGYYNSPPQDSSPPTDP 330
            P  PP       S   PP   SPP  P+P  TP   T   P   +   PPQ S PP  P
Sbjct: 498 PPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPP--P 555

Query: 331 TPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P   S+P  P    ++SPP  S PP    P
Sbjct: 556 EPYYYSSPPPP----HSSPPPHSPPPPHSPP 582

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 52/145 (35%), Positives = 59/145 (40%), Gaps = 7/145 (4%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTP-SSPPGGGSYDPTPSPPSDSGGSPPG--SYDPTPSPPSGDGSYNP 177
            +P PP       PTP SSPP    Y P P PP      PP    Y P P PP    S  P
Sbjct: 590  SPPPP-------PTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPP 642

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQD---SSPPTDPT-PTTP 345
             P    SS   PP   S P  P P   S+P  P   Y++ PP     SSPP  P+ P   
Sbjct: 643  PPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEE 702

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPL 420
            S P  P   +   PP     P  P+
Sbjct: 703  SPPPAPVVHHSPPPPMVHHSPPPPV 727

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 57/161 (35%), Positives = 65/161 (40%), Gaps = 23/161 (14%)
 Frame = +1

Query: 4    PTPTPPSGDG--SYNPTP------SSPPGGGSYDPTPSPPSDSGGSPP-GSYDPTPSPPS 156
            P P PP       ++P P      SSPP   S  P  SPP      PP   Y   P PP+
Sbjct: 537  PPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPT 596

Query: 157  GDGSYNPTP--STPPSSDCTPPSQDSP-----PSDPTPTTPSTPTTPSGGYYNSPPQD-- 309
               S  PTP  S PP   C  P    P     P  P P    +   P   YY+SPP    
Sbjct: 597  PVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPV 656

Query: 310  --SSPPTDPTPTTPSTPTTPSGGYYNSPPQD---SSPPSDP 417
              SSPP  P P   S+P  P   Y++ PP     SSPP  P
Sbjct: 657  YYSSPP-PPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPP 696

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 58/163 (35%), Positives = 65/163 (39%), Gaps = 24/163 (14%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTP------SPPSDSGGSPPGSYDPTPSPPSGDG 165
            P PTP        P P SPP      P P      SPP      PP S  P  SPP    
Sbjct: 527  PAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIY 586

Query: 166  SY--NPTPSTPPSSDCTPPSQDSPPS----DPTPTTP----STPTTPSGGYYNSPPQD-- 309
             Y   P P TP SS    P    PP     +P P  P    S P  P   +Y+SPP    
Sbjct: 587  PYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPV 646

Query: 310  --SSPPTDPTPTTPSTPTTPSGGYYNSPPQDS----SPPSDPL 420
              SSPP  P P   S+P  P   +Y+SPP       SPP  P+
Sbjct: 647  YYSSPP--PPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPV 687

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 38/115 (33%), Positives = 49/115 (42%), Gaps = 3/115 (2%)
 Frame = +1

Query: 85  TPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPT-TPS 261
           +P PP  +   PP    P+P PP+   S  PT ++PP           PPS P P  +P 
Sbjct: 393 SPRPPVVTPLPPPSL--PSPPPPAPIFSTPPTLTSPP-----------PPSPPPPVYSPP 439

Query: 262 TPTTPSGGYYNSPPQDSSPPTDP--TPTTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
            P  P    Y+ PP    PP  P  +P  P  P  P    Y+ PP    PP  P+
Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPV 494

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 50/148 (33%), Positives = 60/148 (40%), Gaps = 10/148 (6%)
 Frame = +1

Query: 4    PTP--TPPSGDGSYNPTPSSPPGGGSYDPTPSPP--SDSGGSPPGSYDPTPSPPSGDGSY 171
            PTP  +PP       P P  PP    Y P P PP    S   PP  Y  +P PP     Y
Sbjct: 603  PTPVYSPPPPPPCIEPPP--PPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPP--PVYY 658

Query: 172  NPTPSTPPSSDCTPPSQD----SPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
            +  P  PP    +PP  +    SPP  P+P   S+P  P      S P + SPP  P P 
Sbjct: 659  SSPPPPPPVHYSSPPPPEVHYHSPP--PSPVHYSSPPPPP-----SAPCEESPP--PAPV 709

Query: 340  TPSTPTTPSGGYYNSPP--QDSSPPSDP 417
               +P  P   +   PP    S PP  P
Sbjct: 710  VHHSPPPPMVHHSPPPPVIHQSPPPPSP 737

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 47/150 (31%), Positives = 58/150 (38%), Gaps = 11/150 (7%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPS--DSGGSPPGSYDPTPSPPSGDGSYN 174
            +P P PP  +  Y+P P  PP    Y   P PP    S   PP  Y   P PP    S  
Sbjct: 617  EPPPPPPCIE--YSPPP--PPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSP 672

Query: 175  PTPS----TPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
            P P     +PP S     S   PPS P   +P     P+   ++SPP      + P P  
Sbjct: 673  PPPEVHYHSPPPSPVHYSSPPPPPSAPCEESP----PPAPVVHHSPPPPMVHHSPPPPVI 728

Query: 343  PSTPTTPSGGYYNSPP-----QDSSPPSDP 417
              +P  PS  Y    P       +SPP  P
Sbjct: 729  HQSPPPPSPEYEGPLPPVIGVSYASPPPPP 758

[78][TOP]
>UniRef100_Q1EPA3 Protein kinase family protein n=1 Tax=Musa acuminata
           RepID=Q1EPA3_MUSAC
          Length = 648

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 51/142 (35%), Positives = 63/142 (44%), Gaps = 5/142 (3%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTP 192
           +PP    +  PTP SPP      PTP PP+D    P  +  P P+PP    S  P   +P
Sbjct: 31  SPPPAPNAPPPTPPSPPPASPPPPTPPPPADVPPPPVVTSPPPPAPPPPSVSPPPPALSP 90

Query: 193 P--SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT--DPTPTTPSTPT- 357
           P  S+   PPS   PP+   P  P + T P       PP  + PPT   P P + S P  
Sbjct: 91  PPASTPPRPPSASPPPAAAPPPPPPSATPPPTNSPPPPPSATPPPTISPPPPGSQSPPAP 150

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
            PS     +PP    PPS P P
Sbjct: 151 APSNSTGGTPPAPPKPPSPPSP 172

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 52/152 (34%), Positives = 70/152 (46%), Gaps = 15/152 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGG-------SYDPTPSPPSDSGGSPPGSYDPTP-SPPSG 159
           P PTPPS   +  P P+ PP          +  P P+PP  S   PP +  P P S P  
Sbjct: 39  PPPTPPSPPPASPPPPTPPPPADVPPPPVVTSPPPPAPPPPSVSPPPPALSPPPASTPPR 98

Query: 160 DGSYNPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSP---PQDSSPP 321
             S +P P+    PP    TPP  +SPP  P+ T P T + P  G  + P   P +S+  
Sbjct: 99  PPSASPPPAAAPPPPPPSATPPPTNSPPPPPSATPPPTISPPPPGSQSPPAPAPSNSTGG 158

Query: 322 TDPTPTTPSTPTTPS-GGYYNSPPQDSSPPSD 414
           T P P  P +P +PS    + +P    SP S+
Sbjct: 159 TPPAPPKPPSPPSPSPSASHRAPAYPISPSSN 190

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 48/138 (34%), Positives = 60/138 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+P     S  P  +SPP   S     SPP  S   PP    P P+PPS   +  P P
Sbjct: 4   PPPSP-----SATPPSTSPPPPTSL----SPPPASNSPPPAPNAPPPTPPSPPPASPPPP 54

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           + PP +D  PP   + P  P P  PS    P      SPP  S+PP  P+ + P     P
Sbjct: 55  TPPPPADVPPPPVVTSPPPPAPPPPSVSPPPPA---LSPPPASTPPRPPSASPPPAAAPP 111

Query: 364 SGGYYNSPPQDSSPPSDP 417
                 +PP  +SPP  P
Sbjct: 112 PPPPSATPPPTNSPPPPP 129

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 47/136 (34%), Positives = 60/136 (44%), Gaps = 1/136 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS-GDGSYNPT 180
           P+ TPPS       + S PP   S  P P+ P  +  SPP +  P P+PP   D    P 
Sbjct: 8   PSATPPSTSPPPPTSLSPPPASNSPPPAPNAPPPTPPSPPPASPPPPTPPPPADVPPPPV 67

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            ++PP     PPS   PP   +P   STP  P      SPP  ++PP  P   TP    +
Sbjct: 68  VTSPPPPAPPPPSVSPPPPALSPPPASTPPRPPSA---SPPPAAAPPPPPPSATPPPTNS 124

Query: 361 PSGGYYNSPPQDSSPP 408
           P      +PP   SPP
Sbjct: 125 PPPPPSATPPPTISPP 140

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 51/148 (34%), Positives = 68/148 (45%), Gaps = 17/148 (11%)
 Frame = +1

Query: 4   PTPTPPSGDGS----YNPTPSSPPGGGSYDPTP--SPPSDS------GGSPPGSYDPTPS 147
           PTP PP+         +P P +PP      P P  SPP  S        SPP +  P P 
Sbjct: 54  PTPPPPADVPPPPVVTSPPPPAPPPPSVSPPPPALSPPPASTPPRPPSASPPPAAAPPPP 113

Query: 148 PPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPT 324
           PPS   +  PT S PP    TPP   SPP   + + P+  P+  +GG   +PP+  SPP+
Sbjct: 114 PPS--ATPPPTNSPPPPPSATPPPTISPPPPGSQSPPAPAPSNSTGGTPPAPPKPPSPPS 171

Query: 325 DPTPT----TPSTPTTPSGGYYNSPPQD 396
            P+P+     P+ P +PS      P  D
Sbjct: 172 -PSPSASHRAPAYPISPSSNGSGIPTSD 198

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 44/120 (36%), Positives = 52/120 (43%), Gaps = 11/120 (9%)
 Frame = +1

Query: 91  SPPSDSGGSPPGSYDPTP---SPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS 261
           SPP     +PP +  P P   SPP    S  P P+ PP    TPPS   PP+ P P TP 
Sbjct: 3   SPPPSPSATPPSTSPPPPTSLSPPPASNSPPPAPNAPPP---TPPSP--PPASPPPPTPP 57

Query: 262 TPT-TPSGGYYNSPPQDSSPPTDPTPTTP-------STPTTPSGGYYNSPPQDSSPPSDP 417
            P   P      SPP  + PP   +P  P       STP  P      SPP  ++PP  P
Sbjct: 58  PPADVPPPPVVTSPPPPAPPPPSVSPPPPALSPPPASTPPRPPSA---SPPPAAAPPPPP 114

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 36/93 (38%), Positives = 44/93 (47%), Gaps = 9/93 (9%)
 Frame = +1

Query: 175 PTPS-TPPSSDCTPPSQDSPP--SDPTPTTPST--PTTPSGGYYNSPPQDSSPPTD---- 327
           P+PS TPPS+   PP+  SPP  S+  P  P+   PT PS    + PP    PP D    
Sbjct: 6   PSPSATPPSTSPPPPTSLSPPPASNSPPPAPNAPPPTPPSPPPASPPPPTPPPPADVPPP 65

Query: 328 PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
           P  T+P  P  P       PP  S PP+   PR
Sbjct: 66  PVVTSPPPPAPPPPSVSPPPPALSPPPASTPPR 98

[79][TOP]
>UniRef100_O22514 Proline rich protein n=1 Tax=Santalum album RepID=O22514_9MAGN
          Length = 326

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 62/149 (41%), Positives = 76/149 (51%), Gaps = 13/149 (8%)
 Frame = +1

Query: 4   PTPTPPS-GDGSYNPTPSSP---PGGGSYDPTPSPPSDSGGSPPGS------YDPTPSPP 153
           PT TPP+ G+    P P SP   PG  S  P+P  PS    SPP S      Y  +PSPP
Sbjct: 161 PTSTPPTDGETPRPPGPRSPSPSPGPPSCSPSPKSPSPPASSPPRSRPGPPDYTTSPSPP 220

Query: 154 SGDGSYNPTPS---TPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT 324
           +   S  PTP    +PP++  +PPS+ S PS PT  TP TP  PS  Y  SP   SS P+
Sbjct: 221 T-PRSVPPTPPASPSPPTAKPSPPSRGSSPSPPTSPTP-TPRPPS--YSPSPTPPSSRPS 276

Query: 325 DPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
            P  +   TP +P+      PP   SPPS
Sbjct: 277 PPLRSPILTPPSPAA----VPPIGRSPPS 301

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 64/163 (39%), Positives = 78/163 (47%), Gaps = 24/163 (14%)
 Frame = +1

Query: 4   PTP--TPPSGDGSYNP----TPSSPPGGGSYDPTPSPPSDSGGSP----------PGSYD 135
           PTP  TPP+   S +P    +PS  PG  +  PTP P S +   P          P S  
Sbjct: 122 PTPYGTPPTVRRSPSPPESASPSPSPGPPAATPTPRPSSPTSTPPTDGETPRPPGPRSPS 181

Query: 136 PTPSPPS---GDGSYNPTPSTPPSSDCTPPSQDSPPSDPT-----PTTPSTPTTPSGGYY 291
           P+P PPS      S +P  S+PP S   PP   + PS PT     PT P++P+ P+    
Sbjct: 182 PSPGPPSCSPSPKSPSPPASSPPRSRPGPPDYTTSPSPPTPRSVPPTPPASPSPPTA--K 239

Query: 292 NSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
            SPP   S P+ PT  TP TP  PS  Y  SP   SS PS PL
Sbjct: 240 PSPPSRGSSPSPPTSPTP-TPRPPS--YSPSPTPPSSRPSPPL 279

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 54/149 (36%), Positives = 67/149 (44%), Gaps = 14/149 (9%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYDPT----PSPPSDSGGSP-PGSYDPTPSP-PSGDGSYN 174
           TPP     +NP PS PP      PT    PSPP  +  SP PG    TP+P PS   S  
Sbjct: 111 TPPL----FNP-PSDPPTPYGTPPTVRRSPSPPESASPSPSPGPPAATPTPRPSSPTSTP 165

Query: 175 PTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP--- 336
           PT      PP      PS   P   P+P +PS P +        PP  ++ P+ PTP   
Sbjct: 166 PTDGETPRPPGPRSPSPSPGPPSCSPSPKSPSPPASSPPRSRPGPPDYTTSPSPPTPRSV 225

Query: 337 --TTPSTPTTPSGGYYNSPPQDSSPPSDP 417
             T P++P+ P+     SPP   S PS P
Sbjct: 226 PPTPPASPSPPTA--KPSPPSRGSSPSPP 252

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 50/121 (41%), Positives = 66/121 (54%), Gaps = 8/121 (6%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
           +P+PP+   S  PTP + P   +  P+P P   S  SPP S  PTP PPS    Y+P+P 
Sbjct: 216 SPSPPT-PRSVPPTPPASPSPPTAKPSP-PSRGSSPSPPTSPTPTPRPPS----YSPSP- 268

Query: 187 TPPSSDCTPPSQD---SPPSD----PTPTTPSTPTTPSGGYYNSPPQDSSPPTDP-TPTT 342
           TPPSS  +PP +    +PPS     P   +P +P  P      S P+ SSPPT P TP++
Sbjct: 269 TPPSSRPSPPLRSPILTPPSPAAVPPIGRSPPSPIDPPC----SSPEPSSPPTSPPTPSS 324

Query: 343 P 345
           P
Sbjct: 325 P 325

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 48/148 (32%), Positives = 63/148 (42%), Gaps = 9/148 (6%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P+P  G       P  PP G    P  +P S +   P   +D TP        +NP PS 
Sbjct: 72  PSPTLGLPFPPLDPRKPPSG----PFGNPNSPASLIPWRRWDHTPP------LFNP-PSD 120

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPS--------TPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
           PP+   TPP+    PS P   +PS        TPT       ++PP D   P  P P +P
Sbjct: 121 PPTPYGTPPTVRRSPSPPESASPSPSPGPPAATPTPRPSSPTSTPPTDGETPRPPGPRSP 180

Query: 346 S-TPTTPSGGYYNSPPQDSSPPSDPLPR 426
           S +P  PS    +  P+  SPP+   PR
Sbjct: 181 SPSPGPPS---CSPSPKSPSPPASSPPR 205

[80][TOP]
>UniRef100_C7J265 Os05g0516400 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group
           RepID=C7J265_ORYSJ
          Length = 868

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 54/147 (36%), Positives = 63/147 (42%), Gaps = 10/147 (6%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG-------- 165
           P PP    +  P P  PP  G+ DP P PP      PP +  P PSPP+           
Sbjct: 46  PPPPPNASTPAPAPPLPPSLGAPDPPPPPPPVMPSRPPPAA-PPPSPPAASPPPPPAPPV 104

Query: 166 SYNPTPSTPPSSDCTP--PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
           +  PTPS PP     P  P +  PPS P P     P +PS      PP    PPT   P 
Sbjct: 105 APRPTPSPPPPPPVMPSKPVKPVPPSSPPPPPVMQPPSPSPPLIPPPP----PPTPVMPV 160

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDPL 420
            P TP+ PS    N PP   SPP  P+
Sbjct: 161 LPPTPSPPSP--VNPPPPSPSPPPSPV 185

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 59/162 (36%), Positives = 69/162 (42%), Gaps = 22/162 (13%)
 Frame = +1

Query: 4   PTPTPP-------SGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGS----YDPTPSP 150
           PTP+PP       S      P  S PP      P+PSPP      PP        PTPSP
Sbjct: 108 PTPSPPPPPPVMPSKPVKPVPPSSPPPPPVMQPPSPSPPLIPPPPPPTPVMPVLPPTPSP 167

Query: 151 PSGDGSYNPTPSTPPSS-DCTPP--SQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP 321
           PS      P+PS PPS  +  PP  S  SP S P+P  P  P T      N  P  +SPP
Sbjct: 168 PSPVNPPPPSPSPPPSPVNPLPPITSPPSPVSPPSPANPLPPATSPPSPANPLPPATSPP 227

Query: 322 TDPTPTTPST--------PTTPSGGYYNSPPQDSSPPSDPLP 423
           +   P  P+T        PT PS     +P   + PP  PLP
Sbjct: 228 SPANPLPPTTSPPSPAPPPTVPSQPPEAAPAPTTKPPPTPLP 269

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 59/155 (38%), Positives = 65/155 (41%), Gaps = 14/155 (9%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPP-------SG 159
           DP P PP    S  P  + PP   +  P P P      +PP +  PTPSPP       S 
Sbjct: 69  DPPPPPPPVMPSRPPPAAPPPSPPAASPPPPP------APPVAPRPTPSPPPPPPVMPSK 122

Query: 160 DGSYNPTPSTPPSSDCTPPSQD----SPPSDPTPTTPSTPTTPS-GGYYNSPPQDSSPPT 324
                P  S PP     PPS       PP  PTP  P  P TPS     N PP   SPP 
Sbjct: 123 PVKPVPPSSPPPPPVMQPPSPSPPLIPPPPPPTPVMPVLPPTPSPPSPVNPPPPSPSPP- 181

Query: 325 DPTPTTPSTPTTPSGGYYNSPPQDSSPPS--DPLP 423
            P+P  P  P T       SPP   SPPS  +PLP
Sbjct: 182 -PSPVNPLPPIT-------SPPSPVSPPSPANPLP 208

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 59/168 (35%), Positives = 79/168 (47%), Gaps = 27/168 (16%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGS------YDPTP-SPPSDSGGSPPGSYDPTPSPPSGD 162
           PTP+PPS      P+PS PP   +        P+P SPPS +   PP +  P+P+ P   
Sbjct: 163 PTPSPPSPVNPPPPSPSPPPSPVNPLPPITSPPSPVSPPSPANPLPPATSPPSPANPLPP 222

Query: 163 GSYNPTPSTP------PSSDCTPPSQDSPPSD--PTPTT--PSTPTTPSGGYYNSPPQDS 312
            +  P+P+ P      P S   PP+  S P +  P PTT  P TP  P+     SPP  S
Sbjct: 223 ATSPPSPANPLPPTTSPPSPAPPPTVPSQPPEAAPAPTTKPPPTPLPPA----RSPPAPS 278

Query: 313 SPPTDPTPT-TPS---------TPTTPSGGYYNSPPQDSSPPSDPLPR 426
               +P+P+ +PS         TP+ P GG   + P  S P S P PR
Sbjct: 279 PASREPSPSPSPSVAPPSLPIFTPSPPGGGRGAATP--SPPSSRPSPR 324

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/145 (33%), Positives = 61/145 (42%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P   PPS   +  P P +PP      P+P PP     S P    P  SPP       P+P
Sbjct: 84  PAAPPPSPPAASPPPPPAPPVAPRPTPSPPPPPPVMPSKPVKPVPPSSPPPPPVMQPPSP 143

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP----TTPST 351
           S P      PP+   P   PTP+ PS    P       PP  S PP+   P    T+P +
Sbjct: 144 SPPLIPPPPPPTPVMPVLPPTPSPPSPVNPP-------PPSPSPPPSPVNPLPPITSPPS 196

Query: 352 PTTPSGGYYNSPPQDSSP-PSDPLP 423
           P +P       PP  S P P++PLP
Sbjct: 197 PVSPPSPANPLPPATSPPSPANPLP 221

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 57/151 (37%), Positives = 68/151 (45%), Gaps = 13/151 (8%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGG---SYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P PP+   +  PTPS PP      S    P PPS S   PP    P+PSPP       PT
Sbjct: 97  PPPPAPPVAPRPTPSPPPPPPVMPSKPVKPVPPS-SPPPPPVMQPPSPSPPLIPPPPPPT 155

Query: 181 P--------STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           P         +PPS    PP   SPP  P+P  P  P T       SPP   SPP+   P
Sbjct: 156 PVMPVLPPTPSPPSPVNPPPPSPSPP--PSPVNPLPPIT-------SPPSPVSPPSPANP 206

Query: 337 TTPST-PTTPSGGYYNSPPQDSSP-PSDPLP 423
             P+T P +P+      PP  S P P++PLP
Sbjct: 207 LPPATSPPSPANPL---PPATSPPSPANPLP 234

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 54/163 (33%), Positives = 65/163 (39%), Gaps = 24/163 (14%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPT------------PS 147
           P+P+PP       PTP  P       PTPSPPS     PP    P             PS
Sbjct: 141 PSPSPPLIPPPPPPTPVMPV----LPPTPSPPSPVNPPPPSPSPPPSPVNPLPPITSPPS 196

Query: 148 PPSGDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPST--------PTTPSGGYYNS 297
           P S     NP P  ++PPS     P   SPPS   P  P+T        PT PS     +
Sbjct: 197 PVSPPSPANPLPPATSPPSPANPLPPATSPPSPANPLPPTTSPPSPAPPPTVPSQPPEAA 256

Query: 298 PPQDSSPPTDPTP--TTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
           P   + PP  P P   +P  P+  S     SP    +PPS P+
Sbjct: 257 PAPTTKPPPTPLPPARSPPAPSPASREPSPSPSPSVAPPSLPI 299

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 47/144 (32%), Positives = 61/144 (42%), Gaps = 9/144 (6%)
 Frame = +1

Query: 4   PTP-TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPP----SGDGS 168
           P+P +PPS      P  S P       P  SPPS +   PP +  P+P+PP    S    
Sbjct: 195 PSPVSPPSPANPLPPATSPPSPANPLPPATSPPSPANPLPPTTSPPSPAPPPTVPSQPPE 254

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTD----PTP 336
             P P+T P     PP++  P   P    PS   +PS    + P    SPP       TP
Sbjct: 255 AAPAPTTKPPPTPLPPARSPPAPSPASREPSPSPSPSVAPPSLPIFTPSPPGGGRGAATP 314

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPP 408
           + PS+  +P      SPP  SS P
Sbjct: 315 SPPSSRPSP-----RSPPPPSSAP 333

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 45/142 (31%), Positives = 57/142 (40%), Gaps = 1/142 (0%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           +P P   S     NP P          P  SPPS +   PP +  P+P+PP       PT
Sbjct: 205 NPLPPATSPPSPANPLP----------PATSPPSPANPLPPTTSPPSPAPP-------PT 247

Query: 181 -PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            PS PP +   P ++  P   P   +P  P+  S     SP    +PP+ P   TPS P 
Sbjct: 248 VPSQPPEAAPAPTTKPPPTPLPPARSPPAPSPASREPSPSPSPSVAPPSLPI-FTPSPPG 306

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
              G    SPP     P  P P
Sbjct: 307 GGRGAATPSPPSSRPSPRSPPP 328

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 37/118 (31%), Positives = 46/118 (38%), Gaps = 2/118 (1%)
 Frame = +1

Query: 76  YDPTPSPPSDSGGSPPGSYDPTPSPPSGD--GSYNPTPSTPPSSDCTPPSQDSPPSDPTP 249
           + P  +PP      PP +  P P+PP     G+ +P P  PP     PP    PPS P  
Sbjct: 39  HPPMSAPPPP----PPNASTPAPAPPLPPSLGAPDPPPPPPPVMPSRPPPAAPPPSPPAA 94

Query: 250 TTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           + P  P  P        P+ +  P  P P  PS P  P       PP    PPS   P
Sbjct: 95  SPPPPPAPPVA------PRPTPSPPPPPPVMPSKPVKPVPPSSPPPPPVMQPPSPSPP 146

[81][TOP]
>UniRef100_UPI00015DEFD1 Proline-rich protein 2 precursor (Proline-rich protein MP-3). n=1
           Tax=Mus musculus RepID=UPI00015DEFD1
          Length = 227

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 54/139 (38%), Positives = 55/139 (39%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP G     P    PPGG    P P PP   G  PPG   P P PP G       P  
Sbjct: 52  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGG--PQPRPPQG-------PPP 96

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           P      PP    PP  P P  P  P  P GG    PPQ   PP  P    P  P  P G
Sbjct: 97  PGGPQPRPPQGPPPPGGPQPRPPQGPPPP-GGPQQRPPQGPPPPGGPQQRPPQGP-PPPG 154

Query: 370 GYYNSPPQDSSPPSDPLPR 426
           G    PPQ   PP+ P PR
Sbjct: 155 GPQPRPPQGPPPPAGPQPR 173

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 55/156 (35%), Positives = 56/156 (35%), Gaps = 17/156 (10%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYNPT 180
           P PP G     P    PPGG    P P PP   G  PPG   P P    PP G     P 
Sbjct: 66  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGGPQPRPPQGPPPPGGPQPRPP 119

Query: 181 PSTPPSS--DCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
              PP       PP    PP  P    P  P  P GG    PPQ   PP  P P  P  P
Sbjct: 120 QGPPPPGGPQQRPPQGPPPPGGPQQRPPQGPPPP-GGPQPRPPQGPPPPAGPQPRPPQGP 178

Query: 355 ------------TTPSGGYYNSPPQDSSPPSDPLPR 426
                         P+GG    PPQ   PP  P PR
Sbjct: 179 PPPGPHPRPTQGPPPTGGPQQRPPQGPPPPGGPQPR 214

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 47/123 (38%), Positives = 47/123 (38%)
 Frame = +1

Query: 58  PPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPS 237
           PP  GS    P   S  G  PPG   P P PP G       P  P      PP    PP 
Sbjct: 34  PPPSGSQPRPPVNGSQQGPPPPGG--PQPRPPQG-------PPPPGGPQPRPPQGPPPPG 84

Query: 238 DPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
            P P  P  P  P GG    PPQ   PP  P P  P  P  P GG    PPQ   PP  P
Sbjct: 85  GPQPRPPQGPPPP-GGPQPRPPQGPPPPGGPQPRPPQGP-PPPGGPQQRPPQGPPPPGGP 142

Query: 418 LPR 426
             R
Sbjct: 143 QQR 145

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 50/143 (34%), Positives = 53/143 (37%), Gaps = 5/143 (3%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYNPT 180
           P PP G     P    PPGG    P P PP   G  PPG     P    PP G     P 
Sbjct: 94  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGGPQQRPPQGPPPPGGPQQRPP 147

Query: 181 PSTPPSS--DCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
              PP       PP    PP+ P P  P  P  P  G +  P Q   P   P    P  P
Sbjct: 148 QGPPPPGGPQPRPPQGPPPPAGPQPRPPQGPPPP--GPHPRPTQGPPPTGGPQQRPPQGP 205

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
             P GG    PPQ   PP+ P P
Sbjct: 206 -PPPGGPQPRPPQGPPPPTGPQP 227

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 38/111 (34%), Positives = 40/111 (36%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P   PP G     P    PP GG   P P PP      PP    P P PP G        
Sbjct: 133 PQGPPPPGGPQQRPPQGPPPPGG---PQPRPPQ----GPPPPAGPQPRPPQG-------- 177

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
             PP      P+Q  PP+      P     P GG    PPQ   PPT P P
Sbjct: 178 -PPPPGPHPRPTQGPPPTGGPQQRPPQGPPPPGGPQPRPPQGPPPPTGPQP 227

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 37/90 (41%), Positives = 37/90 (41%), Gaps = 6/90 (6%)
 Frame = +1

Query: 175 PTPSTPPS-SDCTPPSQDS-----PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           P    PPS S   PP   S     PP  P P  P  P  P GG    PPQ   PP  P P
Sbjct: 30  PNQRPPPSGSQPRPPVNGSQQGPPPPGGPQPRPPQGP-PPPGGPQPRPPQGPPPPGGPQP 88

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
             P  P  P GG    PPQ   PP  P PR
Sbjct: 89  RPPQGP-PPPGGPQPRPPQGPPPPGGPQPR 117

[82][TOP]
>UniRef100_UPI0000195290 proline rich protein 2 n=1 Tax=Mus musculus RepID=UPI0000195290
          Length = 316

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 54/139 (38%), Positives = 55/139 (39%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP G     P    PPGG    P P PP   G  PPG   P P PP G       P  
Sbjct: 52  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGG--PQPRPPQG-------PPP 96

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           P      PP    PP  P P  P  P  P GG    PPQ   PP  P    P  P  P G
Sbjct: 97  PGGPQPRPPQGPPPPGGPQPRPPQGPPPP-GGPQQRPPQGPPPPGGPQQRPPQGP-PPPG 154

Query: 370 GYYNSPPQDSSPPSDPLPR 426
           G    PPQ   PP+ P PR
Sbjct: 155 GPQPRPPQGPPPPAGPQPR 173

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 51/154 (33%), Positives = 55/154 (35%), Gaps = 13/154 (8%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG-------SPPGSYDPTPSPPSG- 159
           P   PP G     P    PP GG     P  P   GG        PP    P P PP G 
Sbjct: 119 PQGPPPPGGPQQRPPQGPPPPGGPQQRPPQGPPPPGGPQPRPPQGPPPPAGPQPRPPQGP 178

Query: 160 ---DGSYNPTPSTPPSSDCTP--PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT 324
                   PT   PP+       P    PP  P P  P  P  P G +    P    PPT
Sbjct: 179 PPPGPHLRPTQGPPPTGGPQQRYPQSPPPPGGPQPRPPQGPPPPGGPH--PRPTQGPPPT 236

Query: 325 DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
            P P  P+    P+GG    PPQ   PP  P PR
Sbjct: 237 GPQP-RPTQGPPPTGGPQQRPPQGPPPPGGPQPR 269

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 49/145 (33%), Positives = 56/145 (38%), Gaps = 4/145 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGS----YNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P P PP G         PT   PP GG     P  P   GG  P    P   PP G    
Sbjct: 170 PQPRPPQGPPPPGPHLRPTQGPPPTGGPQQRYPQSPPPPGGPQPRP--PQGPPPPGGPHP 227

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            PT   PP+     P+Q  PP+      P     P GG    PPQ   PPT P P  P+ 
Sbjct: 228 RPTQGPPPTGPQPRPTQGPPPTGGPQQRPPQGPPPPGGPQPRPPQGPPPPTGPQP-RPTQ 286

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLPR 426
              P+GG   +PP   +P   P  R
Sbjct: 287 GPHPTGGPQQTPPLAGNPQGPPQGR 311

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 54/156 (34%), Positives = 55/156 (35%), Gaps = 17/156 (10%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYNPT 180
           P PP G     P    PPGG    P P PP   G  PPG   P P    PP G     P 
Sbjct: 66  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGGPQPRPPQGPPPPGGPQPRPP 119

Query: 181 PSTPPSS--DCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
              PP       PP    PP  P    P  P  P GG    PPQ   PP  P P  P  P
Sbjct: 120 QGPPPPGGPQQRPPQGPPPPGGPQQRPPQGPPPP-GGPQPRPPQGPPPPAGPQPRPPQGP 178

Query: 355 ------------TTPSGGYYNSPPQDSSPPSDPLPR 426
                         P+GG     PQ   PP  P PR
Sbjct: 179 PPPGPHLRPTQGPPPTGGPQQRYPQSPPPPGGPQPR 214

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 47/123 (38%), Positives = 47/123 (38%)
 Frame = +1

Query: 58  PPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPS 237
           PP  GS    P   S  G  PPG   P P PP G       P  P      PP    PP 
Sbjct: 34  PPPSGSQPRPPVNGSQQGPPPPGG--PQPRPPQG-------PPPPGGPQPRPPQGPPPPG 84

Query: 238 DPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
            P P  P  P  P GG    PPQ   PP  P P  P  P  P GG    PPQ   PP  P
Sbjct: 85  GPQPRPPQGPPPP-GGPQPRPPQGPPPPGGPQPRPPQGP-PPPGGPQQRPPQGPPPPGGP 142

Query: 418 LPR 426
             R
Sbjct: 143 QQR 145

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 51/144 (35%), Positives = 54/144 (37%), Gaps = 5/144 (3%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYNPT 180
           P PP G     P    PPGG    P P PP   G  PPG     P    PP G     P 
Sbjct: 94  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGGPQQRPPQGPPPPGGPQQRPP 147

Query: 181 PSTPPSS--DCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
              PP       PP    PP+ P P  P  P  P  G +  P Q   P   P    P +P
Sbjct: 148 QGPPPPGGPQPRPPQGPPPPAGPQPRPPQGPPPP--GPHLRPTQGPPPTGGPQQRYPQSP 205

Query: 355 TTPSGGYYNSPPQDSSPPSDPLPR 426
             P GG    PPQ   PP  P PR
Sbjct: 206 -PPPGGPQPRPPQGPPPPGGPHPR 228

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 47/140 (33%), Positives = 52/140 (37%), Gaps = 1/140 (0%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP G     P    PPGG    P   PP   G   P    P   PP G     P    
Sbjct: 108 PPPPGGPQPRPPQGPPPPGGPQQRPPQGPPPPGG---PQQRPPQGPPPPGGPQPRPPQGP 164

Query: 190 PPSSDCTP-PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPS 366
           PP +   P P Q  PP  P    P+    P+GG     PQ   PP  P P  P  P  P 
Sbjct: 165 PPPAGPQPRPPQGPPPPGP-HLRPTQGPPPTGGPQQRYPQSPPPPGGPQPRPPQGPPPPG 223

Query: 367 GGYYNSPPQDSSPPSDPLPR 426
           G +    P    PP+ P PR
Sbjct: 224 GPH--PRPTQGPPPTGPQPR 241

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 37/90 (41%), Positives = 37/90 (41%), Gaps = 6/90 (6%)
 Frame = +1

Query: 175 PTPSTPPS-SDCTPPSQDS-----PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           P    PPS S   PP   S     PP  P P  P  P  P GG    PPQ   PP  P P
Sbjct: 30  PNQRPPPSGSQPRPPVNGSQQGPPPPGGPQPRPPQGP-PPPGGPQPRPPQGPPPPGGPQP 88

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
             P  P  P GG    PPQ   PP  P PR
Sbjct: 89  RPPQGP-PPPGGPQPRPPQGPPPPGGPQPR 117

[83][TOP]
>UniRef100_Q9J2H0 Latency-associated nuclear antigen n=1 Tax=Rhesus monkey
           rhadinovirus H26-95 RepID=Q9J2H0_9GAMA
          Length = 448

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 57/156 (36%), Positives = 69/156 (44%), Gaps = 16/156 (10%)
 Frame = +1

Query: 4   PTPTPP-------SGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGD 162
           PTP+P        SG    N + SSP    S+ P PSPPS      PG +  +P+PPS  
Sbjct: 104 PTPSPSGSAPVLASGLSPRNTSGSSPASPASHSPPPSPPSH-----PGPH--SPAPPS-- 154

Query: 163 GSYNPTPSTPPSSDCTPPSQDS--PPSDPT-------PTTPSTPTTPSGGYYNSPPQDSS 315
            S+NP+P+  PSS   P   DS  PP  PT       P  P +PT  S     SPP    
Sbjct: 155 -SHNPSPNQQPSSFLQPSPHDSPEPPEPPTSLPPPDSPGPPQSPTPTSSPPPQSPPDSPE 213

Query: 316 PPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PP  PTP    +P T     +   P   S P  P P
Sbjct: 214 PPQSPTPQQAPSPNTQQAVSHTDHPTGPSRPGPPFP 249

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 60/182 (32%), Positives = 71/182 (39%), Gaps = 41/182 (22%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPP---------GGGSYDPTPSPPSDSGGSPPGSYD------- 135
           P PTPP+      PT S P          G  +   T S    S GSP GS         
Sbjct: 49  PAPTPPA------PTTSGPQVRAVAEQGHGSDTETATESRHGSSQGSPSGSGSESVIVLG 102

Query: 136 -PTPSPP-------SGDGSYNPTPSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTT---- 273
            PTPSP        SG    N + S+P  P+S   PPS   PPS P P +P+ P++    
Sbjct: 103 SPTPSPSGSAPVLASGLSPRNTSGSSPASPASHSPPPS---PPSHPGPHSPAPPSSHNPS 159

Query: 274 ----PSGGYYNSPPQDSSPPTDPT-------PTTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
               PS     SP     PP  PT       P  P +PT  S     SPP    PP  P 
Sbjct: 160 PNQQPSSFLQPSPHDSPEPPEPPTSLPPPDSPGPPQSPTPTSSPPPQSPPDSPEPPQSPT 219

Query: 421 PR 426
           P+
Sbjct: 220 PQ 221

[84][TOP]
>UniRef100_B0C0T3 Putative uncharacterized protein n=1 Tax=Acaryochloris marina
            MBIC11017 RepID=B0C0T3_ACAM1
          Length = 1003

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 54/147 (36%), Positives = 64/147 (43%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4    PTPTP-PSGDGSYNPTPSSPPGGG-SYDPTPSPPSDSGGSPPGSYDPTPSP---PSGDGS 168
            PTP P P+ D   +PTP   P    + DP P P +D   +P    DPTP P   P  D +
Sbjct: 656  PTPEPDPTPDPDPDPTPDPDPDPTPNPDPDPDPTTDPDPTPDPDPDPTPDPTPDPDPDPT 715

Query: 169  YNPTPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTP-TT 342
             +P P   P  D TP     P  DPTP  TP   +TP       P  D  P  DP P  T
Sbjct: 716  PDPAPDPTPDPDPTPDPDPDPTPDPTPNPTPDPDSTPEPDPDPDPTPDPDPTPDPEPIPT 775

Query: 343  PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P    TP      +P  D +P  DP P
Sbjct: 776  PDPDPTPDPDPDPTPDPDPTPEPDPDP 802

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 54/144 (37%), Positives = 66/144 (45%), Gaps = 3/144 (2%)
 Frame = +1

Query: 1    DPTPTP-PSGDGSYNPTPSSPPGGG-SYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSY 171
            DPTP P P  D + +P P+  P    + DPTP P  D   +P  + DPTP P P+ D   
Sbjct: 677  DPTPNPDPDPDPTTDPDPTPDPDPDPTPDPTPDPDPDP--TPDPAPDPTPDPDPTPDPDP 734

Query: 172  NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            +PTP   P+    P S   P  DP PT    P TP      +P  D +P  DP PT    
Sbjct: 735  DPTPDPTPNPTPDPDSTPEPDPDPDPTPDPDP-TPDPEPIPTPDPDPTPDPDPDPTPDPD 793

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
            PT         P  D +P SDP P
Sbjct: 794  PTPEP-----DPDPDPTPDSDPTP 812

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 54/152 (35%), Positives = 62/152 (40%), Gaps = 11/152 (7%)
 Frame = +1

Query: 1    DPTPTP-PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP---PSGDGS 168
            DP PTP P+ D   +PTP   P     DPTP P       P  + DPTP+P   P     
Sbjct: 699  DPDPTPDPTPDPDPDPTPDPAP-----DPTPDPDPTPDPDPDPTPDPTPNPTPDPDSTPE 753

Query: 169  YNPTPSTPPSSDCTPPSQDSPPSDPTPT-------TPSTPTTPSGGYYNSPPQDSSPPTD 327
             +P P   P  D TP  +  P  DP PT       TP    TP       P  DS P  D
Sbjct: 754  PDPDPDPTPDPDPTPDPEPIPTPDPDPTPDPDPDPTPDPDPTPEPDPDPDPTPDSDPTPD 813

Query: 328  PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P P  P+    P      +P   S P SDP P
Sbjct: 814  PDP-DPTPEPAPDPTPDPAPAPISDPGSDPTP 844

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 51/144 (35%), Positives = 63/144 (43%), Gaps = 3/144 (2%)
 Frame = +1

Query: 1    DPTPTP-PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYN 174
            DP PTP P  D + +PTP   P   + DP P P  D   +P    DPTP P P+     +
Sbjct: 691  DPDPTPDPDPDPTPDPTPDPDPDP-TPDPAPDPTPDPDPTPDPDPDPTPDPTPNPTPDPD 749

Query: 175  PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP-TTPST 351
             TP   P  D TP    +P  +P P TP    TP      +P  D +P  DP P  TP +
Sbjct: 750  STPEPDPDPDPTPDPDPTPDPEPIP-TPDPDPTPDPDPDPTPDPDPTPEPDPDPDPTPDS 808

Query: 352  PTTPSGGYYNSPPQDSSPPSDPLP 423
              TP      +P     P  DP P
Sbjct: 809  DPTPDPDPDPTPEPAPDPTPDPAP 832

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 48/140 (34%), Positives = 58/140 (41%), Gaps = 2/140 (1%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNPTPS 186
            P P   + S N T   P    + +P P+P  D   +P    DPTP+P P  D + +P P+
Sbjct: 637  PDPDDNEASEN-TVVEPKPKPTPEPDPTPDPDPDPTPDPDPDPTPNPDPDPDPTTDPDPT 695

Query: 187  TPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT-TP 363
              P  D TP     P  DPTP     PT         P  D +P  DP PT   TP  TP
Sbjct: 696  PDPDPDPTPDPTPDPDPDPTPDPAPDPT---------PDPDPTPDPDPDPTPDPTPNPTP 746

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
                   P  D  P  DP P
Sbjct: 747  DPDSTPEPDPDPDPTPDPDP 766

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 58/185 (31%), Positives = 73/185 (39%), Gaps = 44/185 (23%)
 Frame = +1

Query: 1    DPTPTP-----PSGDGSYNPTPS-------------SPPGGGSYDPTPSPPSDSGGSPPG 126
            DP PTP     P+ D + NPTP              +P    + DP P P  D   +P  
Sbjct: 725  DPDPTPDPDPDPTPDPTPNPTPDPDSTPEPDPDPDPTPDPDPTPDPEPIPTPDPDPTPDP 784

Query: 127  SYDPTPSP---PSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTP-------TTPSTPTTP 276
              DPTP P   P  D   +PTP + P+ D  P     P  DPTP       + P +  TP
Sbjct: 785  DPDPTPDPDPTPEPDPDPDPTPDSDPTPDPDPDPTPEPAPDPTPDPAPAPISDPGSDPTP 844

Query: 277  SGGYYNSP---------------PQDSSPPTDPTPT-TPSTPTTPSGGYYNSPPQDSSPP 408
              G    P               P    P   PTPT  P+  ++P+ G   +PP  SSP 
Sbjct: 845  EPGPSPGPIPIPVPGPASTPDIGPDGPDPIPSPTPTPEPAPSSSPAPG--ATPPDSSSPN 902

Query: 409  SDPLP 423
            S P P
Sbjct: 903  SIPFP 907

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 59/178 (33%), Positives = 69/178 (38%), Gaps = 39/178 (21%)
 Frame = +1

Query: 1    DPTPTP---PSGDGSYNPTPSSPPGGG-SYDPTPSPPSDSGGSP-------PGSYDPTPS 147
            DPTP P   P  D   +PTP S P      DPTP P  D    P       PGS DPTP 
Sbjct: 787  DPTPDPDPTPEPDPDPDPTPDSDPTPDPDPDPTPEPAPDPTPDPAPAPISDPGS-DPTPE 845

Query: 148  P----------------------------PSGDGSYNPTPSTPPSSDCTPPSQDSPPSDP 243
            P                            PS   +  P PS+ P+   TPP   SP S P
Sbjct: 846  PGPSPGPIPIPVPGPASTPDIGPDGPDPIPSPTPTPEPAPSSSPAPGATPPDSSSPNSIP 905

Query: 244  TPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
             P  P   + PS G  + P    +P + P PTT  TP+T   G     P    P S+P
Sbjct: 906  FP-VPFPGSGPSPGPGSVPGGTPAPGSIPAPTT-GTPSTVPSGIETPTPGAEIPVSEP 961

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 56/175 (32%), Positives = 66/175 (37%), Gaps = 36/175 (20%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPSSPPGGGSYD-PTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
            DP P P S  GS +PTP   P  G    P P P S     P G  DP PSP     +  P
Sbjct: 829  DPAPAPISDPGS-DPTPEPGPSPGPIPIPVPGPASTPDIGPDGP-DPIPSPTP---TPEP 883

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
             PS+ P+   TPP   SP S P P  P   + PS G  + P    +P + P PTT +  T
Sbjct: 884  APSSSPAPGATPPDSSSPNSIPFPV-PFPGSGPSPGPGSVPGGTPAPGSIPAPTTGTPST 942

Query: 358  TPSG----------------GYYNSP-------------------PQDSSPPSDP 417
             PSG                G   +P                   P    PPS P
Sbjct: 943  VPSGIETPTPGAEIPVSEPGGQLPTPADSLPDPAERPAPQQDTAAPSRDDPPSPP 997

[85][TOP]
>UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum
           bicolor RepID=C5XPK9_SORBI
          Length = 613

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 49/130 (37%), Positives = 59/130 (45%), Gaps = 1/130 (0%)
 Frame = +1

Query: 4   PTPTPPSGDG-SYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P+P PPS    S +P P SPP      P+PSPP      PP    P+P PPS      P 
Sbjct: 412 PSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPP------PPSPPPPSPPPPS------PP 459

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           P +PP    +PP    PP  P P +PS P         SPP  S PP  P+P  P    +
Sbjct: 460 PPSPPPPSPSPPPPSPPPPSPPPPSPSPPPP-------SPPPPSPPPPSPSPPPPYYEVS 512

Query: 361 PSGGYYNSPP 390
           P   Y + PP
Sbjct: 513 PEERYLSPPP 522

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 52/144 (36%), Positives = 64/144 (44%), Gaps = 5/144 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP    S  P    PP      P+P PPS    SPP    P PSPP    S +P P
Sbjct: 415 PPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPP--PPSPSPPP 472

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPT-TPSGGYYNSPPQDS--SPPTDPTPTTPSTP 354
            +PP     PPS   PP  P P +P  P+ +P   YY   P++   SPP       P+  
Sbjct: 473 PSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPP------PPAYT 526

Query: 355 TTPSGGYYNSPPQDS--SPPSDPL 420
             P   YY   P+D   SPP  P+
Sbjct: 527 EVPPPPYYEVSPEDRYLSPPPPPV 550

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 56/138 (40%), Positives = 62/138 (44%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P+PP       P PS PP      P+P PPS S   PP    P PSPP       P+PS 
Sbjct: 405 PSPPL------PPPSPPP------PSPPPPSPS---PPPPSPPPPSPPP------PSPSP 443

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           PP S   PP    PPS P P+ P  P +PS      PP  S PP  P P +PS P     
Sbjct: 444 PPPSP--PPPSPPPPSPPPPSPP--PPSPS------PPPPSPPPPSPPPPSPSPPPP--- 490

Query: 370 GYYNSPPQDSSPPSDPLP 423
               SPP  S PP  P P
Sbjct: 491 ----SPPPPSPPPPSPSP 504

[86][TOP]
>UniRef100_C5XEJ9 Putative uncharacterized protein Sb03g029150 n=1 Tax=Sorghum
           bicolor RepID=C5XEJ9_SORBI
          Length = 736

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 55/141 (39%), Positives = 67/141 (47%), Gaps = 9/141 (6%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDP--TPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           PP    S +P P  P    S  P  TPSPP  S   PP    P P  PS     + TP+T
Sbjct: 73  PPPKASSSSPPPPPPKASSSSPPPPTPSPPQHSPPPPPSKQSPPPPAPS-----SKTPAT 127

Query: 190 PPSSDCTPPSQDSPPSDPTP---TTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           PP    +P +   PP+ P P   ++P  P +PS    +SPP  SSPP  P  +T ST T 
Sbjct: 128 PPQK--SPTASPPPPASPPPSSKSSPPPPPSPSSTPPSSPPPRSSPPPPPAAST-STSTP 184

Query: 361 PSGGYYNSPPQD----SSPPS 411
           PS     SPP+     S PPS
Sbjct: 185 PSSTSQKSPPKQELTKSPPPS 205

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 50/135 (37%), Positives = 64/135 (47%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTP 192
           T P+G        + PP   S  P P PP  S  SPP    PTPSPP     ++P P   
Sbjct: 59  TSPAGGPPAPKAQAPPPKASSSSPPPPPPKASSSSPP---PPTPSPPQ----HSPPP--- 108

Query: 193 PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGG 372
                 PPS+ SPP  P P++ +  T P      SPP  +SPP   + ++P  P +PS  
Sbjct: 109 ------PPSKQSPPP-PAPSSKTPATPPQKSPTASPPPPASPPPS-SKSSPPPPPSPSST 160

Query: 373 YYNSPPQDSSPPSDP 417
             +SPP  SSPP  P
Sbjct: 161 PPSSPPPRSSPPPPP 175

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 52/142 (36%), Positives = 62/142 (43%), Gaps = 7/142 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           PTP+PP       P+  SPP       TP+ P     SP  S  P  SPP    S  P P
Sbjct: 97  PTPSPPQHSPPPPPSKQSPPPPAPSSKTPATPPQK--SPTASPPPPASPPPSSKSSPPPP 154

Query: 184 ----STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQD---SSPPTDPTPTT 342
               STPPSS   PP + SPP  P  +T ST T PS     SPP+     SPP   +  T
Sbjct: 155 PSPSSTPPSS---PPPRSSPPPPPAAST-STSTPPSSTSQKSPPKQELTKSPPPSSSEKT 210

Query: 343 PSTPTTPSGGYYNSPPQDSSPP 408
           P   + P     +S  +   PP
Sbjct: 211 PGAASPPPNASSDSGSKSQPPP 232

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 49/142 (34%), Positives = 61/142 (42%), Gaps = 10/142 (7%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTP 192
           TPP    + +P P + P   S    P PPS S  +PP S  P  SPP    +   T STP
Sbjct: 127 TPPQKSPTASPPPPASPPPSSKSSPPPPPSPSS-TPPSSPPPRSSPPPPPAASTST-STP 184

Query: 193 PSSDC--TPPSQD---SPPSDPTPTTPSTPTTP-----SGGYYNSPPQDSSPPTDPTPTT 342
           PSS    +PP Q+   SPP   +  TP   + P       G  + PP   +P T    T 
Sbjct: 185 PSSTSQKSPPKQELTKSPPPSSSEKTPGAASPPPNASSDSGSKSQPPPRGTPSTSSDNTA 244

Query: 343 PSTPTTPSGGYYNSPPQDSSPP 408
              P   S G  +SP Q   PP
Sbjct: 245 GRQPPPASSGTPSSPTQMLPPP 266

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 51/162 (31%), Positives = 65/162 (40%), Gaps = 28/162 (17%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP---- 177
           P P S   S   +P  PP   S  P+  PP  S   PP +   T +PPS     +P    
Sbjct: 138 PPPASPPPSSKSSPPPPPSPSSTPPSSPPPRSSPPPPPAASTSTSTPPSSTSQKSPPKQE 197

Query: 178 -TPSTPPSSDCTPPSQDSPP----------SDPTPT-TPSTPTTPSGGYYNSPPQDSSPP 321
            T S PPSS    P   SPP          S P P  TPST +  + G    PP  S  P
Sbjct: 198 LTKSPPPSSSEKTPGAASPPPNASSDSGSKSQPPPRGTPSTSSDNTAG-RQPPPASSGTP 256

Query: 322 TDPTPTTP-----------STPTTPSGGYYNSPPQDS-SPPS 411
           + PT   P           ++   P+ G +  PP  + SPP+
Sbjct: 257 SSPTQMLPPPMAVTVIVPGASGGPPASGRWRGPPGPALSPPA 298

[87][TOP]
>UniRef100_C5JYR8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis SLH14081
            RepID=C5JYR8_AJEDS
          Length = 1704

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 51/141 (36%), Positives = 55/141 (39%), Gaps = 3/141 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PP G G   P P  PPG G+  P P PP   GG PP    P P PP G G+  P P
Sbjct: 920  PPPPPPPGVGLPPPPPPPPPGVGAPPPPPPPPPGIGGPPPPP--PPPPPPPGVGAPPPPP 977

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQD---SSPPTDPTPTTPSTP 354
              PP +   PP    PP    P  P  P    GG    PP       PP  P P     P
Sbjct: 978  PPPPGAGGPPPPPPPPPGVGGPPPPPPPPPGMGGPPLPPPPPPGMGGPPPPPPPPGMRGP 1037

Query: 355  TTPSGGYYNSPPQDSSPPSDP 417
              P G    S  +   P   P
Sbjct: 1038 PPPPGASIGSWKKTYLPADAP 1058

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 50/141 (35%), Positives = 53/141 (37%), Gaps = 6/141 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPG--GGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
            P P PP+  G   P P  PP   G    P P PP    G+PP    P P PP G G   P
Sbjct: 904  PPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPP----PPPPPPPGIGGPPP 959

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTT----PSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
             P  PP     PP   +PP  P P      P  P  P  G    PP    PP    P  P
Sbjct: 960  PPPPPP----PPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPPPPPPPPGMGGPPLP 1015

Query: 346  STPTTPSGGYYNSPPQDSSPP 408
              P    GG    PP    PP
Sbjct: 1016 PPPPPGMGG----PPPPPPPP 1032

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 52/145 (35%), Positives = 53/145 (36%), Gaps = 6/145 (4%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPP--GGGSYDPTPSPPSDSG-GSPPGSYDPTPSPPSGDGSYNP 177
            TP PP       P P  PP  GG    P P PP   G G PP    P P PP G G+  P
Sbjct: 898  TPKPP-------PPPPPPPAVGGPLPPPPPPPPPPPGVGLPP----PPPPPPPGVGAPPP 946

Query: 178  TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
             P  PP     PP    PP  P    P  P  P  G    PP    PP    P  P  P 
Sbjct: 947  PPPPPPGIGGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPPPPPPP 1006

Query: 358  TPSGGYYNSPPQD---SSPPSDPLP 423
               GG    PP       PP  P P
Sbjct: 1007 PGMGGPPLPPPPPPGMGGPPPPPPP 1031

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 41/112 (36%), Positives = 43/112 (38%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PP G G+  P P  PPG G   P P PP   GG PP    P P PP   G   P P
Sbjct: 962  PPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPP----PPPPPPGMGGP--PLP 1015

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
              PP      P    PP  P P     P  P G    S  +   P   P  T
Sbjct: 1016 PPPP------PGMGGPPPPPPPPGMRGPPPPPGASIGSWKKTYLPADAPAAT 1061

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 37/116 (31%), Positives = 38/116 (32%), Gaps = 4/116 (3%)
 Frame = +1

Query: 73   SYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPT 252
            S  P P P +     PP    P P P  G     P P  PP     PP    PP  P P 
Sbjct: 888  SKKPKPEPTTTPKPPPP----PPPPPAVGGPLPPPPPPPPP-----PPGVGLPPPPPPPP 938

Query: 253  ----TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPP 408
                 P  P  P  G    PP    PP  P    P  P  P  G    PP    PP
Sbjct: 939  PGVGAPPPPPPPPPGIGGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPP 994

[88][TOP]
>UniRef100_UPI0001552FA1 PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI0001552FA1
          Length = 261

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 57/169 (33%), Positives = 58/169 (34%), Gaps = 30/169 (17%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYNPT 180
           P PP G     P    PPGG    P P PP   G  PPG   P P    PP G     P 
Sbjct: 52  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGGPQPRPPQGPPPPGGPQQRPP 105

Query: 181 PSTPPSS--DCTPPSQDSPPSDPTPTTPSTPTTPSG-------------GYYNSPPQDSS 315
              PP       PP    PP  P P  P  P  P G             G    PPQ   
Sbjct: 106 QGPPPPGGPQLRPPQGPPPPGGPQPRPPQGPPPPGGPQLRPPQGPPPPAGPQPRPPQGPP 165

Query: 316 PPTDPTPTTPSTPTT------------PSGGYYNSPPQDSSPPSDPLPR 426
           PP  P P  P  P T            P+GG    PPQ   PP  P PR
Sbjct: 166 PPAGPQPRPPQGPPTTGPQPRPTQGPPPTGGPQQRPPQGPPPPGGPQPR 214

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 53/139 (38%), Positives = 54/139 (38%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP       P P   PGG    P P PP   G  PPG   P P PP G       P  
Sbjct: 41  PRPPVNGSQQGPPP---PGG----PQPRPPQ--GPPPPGG--PQPRPPQG-------PPP 82

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           P      PP    PP  P    P  P  P GG    PPQ   PP  P P  P  P  P G
Sbjct: 83  PGGPQPRPPQGPPPPGGPQQRPPQGP-PPPGGPQLRPPQGPPPPGGPQPRPPQGP-PPPG 140

Query: 370 GYYNSPPQDSSPPSDPLPR 426
           G    PPQ   PP+ P PR
Sbjct: 141 GPQLRPPQGPPPPAGPQPR 159

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 51/153 (33%), Positives = 54/153 (35%), Gaps = 17/153 (11%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYNPT 180
           P PP G     P    PPGG    P   PP      PPG   P P    PP G     P 
Sbjct: 94  PPPPGGPQQRPPQGPPPPGGPQLRPPQGPP------PPGGPQPRPPQGPPPPGGPQLRPP 147

Query: 181 PSTPPSS--DCTPPSQDSPPSDPTPTTPSTPTT------------PSGGYYNSPPQDSSP 318
              PP +     PP    PP+ P P  P  P T            P+GG    PPQ   P
Sbjct: 148 QGPPPPAGPQPRPPQGPPPPAGPQPRPPQGPPTTGPQPRPTQGPPPTGGPQQRPPQGPPP 207

Query: 319 PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
           P  P P  P  P  P GG    P Q   P   P
Sbjct: 208 PGGPQPRPPQGP-PPPGGPQPRPTQGPPPTGGP 239

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 45/140 (32%), Positives = 54/140 (38%), Gaps = 1/140 (0%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP G     P    PPGG    P   PP  +G  P     P   PP   G     P  
Sbjct: 122 PPPPGGPQPRPPQGPPPPGGPQLRPPQGPPPPAGPQPR----PPQGPPPPAGPQPRPPQG 177

Query: 190 PPSSDCTP-PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPS 366
           PP++   P P+Q  PP+      P     P GG    PPQ   PP  P P  P+    P+
Sbjct: 178 PPTTGPQPRPTQGPPPTGGPQQRPPQGPPPPGGPQPRPPQGPPPPGGPQP-RPTQGPPPT 236

Query: 367 GGYYNSPPQDSSPPSDPLPR 426
           GG   +PP   +    P  R
Sbjct: 237 GGPQQTPPLAGNTQGPPQGR 256

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 45/125 (36%), Positives = 47/125 (37%)
 Frame = +1

Query: 43  PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQ 222
           P    PP G  + P P P + S   PP    P P PP G       P  P      PP  
Sbjct: 30  PNQRPPPSG--FQPRP-PVNGSQQGPPPPGGPQPRPPQG-------PPPPGGPQPRPPQG 79

Query: 223 DSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSS 402
             PP  P P  P  P  P GG    PPQ   PP  P    P  P  P GG    PPQ   
Sbjct: 80  PPPPGGPQPRPPQGPPPP-GGPQQRPPQGPPPPGGPQLRPPQGP-PPPGGPQPRPPQGPP 137

Query: 403 PPSDP 417
           PP  P
Sbjct: 138 PPGGP 142

[89][TOP]
>UniRef100_UPI00005DC1BB PERK10 (PROLINE-RICH EXTENSIN-LIKE RECEPTOR KINASE 10); ATP binding
           / protein kinase/ protein serine/threonine kinase/
           protein tyrosine kinase n=1 Tax=Arabidopsis thaliana
           RepID=UPI00005DC1BB
          Length = 762

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 59/154 (38%), Positives = 70/154 (45%), Gaps = 14/154 (9%)
 Frame = +1

Query: 4   PTPTPPSG---DGSYNPTPSSPPGG---GSYDPTPSPPSDSGGSPPG-----SYDPTPSP 150
           PT  P +G   + +  P  SSPP      S  P PSPPS S   PP      S  P PSP
Sbjct: 41  PTREPTNGNPPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSP 100

Query: 151 PSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP 330
           P    +  P P+ P SS   PP    PP  PT   P+TP T      N PP   SPP+ P
Sbjct: 101 PPPLPTEAPPPANPVSSP--PPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLP 158

Query: 331 TPTTPSTPTTPSG--GYYNSPPQD-SSPPSDPLP 423
            P  PS P  P       +SPP+   SPP+  +P
Sbjct: 159 APDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIP 192

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 53/141 (37%), Positives = 64/141 (45%), Gaps = 3/141 (2%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP---GSYDPTPSPPSGDGSYNPT 180
           P  PS  G    +P+  P  G+   T + P+ S   P     S  P PSPPS   +  P 
Sbjct: 28  PPQPSFPGDNATSPTREPTNGNPPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLT-GPP 86

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           P+T P S   PP + SPP  P PT    P  P     + PP+ S PP  PT   P+TP T
Sbjct: 87  PTTIPVS---PPPEPSPPP-PLPTEAPPPANPVS---SPPPESSPPPPPPTEAPPTTPIT 139

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
                 N PP   SPPS P P
Sbjct: 140 SPSPPTNPPPPPESPPSLPAP 160

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 53/153 (34%), Positives = 71/153 (46%), Gaps = 13/153 (8%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PPS   +  P P++ P     +P+P PP  +   PP +  P  SPP       P P
Sbjct: 73  PEPSPPSPSLT-GPPPTTIPVSPPPEPSPPPPLPTEAPPPAN--PVSSPPPESSPPPPPP 129

Query: 184 S-TPPSSDCT--------PPSQDSPPSDPTPTTPSTPTTPSGGY--YNSPPQD-SSPPTD 327
           +  PP++  T        PP  +SPPS P P  PS P  P       +SPP+   SPP  
Sbjct: 130 TEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPAS 189

Query: 328 PTPTTP-STPTTPSGGYYNSPPQDSSPPSDPLP 423
             P  P   P+ P+    ++PP DS  PS P P
Sbjct: 190 EIPPPPRHLPSPPASERPSTPPSDSEHPSPPPP 222

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 50/128 (39%), Positives = 65/128 (50%), Gaps = 11/128 (8%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD----SGGSPPGSYDPTPSPPSGDGSYNP 177
           P+PP+ +      PS+PP    + P+P PP          PPGS  PTPSPPS   S  P
Sbjct: 199 PSPPASE-----RPSTPPSDSEH-PSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRP 252

Query: 178 TPSTPPS--SDCTPPSQDSPPSDPTPTTPSTPTT--PSGGYYN--SPPQDS-SPPTDPTP 336
              +PPS   +  PP + SP  DP P+  S+P T  P     +  SPP+ S S P +P+P
Sbjct: 253 VHPSPPSPPEETLPPPKPSP--DPLPSNSSSPPTLLPPSSVVSPPSPPRKSVSGPDNPSP 310

Query: 337 TTPSTPTT 360
             P TP T
Sbjct: 311 NNP-TPVT 317

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 50/152 (32%), Positives = 68/152 (44%), Gaps = 12/152 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP+      P  S  P      P  SPPS     PP +  P P P     S++P  
Sbjct: 124 PPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSN--PLPPPKLVPPSHSPPR 181

Query: 184 --STPPSSDCTPPSQ--DSPPSDPTPTTPST----PTTPSGGY----YNSPPQDSSPPTD 327
              +PP+S+  PP +   SPP+   P+TP +    P+ P  G+       PP  S  PT 
Sbjct: 182 HLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPT- 240

Query: 328 PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P+P +PS    P      SPP+++ PP  P P
Sbjct: 241 PSPPSPSDSKRPVHPSPPSPPEETLPPPKPSP 272

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 46/140 (32%), Positives = 62/140 (44%), Gaps = 2/140 (1%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSG--GSPPGSYDPTPSPPSGDGSYNPTP 183
           P+PP+ +    P P   P   + +   +PPSDS     PP  +      P   GS  PTP
Sbjct: 184 PSPPASE--IPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTP 241

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S P  SD   P   SPPS P  T P    +P       P   SSPPT   P++  +P +P
Sbjct: 242 SPPSPSDSKRPVHPSPPSPPEETLPPPKPSPD----PLPSNSSSPPTLLPPSSVVSPPSP 297

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                + P  D+  P++P P
Sbjct: 298 PRKSVSGP--DNPSPNNPTP 315

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 53/166 (31%), Positives = 67/166 (40%), Gaps = 26/166 (15%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSS---PPGGGSYDPT-----PSPPSDSGGSPPGSYDPTPSPPSG 159
           PT  PP  +   +P P S   PP      PT     PSPP++    PP   +  PS P+ 
Sbjct: 105 PTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTN----PPPPPESPPSLPAP 160

Query: 160 DGSYNPTPSTP--PSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDP 330
           D   NP P     P S   P    SPP+   P  P   P+ P+    ++PP DS  P+ P
Sbjct: 161 DPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPP 220

Query: 331 TPTTPS-------------TPTTPSGGYYNSP--PQDSSPPSDPLP 423
            P  P              TP+ PS      P  P   SPP + LP
Sbjct: 221 PPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLP 266

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 53/161 (32%), Positives = 68/161 (42%), Gaps = 21/161 (13%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSS---PPGGGSYDPTPSPPSDSGG-------SPPGSYDPTPSPP 153
           P P PPS     NP P     PP        PSPP+           SPP S  P+  P 
Sbjct: 158 PAPDPPS-----NPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPS 212

Query: 154 SGDGSYNPTPSTPPSSDCTPP--SQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP-- 321
             +    P P  P   +  PP  S+   PS P+P+    P  PS     SPP+++ PP  
Sbjct: 213 DSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPP---SPPEETLPPPK 269

Query: 322 --TDPTPTTPSTPTT--PSGGYYN--SPPQDS-SPPSDPLP 423
              DP P+  S+P T  P     +  SPP+ S S P +P P
Sbjct: 270 PSPDPLPSNSSSPPTLLPPSSVVSPPSPPRKSVSGPDNPSP 310

[90][TOP]
>UniRef100_Q9C660 Pto kinase interactor, putative n=1 Tax=Arabidopsis thaliana
           RepID=Q9C660_ARATH
          Length = 760

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 59/154 (38%), Positives = 70/154 (45%), Gaps = 14/154 (9%)
 Frame = +1

Query: 4   PTPTPPSG---DGSYNPTPSSPPGG---GSYDPTPSPPSDSGGSPPG-----SYDPTPSP 150
           PT  P +G   + +  P  SSPP      S  P PSPPS S   PP      S  P PSP
Sbjct: 41  PTREPTNGNPPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSP 100

Query: 151 PSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP 330
           P    +  P P+ P SS   PP    PP  PT   P+TP T      N PP   SPP+ P
Sbjct: 101 PPPLPTEAPPPANPVSSP--PPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLP 158

Query: 331 TPTTPSTPTTPSG--GYYNSPPQD-SSPPSDPLP 423
            P  PS P  P       +SPP+   SPP+  +P
Sbjct: 159 APDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIP 192

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 53/141 (37%), Positives = 64/141 (45%), Gaps = 3/141 (2%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP---GSYDPTPSPPSGDGSYNPT 180
           P  PS  G    +P+  P  G+   T + P+ S   P     S  P PSPPS   +  P 
Sbjct: 28  PPQPSFPGDNATSPTREPTNGNPPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLT-GPP 86

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           P+T P S   PP + SPP  P PT    P  P     + PP+ S PP  PT   P+TP T
Sbjct: 87  PTTIPVS---PPPEPSPPP-PLPTEAPPPANPVS---SPPPESSPPPPPPTEAPPTTPIT 139

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
                 N PP   SPPS P P
Sbjct: 140 SPSPPTNPPPPPESPPSLPAP 160

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 53/153 (34%), Positives = 71/153 (46%), Gaps = 13/153 (8%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PPS   +  P P++ P     +P+P PP  +   PP +  P  SPP       P P
Sbjct: 73  PEPSPPSPSLT-GPPPTTIPVSPPPEPSPPPPLPTEAPPPAN--PVSSPPPESSPPPPPP 129

Query: 184 S-TPPSSDCT--------PPSQDSPPSDPTPTTPSTPTTPSGGY--YNSPPQD-SSPPTD 327
           +  PP++  T        PP  +SPPS P P  PS P  P       +SPP+   SPP  
Sbjct: 130 TEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPAS 189

Query: 328 PTPTTP-STPTTPSGGYYNSPPQDSSPPSDPLP 423
             P  P   P+ P+    ++PP DS  PS P P
Sbjct: 190 EIPPPPRHLPSPPASERPSTPPSDSEHPSPPPP 222

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 50/128 (39%), Positives = 65/128 (50%), Gaps = 11/128 (8%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD----SGGSPPGSYDPTPSPPSGDGSYNP 177
           P+PP+ +      PS+PP    + P+P PP          PPGS  PTPSPPS   S  P
Sbjct: 199 PSPPASE-----RPSTPPSDSEH-PSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRP 252

Query: 178 TPSTPPS--SDCTPPSQDSPPSDPTPTTPSTPTT--PSGGYYN--SPPQDS-SPPTDPTP 336
              +PPS   +  PP + SP  DP P+  S+P T  P     +  SPP+ S S P +P+P
Sbjct: 253 VHPSPPSPPEETLPPPKPSP--DPLPSNSSSPPTLLPPSSVVSPPSPPRKSVSGPDNPSP 310

Query: 337 TTPSTPTT 360
             P TP T
Sbjct: 311 NNP-TPVT 317

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 50/152 (32%), Positives = 68/152 (44%), Gaps = 12/152 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP+      P  S  P      P  SPPS     PP +  P P P     S++P  
Sbjct: 124 PPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSN--PLPPPKLVPPSHSPPR 181

Query: 184 --STPPSSDCTPPSQ--DSPPSDPTPTTPST----PTTPSGGY----YNSPPQDSSPPTD 327
              +PP+S+  PP +   SPP+   P+TP +    P+ P  G+       PP  S  PT 
Sbjct: 182 HLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPT- 240

Query: 328 PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P+P +PS    P      SPP+++ PP  P P
Sbjct: 241 PSPPSPSDSKRPVHPSPPSPPEETLPPPKPSP 272

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 46/140 (32%), Positives = 62/140 (44%), Gaps = 2/140 (1%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSG--GSPPGSYDPTPSPPSGDGSYNPTP 183
           P+PP+ +    P P   P   + +   +PPSDS     PP  +      P   GS  PTP
Sbjct: 184 PSPPASE--IPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTP 241

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S P  SD   P   SPPS P  T P    +P       P   SSPPT   P++  +P +P
Sbjct: 242 SPPSPSDSKRPVHPSPPSPPEETLPPPKPSPD----PLPSNSSSPPTLLPPSSVVSPPSP 297

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                + P  D+  P++P P
Sbjct: 298 PRKSVSGP--DNPSPNNPTP 315

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 53/166 (31%), Positives = 67/166 (40%), Gaps = 26/166 (15%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSS---PPGGGSYDPT-----PSPPSDSGGSPPGSYDPTPSPPSG 159
           PT  PP  +   +P P S   PP      PT     PSPP++    PP   +  PS P+ 
Sbjct: 105 PTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTN----PPPPPESPPSLPAP 160

Query: 160 DGSYNPTPSTP--PSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDP 330
           D   NP P     P S   P    SPP+   P  P   P+ P+    ++PP DS  P+ P
Sbjct: 161 DPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPP 220

Query: 331 TPTTPS-------------TPTTPSGGYYNSP--PQDSSPPSDPLP 423
            P  P              TP+ PS      P  P   SPP + LP
Sbjct: 221 PPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLP 266

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 53/161 (32%), Positives = 68/161 (42%), Gaps = 21/161 (13%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSS---PPGGGSYDPTPSPPSDSGG-------SPPGSYDPTPSPP 153
           P P PPS     NP P     PP        PSPP+           SPP S  P+  P 
Sbjct: 158 PAPDPPS-----NPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPS 212

Query: 154 SGDGSYNPTPSTPPSSDCTPP--SQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP-- 321
             +    P P  P   +  PP  S+   PS P+P+    P  PS     SPP+++ PP  
Sbjct: 213 DSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPP---SPPEETLPPPK 269

Query: 322 --TDPTPTTPSTPTT--PSGGYYN--SPPQDS-SPPSDPLP 423
              DP P+  S+P T  P     +  SPP+ S S P +P P
Sbjct: 270 PSPDPLPSNSSSPPTLLPPSSVVSPPSPPRKSVSGPDNPSP 310

[91][TOP]
>UniRef100_C5X8F7 Putative uncharacterized protein Sb02g032910 n=1 Tax=Sorghum
           bicolor RepID=C5X8F7_SORBI
          Length = 493

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 59/163 (36%), Positives = 75/163 (46%), Gaps = 22/163 (13%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           +P  TPP  + S    PS+PP     +P  +PP+ S   PP S  P  SPP    +  P 
Sbjct: 336 EPPSTPP--EASPPEPPSTPPEASPPEPPSTPPASSPPEPP-STPPATSPPEPPAASPPE 392

Query: 181 PST--------------PPSSDCTPP------SQDSPPSDPTPTTPST-PTTPSGGYYNS 297
           P +              PP S  TPP        +SPPS P P +PST P TP     ++
Sbjct: 393 PPSTPPAASPPESPSVPPPESQSTPPPTPAMAPPESPPSTPPPESPSTPPRTPPESPPST 452

Query: 298 PPQDSSPPTDPTPTTPS-TPTTPSGGYYNSPPQDSSPPSDPLP 423
           PP + SP T P P +PS  P TP+     SP   S PP+ P P
Sbjct: 453 PPPE-SPSTTPPPESPSDPPPTPAA---TSPESPSDPPATPSP 491

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 53/149 (35%), Positives = 72/149 (48%), Gaps = 12/149 (8%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP--SPPSGDGSYN 174
           +P  TPP  + S    PS+PP     +P  +PP+ S   PP +  P P  +PP+     +
Sbjct: 348 EPPSTPP--EASPPEPPSTPPASSPPEPPSTPPATSPPEPPAASPPEPPSTPPAASPPES 405

Query: 175 PTPSTPPSSDCTPPSQ-----DSPPSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTP 336
           P+   P S    PP+      +SPPS P P +PSTP  TP     ++PP +S P T P P
Sbjct: 406 PSVPPPESQSTPPPTPAMAPPESPPSTPPPESPSTPPRTPPESPPSTPPPES-PSTTPPP 464

Query: 337 TTPS----TPTTPSGGYYNSPPQDSSPPS 411
            +PS    TP   S    + PP   SP S
Sbjct: 465 ESPSDPPPTPAATSPESPSDPPATPSPSS 493

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 52/145 (35%), Positives = 65/145 (44%), Gaps = 4/145 (2%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS---GDGSY 171
           +P  TPP       P+PS+PP     +P  +PP  S   PP +    P P      + S 
Sbjct: 215 EPPSTPPPVPEP-TPSPSTPPAASPPEPPSTPPEASPPEPPSTPPEAPPPEPLTPPEASP 273

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP-TPTTPS 348
              PSTPPS     PS  +PP+   P  PSTP   S     S P ++SPP  P TP   S
Sbjct: 274 PEPPSTPPSVPEPTPSPSTPPAASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEAS 333

Query: 349 TPTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS     SPP+  S P +  P
Sbjct: 334 PPEPPSTPPEASPPEPPSTPPEASP 358

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 50/139 (35%), Positives = 63/139 (45%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           +P  TPPS      P+PS+PP     +P  +PP  S   PP S  P  SPP    +  P 
Sbjct: 275 EPPSTPPSVPEP-TPSPSTPPAASPPEPPSTPPEASPPEPP-STPPEASPPEPPST--PP 330

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            ++PP    TPP    P    TP   S P  PS    +SPP+   PP+ P  T+P  P  
Sbjct: 331 EASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPASSPPE---PPSTPPATSPPEPPA 387

Query: 361 PSGGYYNSPPQDSSPPSDP 417
            S     S P  +SPP  P
Sbjct: 388 ASPPEPPSTPPAASPPESP 406

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 55/147 (37%), Positives = 69/147 (46%), Gaps = 8/147 (5%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           +P  TPP  + S    PS+PP     +P  +PP  S   PP +  P P P        P+
Sbjct: 180 EPPSTPP--EASPPEPPSTPPEASPPEPL-TPPEASPPEPPSTPPPVPEP-------TPS 229

Query: 181 PSTPPSSD-----CTPP--SQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
           PSTPP++       TPP  S   PPS P    P  P TP       PP  S+PP+ P PT
Sbjct: 230 PSTPPAASPPEPPSTPPEASPPEPPSTPPEAPPPEPLTPPEASPPEPP--STPPSVPEPT 287

Query: 340 -TPSTPTTPSGGYYNSPPQDSSPPSDP 417
            +PSTP   S     S P ++SPP  P
Sbjct: 288 PSPSTPPAASPPEPPSTPPEASPPEPP 314

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 52/143 (36%), Positives = 67/143 (46%), Gaps = 2/143 (1%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           +P  TPP  + S    PS+PP     +P  +PP  S   PP S  P  SPP    +  P 
Sbjct: 300 EPPSTPP--EASPPEPPSTPPEASPPEPPSTPPEASPPEPP-STPPEASPPEPPST--PP 354

Query: 181 PSTPPSSDCTPP--SQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            ++PP    TPP  S   PPS P  T+P  P   S     S P  +SPP  P+   P + 
Sbjct: 355 EASPPEPPSTPPASSPPEPPSTPPATSPPEPPAASPPEPPSTPPAASPPESPSVPPPESQ 414

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
           +TP      +PP+  SPPS P P
Sbjct: 415 STPPPTPAMAPPE--SPPSTPPP 435

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 54/144 (37%), Positives = 68/144 (47%), Gaps = 6/144 (4%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGS----YNP 177
           P PP      NP PS+PP      P+PS P ++    P S  P  SPP    +      P
Sbjct: 149 PVPPM-----NPPPSTPPPVPEPTPSPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPP 203

Query: 178 TPSTPP-SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
            P TPP +S   PPS   P  +PTP+ PSTP   S     S P ++SPP  P+    + P
Sbjct: 204 EPLTPPEASPPEPPSTPPPVPEPTPS-PSTPPAASPPEPPSTPPEASPPEPPSTPPEAPP 262

Query: 355 TTPSGGYYNSPPQD-SSPPSDPLP 423
             P      SPP+  S+PPS P P
Sbjct: 263 PEPLTPPEASPPEPPSTPPSVPEP 286

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 50/142 (35%), Positives = 64/142 (45%), Gaps = 3/142 (2%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPT--PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYN 174
           +P  TPP       P+  P +PP      P  SPP +   +PP   +PTPSP +   +  
Sbjct: 240 EPPSTPPEASPPEPPSTPPEAPPPEPLTPPEASPP-EPPSTPPSVPEPTPSPSTPPAASP 298

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP-TPTTPST 351
           P P + P     P    +PP    P  PSTP   S     S P ++SPP  P TP   S 
Sbjct: 299 PEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASP 358

Query: 352 PTTPSGGYYNSPPQDSSPPSDP 417
           P  PS    +SPP+   PPS P
Sbjct: 359 PEPPSTPPASSPPE---PPSTP 377

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 54/153 (35%), Positives = 71/153 (46%), Gaps = 12/153 (7%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           +P  TPP  + S    PS+PP     +P  +PP  S   PP S  P  SPP    +  P 
Sbjct: 312 EPPSTPP--EASPPEPPSTPPEASPPEPPSTPPEASPPEPP-STPPEASPPEPPST--PP 366

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP----- 345
            S+PP    TPP+  SPP  P  + P  P+TP      SPP+  S P   + +TP     
Sbjct: 367 ASSPPEPPSTPPAT-SPPEPPAASPPEPPSTPPAA---SPPESPSVPPPESQSTPPPTPA 422

Query: 346 -----STPTTPSGGYYNSPPQ--DSSPPSDPLP 423
                S P+TP     ++PP+    SPPS P P
Sbjct: 423 MAPPESPPSTPPPESPSTPPRTPPESPPSTPPP 455

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 54/155 (34%), Positives = 72/155 (46%), Gaps = 14/155 (9%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS------GD 162
           +P  TPP  + S    PS+PP     +P  +PP  S   PP S  P  SPP         
Sbjct: 324 EPPSTPP--EASPPEPPSTPPEASPPEPPSTPPEASPPEPP-STPPASSPPEPPSTPPAT 380

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
               P  ++PP    TPP+  SPP  P+   P + +TP      +PP+  SPP+ P P +
Sbjct: 381 SPPEPPAASPPEPPSTPPAA-SPPESPSVPPPESQSTPPPTPAMAPPE--SPPSTPPPES 437

Query: 343 PST-PTTPSGGYYNSPPQDS-------SPPSDPLP 423
           PST P TP     ++PP +S         PSDP P
Sbjct: 438 PSTPPRTPPESPPSTPPPESPSTTPPPESPSDPPP 472

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 49/140 (35%), Positives = 60/140 (42%), Gaps = 1/140 (0%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           +P  TPP       P P +PP     +P  +PPS    +P  S  P  SPP    +  P 
Sbjct: 252 EPPSTPPEAPP---PEPLTPPEASPPEPPSTPPSVPEPTPSPSTPPAASPPEPPST--PP 306

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQ-DSSPPTDPTPTTPSTPT 357
            ++PP    TPP    P    TP   S P  PS     SPP+  S+PP    P  PSTP 
Sbjct: 307 EASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPP 366

Query: 358 TPSGGYYNSPPQDSSPPSDP 417
             S     S P  +SPP  P
Sbjct: 367 ASSPPEPPSTPPATSPPEPP 386

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 55/152 (36%), Positives = 66/152 (43%), Gaps = 13/152 (8%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPT----PSPPSGDGS 168
           +PTP+P +   +  P P S P   S    PS P ++   PP    P     P PPS   S
Sbjct: 225 EPTPSPSTPPAASPPEPPSTPPEASPPEPPSTPPEA--PPPEPLTPPEASPPEPPSTPPS 282

Query: 169 Y---NPTPSTPPSSD-----CTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQ-DSSPP 321
                P+PSTPP++       TPP    P    TP   S P  PS     SPP+  S+PP
Sbjct: 283 VPEPTPSPSTPPAASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPP 342

Query: 322 TDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
               P  PSTP   S     S P  SSPP  P
Sbjct: 343 EASPPEPPSTPPEASPPEPPSTPPASSPPEPP 374

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 54/151 (35%), Positives = 69/151 (45%), Gaps = 12/151 (7%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTP--SSPPGGGSY-----DPTPSPPSDSGGSPPGSYDPTPSPPSG 159
           +P  TPP        TP  +SPP   S      +PTPSP +    SPP   +P  +PP  
Sbjct: 192 EPPSTPPEASPPEPLTPPEASPPEPPSTPPPVPEPTPSPSTPPAASPP---EPPSTPPEA 248

Query: 160 DGSYNPT--PSTPPSSDCTPPSQDSPPSDPT--PTTPSTPTTPSGGYYNSPPQ-DSSPPT 324
                P+  P  PP    TPP + SPP  P+  P+ P    +PS     SPP+  S+PP 
Sbjct: 249 SPPEPPSTPPEAPPPEPLTPP-EASPPEPPSTPPSVPEPTPSPSTPPAASPPEPPSTPPE 307

Query: 325 DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
              P  PSTP   S     S P ++SPP  P
Sbjct: 308 ASPPEPPSTPPEASPPEPPSTPPEASPPEPP 338

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 56/143 (39%), Positives = 67/143 (46%), Gaps = 5/143 (3%)
 Frame = +1

Query: 4   PTP-TPPSGDGSYNPTPSSPPGGGSYDPTPS-PPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           P P TPP  + S    PS+PP      P+PS PP+ S   PP S  P  SPP    +  P
Sbjct: 263 PEPLTPP--EASPPEPPSTPPSVPEPTPSPSTPPAASPPEPP-STPPEASPPEPPST--P 317

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQ-DSSPPTDPTPTTPSTP 354
             ++PP    TPP    P    TP   S P  PS     SPP+  S+PP    P  PSTP
Sbjct: 318 PEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPASSPPEPPSTP 377

Query: 355 --TTPSGGYYNSPPQDSSPPSDP 417
             T+P      SPP+   PPS P
Sbjct: 378 PATSPPEPPAASPPE---PPSTP 397

[92][TOP]
>UniRef100_B9IAD8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IAD8_POPTR
          Length = 379

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 58/156 (37%), Positives = 69/156 (44%), Gaps = 18/156 (11%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P+PP      +P P SP     Y    SPP  S   PP  Y  +PSPPS   S  P P
Sbjct: 167 PSPSPPPPYYYKSPPPPSPSPPPPY-VYKSPPPPSSSPPPPYYYKSPSPPS---SSPPPP 222

Query: 184 ----STPPSSDCTPPS---QDSPPSDPTP--------TTPSTPTTPSGGYYNSPPQDSSP 318
               S PP S   PP    +  PP DP+P          P +P+ P   YY SPP  SS 
Sbjct: 223 YYYKSPPPLSPSPPPPYYYKSPPPPDPSPPPPYHYKSPPPPSPSPPPPYYYRSPPPPSSS 282

Query: 319 PTDP---TPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
           P  P   +   P +P+ P   YY SPP  S  P  P
Sbjct: 283 PPPPYHYSSPPPPSPSPPPPYYYKSPPPPSPSPPPP 318

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 58/168 (34%), Positives = 69/168 (41%), Gaps = 28/168 (16%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSY------DPTPSPPSDSGGSPPGSYDPTPSPPSGDG 165
           P+P+PP      +P P SP     Y       P+PSPP       P    P+P PP    
Sbjct: 135 PSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYK 194

Query: 166 SYNPTPSTPPS----SDCTPPSQDSPP----SDPTPTTPSTPTTPSGGYYNSPPQDSSPP 321
           S  P  S+PP        +PPS   PP      P P +PS P  P   Y + PP D SPP
Sbjct: 195 SPPPPSSSPPPPYYYKSPSPPSSSPPPPYYYKSPPPLSPSPP--PPYYYKSPPPPDPSPP 252

Query: 322 TD---PTPTTPSTPTTPSGGYYNSPPQDSS-----------PPSDPLP 423
                 +P  PS P+ P   YY SPP  SS           PP  P P
Sbjct: 253 PPYHYKSPPPPS-PSPPPPYYYRSPPPPSSSPPPPYHYSSPPPPSPSP 299

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 56/151 (37%), Positives = 63/151 (41%), Gaps = 16/151 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP    S  P  SSPP    Y  +P PPS S   P     P P  PS    Y    
Sbjct: 105 PSPPPPYEYKSPPPPSSSPPPPYIYK-SPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKS 163

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTP-----STPTTPSGG-----YYNSP-PQDSSPP--- 321
             PPS    PP     P  P+P+ P      +P  PS       YY SP P  SSPP   
Sbjct: 164 PPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSSSPPPPYYYKSPSPPSSSPPPPY 223

Query: 322 --TDPTPTTPSTPTTPSGGYYNSPPQDSSPP 408
               P P +PS P  P   Y + PP D SPP
Sbjct: 224 YYKSPPPLSPSPP--PPYYYKSPPPPDPSPP 252

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 52/153 (33%), Positives = 62/153 (40%), Gaps = 15/153 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSY-DPTPSPPSGDGSYNPT 180
           P+P+PP      +P P SP    +Y     PP      PP  Y  P P  PS    Y   
Sbjct: 55  PSPSPPPPYEYKSPPPPSPHPPPTYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYEYK 114

Query: 181 PSTPPSSDCTPP--SQDSPPSDPTP--------TTPSTPTTPSGGYYNSPPQDSSPPTDP 330
              PPSS   PP   +  PP  P+P          P +P+ P    Y SPP  S  P  P
Sbjct: 115 SPPPPSSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPP 174

Query: 331 ----TPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
               +P  PS P+ P    Y SPP  SS P  P
Sbjct: 175 YYYKSPPPPS-PSPPPPYVYKSPPPPSSSPPPP 206

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 53/146 (36%), Positives = 60/146 (41%), Gaps = 11/146 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP    S  P   SPP    Y    SPP  S   PP  Y  +P PPS   S  P P
Sbjct: 233 PSPPPPYYYKSPPPPDPSPPPPYHYK---SPPPPSPSPPPPYYYRSPPPPS---SSPPPP 286

Query: 184 ----STPPSSDCTPPS---QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP---- 330
               S PP S   PP    +  PP  P+P  P         YY SPP  S  P  P    
Sbjct: 287 YHYSSPPPPSPSPPPPYYYKSPPPPSPSPPPPY--------YYKSPPPPSPSPPPPYVYK 338

Query: 331 TPTTPSTPTTPSGGYYNSPPQDSSPP 408
           +P  PS    P   Y++ PP   SPP
Sbjct: 339 SPPPPSPSPPPPYYYHSPPPAMKSPP 364

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 51/158 (32%), Positives = 60/158 (37%), Gaps = 21/158 (13%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
           +P PP    S  P   SPP    Y    SPP  S   PP     +P PPS      P+P 
Sbjct: 42  SPPPPYVYKSPPPPSPSPPPPYEYK---SPPPPSPHPPPTYVYKSPPPPS------PSPP 92

Query: 187 TPPSSDCTPPSQDSPPSD---PTPTTPSTPTTPSGGYYNSPPQDSSPP-----TDPTPTT 342
            P      PP   SPP      +P  PS+   P   Y + PP   SPP       P P +
Sbjct: 93  PPYIYKSPPPPSPSPPPPYEYKSPPPPSSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPS 152

Query: 343 PS-------------TPTTPSGGYYNSPPQDSSPPSDP 417
           PS             +P+ P   YY SPP  S  P  P
Sbjct: 153 PSPPPPYIYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 190

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 49/131 (37%), Positives = 57/131 (43%), Gaps = 12/131 (9%)
 Frame = +1

Query: 52  SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPS---SDCTPPSQ 222
           SSPP    Y  +P PPS    SPP  Y+    PP       P+P  PP+       PPS 
Sbjct: 41  SSPPPPYVYK-SPPPPSP---SPPPPYEYKSPPP-------PSPHPPPTYVYKSPPPPSP 89

Query: 223 DSPP----SDPTPTTPSTPTTPSGGYYNSPPQDSSPP-----TDPTPTTPSTPTTPSGGY 375
             PP      P P +PS P  P   Y + PP  SSPP       P P +PS P  P   Y
Sbjct: 90  SPPPPYIYKSPPPPSPSPP--PPYEYKSPPPPSSSPPPPYIYKSPPPPSPSPP--PPYVY 145

Query: 376 YNSPPQDSSPP 408
            + PP   SPP
Sbjct: 146 KSPPPPSPSPP 156

[93][TOP]
>UniRef100_B6U4I2 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6U4I2_MAIZE
          Length = 217

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 58/145 (40%), Positives = 69/145 (47%), Gaps = 4/145 (2%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           +P P PP+      P+  SPP   S  P  SPP     SPP   +P  +PPS       +
Sbjct: 85  NPPPPPPT------PSQPSPPESPSTPPAASPPEPPAASPP---EPPSTPPS------ES 129

Query: 181 PSTPPSSD-CTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP-STP 354
           PSTPP +   TPP  DSPPS P P +PS P          P   S PP  PT T P S P
Sbjct: 130 PSTPPPTPTATPP--DSPPSTPPPESPSDP---------PPESPSDPPPTPTATPPESPP 178

Query: 355 TTPSGGYYNSPPQDSSP--PSDPLP 423
           +TP     + PP  + P  PSDP P
Sbjct: 179 STPPPESPSDPPPATPPESPSDPPP 203

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 45/128 (35%), Positives = 65/128 (50%), Gaps = 7/128 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSS----PPGGGSYDPTPSPPSDSGGSPPGSYDPTP--SPPSGDG 165
           PTP+ PS   S +  P++    PP     +P  +PPS+S  +PP +   TP  SPPS   
Sbjct: 91  PTPSQPSPPESPSTPPAASPPEPPAASPPEPPSTPPSESPSTPPPTPTATPPDSPPSTPP 150

Query: 166 SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQD-SSPPTDPTPTT 342
             +P+   P S    PP+  + P +  P+TP  P +PS     +PP+  S PP  P  T 
Sbjct: 151 PESPSDPPPESPSDPPPTPTATPPESPPSTPP-PESPSDPPPATPPESPSDPPPTPAATP 209

Query: 343 PSTPTTPS 366
           P+TP+  S
Sbjct: 210 PTTPSPSS 217

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 36/94 (38%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           D  P+ P  +   +P P SP      DP P+P +    SPP +  P P  PS     +P 
Sbjct: 143 DSPPSTPPPESPSDPPPESPS-----DPPPTPTATPPESPPST--PPPESPS-----DPP 190

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPST-PTTPS 279
           P+TPP S          PSDP PT  +T PTTPS
Sbjct: 191 PATPPES----------PSDPPPTPAATPPTTPS 214

[94][TOP]
>UniRef100_A3KD22 Leucine-rich repeat/extensin 1 n=1 Tax=Nicotiana tabacum
           RepID=A3KD22_TOBAC
          Length = 723

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 55/140 (39%), Positives = 64/140 (45%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           PT TP S       TPSSPP      P P  P+ S   PP  Y P P  PS     +P P
Sbjct: 563 PTYTPQSPPPPVYVTPSSPPPPVYEHPKPPTPTPS---PPAGYTP-PQEPS-----HPAP 613

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            TPP ++  PP   +P   P P+ P T   PS  Y  SPP      T  +P  PS+   P
Sbjct: 614 PTPPCNETPPPPPSTPHWQPKPSPPPT-YNPSPSYTQSPPPPPPTYTYSSPPPPSSSPPP 672

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
              YY+SPP    PPS P P
Sbjct: 673 PTYYYSSPP--PPPPSPPPP 690

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 52/148 (35%), Positives = 65/148 (43%), Gaps = 10/148 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNP---TPSSPPGGGSYDPTP---SPPSDSGGSPPGSYDPTPS---PPS 156
           P   PP     Y P   TP SPP      P P    PP+ +  SPP     TPS   PP 
Sbjct: 532 PQSPPPPPPVHYEPPPYTPQSPP------PPPVHYEPPTYTPQSPPPPVYVTPSSPPPPV 585

Query: 157 GDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
            +    PTP+  P +  TPP + S P+ PTP    TP  P    +  P     P  +P+P
Sbjct: 586 YEHPKPPTPTPSPPAGYTPPQEPSHPAPPTPPCNETPPPPPSTPHWQPKPSPPPTYNPSP 645

Query: 337 TTPSTPTTPSGGY-YNSPPQDSSPPSDP 417
           +   +P  P   Y Y+SPP  SS P  P
Sbjct: 646 SYTQSPPPPPPTYTYSSPPPPSSSPPPP 673

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 56/162 (34%), Positives = 67/162 (41%), Gaps = 24/162 (14%)
 Frame = +1

Query: 4   PTPTPPS----GDGSYNP-TPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP----SPPS 156
           P+P PP        +Y P +P  PP    Y+P    P      PP  Y+P P    SPP 
Sbjct: 496 PSPPPPQPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPPYTPQSPPP 555

Query: 157 GDGSYNP---TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSS---P 318
               Y P   TP +PP      PS   PP    P  P+   +P  GY  +PPQ+ S   P
Sbjct: 556 PPVHYEPPTYTPQSPPPPVYVTPSSPPPPVYEHPKPPTPTPSPPAGY--TPPQEPSHPAP 613

Query: 319 PTDP----TPTTPSTP-----TTPSGGYYNSPPQDSSPPSDP 417
           PT P     P  PSTP      +P   Y  SP    SPP  P
Sbjct: 614 PTPPCNETPPPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPP 655

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 52/147 (35%), Positives = 69/147 (46%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGS---YDPTPSPPSGDGSYN 174
           PTP+PP+G         +PP   S+   P+PP +    PP S   + P PSPP    +YN
Sbjct: 594 PTPSPPAG--------YTPPQEPSHPAPPTPPCNETPPPPPSTPHWQPKPSPPP---TYN 642

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           P+PS   S    PP+       P  ++P  PT     YY+SPP    PP  P P +PS P
Sbjct: 643 PSPSYTQSPPPPPPTYTYSSPPPPSSSPPPPTY----YYSSPP---PPPPSPPPPSPS-P 694

Query: 355 TTPSGGYYNSPP----QDSSPPSDPLP 423
             PS  +   PP      +SPP   +P
Sbjct: 695 PPPSYEHVPLPPIVGVSYASPPPPVIP 721

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 51/166 (30%), Positives = 61/166 (36%), Gaps = 26/166 (15%)
 Frame = +1

Query: 4   PTPTPPSGDGSYN--------------PT-----PSSPPGGGSYDPTPSPPSDSGGSPPG 126
           P P PP     Y+              PT     P  PP    Y+P    P      PP 
Sbjct: 482 PPPPPPPSPVYYHHPSPPPPQPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPV 541

Query: 127 SYDPTP----SPPSGDGSYNP---TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGG 285
            Y+P P    SPP     Y P   TP +PP      PS   PP    P  P+   +P  G
Sbjct: 542 HYEPPPYTPQSPPPPPVHYEPPTYTPQSPPPPVYVTPSSPPPPVYEHPKPPTPTPSPPAG 601

Query: 286 YYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           Y  +PPQ+ S P  PTP    TP  P    +  P     P  +P P
Sbjct: 602 Y--TPPQEPSHPAPPTPPCNETPPPPPSTPHWQPKPSPPPTYNPSP 645

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 48/150 (32%), Positives = 62/150 (41%), Gaps = 13/150 (8%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           PT P       P PSS   G  +  +P PP  +   PP S  P P   S   S+      
Sbjct: 412 PTKPIVPIESPPPPSSKSSGSHFKRSPPPPQST---PPPSPPPPPPVYSSSPSHQHRSPP 468

Query: 190 PPSSDCTPPSQDSPPSDPTPTT----PSTPTTPSGGYYNSP---PQDSSPPTDPT----P 336
           PP+   +P ++ +PP  P P+       +P  P   YY  P   PQ   PP  P     P
Sbjct: 469 PPTHKISPVTRHAPPPPPPPSPVYYHHPSPPPPQPVYYAPPTYKPQSPPPPPPPVHYEPP 528

Query: 337 T-TPSTPTTPSGGYYNSPP-QDSSPPSDPL 420
           T TP +P  P   +Y  PP    SPP  P+
Sbjct: 529 TYTPQSPPPPPPVHYEPPPYTPQSPPPPPV 558

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 40/122 (32%), Positives = 51/122 (41%), Gaps = 9/122 (7%)
 Frame = +1

Query: 82  PTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSD---------CTPPSQDSPP 234
           PTP P      + P +  P PSPP+      P  S PP S            PP Q +PP
Sbjct: 391 PTPKPKRPPVQNKPPA--PKPSPPT--KPIVPIESPPPPSSKSSGSHFKRSPPPPQSTPP 446

Query: 235 SDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
             P P  P   ++PS   + SPP  +   +  T   P  P  PS  YY+ P   S PP  
Sbjct: 447 PSPPPPPPVYSSSPS-HQHRSPPPPTHKISPVTRHAPPPPPPPSPVYYHHP---SPPPPQ 502

Query: 415 PL 420
           P+
Sbjct: 503 PV 504

[95][TOP]
>UniRef100_C4M0W3 Lysozyme, putative n=1 Tax=Entamoeba histolytica HM-1:IMSS
           RepID=C4M0W3_ENTHI
          Length = 722

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 61/156 (39%), Positives = 79/156 (50%), Gaps = 23/156 (14%)
 Frame = +1

Query: 19  PSGDGSYNPTPS--SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP----PSGDGSYNP- 177
           P+G    NPTP   +P  G +   +PS PS  G +P G  D TPS     PSGD + +  
Sbjct: 191 PAGVTPVNPTPEPETPTDGSTDGNSPSTPSTDGNTPSG--DSTPSTDGNTPSGDSTPSTD 248

Query: 178 --TPSTPPSSDCTPPSQDSPPSDPTPTTPS----TPTTPSGGYYNSPPQDSSPPTDPTPT 339
             TPSTP +   TP    +P +D TP+TPS    TP+TPS G  N+P   S+ P+  + T
Sbjct: 249 GNTPSTPSTDGNTPSGDSTPSTDITPSTPSSGSNTPSTPSSGS-NTPSSSSNTPSSSSNT 307

Query: 340 ------TPS----TPTTPSGGYYNSPPQDSSPPSDP 417
                 TPS    TP+TPS G  N     S+  S P
Sbjct: 308 PSSSSNTPSSSSNTPSTPSSGSNNGSSNGSNNTSKP 343

[96][TOP]
>UniRef100_C3Y885 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae
           RepID=C3Y885_BRAFL
          Length = 657

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 55/155 (35%), Positives = 71/155 (45%), Gaps = 14/155 (9%)
 Frame = +1

Query: 1   DPTPTPPSGDG-SYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           D    PPS D  S  P+P +P    S D   +PPS    S P S D    PPS D    P
Sbjct: 193 DNPSAPPSPDNPSAPPSPDNPSVPPSTDNPSAPPSTDNPSAPPSPDNPSVPPSPDNPSAP 252

Query: 178 ----TPSTPPSSD--CTPPSQDSP---PSDPTPTTPSTPTTPSG----GYYNSPPQDSSP 318
                PS PPS+D    PPS D+P   PS   P+ P +P  PS        ++PP   +P
Sbjct: 253 PSPDNPSVPPSTDNPSAPPSTDNPSAPPSPDNPSAPPSPDNPSAHPSHDNRSAPPSPDNP 312

Query: 319 PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              P+P  PS P +P     ++PP   +P + P P
Sbjct: 313 SVPPSPDNPSAPPSPDNP--SAPPSPDNPSAPPSP 345

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 48/143 (33%), Positives = 68/143 (47%), Gaps = 2/143 (1%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           +P+  P + + S  P+P +P    S D   +PPS    S P S D   +PPS D      
Sbjct: 221 NPSAPPSTDNPSAPPSPDNPSVPPSPDNPSAPPSPDNPSVPPSTDNPSAPPSTDN----- 275

Query: 181 PSTPPSSD--CTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           PS PPS D    PPS D+P + P+    S P +P     + PP   +P   P+P  PS P
Sbjct: 276 PSAPPSPDNPSAPPSPDNPSAHPSHDNRSAPPSPDNP--SVPPSPDNPSAPPSPDNPSAP 333

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
            +P     ++PP   +P + P P
Sbjct: 334 PSPDNP--SAPPSPDNPSAPPSP 354

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 53/147 (36%), Positives = 67/147 (45%), Gaps = 10/147 (6%)
 Frame = +1

Query: 13  TPPSGDG-SYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP---- 177
           +PPS D  S  P+P +P    S D   +PPS    S P S D   +PPS D    P    
Sbjct: 179 SPPSPDNPSAPPSPDNPSAPPSPDNPSAPPSPDNPSVPPSTDNPSAPPSTDNPSAPPSPD 238

Query: 178 TPSTPPSSD--CTPPSQDSP---PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
            PS PPS D    PPS D+P   PS   P+ P +   PS     +PP   +P   P+P  
Sbjct: 239 NPSVPPSPDNPSAPPSPDNPSVPPSTDNPSAPPSTDNPS-----APPSPDNPSAPPSPDN 293

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PS    PS    ++PP   +P   P P
Sbjct: 294 PS--AHPSHDNRSAPPSPDNPSVPPSP 318

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 49/129 (37%), Positives = 62/129 (48%), Gaps = 7/129 (5%)
 Frame = +1

Query: 1   DPTPTPPSGDG-SYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG-SYN 174
           D    PPS D  S  P+P +P    S D   +PPS    S P S D   +PPS D  S +
Sbjct: 238 DNPSVPPSPDNPSAPPSPDNPSVPPSTDNPSAPPSTDNPSAPPSPDNPSAPPSPDNPSAH 297

Query: 175 PTP---STPPSSD--CTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
           P+    S PPS D    PPS D+P + P+P  PS P         SP   S+PP+   P+
Sbjct: 298 PSHDNRSAPPSPDNPSVPPSPDNPSAPPSPDNPSAPP--------SPDNPSAPPSPDNPS 349

Query: 340 TPSTPTTPS 366
            P +P  PS
Sbjct: 350 APPSPDNPS 358

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 34/115 (29%), Positives = 52/115 (45%), Gaps = 2/115 (1%)
 Frame = +1

Query: 85  TPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSD--CTPPSQDSPPSDPTPTTP 258
           TP   ++ G +P  S +   +P   +        +PPS D    PPS D+P + P+P  P
Sbjct: 145 TPHISNNEGDTPHISNNEGDTPHISNNEAQLAALSPPSPDNPSAPPSPDNPSAPPSPDNP 204

Query: 259 STPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           S P +P     + PP   +P   P+   PS P +P     + PP   +P + P P
Sbjct: 205 SAPPSPDNP--SVPPSTDNPSAPPSTDNPSAPPSPDNP--SVPPSPDNPSAPPSP 255

[97][TOP]
>UniRef100_Q18DZ3 Probable cell surface glycoprotein n=1 Tax=Haloquadratum walsbyi
           DSM 16790 RepID=Q18DZ3_HALWD
          Length = 1358

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 58/150 (38%), Positives = 73/150 (48%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4   PTPTP-----PSGDGSYNPTPS---SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSG 159
           PTPTP     P+   +  PTPS   SP    +  PTPSP S    SP  S  PTP+PP+ 
Sbjct: 282 PTPTPTQTPTPTLTPTSTPTPSPTPSPTSTPTPSPTPSPTSTPTPSPTPSPTPTPTPPA- 340

Query: 160 DGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTP 336
             +  PTP+  PS    P +   P S PTPT   TPT TP      +P   ++P   PTP
Sbjct: 341 --TATPTPTPTPSPTPAPTNTPPPTSAPTPTATPTPTPTP------TPTPTATPTPTPTP 392

Query: 337 T-TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           T TP+   TP+     SP   ++P   P P
Sbjct: 393 TPTPTATPTPTPTPTPSPTPTATPTPTPTP 422

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 52/145 (35%), Positives = 75/145 (51%), Gaps = 7/145 (4%)
 Frame = +1

Query: 7   TPTP-PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-----PSGDGS 168
           TPTP P+   +  PTPS  P   S  PTP+PP+ +  +P  +  PTP+P     P+   +
Sbjct: 311 TPTPSPTPSPTSTPTPSPTP---SPTPTPTPPATATPTPTPTPSPTPAPTNTPPPTSAPT 367

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
              TP+  P+   TP +  +P   PTPT  +TP TP+     SP   ++P   PTPT   
Sbjct: 368 PTATPTPTPTPTPTPTATPTPTPTPTPTPTATP-TPTPTPTPSPTPTATPTPTPTPTPSP 426

Query: 349 TPT-TPSGGYYNSPPQDSSPPSDPL 420
           TPT TP+    ++P   S  P+ P+
Sbjct: 427 TPTATPTATATSTPTPPSVEPTTPV 451

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 47/123 (38%), Positives = 60/123 (48%), Gaps = 2/123 (1%)
 Frame = +1

Query: 4   PTPTPPS-GDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNP 177
           PTPTPP+    +  PTPS  P      PT +PP  S  +P  +  PTP+P P+   +  P
Sbjct: 334 PTPTPPATATPTPTPTPSPTPA-----PTNTPPPTSAPTPTATPTPTPTPTPTPTATPTP 388

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
           TP+  P+   TP    +P   PTPT   TPT        +P    +P   PT T  STPT
Sbjct: 389 TPTPTPTPTATPTPTPTPTPSPTPTATPTPTP-------TPTPSPTPTATPTATATSTPT 441

Query: 358 TPS 366
            PS
Sbjct: 442 PPS 444

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 57/151 (37%), Positives = 73/151 (48%), Gaps = 12/151 (7%)
 Frame = +1

Query: 7   TPTP-PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP---PSGDGSYN 174
           TPTP PS   S  PTP+  P      PTPSP      +P  +  PT +P   P+   +  
Sbjct: 253 TPTPTPSPTPSPTPTPTQTPTPTPL-PTPSPTPTPTQTPTPTLTPTSTPTPSPTPSPTST 311

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPT-TPSGGYYNSP-PQDSSPPTD-PTPTTP 345
           PTPS  PS   TP    +P   PTPT P+T T TP+     +P P ++ PPT  PTPT  
Sbjct: 312 PTPSPTPSPTSTPTPSPTPSPTPTPTPPATATPTPTPTPSPTPAPTNTPPPTSAPTPTAT 371

Query: 346 STPT-----TPSGGYYNSPPQDSSPPSDPLP 423
            TPT     TP+     +P    +P + P P
Sbjct: 372 PTPTPTPTPTPTATPTPTPTPTPTPTATPTP 402

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 53/141 (37%), Positives = 67/141 (47%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           PT TP        PTPS         PTPSP      +P  +  PTPS P+   +  PTP
Sbjct: 250 PTQTP-------TPTPS---------PTPSPTPTPTQTPTPTPLPTPS-PTPTPTQTPTP 292

Query: 184 STPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           +  P+S  TP    SP S PTP+ TPS  +TP+     SP    +PP   TPT   TP +
Sbjct: 293 TLTPTSTPTPSPTPSPTSTPTPSPTPSPTSTPTPSPTPSPTPTPTPPATATPTPTPTP-S 351

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P+    N+PP  S+P     P
Sbjct: 352 PTPAPTNTPPPTSAPTPTATP 372

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 42/145 (28%), Positives = 64/145 (44%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-----PSGDGS 168
           PTP+P     +  P  S+P    +  PTP+P      +P  +  PTP+P     P+   +
Sbjct: 348 PTPSPTPAPTNTPPPTSAPTPTATPTPTPTPTPTPTATPTPTPTPTPTPTATPTPTPTPT 407

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
            +PTP+  P+   TP    +P + PT T  STPT PS         +    +D   ++ S
Sbjct: 408 PSPTPTATPTPTPTPTPSPTPTATPTATATSTPTPPSVEPTTPVDTEDENESDSDSSSGS 467

Query: 349 TPTTPSGGYYNSPPQDSSPPSDPLP 423
           +  +  G   N+ P   S P  P P
Sbjct: 468 STDSSGGSNSNNKPDKQSTPKAPTP 492

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 44/126 (34%), Positives = 62/126 (49%), Gaps = 9/126 (7%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNP 177
           PTPTP P+   +  PTP+  P   +  PTP+P      +P  +  PTP+P PS   +  P
Sbjct: 376 PTPTPTPTATPTPTPTPTPTP---TATPTPTPTPTPSPTPTATPTPTPTPTPSPTPTATP 432

Query: 178 TPS-----TPPSSDCTPP--SQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           T +     TPPS + T P  ++D   SD   ++ S+  +  G   N+ P   S P  PTP
Sbjct: 433 TATATSTPTPPSVEPTTPVDTEDENESDSDSSSGSSTDSSGGSNSNNKPDKQSTPKAPTP 492

Query: 337 TTPSTP 354
           T   TP
Sbjct: 493 TPTPTP 498

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 52/152 (34%), Positives = 67/152 (44%), Gaps = 12/152 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           PT TP +      PT ++ P   S  PT +  +    +P  +  PT +P        PTP
Sbjct: 212 PTATPTA-----TPTATATPTATS-TPTATATATITSTPVSTSTPTQTP-------TPTP 258

Query: 184 STPPSSDCTPPSQDSPPSDPTP--TTPSTPT-----TPSGGYYNSP-PQDSSPPT-DPTP 336
           S  PS   TP    +P   PTP  T   T T     TP+     SP P  +S PT  PTP
Sbjct: 259 SPTPSPTPTPTQTPTPTPLPTPSPTPTPTQTPTPTLTPTSTPTPSPTPSPTSTPTPSPTP 318

Query: 337 TTPSTPT---TPSGGYYNSPPQDSSPPSDPLP 423
           +  STPT   TPS     +PP  ++P   P P
Sbjct: 319 SPTSTPTPSPTPSPTPTPTPPATATPTPTPTP 350

[98][TOP]
>UniRef100_P05143-2 Isoform 2 of Proline-rich protein 2 n=1 Tax=Mus musculus
           RepID=P05143-2
          Length = 303

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 54/139 (38%), Positives = 55/139 (39%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP G     P    PPGG    P P PP   G  PPG   P P PP G       P  
Sbjct: 52  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGG--PQPRPPQG-------PPP 96

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           P      PP    PP  P P  P  P  P GG    PPQ   PP  P    P  P  P G
Sbjct: 97  PGGPQPRPPQGPPPPGGPQPRPPQGPPPP-GGPQPRPPQGPPPPGGPQQRPPQGP-PPPG 154

Query: 370 GYYNSPPQDSSPPSDPLPR 426
           G    PPQ   PP+ P PR
Sbjct: 155 GPQPRPPQGPPPPAGPQPR 173

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 56/142 (39%), Positives = 56/142 (39%), Gaps = 5/142 (3%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSS-----PPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           PPSG     P   S     PPGG    P P PP   G  PPG   P P PP G       
Sbjct: 35  PPSGSQPRPPVNGSQQGPPPPGG----PQPRPPQ--GPPPPGG--PQPRPPQG------- 79

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           P  P      PP    PP  P P  P  P  P GG    PPQ   PP  P P  P  P  
Sbjct: 80  PPPPGGPQPRPPQGPPPPGGPQPRPPQGP-PPPGGPQPRPPQGPPPPGGPQPRPPQGP-P 137

Query: 361 PSGGYYNSPPQDSSPPSDPLPR 426
           P GG    PPQ   PP  P PR
Sbjct: 138 PPGGPQQRPPQGPPPPGGPQPR 159

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 54/144 (37%), Positives = 55/144 (38%), Gaps = 5/144 (3%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYNPT 180
           P PP G     P    PPGG    P P PP   G  PPG   P P    PP G     P 
Sbjct: 66  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGGPQPRPPQGPPPPGGPQPRPP 119

Query: 181 PSTPPSS--DCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
              PP       PP    PP  P    P  P  P GG    PPQ   PP  P P  P  P
Sbjct: 120 QGPPPPGGPQPRPPQGPPPPGGPQQRPPQGPPPP-GGPQPRPPQGPPPPAGPQPRPPQGP 178

Query: 355 TTPSGGYYNSPPQDSSPPSDPLPR 426
             P+GG     PQ   PP  P PR
Sbjct: 179 -PPTGGPQQRYPQSPPPPGGPQPR 201

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 52/144 (36%), Positives = 56/144 (38%), Gaps = 5/144 (3%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYNPT 180
           P PP G     P    PPGG    P P PP   G  PPG   P P    PP G     P 
Sbjct: 94  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGGPQPRPPQGPPPPGGPQQRPP 147

Query: 181 PSTPPSS--DCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
              PP       PP    PP+ P P  P  P  P+GG     PQ   PP  P P  P  P
Sbjct: 148 QGPPPPGGPQPRPPQGPPPPAGPQPRPPQGPP-PTGGPQQRYPQSPPPPGGPQPRPPQGP 206

Query: 355 TTPSGGYYNSPPQDSSPPSDPLPR 426
             P G +    P    PP+ P PR
Sbjct: 207 PPPGGPH--PRPTQGPPPTGPQPR 228

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 52/145 (35%), Positives = 56/145 (38%), Gaps = 6/145 (4%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP------PGSYDPTPSPPSGDGSY 171
           P PP G     P    PPGG    P   PP   G  P      P    P P PP G    
Sbjct: 122 PPPPGGPQPRPPQGPPPPGGPQQRPPQGPPPPGGPQPRPPQGPPPPAGPQPRPPQG---- 177

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            P P+  P      P    PP  P P  P  P  P GG +  P Q   PPT P P  P+ 
Sbjct: 178 -PPPTGGPQQRY--PQSPPPPGGPQPRPPQGPPPP-GGPHPRPTQ-GPPPTGPQP-RPTQ 231

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLPR 426
              P+GG    PPQ   PP  P PR
Sbjct: 232 GPPPTGGPQQRPPQGPPPPGGPQPR 256

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 50/164 (30%), Positives = 59/164 (35%), Gaps = 25/164 (15%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSG------------GSPPGSYDPTPSPP 153
           P PP G     P    PPGG    P   PP  +G            G P   Y  +P PP
Sbjct: 136 PPPPGGPQQRPPQGPPPPGGPQPRPPQGPPPPAGPQPRPPQGPPPTGGPQQRYPQSPPPP 195

Query: 154 SGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT 333
            G     P    PP      P+Q  PP+ P P  P+    P+GG    PPQ   PP  P 
Sbjct: 196 GGPQPRPPQGPPPPGGPHPRPTQGPPPTGPQPR-PTQGPPPTGGPQQRPPQGPPPPGGPQ 254

Query: 334 PTTPSTPTT-------------PSGGYYNSPPQDSSPPSDPLPR 426
           P  P  P               P+GG   +PP   +P   P  R
Sbjct: 255 PRPPQGPPPPTGPQPRPTQGPHPTGGPQQTPPLAGNPQGPPQGR 298

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 37/90 (41%), Positives = 37/90 (41%), Gaps = 6/90 (6%)
 Frame = +1

Query: 175 PTPSTPPS-SDCTPPSQDS-----PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           P    PPS S   PP   S     PP  P P  P  P  P GG    PPQ   PP  P P
Sbjct: 30  PNQRPPPSGSQPRPPVNGSQQGPPPPGGPQPRPPQGP-PPPGGPQPRPPQGPPPPGGPQP 88

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
             P  P  P GG    PPQ   PP  P PR
Sbjct: 89  RPPQGP-PPPGGPQPRPPQGPPPPGGPQPR 117

[99][TOP]
>UniRef100_P05143 Proline-rich protein 2 n=1 Tax=Mus musculus RepID=PRP2_MOUSE
          Length = 317

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 54/139 (38%), Positives = 55/139 (39%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP G     P    PPGG    P P PP   G  PPG   P P PP G       P  
Sbjct: 52  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGG--PQPRPPQG-------PPP 96

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           P      PP    PP  P P  P  P  P GG    PPQ   PP  P    P  P  P G
Sbjct: 97  PGGPQPRPPQGPPPPGGPQPRPPQGPPPP-GGPQPRPPQGPPPPGGPQQRPPQGP-PPPG 154

Query: 370 GYYNSPPQDSSPPSDPLPR 426
           G    PPQ   PP+ P PR
Sbjct: 155 GPQPRPPQGPPPPAGPQPR 173

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 56/142 (39%), Positives = 56/142 (39%), Gaps = 5/142 (3%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSS-----PPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           PPSG     P   S     PPGG    P P PP   G  PPG   P P PP G       
Sbjct: 35  PPSGSQPRPPVNGSQQGPPPPGG----PQPRPPQ--GPPPPGG--PQPRPPQG------- 79

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           P  P      PP    PP  P P  P  P  P GG    PPQ   PP  P P  P  P  
Sbjct: 80  PPPPGGPQPRPPQGPPPPGGPQPRPPQGP-PPPGGPQPRPPQGPPPPGGPQPRPPQGP-P 137

Query: 361 PSGGYYNSPPQDSSPPSDPLPR 426
           P GG    PPQ   PP  P PR
Sbjct: 138 PPGGPQQRPPQGPPPPGGPQPR 159

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 52/136 (38%), Positives = 54/136 (39%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP G     P    PPGG    P P PP   G  PPG   P P PP G       P  
Sbjct: 66  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGG--PQPRPPQG-------PPP 110

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           P      PP    PP  P P  P  P  P GG    PPQ   PP  P P  P  P  P+G
Sbjct: 111 PGGPQPRPPQGPPPPGGPQPRPPQGP-PPPGGPQQRPPQGPPPPGGPQPRPPQGPPPPAG 169

Query: 370 GYYNSPPQDSSPPSDP 417
                PPQ   PP+ P
Sbjct: 170 P-QPRPPQGPPPPAGP 184

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 50/150 (33%), Positives = 58/150 (38%), Gaps = 11/150 (7%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS--------PPGSYDPTPS---PPS 156
           P PP+G     P    PP G    PT  PP   G          PPG   P P    PP 
Sbjct: 164 PPPPAGPQPRPPQGPPPPAGPHLRPTQGPPPTGGPQQRYPQSPPPPGGPQPRPPQGPPPP 223

Query: 157 GDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           G     PT   PP+     P+Q  PP+      P     P GG    PPQ   PPT P P
Sbjct: 224 GGPHPRPTQGPPPTGPQPRPTQGPPPTGGPQQRPPQGPPPPGGPQPRPPQGPPPPTGPQP 283

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
             P+    P+GG   +PP   +P   P  R
Sbjct: 284 -RPTQGPHPTGGPQQTPPLAGNPQGPPQGR 312

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 52/144 (36%), Positives = 55/144 (38%), Gaps = 5/144 (3%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYNPT 180
           P PP G     P    PPGG    P P PP   G  PPG   P P    PP G     P 
Sbjct: 80  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGGPQPRPPQGPPPPGGPQPRPP 133

Query: 181 PSTPPSS--DCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
              PP       PP    PP  P P  P  P  P+G     PPQ   PP  P    P+  
Sbjct: 134 QGPPPPGGPQQRPPQGPPPPGGPQPRPPQGPPPPAGPQPR-PPQGPPPPAGP-HLRPTQG 191

Query: 355 TTPSGGYYNSPPQDSSPPSDPLPR 426
             P+GG     PQ   PP  P PR
Sbjct: 192 PPPTGGPQQRYPQSPPPPGGPQPR 215

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 51/155 (32%), Positives = 55/155 (35%), Gaps = 14/155 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG-------SPPGSYDPTPSPPSG- 159
           P   PP G     P    PP GG     P  P   GG        PP    P P PP G 
Sbjct: 119 PQGPPPPGGPQPRPPQGPPPPGGPQQRPPQGPPPPGGPQPRPPQGPPPPAGPQPRPPQGP 178

Query: 160 ----DGSYNPTPSTPPSSDCTP--PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP 321
                    PT   PP+       P    PP  P P  P  P  P G +    P    PP
Sbjct: 179 PPPAGPHLRPTQGPPPTGGPQQRYPQSPPPPGGPQPRPPQGPPPPGGPH--PRPTQGPPP 236

Query: 322 TDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
           T P P  P+    P+GG    PPQ   PP  P PR
Sbjct: 237 TGPQP-RPTQGPPPTGGPQQRPPQGPPPPGGPQPR 270

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 53/150 (35%), Positives = 57/150 (38%), Gaps = 9/150 (6%)
 Frame = +1

Query: 4   PTPTPPSGD----GSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP---SPPSGD 162
           P P PP G     G     P  PP  G   P P PP   G  PPG   P P    PP G 
Sbjct: 86  PQPRPPQGPPPPGGPQPRPPQGPPPPGG--PQPRPP--QGPPPPGGPQPRPPQGPPPPGG 141

Query: 163 GSYNPTPSTPP--SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
               P    PP       PP    PP+ P P  P  P  P+G +   P Q   P   P  
Sbjct: 142 PQQRPPQGPPPPGGPQPRPPQGPPPPAGPQPRPPQGPPPPAGPHLR-PTQGPPPTGGPQQ 200

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
             P +P  P GG    PPQ   PP  P PR
Sbjct: 201 RYPQSP-PPPGGPQPRPPQGPPPPGGPHPR 229

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 52/157 (33%), Positives = 56/157 (35%), Gaps = 18/157 (11%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYNPT 180
           P PP G     P    PPGG    P P PP   G  PPG   P P    PP G     P 
Sbjct: 94  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGGPQPRPPQGPPPPGGPQQRPP 147

Query: 181 PSTPPSS--DCTPPSQDSPPSDPTPTTPSTPTTPSG-------------GYYNSPPQDSS 315
              PP       PP    PP+ P P  P  P  P+G             G     PQ   
Sbjct: 148 QGPPPPGGPQPRPPQGPPPPAGPQPRPPQGPPPPAGPHLRPTQGPPPTGGPQQRYPQSPP 207

Query: 316 PPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
           PP  P P  P  P  P G +    P    PP+ P PR
Sbjct: 208 PPGGPQPRPPQGPPPPGGPH--PRPTQGPPPTGPQPR 242

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 37/90 (41%), Positives = 37/90 (41%), Gaps = 6/90 (6%)
 Frame = +1

Query: 175 PTPSTPPS-SDCTPPSQDS-----PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           P    PPS S   PP   S     PP  P P  P  P  P GG    PPQ   PP  P P
Sbjct: 30  PNQRPPPSGSQPRPPVNGSQQGPPPPGGPQPRPPQGP-PPPGGPQPRPPQGPPPPGGPQP 88

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
             P  P  P GG    PPQ   PP  P PR
Sbjct: 89  RPPQGP-PPPGGPQPRPPQGPPPPGGPQPR 117

[100][TOP]
>UniRef100_UPI0000DD9D0C Os11g0657400 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD9D0C
          Length = 1399

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/138 (36%), Positives = 71/138 (51%), Gaps = 5/138 (3%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
            PTP S   S  P P +P G     P  +PP++     P S   +P PP+ +G     P +
Sbjct: 652  PTPESKASS--PPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKS 709

Query: 190  PPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPTDPTP-TTPSTPT- 357
             P  + +PP+ +S  S P P  P   TP+ P     +SPP++ SPP  PT  T+P TP  
Sbjct: 710  TPPVEKSPPTPESEASSPPPPAPEGHTPSPPK----SSPPEEKSPPIPPTSHTSPPTPEE 765

Query: 358  -TPSGGYYNSPPQDSSPP 408
             TPS    +SPP++ SPP
Sbjct: 766  YTPSPP-KSSPPEEKSPP 782

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 55/144 (38%), Positives = 72/144 (50%), Gaps = 8/144 (5%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP----SPPSGDGSYNPTP 183
           PP G     PT S  P       TPSPP    G P G   PTP    SPP     Y P+P
Sbjct: 550 PPEGKSPPTPTASHSPPPVPEGHTPSPPKS--GPPAGESPPTPESKASPPPTPEEYTPSP 607

Query: 184 --STPPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
             STPP ++ +PP+ +S  S P P  P   TP+ P     ++PP + SPPT  +  +   
Sbjct: 608 PKSTPP-AEKSPPTPESKASSPPPPAPEGHTPSPPE----STPPSEKSPPTPESKASSPP 662

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLP 423
           P TP  G+  SPP+ S+PP++  P
Sbjct: 663 PPTPE-GHTPSPPK-STPPTEKSP 684

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 56/153 (36%), Positives = 81/153 (52%), Gaps = 14/153 (9%)
 Frame = +1

Query: 7    TPTPPSGD---GSYNPTPSS----PPGGGSYDPTP---SPPSDSGGSPPGSYDPTPSPPS 156
            TP+PP      G   PTP S    PP    Y P+P   +PP++     P S   +P PP+
Sbjct: 573  TPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPA 632

Query: 157  GDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPT 324
             +G + P+P  STPP S+ +PP+ +S  S P P TP   TP+ P     ++PP + SPPT
Sbjct: 633  PEG-HTPSPPESTPP-SEKSPPTPESKASSPPPPTPEGHTPSPPK----STPPTEKSPPT 686

Query: 325  DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              + ++   P  P  G+  SPP+ S+PP +  P
Sbjct: 687  PESESSSPPPPAPE-GHMPSPPK-STPPVEKSP 717

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 54/157 (34%), Positives = 71/157 (45%), Gaps = 16/157 (10%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           + +P  P  + + +PTPSSP       P P+P      SPP  Y   P P SG    +P 
Sbjct: 465 EESPEEPPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPE 524

Query: 181 PSTPPSSDCTPPSQDSPP------------SDPTPTTPSTPTTPSGGYYNSPPQDSSPPT 324
               P     PP++ SPP            S PTPT   +P     G+  SPP+ S PP 
Sbjct: 525 RKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPVPEGHTPSPPK-SGPPA 583

Query: 325 DPTPTTP----STPTTPSGGYYNSPPQDSSPPSDPLP 423
             +P TP    S P TP   Y  SPP+ S+PP++  P
Sbjct: 584 GESPPTPESKASPPPTPE-EYTPSPPK-STPPAEKSP 618

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 51/142 (35%), Positives = 72/142 (50%), Gaps = 4/142 (2%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
            PTP S   S  P P +P G     P  +PPS+     P S   +P PP+ +G    TPS 
Sbjct: 619  PTPESKASS--PPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGH---TPSP 673

Query: 190  PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP----STPT 357
            P S   TPP++ SPP+  + ++   P  P  G+  SPP+ S+PP + +P TP    S+P 
Sbjct: 674  PKS---TPPTEKSPPTPESESSSPPPPAPE-GHMPSPPK-STPPVEKSPPTPESEASSPP 728

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             P+   +   P  SSPP +  P
Sbjct: 729  PPAPEGHTPSPPKSSPPEEKSP 750

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 58/154 (37%), Positives = 72/154 (46%), Gaps = 18/154 (11%)
 Frame = +1

Query: 4    PTPTP----PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG--SPPGSYDP---TPSPPS 156
            P PTP    PS   S  PT  SPP   S   +P PP+  G   SPP S  P   +P  P 
Sbjct: 662  PPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPE 721

Query: 157  GDGSYNPTPS----TPPSSDCTPPSQDSPPSDPTP-TTPSTPT--TPSGGYYNSPPQDSS 315
             + S  P P+    TP     +PP + SPP  PT  T+P TP   TPS    + P + S 
Sbjct: 722  SEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSP 781

Query: 316  PPTDPTPTTPST--PTTPSGGYYNSPPQDSSPPS 411
            PP  P  + PS   PT+P       PP + SPP+
Sbjct: 782  PPHSPEKSPPSEAHPTSP-------PPSEKSPPT 808

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 50/153 (32%), Positives = 69/153 (45%), Gaps = 17/153 (11%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
            +P PP+ +G     P S P      PTP   + S   PP     TPSPP        +P 
Sbjct: 693  SPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSP-PPPAPEGHTPSPPKSSPPEEKSPP 751

Query: 187  TPPSSDCTPPSQD----SPPSDPTPTTPSTP------TTPSGGYYNS-PPQDSSPPT--- 324
             PP+S  +PP+ +    SPP    P   S P      + PS  +  S PP + SPPT   
Sbjct: 752  IPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAE 811

Query: 325  DPTPTTPSTPTTPSGGYYNSPP---QDSSPPSD 414
            + +P TP    +P  G+  +PP   + SSPP +
Sbjct: 812  ESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPE 844

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 46/141 (32%), Positives = 61/141 (43%), Gaps = 7/141 (4%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPPGGGSYDPTPSP--PSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+PP        +P  PP   +  PTP    PS    SPP    P P  P         
Sbjct: 736  TPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAH 795

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP-----TDPTPTTP 345
            P++PP S+ +PP+     S PTP    +P +   G   SP + SSPP     + P P   
Sbjct: 796  PTSPPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKS 855

Query: 346  STPTTPSGGYYNSPPQDSSPP 408
            S+P  P     + PP + SPP
Sbjct: 856  SSP-PPEAHVSSPPPPEKSPP 875

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 57/154 (37%), Positives = 68/154 (44%), Gaps = 16/154 (10%)
 Frame = +1

Query: 4    PTPTPPSGDGSY------NPTPSSPPGGGSYDP-TP----SPPSDSGGSPPGSYDPTPSP 150
            P+PTP S   S+      +P  S+PP      P TP    SPPS+    PP     +P P
Sbjct: 967  PSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPP 1026

Query: 151  PSGDGSYNPTPSTPPSSDCTPPSQDSPP-----SDPTPTTPSTPTTPSGGYYNSPPQDSS 315
                    P PS  P     PP + SPP     S+P PT  S P  P       PP  SS
Sbjct: 1027 AEKS---QPPPS--PVESVLPPVKSSPPHAPVISEPPPTKSSPPQVPVTS--EPPPAKSS 1079

Query: 316  PPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
            PP +P     S P TP   Y  S P++SSPPS P
Sbjct: 1080 PPHEPI----SPPETPEKSYPPSTPEESSPPSVP 1109

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 60/171 (35%), Positives = 72/171 (42%), Gaps = 32/171 (18%)
 Frame = +1

Query: 4    PTPTPPSGDGSY------NPTPSSPP----GGGSYDPTPSPPSDSGGSPPGSYDPTPSPP 153
            PTPTP S   S+      +P  S+PP       S+ P  S P      PP S  P  SPP
Sbjct: 917  PTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSSPP 976

Query: 154  SGDGSYNPTP--STPPSSDCTPPS----QDSPPSD-----PTPTTPSTPTT------PSG 282
            S +    P+P  STPP     PP       SPPS+     P+P   S P        PS 
Sbjct: 977  SHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPPPSP 1036

Query: 283  GYYNSPPQDSSPP-----TDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
                 PP  SSPP     ++P PT  S P  P       PP  SSPP +P+
Sbjct: 1037 VESVLPPVKSSPPHAPVISEPPPTKSSPPQVPVTS--EPPPAKSSPPHEPI 1085

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 57/168 (33%), Positives = 74/168 (44%), Gaps = 31/168 (18%)
 Frame = +1

Query: 13   TPPSGDGSYNPTP----SSPPGGGSYDPTPS------PPSDSGGSPPGSYDP---TPS-- 147
            TPPS   S +P P    SSPP   S  P P       PP +    PP +  P   TP   
Sbjct: 831  TPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEIS 890

Query: 148  -PPSGDG--SYNPTPSTPPSSDCTPPSQDSPPSDP------TPTTP--STPTTPSGGYYN 294
             PP G    S+ P  S+PPS +  PP   +P S P       P +P  STP        +
Sbjct: 891  PPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPS 950

Query: 295  SPPQDSSPPTD-----PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              P+ SSPP++     P+PT  S+P +       SP + + PP  PLP
Sbjct: 951  HTPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLP 998

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 56/157 (35%), Positives = 71/157 (45%), Gaps = 21/157 (13%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY-- 171
            + +P PP        TP  SPP  G   P+ +P S S  S      PTP+P S   S+  
Sbjct: 871  EKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEE 930

Query: 172  ----NPTPSTPPSSDCTPPSQ----DSPPSD-----PTPTTPSTPTTPSGGYYNSPPQDS 312
                +P  STPP  + +PPS      SPPS+     P+PT  S+P +       SP + +
Sbjct: 931  YVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKST 990

Query: 313  SPPTDPTPTTPSTPT----TPSGGYYNSP-PQDSSPP 408
             PP  P P  P TPT     PS   Y  P P  SSPP
Sbjct: 991  PPPEKPLP--PHTPTINSSPPSEEEYMPPSPVKSSPP 1025

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 52/149 (34%), Positives = 69/149 (46%), Gaps = 11/149 (7%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTP-SPPSDSGGSPP--GSYDPTP----SPPSGDGS 168
           P P SG    +P     P   +  PT  SPP+    SPP  G   PTP    SPP     
Sbjct: 512 PPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPVPEG 571

Query: 169 YNPTP--STPPSSDC--TPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           + P+P  S PP+ +   TP S+ SPP  P   TPS P        ++PP + SPPT  + 
Sbjct: 572 HTPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPK-------STPPAEKSPPTPESK 624

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            +   P  P G  +   P +S+PPS+  P
Sbjct: 625 ASSPPPPAPEG--HTPSPPESTPPSEKSP 651

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 52/157 (33%), Positives = 70/157 (44%), Gaps = 21/157 (13%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP-- 177
            PT  PPS      PTP+      + + +PSPPS   G+PP     +  PP    S  P  
Sbjct: 796  PTSPPPSEKSP--PTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPE 853

Query: 178  -TPSTPPSSDCT--PPSQDSPP-----SDPTPTTPSTPTTPSGGYYNSPPQDSSPPT--- 324
             + S PP +  +  PP + SPP     S PT T   +P        +  P+ SSPP+   
Sbjct: 854  KSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKES 913

Query: 325  --DPTPTTPSTPTT------PSGGYYNSPPQDSSPPS 411
               PTPT  S+P +      PS      PP++ SPPS
Sbjct: 914  EPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPS 950

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 52/149 (34%), Positives = 68/149 (45%), Gaps = 10/149 (6%)
 Frame = +1

Query: 7    TPT----PPSGDGSYNPTP--SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGS 168
            TPT    PPS +    P+P  SSPP      P PSP       PP    P  +P   +  
Sbjct: 1001 TPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPPPSPVESV--LPPVKSSPPHAPVISEPP 1058

Query: 169  YNPTPSTPPSSDCT---PPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
              PT S+PP    T   PP++ SPP +P     S P TP   Y  S P++SSPP+ P  +
Sbjct: 1059 --PTKSSPPQVPVTSEPPPAKSSPPHEPI----SPPETPEKSYPPSTPEESSPPSVPKAS 1112

Query: 340  TPST-PTTPSGGYYNSPPQDSSPPSDPLP 423
            +P T  + P     + PP    P   P+P
Sbjct: 1113 SPPTEKSLPPPATVSLPPPTVKPLPPPVP 1141

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 51/168 (30%), Positives = 71/168 (42%), Gaps = 26/168 (15%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTP------------SSPPGGGSYDPTPS------PPSDSGGSPPG 126
            + +P+PPSG     P+P            SSPP   S  P P       PP +    PP 
Sbjct: 819  EKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPPPE 878

Query: 127  SYDP---TPS---PPSGDG--SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSG 282
            +  P   TP    PP G    S+ P  S+PPS +  PP   +P S P       P +P+ 
Sbjct: 879  TKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAK 938

Query: 283  GYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
                 PP++ SPP+     TP + + PS        ++S PP  P P+
Sbjct: 939  S--TPPPEEKSPPSH----TPESSSPPS--------EESEPPPSPTPK 972

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 46/137 (33%), Positives = 62/137 (45%), Gaps = 3/137 (2%)
 Frame = +1

Query: 13   TPPSGDGSYNPTP---SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            +PPS +    PTP   SSPP    Y     PPS +  +PP       SPP    S+ P  
Sbjct: 907  SPPSKESEPPPTPTPKSSPPSHEEY----VPPSPAKSTPP---PEEKSPP----SHTPES 955

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            S+PPS +  PP   +P S P       P +P+      PP+   PP   TPT  S+P + 
Sbjct: 956  SSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKS--TPPPEKPLPP--HTPTINSSPPSE 1011

Query: 364  SGGYYNSPPQDSSPPSD 414
                  SP + S PP++
Sbjct: 1012 EEYMPPSPVKSSPPPAE 1028

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 46/152 (30%), Positives = 62/152 (40%), Gaps = 16/152 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT-------PSPPSDSGGSPPGSYDPTPSPPSGD 162
           PTP  PS      P    P G     P        PS P+  G  PP   + +P  P  +
Sbjct: 417 PTPGKPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHG--PPPPEEESPEEPPEE 474

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPT-------PTTPSTPTTPSGGYYNSPPQ--DSS 315
            + +PTPS+P S     P++ +PP  P        P     P  PS G+    P+   + 
Sbjct: 475 PTPSPTPSSPES-----PAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAP 529

Query: 316 PPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           PP    PT  S P TP     + PP+  SPP+
Sbjct: 530 PPQAEPPTEYSPPATPES---SPPPEGKSPPT 558

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 56/162 (34%), Positives = 69/162 (42%), Gaps = 27/162 (16%)
 Frame = +1

Query: 16   PPSGDG--SYNPTPSSPPGGGSYDP---TP--SPPSDSGGSPPGSYDPTPSPPS-GDGSY 171
            PP G    S+ P  SSPP   S  P   TP  SPPS     PP     TP P      S+
Sbjct: 892  PPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPSH 951

Query: 172  NPTPSTPPSSDCTPP-SQDSPPSDPT-----PTTP--STPTTPSGGYYNSPPQDSSPPTD 327
             P  S+PPS +  PP S     S P+     P +P  STP        ++P  +SSPP++
Sbjct: 952  TPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSE 1011

Query: 328  -----PTPTTPSTPTT------PSGGYYNSPPQDSSPPSDPL 420
                 P+P   S P        PS      PP  SSPP  P+
Sbjct: 1012 EEYMPPSPVKSSPPPAEKSQPPPSPVESVLPPVKSSPPHAPV 1053

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 45/149 (30%), Positives = 58/149 (38%), Gaps = 9/149 (6%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNP-TP--SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
            +P   P + + SY P TP  SSPP   S     SPP++    PP +    P       + 
Sbjct: 1083 EPISPPETPEKSYPPSTPEESSPP---SVPKASSPPTEKSLPPPATVSLPPP------TV 1133

Query: 172  NPTPSTPPSSDCTPPSQDSPPSDPT---PTTPSTPTTPSGGYYNSPPQDSSPPTDPT--- 333
             P P   P S   PP +  PP  P    P    +P  P+      PP  S PP  P    
Sbjct: 1134 KPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILP 1193

Query: 334  PTTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
            P    +P  P+      PP  S PP  P+
Sbjct: 1194 PPPVKSPPPPAPVISPPPPVKSPPPPAPV 1222

[101][TOP]
>UniRef100_B1Z6K9 Type VI secretion system Vgr family protein n=1 Tax=Burkholderia
            ambifaria MC40-6 RepID=B1Z6K9_BURA4
          Length = 1057

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 58/157 (36%), Positives = 66/157 (42%), Gaps = 17/157 (10%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS---PPSDSGGSPPGSYDPTPS----PPSGD 162
            P P  P    S  P PSS P   S  P PS   PP  S   PP S  P PS    PPS +
Sbjct: 712  PPPALPPAPSSEPPPPSSEPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 771

Query: 163  ----GSYNPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP 321
                 S  P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP
Sbjct: 772  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 831

Query: 322  TDPTPTTPSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
            +   P   S P  PS      PP  S PP   S+P P
Sbjct: 832  SSEPPPPSSEPPPPSS---EPPPPSSEPPPPSSEPPP 865

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 56/150 (37%), Positives = 66/150 (44%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P P PP+      P PSS P   S +P PS  PP  S   PP S +P P  S P    S 
Sbjct: 709  PLPPPPA----LPPAPSSEPPPPSSEPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 764

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 765  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 824

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 825  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 851

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 56/152 (36%), Positives = 66/152 (43%), Gaps = 14/152 (9%)
 Frame = +1

Query: 10   PTPPSGD---GSYNPTPSSPPGGGSYDPTP---SPPSDSGGSPPGSYDPTP--SPPSGDG 165
            P PPS +    S  P PSS P   S +P P    PP  S   PP S +P P  S P    
Sbjct: 724  PPPPSSEPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 783

Query: 166  SYNPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
            S  P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P
Sbjct: 784  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 843

Query: 337  TTPSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
               S P  PS      PP  S PP   S+P P
Sbjct: 844  PPSSEPPPPSS---EPPPPSSEPPPPSSEPPP 872

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 733  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 792

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 793  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 852

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 853  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 879

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 740  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 799

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 800  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 859

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 860  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 886

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 747  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 806

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 807  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 866

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 867  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 893

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 754  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 813

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 814  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 873

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 874  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 900

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 761  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 820

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 821  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 880

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 881  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 907

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 768  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 827

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 828  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 887

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 888  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 914

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 775  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 834

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 835  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 894

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 895  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 921

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 782  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 841

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 842  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 901

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 902  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 928

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 789  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 848

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 849  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 908

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 909  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 935

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 796  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 855

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 856  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 915

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 916  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 942

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 803  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 862

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 863  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 922

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 923  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 949

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 810  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 869

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 870  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 929

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 930  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 956

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 817  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 876

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 877  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 936

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 937  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 963

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 824  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 883

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 884  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 943

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 944  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 970

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 831  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 890

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 891  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 950

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 951  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 977

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 838  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 897

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 898  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 957

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 958  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 984

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 845  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 904

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 905  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 964

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 965  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 991

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 852  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 911

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 912  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 971

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 972  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 998

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 859  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 918

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 919  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 978

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 979  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 1005

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 866  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 925

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 926  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 985

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 986  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 1012

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 873  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 932

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 933  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 992

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 993  SSEPPPPSS---EPPPPSSEPPPPSSEPPP 1019

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 880  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 939

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 940  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 999

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 1000 SSEPPPPSS---EPPPPSSEPPPPSSEPPP 1026

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 887  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 946

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 947  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 1006

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 1007 SSEPPPPSS---EPPPPSSEPPPPSSEPPP 1033

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 894  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 953

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 954  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 1013

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 1014 SSEPPPPSS---EPPPPSSEPPPPSSEPPP 1040

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 901  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 960

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 961  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 1020

Query: 343  PSTPTTPSGGYYNSPPQDSSPP---SDPLP 423
             S P  PS      PP  S PP   S+P P
Sbjct: 1021 SSEPPPPSS---EPPPPSSEPPPPSSEPPP 1047

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 52/145 (35%), Positives = 61/145 (42%), Gaps = 7/145 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 908  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 967

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 968  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 1027

Query: 343  PSTPTTPSGGYYNSPPQDSSPPSDP 417
             S P  PS    + PP  SS P  P
Sbjct: 1028 SSEPPPPS----SEPPPPSSEPPPP 1048

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 51/144 (35%), Positives = 61/144 (42%), Gaps = 7/144 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS--PPSDSGGSPPGSYDPTP--SPPSGDGSY 171
            P+  PP       P  S PP   S  P PS  PP  S   PP S +P P  S P    S 
Sbjct: 915  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 974

Query: 172  NPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P PS+   PPSS+  PPS + PP    P  PS+   P       P  +  PP+   P  
Sbjct: 975  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP 1034

Query: 343  PSTPTTPSGGYYNSPPQDSSPPSD 414
             S P  PS      PP +  PPS+
Sbjct: 1035 SSEPPPPSSE--PPPPSEEPPPSE 1056

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 43/127 (33%), Positives = 53/127 (41%), Gaps = 7/127 (5%)
 Frame = +1

Query: 64   GGGSYDPTPSPPSDSGGSPP--GSYDPTPSPPSGDGSYNPTPST--PPSSDCTPPSQDSP 231
            GGG+  P P P      + P      P P+ P    S  P PS+  PPSS+  PPS + P
Sbjct: 686  GGGAIPPIPVPLFFRSITVPILPPLPPPPALPPAPSSEPPPPSSEPPPSSEPPPPSSEPP 745

Query: 232  PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPP- 408
            P    P  PS+   P       P  +  PP+   P   S P  PS      PP  S PP 
Sbjct: 746  PPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSS---EPPPPSSEPPP 802

Query: 409  --SDPLP 423
              S+P P
Sbjct: 803  PSSEPPP 809

[102][TOP]
>UniRef100_Q41814 Hydroxyproline-rich glycoprotein n=1 Tax=Zea mays
           RepID=Q41814_MAIZE
          Length = 303

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 54/151 (35%), Positives = 74/151 (49%), Gaps = 10/151 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP---PGGGSYDPTPSPPSDSGGSP---PGSYDPTPSPPS--- 156
           PTPTPP+    Y P+P  P   P   +Y P+P PP+    +P   P +Y P+P PP+   
Sbjct: 127 PTPTPPT----YTPSPKPPTPKPTPPTYTPSPKPPATKPPTPKPTPPTYTPSPKPPTPKP 182

Query: 157 GDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
              +Y P+P  PP+   TPP+    P  PTP  P+ PT     Y  SP   ++ P  P P
Sbjct: 183 TPPTYTPSPK-PPTPKPTPPTYTPSPKPPTP-KPTPPT-----YTPSPKPPATKPPTPKP 235

Query: 337 TTPS-TPTTPSGGYYNSPPQDSSPPSDPLPR 426
           T P+ TP+        SPP  +  P  P P+
Sbjct: 236 TPPTYTPSPKPPTPKPSPPTYTPSPKPPTPK 266

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 54/149 (36%), Positives = 70/149 (46%), Gaps = 11/149 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP---PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS---GDG 165
           P PTPP+    Y P+P  P   P   +Y P+P PP+      P +Y P+P PP+      
Sbjct: 164 PKPTPPT----YTPSPKPPTPKPTPPTYTPSPKPPTPK--PTPPTYTPSPKPPTPKPTPP 217

Query: 166 SYNPTP----STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT 333
           +Y P+P    + PP+   TPP+    P  PTP  PS PT     Y  SP   +  PT PT
Sbjct: 218 TYTPSPKPPATKPPTPKPTPPTYTPSPKPPTP-KPSPPT-----YTPSPKPPTPKPTPPT 271

Query: 334 PT-TPSTPTTPSGGYYNSPPQDSSPPSDP 417
            T TP  P T    Y  +PP   +P   P
Sbjct: 272 YTPTPKPPATKPPTYTPTPPVSHTPSPPP 300

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 51/153 (33%), Positives = 69/153 (45%), Gaps = 12/153 (7%)
 Frame = +1

Query: 4   PTPTPPS---GDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS------ 156
           P PTPP+       + PTP   P   +Y P+P PP+      P +Y P+P PP+      
Sbjct: 107 PKPTPPTYTPAPTPHKPTPKPTPTPPTYTPSPKPPTPK--PTPPTYTPSPKPPATKPPTP 164

Query: 157 --GDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP 330
                +Y P+P  PP+   TPP+    P  PTP  P+ PT     Y  SP   +  PT P
Sbjct: 165 KPTPPTYTPSPK-PPTPKPTPPTYTPSPKPPTP-KPTPPT-----YTPSPKPPTPKPTPP 217

Query: 331 TPT-TPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
           T T +P  P T       +PP  +  P  P P+
Sbjct: 218 TYTPSPKPPATKPPTPKPTPPTYTPSPKPPTPK 250

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 48/139 (34%), Positives = 61/139 (43%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           PTPP+   S  PTP  P    +  PTP P   +    P  + PTP P     +Y P+P  
Sbjct: 83  PTPPTYTPSPKPTP--PTYTPTPPPTPKPTPPTYTPAPTPHKPTPKPTPTPPTYTPSPK- 139

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           PP+   TPP+  +P   P  T P TP      Y  SP   +  PT PT T    P TP  
Sbjct: 140 PPTPKPTPPTY-TPSPKPPATKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPTPK- 197

Query: 370 GYYNSPPQDSSPPSDPLPR 426
               +PP  +  P  P P+
Sbjct: 198 ---PTPPTYTPSPKPPTPK 213

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 51/154 (33%), Positives = 64/154 (41%), Gaps = 22/154 (14%)
 Frame = +1

Query: 31  GSYNPTPS---------SPPGGGSYDPTP----SPPSDSG---GSPPGSYDP-----TPS 147
           G Y PTP+          PP  G     P     PP + G     PP  + P     TPS
Sbjct: 32  GGYTPTPTPATPTPKPEKPPTKGPKPDKPPKEHKPPKEHGPKPEKPPKEHKPTPPTYTPS 91

Query: 148 PPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTD 327
           P     +Y PTP  PP+   TPP+    P+   PT   TPT P+  Y  SP   +  PT 
Sbjct: 92  PKPTPPTYTPTP--PPTPKPTPPTYTPAPTPHKPTPKPTPTPPT--YTPSPKPPTPKPTP 147

Query: 328 PTPT-TPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
           PT T +P  P T       +PP  +  P  P P+
Sbjct: 148 PTYTPSPKPPATKPPTPKPTPPTYTPSPKPPTPK 181

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 36/125 (28%), Positives = 50/125 (40%), Gaps = 16/125 (12%)
 Frame = +1

Query: 100 SDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPS---SDCTPPSQDSPPSD---------- 240
           +D+G    G Y PTP+P +      P P  PP+       PP +  PP +          
Sbjct: 24  ADAGYGYGGGYTPTPTPATP----TPKPEKPPTKGPKPDKPPKEHKPPKEHGPKPEKPPK 79

Query: 241 ---PTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
              PTP T +    P+   Y   P  +  PT PT T   TP  P+     +PP  +  P 
Sbjct: 80  EHKPTPPTYTPSPKPTPPTYTPTPPPTPKPTPPTYTPAPTPHKPTPKPTPTPPTYTPSPK 139

Query: 412 DPLPR 426
            P P+
Sbjct: 140 PPTPK 144

[103][TOP]
>UniRef100_Q41645 Extensin (Fragment) n=1 Tax=Volvox carteri RepID=Q41645_VOLCA
          Length = 464

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 53/144 (36%), Positives = 63/144 (43%), Gaps = 9/144 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P+PP    S +P P SPP      P+P PP  S   PP    P+P PP      +P P
Sbjct: 318 PSPSPPPPRSSPSPPPPSPP-----PPSPPPPRPSPSPPPPRSSPSPPPPV----VSPPP 368

Query: 184 STPPSSDCTPP--SQDSPPSDPTPTTPSTPTTPSGGYYNSP---PQDSSPPTDPTPTTPS 348
             P +S   PP  S   PP  P P+ P +P  P+    N P   P  S     P  T P 
Sbjct: 369 PPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPLGTRPP 428

Query: 349 TPT----TPSGGYYNSPPQDSSPP 408
            P      P   YY  PPQD SPP
Sbjct: 429 PPPPEDDAPPPDYYFPPPQDMSPP 452

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 56/146 (38%), Positives = 62/146 (42%), Gaps = 8/146 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTP---SSPPGGGSYDPTPSPPSD-SGGSPPGSYDPTPSPPSGDGSY 171
           P P PP       P P   SSPP      P+PSPP   S  SPP    P PSPP    S 
Sbjct: 289 PPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPS- 347

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT--- 342
            P+P  P SS   PP   SPP  P   +P  P   S      PP  S PP+ P P T   
Sbjct: 348 -PSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAA 406

Query: 343 -PSTPTTPSGGYYNSPPQDSSPPSDP 417
            P +P  PS      PP  + PP  P
Sbjct: 407 NPPSP-APSRSRAGGPPLGTRPPPPP 431

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 51/143 (35%), Positives = 58/143 (40%), Gaps = 4/143 (2%)
 Frame = +1

Query: 7   TPTPPSGDGSYNP---TPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           T +PP    S  P    P SPP   +  P P PP  S   PP     +P PP       P
Sbjct: 262 TASPPLPKTSPPPPPRVPPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPP---RP 318

Query: 178 TPST-PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           +PS  PP S  +PP    PP  P P  PS    P     + PP   SPP  P   +P  P
Sbjct: 319 SPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPP 378

Query: 355 TTPSGGYYNSPPQDSSPPSDPLP 423
              S      PP  S PPS P P
Sbjct: 379 PASSPPPPPRPPPPSPPPSPPPP 401

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 54/145 (37%), Positives = 59/145 (40%), Gaps = 8/145 (5%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPS--SPPGGGSYDPTP----SPPSDSGGSPPGSYDPTPSPPSGDGS 168
           T  PP    S +P P+  SPP      P+P    SPP      PP    P PSPP    S
Sbjct: 230 TSPPPPARVSSSPPPATRSPPPRRITSPSPVLTASPPLPKTSPPPPPRVP-PSPPPPVAS 288

Query: 169 YNPTPSTPP--SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
             P P  PP  S    PP   S P  P P  PS P+ P      SPP  S PP  P P  
Sbjct: 289 --PPPPPPPRVSPSPPPPQPVSSPPPPPPPRPS-PSPPPPRSSPSPPPPSPPPPSPPPPR 345

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDP 417
           PS    P     + PP   SPP  P
Sbjct: 346 PSPSPPPPRSSPSPPPPVVSPPPPP 370

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 47/139 (33%), Positives = 50/139 (35%), Gaps = 12/139 (8%)
 Frame = +1

Query: 46  TPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP------------SPPSGDGSYNPTPST 189
           TPS PP        P P   S   PP +  P P            SPP    S  P P  
Sbjct: 219 TPSPPPPPRVSTSPPPPARVSSSPPPATRSPPPRRITSPSPVLTASPPLPKTSPPPPPRV 278

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           PPS    PP    PP  P   +PS P          PPQ  S P  P P  PS    P  
Sbjct: 279 PPSPP--PPVASPPPPPPPRVSPSPP----------PPQPVSSPPPPPPPRPSPSPPPPR 326

Query: 370 GYYNSPPQDSSPPSDPLPR 426
              + PP    PPS P PR
Sbjct: 327 SSPSPPPPSPPPPSPPPPR 345

[104][TOP]
>UniRef100_Q2R063 Transposon protein, putative, unclassified n=1 Tax=Oryza sativa
            Japonica Group RepID=Q2R063_ORYSJ
          Length = 946

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/138 (36%), Positives = 71/138 (51%), Gaps = 5/138 (3%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
            PTP S   S  P P +P G     P  +PP++     P S   +P PP+ +G     P +
Sbjct: 652  PTPESKASS--PPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKS 709

Query: 190  PPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPTDPTP-TTPSTPT- 357
             P  + +PP+ +S  S P P  P   TP+ P     +SPP++ SPP  PT  T+P TP  
Sbjct: 710  TPPVEKSPPTPESEASSPPPPAPEGHTPSPPK----SSPPEEKSPPIPPTSHTSPPTPEE 765

Query: 358  -TPSGGYYNSPPQDSSPP 408
             TPS    +SPP++ SPP
Sbjct: 766  YTPSPP-KSSPPEEKSPP 782

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 55/144 (38%), Positives = 72/144 (50%), Gaps = 8/144 (5%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP----SPPSGDGSYNPTP 183
           PP G     PT S  P       TPSPP    G P G   PTP    SPP     Y P+P
Sbjct: 550 PPEGKSPPTPTASHSPPPVPEGHTPSPPKS--GPPAGESPPTPESKASPPPTPEEYTPSP 607

Query: 184 --STPPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
             STPP ++ +PP+ +S  S P P  P   TP+ P     ++PP + SPPT  +  +   
Sbjct: 608 PKSTPP-AEKSPPTPESKASSPPPPAPEGHTPSPPE----STPPSEKSPPTPESKASSPP 662

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLP 423
           P TP  G+  SPP+ S+PP++  P
Sbjct: 663 PPTPE-GHTPSPPK-STPPTEKSP 684

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 56/153 (36%), Positives = 81/153 (52%), Gaps = 14/153 (9%)
 Frame = +1

Query: 7    TPTPPSGD---GSYNPTPSS----PPGGGSYDPTP---SPPSDSGGSPPGSYDPTPSPPS 156
            TP+PP      G   PTP S    PP    Y P+P   +PP++     P S   +P PP+
Sbjct: 573  TPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPA 632

Query: 157  GDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPT 324
             +G + P+P  STPP S+ +PP+ +S  S P P TP   TP+ P     ++PP + SPPT
Sbjct: 633  PEG-HTPSPPESTPP-SEKSPPTPESKASSPPPPTPEGHTPSPPK----STPPTEKSPPT 686

Query: 325  DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              + ++   P  P  G+  SPP+ S+PP +  P
Sbjct: 687  PESESSSPPPPAPE-GHMPSPPK-STPPVEKSP 717

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 54/157 (34%), Positives = 71/157 (45%), Gaps = 16/157 (10%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           + +P  P  + + +PTPSSP       P P+P      SPP  Y   P P SG    +P 
Sbjct: 465 EESPEEPPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPE 524

Query: 181 PSTPPSSDCTPPSQDSPP------------SDPTPTTPSTPTTPSGGYYNSPPQDSSPPT 324
               P     PP++ SPP            S PTPT   +P     G+  SPP+ S PP 
Sbjct: 525 RKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPVPEGHTPSPPK-SGPPA 583

Query: 325 DPTPTTP----STPTTPSGGYYNSPPQDSSPPSDPLP 423
             +P TP    S P TP   Y  SPP+ S+PP++  P
Sbjct: 584 GESPPTPESKASPPPTPE-EYTPSPPK-STPPAEKSP 618

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 51/142 (35%), Positives = 72/142 (50%), Gaps = 4/142 (2%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
            PTP S   S  P P +P G     P  +PPS+     P S   +P PP+ +G    TPS 
Sbjct: 619  PTPESKASS--PPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGH---TPSP 673

Query: 190  PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP----STPT 357
            P S   TPP++ SPP+  + ++   P  P  G+  SPP+ S+PP + +P TP    S+P 
Sbjct: 674  PKS---TPPTEKSPPTPESESSSPPPPAPE-GHMPSPPK-STPPVEKSPPTPESEASSPP 728

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             P+   +   P  SSPP +  P
Sbjct: 729  PPAPEGHTPSPPKSSPPEEKSP 750

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 58/154 (37%), Positives = 72/154 (46%), Gaps = 18/154 (11%)
 Frame = +1

Query: 4    PTPTP----PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG--SPPGSYDP---TPSPPS 156
            P PTP    PS   S  PT  SPP   S   +P PP+  G   SPP S  P   +P  P 
Sbjct: 662  PPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPE 721

Query: 157  GDGSYNPTPS----TPPSSDCTPPSQDSPPSDPTP-TTPSTPT--TPSGGYYNSPPQDSS 315
             + S  P P+    TP     +PP + SPP  PT  T+P TP   TPS    + P + S 
Sbjct: 722  SEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSP 781

Query: 316  PPTDPTPTTPST--PTTPSGGYYNSPPQDSSPPS 411
            PP  P  + PS   PT+P       PP + SPP+
Sbjct: 782  PPHSPEKSPPSEAHPTSP-------PPSEKSPPT 808

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 50/153 (32%), Positives = 69/153 (45%), Gaps = 17/153 (11%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
            +P PP+ +G     P S P      PTP   + S   PP     TPSPP        +P 
Sbjct: 693  SPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSP-PPPAPEGHTPSPPKSSPPEEKSPP 751

Query: 187  TPPSSDCTPPSQD----SPPSDPTPTTPSTP------TTPSGGYYNS-PPQDSSPPT--- 324
             PP+S  +PP+ +    SPP    P   S P      + PS  +  S PP + SPPT   
Sbjct: 752  IPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAE 811

Query: 325  DPTPTTPSTPTTPSGGYYNSPP---QDSSPPSD 414
            + +P TP    +P  G+  +PP   + SSPP +
Sbjct: 812  ESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPE 844

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 46/141 (32%), Positives = 61/141 (43%), Gaps = 7/141 (4%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPPGGGSYDPTPSP--PSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+PP        +P  PP   +  PTP    PS    SPP    P P  P         
Sbjct: 736  TPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAH 795

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP-----TDPTPTTP 345
            P++PP S+ +PP+     S PTP    +P +   G   SP + SSPP     + P P   
Sbjct: 796  PTSPPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKS 855

Query: 346  STPTTPSGGYYNSPPQDSSPP 408
            S+P  P     + PP + SPP
Sbjct: 856  SSP-PPEAHVSSPPPPEKSPP 875

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 52/149 (34%), Positives = 69/149 (46%), Gaps = 11/149 (7%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTP-SPPSDSGGSPP--GSYDPTP----SPPSGDGS 168
           P P SG    +P     P   +  PT  SPP+    SPP  G   PTP    SPP     
Sbjct: 512 PPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPVPEG 571

Query: 169 YNPTP--STPPSSDC--TPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           + P+P  S PP+ +   TP S+ SPP  P   TPS P        ++PP + SPPT  + 
Sbjct: 572 HTPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPK-------STPPAEKSPPTPESK 624

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            +   P  P G  +   P +S+PPS+  P
Sbjct: 625 ASSPPPPAPEG--HTPSPPESTPPSEKSP 651

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 56/147 (38%), Positives = 69/147 (46%), Gaps = 12/147 (8%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG-SPPGSYD--PTPSPPSGDGSYNP 177
            TP+PP    S  P   SPP    + P  SPPS++   SPP S    PTP+  S   +   
Sbjct: 767  TPSPPK---SSPPEEKSPP---PHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEK 820

Query: 178  TPSTPPSSDCTPPS---QDSPP-----SDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT 333
            +PS P   + TPPS     SPP     S P P   S+P  P   + +SPP     P  P 
Sbjct: 821  SPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSP--PPEAHVSSPPPPEKSP--PP 876

Query: 334  PTTPSTPT-TPSGGYYNSPPQDSSPPS 411
            P T S PT TP     + PP+  SPPS
Sbjct: 877  PETKSPPTLTPE---ISPPPEGKSPPS 900

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 44/142 (30%), Positives = 60/142 (42%), Gaps = 4/142 (2%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            PT  PPS      PTP+      + + +PSPPS   G+PP     +  PP    S     
Sbjct: 796  PTSPPPSEKSP--PTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVS----- 848

Query: 184  STPPSSDCTPPSQ----DSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            S PP    +PP +      PP + +P  P T + P+     SPP +   P   TP + S 
Sbjct: 849  SPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSP 908

Query: 352  PTTPSGGYYNSPPQDSSPPSDP 417
            P+  S      PP   +P S P
Sbjct: 909  PSKES-----EPPPTPTPKSSP 925

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 46/152 (30%), Positives = 62/152 (40%), Gaps = 16/152 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT-------PSPPSDSGGSPPGSYDPTPSPPSGD 162
           PTP  PS      P    P G     P        PS P+  G  PP   + +P  P  +
Sbjct: 417 PTPGKPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHG--PPPPEEESPEEPPEE 474

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPT-------PTTPSTPTTPSGGYYNSPPQ--DSS 315
            + +PTPS+P S     P++ +PP  P        P     P  PS G+    P+   + 
Sbjct: 475 PTPSPTPSSPES-----PAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAP 529

Query: 316 PPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           PP    PT  S P TP     + PP+  SPP+
Sbjct: 530 PPQAEPPTEYSPPATPES---SPPPEGKSPPT 558

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 42/121 (34%), Positives = 58/121 (47%), Gaps = 3/121 (2%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTP--SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYN 174
            + +P+PPSG     P+P  SS P   ++  +P PP  S   PP ++  +P PP       
Sbjct: 819  EKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSP-PPEKSSSPPPEAHVSSPPPPE------ 871

Query: 175  PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTPTTPST 351
               S PP    +PP+  +P   P P   S P+ TP     +SPP   S P  PTPT  S+
Sbjct: 872  --KSPPPPETKSPPTL-TPEISPPPEGKSPPSHTPES---SSPPSKESEP-PPTPTPKSS 924

Query: 352  P 354
            P
Sbjct: 925  P 925

[105][TOP]
>UniRef100_Q0IRA5 Os11g0657400 protein n=1 Tax=Oryza sativa Japonica Group
            RepID=Q0IRA5_ORYSJ
          Length = 1064

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/138 (36%), Positives = 71/138 (51%), Gaps = 5/138 (3%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
            PTP S   S  P P +P G     P  +PP++     P S   +P PP+ +G     P +
Sbjct: 652  PTPESKASS--PPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKS 709

Query: 190  PPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPTDPTP-TTPSTPT- 357
             P  + +PP+ +S  S P P  P   TP+ P     +SPP++ SPP  PT  T+P TP  
Sbjct: 710  TPPVEKSPPTPESEASSPPPPAPEGHTPSPPK----SSPPEEKSPPIPPTSHTSPPTPEE 765

Query: 358  -TPSGGYYNSPPQDSSPP 408
             TPS    +SPP++ SPP
Sbjct: 766  YTPSPP-KSSPPEEKSPP 782

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 55/144 (38%), Positives = 72/144 (50%), Gaps = 8/144 (5%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP----SPPSGDGSYNPTP 183
           PP G     PT S  P       TPSPP    G P G   PTP    SPP     Y P+P
Sbjct: 550 PPEGKSPPTPTASHSPPPVPEGHTPSPPKS--GPPAGESPPTPESKASPPPTPEEYTPSP 607

Query: 184 --STPPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
             STPP ++ +PP+ +S  S P P  P   TP+ P     ++PP + SPPT  +  +   
Sbjct: 608 PKSTPP-AEKSPPTPESKASSPPPPAPEGHTPSPPE----STPPSEKSPPTPESKASSPP 662

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLP 423
           P TP  G+  SPP+ S+PP++  P
Sbjct: 663 PPTPE-GHTPSPPK-STPPTEKSP 684

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 56/153 (36%), Positives = 81/153 (52%), Gaps = 14/153 (9%)
 Frame = +1

Query: 7    TPTPPSGD---GSYNPTPSS----PPGGGSYDPTP---SPPSDSGGSPPGSYDPTPSPPS 156
            TP+PP      G   PTP S    PP    Y P+P   +PP++     P S   +P PP+
Sbjct: 573  TPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPA 632

Query: 157  GDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPT 324
             +G + P+P  STPP S+ +PP+ +S  S P P TP   TP+ P     ++PP + SPPT
Sbjct: 633  PEG-HTPSPPESTPP-SEKSPPTPESKASSPPPPTPEGHTPSPPK----STPPTEKSPPT 686

Query: 325  DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              + ++   P  P  G+  SPP+ S+PP +  P
Sbjct: 687  PESESSSPPPPAPE-GHMPSPPK-STPPVEKSP 717

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 54/157 (34%), Positives = 71/157 (45%), Gaps = 16/157 (10%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           + +P  P  + + +PTPSSP       P P+P      SPP  Y   P P SG    +P 
Sbjct: 465 EESPEEPPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPE 524

Query: 181 PSTPPSSDCTPPSQDSPP------------SDPTPTTPSTPTTPSGGYYNSPPQDSSPPT 324
               P     PP++ SPP            S PTPT   +P     G+  SPP+ S PP 
Sbjct: 525 RKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPVPEGHTPSPPK-SGPPA 583

Query: 325 DPTPTTP----STPTTPSGGYYNSPPQDSSPPSDPLP 423
             +P TP    S P TP   Y  SPP+ S+PP++  P
Sbjct: 584 GESPPTPESKASPPPTPE-EYTPSPPK-STPPAEKSP 618

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 51/142 (35%), Positives = 72/142 (50%), Gaps = 4/142 (2%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
            PTP S   S  P P +P G     P  +PPS+     P S   +P PP+ +G    TPS 
Sbjct: 619  PTPESKASS--PPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGH---TPSP 673

Query: 190  PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP----STPT 357
            P S   TPP++ SPP+  + ++   P  P  G+  SPP+ S+PP + +P TP    S+P 
Sbjct: 674  PKS---TPPTEKSPPTPESESSSPPPPAPE-GHMPSPPK-STPPVEKSPPTPESEASSPP 728

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             P+   +   P  SSPP +  P
Sbjct: 729  PPAPEGHTPSPPKSSPPEEKSP 750

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 58/154 (37%), Positives = 72/154 (46%), Gaps = 18/154 (11%)
 Frame = +1

Query: 4    PTPTP----PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG--SPPGSYDP---TPSPPS 156
            P PTP    PS   S  PT  SPP   S   +P PP+  G   SPP S  P   +P  P 
Sbjct: 662  PPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPE 721

Query: 157  GDGSYNPTPS----TPPSSDCTPPSQDSPPSDPTP-TTPSTPT--TPSGGYYNSPPQDSS 315
             + S  P P+    TP     +PP + SPP  PT  T+P TP   TPS    + P + S 
Sbjct: 722  SEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSP 781

Query: 316  PPTDPTPTTPST--PTTPSGGYYNSPPQDSSPPS 411
            PP  P  + PS   PT+P       PP + SPP+
Sbjct: 782  PPHSPEKSPPSEAHPTSP-------PPSEKSPPT 808

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 50/153 (32%), Positives = 69/153 (45%), Gaps = 17/153 (11%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
            +P PP+ +G     P S P      PTP   + S   PP     TPSPP        +P 
Sbjct: 693  SPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSP-PPPAPEGHTPSPPKSSPPEEKSPP 751

Query: 187  TPPSSDCTPPSQD----SPPSDPTPTTPSTP------TTPSGGYYNS-PPQDSSPPT--- 324
             PP+S  +PP+ +    SPP    P   S P      + PS  +  S PP + SPPT   
Sbjct: 752  IPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAE 811

Query: 325  DPTPTTPSTPTTPSGGYYNSPP---QDSSPPSD 414
            + +P TP    +P  G+  +PP   + SSPP +
Sbjct: 812  ESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPE 844

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 46/141 (32%), Positives = 61/141 (43%), Gaps = 7/141 (4%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPPGGGSYDPTPSP--PSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+PP        +P  PP   +  PTP    PS    SPP    P P  P         
Sbjct: 736  TPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAH 795

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP-----TDPTPTTP 345
            P++PP S+ +PP+     S PTP    +P +   G   SP + SSPP     + P P   
Sbjct: 796  PTSPPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKS 855

Query: 346  STPTTPSGGYYNSPPQDSSPP 408
            S+P  P     + PP + SPP
Sbjct: 856  SSP-PPEAHVSSPPPPEKSPP 875

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 57/168 (33%), Positives = 74/168 (44%), Gaps = 31/168 (18%)
 Frame = +1

Query: 13   TPPSGDGSYNPTP----SSPPGGGSYDPTPS------PPSDSGGSPPGSYDP---TPS-- 147
            TPPS   S +P P    SSPP   S  P P       PP +    PP +  P   TP   
Sbjct: 831  TPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEIS 890

Query: 148  -PPSGDG--SYNPTPSTPPSSDCTPPSQDSPPSDP------TPTTP--STPTTPSGGYYN 294
             PP G    S+ P  S+PPS +  PP   +P S P       P +P  STP        +
Sbjct: 891  PPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPS 950

Query: 295  SPPQDSSPPTD-----PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              P+ SSPP++     P+PT  S+P +       SP + + PP  PLP
Sbjct: 951  HTPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLP 998

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 56/157 (35%), Positives = 71/157 (45%), Gaps = 21/157 (13%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY-- 171
            + +P PP        TP  SPP  G   P+ +P S S  S      PTP+P S   S+  
Sbjct: 871  EKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEE 930

Query: 172  ----NPTPSTPPSSDCTPPSQ----DSPPSD-----PTPTTPSTPTTPSGGYYNSPPQDS 312
                +P  STPP  + +PPS      SPPS+     P+PT  S+P +       SP + +
Sbjct: 931  YVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKST 990

Query: 313  SPPTDPTPTTPSTPT----TPSGGYYNSP-PQDSSPP 408
             PP  P P  P TPT     PS   Y  P P  SSPP
Sbjct: 991  PPPEKPLP--PHTPTINSSPPSEEEYMPPSPVKSSPP 1025

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 52/149 (34%), Positives = 69/149 (46%), Gaps = 11/149 (7%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTP-SPPSDSGGSPP--GSYDPTP----SPPSGDGS 168
           P P SG    +P     P   +  PT  SPP+    SPP  G   PTP    SPP     
Sbjct: 512 PPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPVPEG 571

Query: 169 YNPTP--STPPSSDC--TPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           + P+P  S PP+ +   TP S+ SPP  P   TPS P        ++PP + SPPT  + 
Sbjct: 572 HTPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPK-------STPPAEKSPPTPESK 624

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            +   P  P G  +   P +S+PPS+  P
Sbjct: 625 ASSPPPPAPEG--HTPSPPESTPPSEKSP 651

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 52/157 (33%), Positives = 70/157 (44%), Gaps = 21/157 (13%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP-- 177
            PT  PPS      PTP+      + + +PSPPS   G+PP     +  PP    S  P  
Sbjct: 796  PTSPPPSEKSP--PTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPE 853

Query: 178  -TPSTPPSSDCT--PPSQDSPP-----SDPTPTTPSTPTTPSGGYYNSPPQDSSPPT--- 324
             + S PP +  +  PP + SPP     S PT T   +P        +  P+ SSPP+   
Sbjct: 854  KSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKES 913

Query: 325  --DPTPTTPSTPTT------PSGGYYNSPPQDSSPPS 411
               PTPT  S+P +      PS      PP++ SPPS
Sbjct: 914  EPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPS 950

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 57/184 (30%), Positives = 76/184 (41%), Gaps = 45/184 (24%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTP------------SSPPGGGSYDPTPS------PPSDSGGSPPG 126
            + +P+PPSG     P+P            SSPP   S  P P       PP +    PP 
Sbjct: 819  EKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPPPE 878

Query: 127  SYDP---TPS---PPSGDG--SYNPTPSTPPSSDCTPPSQDSPPSDP------TPTTP-- 258
            +  P   TP    PP G    S+ P  S+PPS +  PP   +P S P       P +P  
Sbjct: 879  TKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAK 938

Query: 259  STPTTPSGGYYNSPPQDSSPPTD-----PTPTTPSTPTT------PSGGYYNSPPQDSSP 405
            STP        +  P+ SSPP++     P+PT  S+P +      PS      PP+   P
Sbjct: 939  STPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLP 998

Query: 406  PSDP 417
            P  P
Sbjct: 999  PHTP 1002

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 52/146 (35%), Positives = 64/146 (43%), Gaps = 13/146 (8%)
 Frame = +1

Query: 16   PPSGDG--SYNPTPSSPPGGGSYDP---TP--SPPSDSGGSPPGSYDPTPSPPS-GDGSY 171
            PP G    S+ P  SSPP   S  P   TP  SPPS     PP     TP P      S+
Sbjct: 892  PPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPSH 951

Query: 172  NPTPSTPPSSDCTPPS----QDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDPTP 336
             P  S+PPS +  PP     + SPPS      PS   +TP       PP+   PP   TP
Sbjct: 952  TPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTP-------PPEKPLPP--HTP 1002

Query: 337  TTPSTPTTPSGGYYNSPPQDSSPPSD 414
            T  S+P +       SP + S PP++
Sbjct: 1003 TINSSPPSEEEYMPPSPVKSSPPPAE 1028

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 46/152 (30%), Positives = 62/152 (40%), Gaps = 16/152 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT-------PSPPSDSGGSPPGSYDPTPSPPSGD 162
           PTP  PS      P    P G     P        PS P+  G  PP   + +P  P  +
Sbjct: 417 PTPGKPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHG--PPPPEEESPEEPPEE 474

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPT-------PTTPSTPTTPSGGYYNSPPQ--DSS 315
            + +PTPS+P S     P++ +PP  P        P     P  PS G+    P+   + 
Sbjct: 475 PTPSPTPSSPES-----PAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAP 529

Query: 316 PPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           PP    PT  S P TP     + PP+  SPP+
Sbjct: 530 PPQAEPPTEYSPPATPES---SPPPEGKSPPT 558

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 39/133 (29%), Positives = 57/133 (42%), Gaps = 6/133 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSY------NPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG 165
            PTPTP S   S+      +P  S+PP      P+ +P S S  S      P+P+P S   
Sbjct: 917  PTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSSPP 976

Query: 166  SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
            S+       P+    PP +  PP   TPT  S+P +       SP + S PP + +   P
Sbjct: 977  SHEEYVPPSPAKSTPPPEKPLPPH--TPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPPP 1034

Query: 346  STPTTPSGGYYNS 384
            S   T +   + +
Sbjct: 1035 SPVETTTNKVFTA 1047

[106][TOP]
>UniRef100_B9G8N7 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=B9G8N7_ORYSJ
          Length = 1360

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/138 (36%), Positives = 71/138 (51%), Gaps = 5/138 (3%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
            PTP S   S  P P +P G     P  +PP++     P S   +P PP+ +G     P +
Sbjct: 652  PTPESKASS--PPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKS 709

Query: 190  PPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPTDPTP-TTPSTPT- 357
             P  + +PP+ +S  S P P  P   TP+ P     +SPP++ SPP  PT  T+P TP  
Sbjct: 710  TPPVEKSPPTPESEASSPPPPAPEGHTPSPPK----SSPPEEKSPPIPPTSHTSPPTPEE 765

Query: 358  -TPSGGYYNSPPQDSSPP 408
             TPS    +SPP++ SPP
Sbjct: 766  YTPSPP-KSSPPEEKSPP 782

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 55/144 (38%), Positives = 72/144 (50%), Gaps = 8/144 (5%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP----SPPSGDGSYNPTP 183
           PP G     PT S  P       TPSPP    G P G   PTP    SPP     Y P+P
Sbjct: 550 PPEGKSPPTPTASHSPPPVPEGHTPSPPKS--GPPAGESPPTPESKASPPPTPEEYTPSP 607

Query: 184 --STPPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
             STPP ++ +PP+ +S  S P P  P   TP+ P     ++PP + SPPT  +  +   
Sbjct: 608 PKSTPP-AEKSPPTPESKASSPPPPAPEGHTPSPPE----STPPSEKSPPTPESKASSPP 662

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLP 423
           P TP  G+  SPP+ S+PP++  P
Sbjct: 663 PPTPE-GHTPSPPK-STPPTEKSP 684

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 56/153 (36%), Positives = 81/153 (52%), Gaps = 14/153 (9%)
 Frame = +1

Query: 7    TPTPPSGD---GSYNPTPSS----PPGGGSYDPTP---SPPSDSGGSPPGSYDPTPSPPS 156
            TP+PP      G   PTP S    PP    Y P+P   +PP++     P S   +P PP+
Sbjct: 573  TPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPA 632

Query: 157  GDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPT 324
             +G + P+P  STPP S+ +PP+ +S  S P P TP   TP+ P     ++PP + SPPT
Sbjct: 633  PEG-HTPSPPESTPP-SEKSPPTPESKASSPPPPTPEGHTPSPPK----STPPTEKSPPT 686

Query: 325  DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              + ++   P  P  G+  SPP+ S+PP +  P
Sbjct: 687  PESESSSPPPPAPE-GHMPSPPK-STPPVEKSP 717

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 54/157 (34%), Positives = 71/157 (45%), Gaps = 16/157 (10%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           + +P  P  + + +PTPSSP       P P+P      SPP  Y   P P SG    +P 
Sbjct: 465 EESPEEPPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPE 524

Query: 181 PSTPPSSDCTPPSQDSPP------------SDPTPTTPSTPTTPSGGYYNSPPQDSSPPT 324
               P     PP++ SPP            S PTPT   +P     G+  SPP+ S PP 
Sbjct: 525 RKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPVPEGHTPSPPK-SGPPA 583

Query: 325 DPTPTTP----STPTTPSGGYYNSPPQDSSPPSDPLP 423
             +P TP    S P TP   Y  SPP+ S+PP++  P
Sbjct: 584 GESPPTPESKASPPPTPE-EYTPSPPK-STPPAEKSP 618

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 51/142 (35%), Positives = 72/142 (50%), Gaps = 4/142 (2%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
            PTP S   S  P P +P G     P  +PPS+     P S   +P PP+ +G    TPS 
Sbjct: 619  PTPESKASS--PPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGH---TPSP 673

Query: 190  PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP----STPT 357
            P S   TPP++ SPP+  + ++   P  P  G+  SPP+ S+PP + +P TP    S+P 
Sbjct: 674  PKS---TPPTEKSPPTPESESSSPPPPAPE-GHMPSPPK-STPPVEKSPPTPESEASSPP 728

Query: 358  TPSGGYYNSPPQDSSPPSDPLP 423
             P+   +   P  SSPP +  P
Sbjct: 729  PPAPEGHTPSPPKSSPPEEKSP 750

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 58/154 (37%), Positives = 72/154 (46%), Gaps = 18/154 (11%)
 Frame = +1

Query: 4    PTPTP----PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG--SPPGSYDP---TPSPPS 156
            P PTP    PS   S  PT  SPP   S   +P PP+  G   SPP S  P   +P  P 
Sbjct: 662  PPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPE 721

Query: 157  GDGSYNPTPS----TPPSSDCTPPSQDSPPSDPTP-TTPSTPT--TPSGGYYNSPPQDSS 315
             + S  P P+    TP     +PP + SPP  PT  T+P TP   TPS    + P + S 
Sbjct: 722  SEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSP 781

Query: 316  PPTDPTPTTPST--PTTPSGGYYNSPPQDSSPPS 411
            PP  P  + PS   PT+P       PP + SPP+
Sbjct: 782  PPHSPEKSPPSEAHPTSP-------PPSEKSPPT 808

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 50/153 (32%), Positives = 69/153 (45%), Gaps = 17/153 (11%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
            +P PP+ +G     P S P      PTP   + S   PP     TPSPP        +P 
Sbjct: 693  SPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSP-PPPAPEGHTPSPPKSSPPEEKSPP 751

Query: 187  TPPSSDCTPPSQD----SPPSDPTPTTPSTP------TTPSGGYYNS-PPQDSSPPT--- 324
             PP+S  +PP+ +    SPP    P   S P      + PS  +  S PP + SPPT   
Sbjct: 752  IPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAE 811

Query: 325  DPTPTTPSTPTTPSGGYYNSPP---QDSSPPSD 414
            + +P TP    +P  G+  +PP   + SSPP +
Sbjct: 812  ESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPE 844

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 46/141 (32%), Positives = 61/141 (43%), Gaps = 7/141 (4%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPPGGGSYDPTPSP--PSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            TP+PP        +P  PP   +  PTP    PS    SPP    P P  P         
Sbjct: 736  TPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAH 795

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP-----TDPTPTTP 345
            P++PP S+ +PP+     S PTP    +P +   G   SP + SSPP     + P P   
Sbjct: 796  PTSPPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKS 855

Query: 346  STPTTPSGGYYNSPPQDSSPP 408
            S+P  P     + PP + SPP
Sbjct: 856  SSP-PPEAHVSSPPPPEKSPP 875

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 57/154 (37%), Positives = 68/154 (44%), Gaps = 16/154 (10%)
 Frame = +1

Query: 4    PTPTPPSGDGSY------NPTPSSPPGGGSYDP-TP----SPPSDSGGSPPGSYDPTPSP 150
            P+PTP S   S+      +P  S+PP      P TP    SPPS+    PP     +P P
Sbjct: 967  PSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPP 1026

Query: 151  PSGDGSYNPTPSTPPSSDCTPPSQDSPP-----SDPTPTTPSTPTTPSGGYYNSPPQDSS 315
                    P PS  P     PP + SPP     S+P PT  S P  P       PP  SS
Sbjct: 1027 AEKS---QPPPS--PVESVLPPVKSSPPHAPVISEPPPTKSSPPQVPVTS--EPPPAKSS 1079

Query: 316  PPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
            PP +P     S P TP   Y  S P++SSPPS P
Sbjct: 1080 PPHEPI----SPPETPEKSYPPSTPEESSPPSVP 1109

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 60/171 (35%), Positives = 72/171 (42%), Gaps = 32/171 (18%)
 Frame = +1

Query: 4    PTPTPPSGDGSY------NPTPSSPP----GGGSYDPTPSPPSDSGGSPPGSYDPTPSPP 153
            PTPTP S   S+      +P  S+PP       S+ P  S P      PP S  P  SPP
Sbjct: 917  PTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSSPP 976

Query: 154  SGDGSYNPTP--STPPSSDCTPPS----QDSPPSD-----PTPTTPSTPTT------PSG 282
            S +    P+P  STPP     PP       SPPS+     P+P   S P        PS 
Sbjct: 977  SHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPPPSP 1036

Query: 283  GYYNSPPQDSSPP-----TDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
                 PP  SSPP     ++P PT  S P  P       PP  SSPP +P+
Sbjct: 1037 VESVLPPVKSSPPHAPVISEPPPTKSSPPQVPVTS--EPPPAKSSPPHEPI 1085

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 57/168 (33%), Positives = 74/168 (44%), Gaps = 31/168 (18%)
 Frame = +1

Query: 13   TPPSGDGSYNPTP----SSPPGGGSYDPTPS------PPSDSGGSPPGSYDP---TPS-- 147
            TPPS   S +P P    SSPP   S  P P       PP +    PP +  P   TP   
Sbjct: 831  TPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEIS 890

Query: 148  -PPSGDG--SYNPTPSTPPSSDCTPPSQDSPPSDP------TPTTP--STPTTPSGGYYN 294
             PP G    S+ P  S+PPS +  PP   +P S P       P +P  STP        +
Sbjct: 891  PPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPS 950

Query: 295  SPPQDSSPPTD-----PTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              P+ SSPP++     P+PT  S+P +       SP + + PP  PLP
Sbjct: 951  HTPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLP 998

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 56/157 (35%), Positives = 71/157 (45%), Gaps = 21/157 (13%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY-- 171
            + +P PP        TP  SPP  G   P+ +P S S  S      PTP+P S   S+  
Sbjct: 871  EKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEE 930

Query: 172  ----NPTPSTPPSSDCTPPSQ----DSPPSD-----PTPTTPSTPTTPSGGYYNSPPQDS 312
                +P  STPP  + +PPS      SPPS+     P+PT  S+P +       SP + +
Sbjct: 931  YVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKST 990

Query: 313  SPPTDPTPTTPSTPT----TPSGGYYNSP-PQDSSPP 408
             PP  P P  P TPT     PS   Y  P P  SSPP
Sbjct: 991  PPPEKPLP--PHTPTINSSPPSEEEYMPPSPVKSSPP 1025

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 52/149 (34%), Positives = 69/149 (46%), Gaps = 11/149 (7%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTP-SPPSDSGGSPP--GSYDPTP----SPPSGDGS 168
           P P SG    +P     P   +  PT  SPP+    SPP  G   PTP    SPP     
Sbjct: 512 PPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPVPEG 571

Query: 169 YNPTP--STPPSSDC--TPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           + P+P  S PP+ +   TP S+ SPP  P   TPS P        ++PP + SPPT  + 
Sbjct: 572 HTPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPK-------STPPAEKSPPTPESK 624

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            +   P  P G  +   P +S+PPS+  P
Sbjct: 625 ASSPPPPAPEG--HTPSPPESTPPSEKSP 651

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 52/157 (33%), Positives = 70/157 (44%), Gaps = 21/157 (13%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP-- 177
            PT  PPS      PTP+      + + +PSPPS   G+PP     +  PP    S  P  
Sbjct: 796  PTSPPPSEKSP--PTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPE 853

Query: 178  -TPSTPPSSDCT--PPSQDSPP-----SDPTPTTPSTPTTPSGGYYNSPPQDSSPPT--- 324
             + S PP +  +  PP + SPP     S PT T   +P        +  P+ SSPP+   
Sbjct: 854  KSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKES 913

Query: 325  --DPTPTTPSTPTT------PSGGYYNSPPQDSSPPS 411
               PTPT  S+P +      PS      PP++ SPPS
Sbjct: 914  EPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPS 950

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 52/149 (34%), Positives = 68/149 (45%), Gaps = 10/149 (6%)
 Frame = +1

Query: 7    TPT----PPSGDGSYNPTP--SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGS 168
            TPT    PPS +    P+P  SSPP      P PSP       PP    P  +P   +  
Sbjct: 1001 TPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPPPSPVESV--LPPVKSSPPHAPVISEPP 1058

Query: 169  YNPTPSTPPSSDCT---PPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
              PT S+PP    T   PP++ SPP +P     S P TP   Y  S P++SSPP+ P  +
Sbjct: 1059 --PTKSSPPQVPVTSEPPPAKSSPPHEPI----SPPETPEKSYPPSTPEESSPPSVPKAS 1112

Query: 340  TPST-PTTPSGGYYNSPPQDSSPPSDPLP 423
            +P T  + P     + PP    P   P+P
Sbjct: 1113 SPPTEKSLPPPATVSLPPPTVKPLPPPVP 1141

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 51/168 (30%), Positives = 71/168 (42%), Gaps = 26/168 (15%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTP------------SSPPGGGSYDPTPS------PPSDSGGSPPG 126
            + +P+PPSG     P+P            SSPP   S  P P       PP +    PP 
Sbjct: 819  EKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPPPE 878

Query: 127  SYDP---TPS---PPSGDG--SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSG 282
            +  P   TP    PP G    S+ P  S+PPS +  PP   +P S P       P +P+ 
Sbjct: 879  TKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAK 938

Query: 283  GYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
                 PP++ SPP+     TP + + PS        ++S PP  P P+
Sbjct: 939  S--TPPPEEKSPPSH----TPESSSPPS--------EESEPPPSPTPK 972

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 46/137 (33%), Positives = 62/137 (45%), Gaps = 3/137 (2%)
 Frame = +1

Query: 13   TPPSGDGSYNPTP---SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            +PPS +    PTP   SSPP    Y     PPS +  +PP       SPP    S+ P  
Sbjct: 907  SPPSKESEPPPTPTPKSSPPSHEEY----VPPSPAKSTPP---PEEKSPP----SHTPES 955

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            S+PPS +  PP   +P S P       P +P+      PP+   PP   TPT  S+P + 
Sbjct: 956  SSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKS--TPPPEKPLPP--HTPTINSSPPSE 1011

Query: 364  SGGYYNSPPQDSSPPSD 414
                  SP + S PP++
Sbjct: 1012 EEYMPPSPVKSSPPPAE 1028

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 46/152 (30%), Positives = 62/152 (40%), Gaps = 16/152 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT-------PSPPSDSGGSPPGSYDPTPSPPSGD 162
           PTP  PS      P    P G     P        PS P+  G  PP   + +P  P  +
Sbjct: 417 PTPGKPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHG--PPPPEEESPEEPPEE 474

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPT-------PTTPSTPTTPSGGYYNSPPQ--DSS 315
            + +PTPS+P S     P++ +PP  P        P     P  PS G+    P+   + 
Sbjct: 475 PTPSPTPSSPES-----PAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAP 529

Query: 316 PPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           PP    PT  S P TP     + PP+  SPP+
Sbjct: 530 PPQAEPPTEYSPPATPES---SPPPEGKSPPT 558

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 56/162 (34%), Positives = 69/162 (42%), Gaps = 27/162 (16%)
 Frame = +1

Query: 16   PPSGDG--SYNPTPSSPPGGGSYDP---TP--SPPSDSGGSPPGSYDPTPSPPS-GDGSY 171
            PP G    S+ P  SSPP   S  P   TP  SPPS     PP     TP P      S+
Sbjct: 892  PPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPSH 951

Query: 172  NPTPSTPPSSDCTPP-SQDSPPSDPT-----PTTP--STPTTPSGGYYNSPPQDSSPPTD 327
             P  S+PPS +  PP S     S P+     P +P  STP        ++P  +SSPP++
Sbjct: 952  TPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSE 1011

Query: 328  -----PTPTTPSTPTT------PSGGYYNSPPQDSSPPSDPL 420
                 P+P   S P        PS      PP  SSPP  P+
Sbjct: 1012 EEYMPPSPVKSSPPPAEKSQPPPSPVESVLPPVKSSPPHAPV 1053

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 45/149 (30%), Positives = 58/149 (38%), Gaps = 9/149 (6%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNP-TP--SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
            +P   P + + SY P TP  SSPP   S     SPP++    PP +    P       + 
Sbjct: 1083 EPISPPETPEKSYPPSTPEESSPP---SVPKASSPPTEKSLPPPATVSLPPP------TV 1133

Query: 172  NPTPSTPPSSDCTPPSQDSPPSDPT---PTTPSTPTTPSGGYYNSPPQDSSPPTDPT--- 333
             P P   P S   PP +  PP  P    P    +P  P+      PP  S PP  P    
Sbjct: 1134 KPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILP 1193

Query: 334  PTTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
            P    +P  P+      PP  S PP  P+
Sbjct: 1194 PPPVKSPPPPAPVISPPPPVKSPPPPAPV 1222

[107][TOP]
>UniRef100_A3KD20 Leucine-rich repeat/extensin n=1 Tax=Nicotiana plumbaginifolia
            RepID=A3KD20_NICPL
          Length = 725

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 61/163 (37%), Positives = 75/163 (46%), Gaps = 23/163 (14%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSY--DPTPSPPSDSGGSPPGS----YDPT------PS 147
            PT TP S       TPSSPP        PTPSPP  +G +PP        PT      P+
Sbjct: 563  PTYTPHSPPPPVYVTPSSPPPPTPVYEHPTPSPP--AGYTPPQEPSHPAPPTPPCNEPPT 620

Query: 148  PPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGG------YYNSPPQD 309
            PP     + P PS PP+ + +P    SPP  P   T S+P  PS        YY+SPP  
Sbjct: 621  PPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPSPSPPPPTYYYSSPPPP 680

Query: 310  SSPPTDPTPTTPS-TPTTPSGGYYNSPP----QDSSPPSDPLP 423
            S PP  P+P  PS +P  PS  +   PP      +SPP   +P
Sbjct: 681  SPPPPSPSPPPPSPSPPPPSYEHVPLPPVVGVSYASPPPPVIP 723

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 57/149 (38%), Positives = 67/149 (44%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYD-PTPSPPSG----DGS 168
           P P PP        TP SPP      P+  PP      P   Y+ PTPSPP+G       
Sbjct: 552 PPPPPPVHYEPPTYTPHSPPPPVYVTPSSPPP------PTPVYEHPTPSPPAGYTPPQEP 605

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT----DPTP 336
            +P P TPP ++   P   +P   P P+ P T   PS  Y  SPP    PPT     P P
Sbjct: 606 SHPAPPTPPCNEPPTPPPSTPHWQPKPSPPPT-YNPSPSYTQSPPPP--PPTYTYSSPPP 662

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            +PS P  P   YY+SPP  S PP  P P
Sbjct: 663 PSPSPP--PPTYYYSSPPPPSPPPPSPSP 689

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 62/187 (33%), Positives = 72/187 (38%), Gaps = 47/187 (25%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDP------TPSPPSDSGGSPPGSYDPTPSPPSGDG 165
            P P PPS    ++P+PS PP    Y P      +P PP       P +Y P   PP    
Sbjct: 481  PPPPPPSPVYYHHPSPSPPPPPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPV 540

Query: 166  SYNPTPSTPPSSDCTPPSQDSPP-----SDPTPT--TPSTPTTPSGGYYN---------S 297
             Y P   TP S    PP    PP     S P P   TPS+P  P+  Y +         +
Sbjct: 541  HYEPPTYTPQSPPPPPPVHYEPPTYTPHSPPPPVYVTPSSPPPPTPVYEHPTPSPPAGYT 600

Query: 298  PPQDSS-----------PPTDPTPT-----TPSTPTT--PSGGYYNSPP-------QDSS 402
            PPQ+ S           PPT P  T      PS P T  PS  Y  SPP         S 
Sbjct: 601  PPQEPSHPAPPTPPCNEPPTPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSP 660

Query: 403  PPSDPLP 423
            PP  P P
Sbjct: 661  PPPSPSP 667

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 56/172 (32%), Positives = 68/172 (39%), Gaps = 32/172 (18%)
 Frame = +1

Query: 4   PTPTPPSGDGSYN--------PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSG 159
           P+P PP    S +        PT    P      P P PPS     P   + P+PSPP  
Sbjct: 447 PSPPPPVYSSSPSHKHRSPPPPTHKISPVTRHASPPPPPPS-----PVYYHHPSPSPPPP 501

Query: 160 DGSYNP-------TPSTPPSSDCTPPS---QDSPPSDPT----PT-TPSTPTTPSGGYYN 294
              Y P        P  PP     PP+   Q  PP  P     PT TP +P  P   +Y 
Sbjct: 502 PVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPQSPPPPPPVHYE 561

Query: 295 SP---PQDSSPPTDPTPTTPSTPT------TPSGGYYNSPPQDSSPPSDPLP 423
            P   P    PP   TP++P  PT      TPS     +PPQ+ S P+ P P
Sbjct: 562 PPTYTPHSPPPPVYVTPSSPPPPTPVYEHPTPSPPAGYTPPQEPSHPAPPTP 613

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 47/154 (30%), Positives = 61/154 (39%), Gaps = 15/154 (9%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPP--SGDGSYNPT 180
           TP+ P       P PSS   G  +  +P PP  +   PP    P+P PP  S   S+   
Sbjct: 411 TPSRPVAPIESPPPPSSKSSGSHFKRSPPPPQST---PP----PSPPPPVYSSSPSHKHR 463

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTT-----PSTPTTPSGGYYNSP---PQDSSPPTDPT- 333
              PP+   +P ++ + P  P P+      PS    P   YY  P   PQ   PP  P  
Sbjct: 464 SPPPPTHKISPVTRHASPPPPPPSPVYYHHPSPSPPPPPVYYAPPTYKPQSPPPPPPPVH 523

Query: 334 ---PT-TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              PT TP +P  P   +Y  P      P  P P
Sbjct: 524 YEPPTYTPQSPPPPPPVHYEPPTYTPQSPPPPPP 557

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 43/151 (28%), Positives = 51/151 (33%), Gaps = 24/151 (15%)
 Frame = +1

Query: 43  PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQ 222
           P P+  P        P  P  S  S P +   +P PPS   S +    +PP    TPP  
Sbjct: 389 PKPTPKPKRPPVQNKPPAPKPSTPSRPVAPIESPPPPSSKSSGSHFKRSPPPPQSTPPPS 448

Query: 223 DSPP-----------SDPTPTTPSTPTT---------PSGGYYNSPPQDSSPP----TDP 330
             PP           S P PT   +P T         PS  YY+ P     PP      P
Sbjct: 449 PPPPVYSSSPSHKHRSPPPPTHKISPVTRHASPPPPPPSPVYYHHPSPSPPPPPVYYAPP 508

Query: 331 TPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           T    S P  P   +Y  P      P  P P
Sbjct: 509 TYKPQSPPPPPPPVHYEPPTYTPQSPPPPPP 539

[108][TOP]
>UniRef100_A2ZGJ0 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2ZGJ0_ORYSI
          Length = 854

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/138 (36%), Positives = 71/138 (51%), Gaps = 5/138 (3%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           PTP S   S  P P +P G     P  +PP++     P S   +P PP+ +G     P +
Sbjct: 373 PTPESKASS--PPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKS 430

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPS--TPTTPSGGYYNSPPQDSSPPTDPTP-TTPSTPT- 357
            P  + +PP+ +S  S P P  P   TP+ P     +SPP++ SPP  PT  T+P TP  
Sbjct: 431 TPPVEKSPPTPESEASSPPPPAPEGHTPSPPK----SSPPEEKSPPIPPTSHTSPPTPEE 486

Query: 358 -TPSGGYYNSPPQDSSPP 408
            TPS    +SPP++ SPP
Sbjct: 487 YTPSPP-KSSPPEEKSPP 503

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 59/156 (37%), Positives = 74/156 (47%), Gaps = 20/156 (12%)
 Frame = +1

Query: 4   PTPTP----PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGG--SPPGSYDP---TPSPPS 156
           P PTP    PS   S  PT  SPP   S   +P PP+  G   SPP S  P   +P  P 
Sbjct: 383 PPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPE 442

Query: 157 GDGSYNPTPS----TPPSSDCTPPSQDSPPSDPTP-TTPSTPT--TPSGGYYNSPPQDSS 315
            + S  P P+    TP     +PP + SPP  PT  T+P TP   TPS    + P + S 
Sbjct: 443 SEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSP 502

Query: 316 PPTDPTPTTPS----TPTTPSGGYYNSPPQDSSPPS 411
           PP  P  + PS    T T PS     +P ++SSPP+
Sbjct: 503 PPHSPEKSPPSEAHPTSTPPSEKSPPTPAEESSPPT 538

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 58/180 (32%), Positives = 78/180 (43%), Gaps = 39/180 (21%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTP----SSPPGGGSYDPTP----SPPSDSGGSPPGSYDPTPSPPS 156
            + +P+PPSG     P+P    S PP      P P    SPP ++  SPP   + +P PP 
Sbjct: 540  EKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSPPPPPEKSPPPPE 599

Query: 157  GDGSYNPTPS-TPPSSDCTPPS----QDSPPS-----DPTPTTPSTPTT------PSGGY 288
                  PTP  +PP    +PPS      SPPS      PTPT  S+P +      PS   
Sbjct: 600  TKSPPTPTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAK 659

Query: 289  YNSPPQDSSPPT---------------DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
               PP++ SPP+                P+PT  S+P +       SP + + PP  PLP
Sbjct: 660  STPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLP 719

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 54/157 (34%), Positives = 72/157 (45%), Gaps = 21/157 (13%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP-- 177
           PT TPPS      PTP+      + + +PSPPS   G+PP     +  PP    S  P  
Sbjct: 517 PTSTPPSEKSP--PTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPE 574

Query: 178 -TPSTPPSSDCTPPS--QDSPP-----SDPTPTTPSTPTTPSGGYYNSPPQDSSPPT--- 324
            + S PP +  +PP   + SPP     S PTPT   +P        +  P+ SSPP+   
Sbjct: 575 KSSSPPPEAHVSPPPPPEKSPPPPETKSPPTPTPEISPPPEGKSPPSHTPESSSPPSKES 634

Query: 325 --DPTPTTPSTPTT------PSGGYYNSPPQDSSPPS 411
              PTPT  S+P +      PS      PP++ SPPS
Sbjct: 635 EPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPS 671

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 53/147 (36%), Positives = 70/147 (47%), Gaps = 11/147 (7%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS-------PPSGDGSYN 174
           PP G     PT S  P       TPSPP    G P G   PTP        PP+ +G   
Sbjct: 335 PPEGKSPPTPTASHSPPPVPEGHTPSPPKS--GPPAGESPPTPESKASSPPPPTPEGH-- 390

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP--- 345
            TPS P S   TPP++ SPP+  + ++   P  P  G+  SPP+ S+PP + +P TP   
Sbjct: 391 -TPSPPKS---TPPTEKSPPTPESESSSPPPPAPE-GHMPSPPK-STPPVEKSPPTPESE 444

Query: 346 -STPTTPSGGYYNSPPQDSSPPSDPLP 423
            S+P  P+   +   P  SSPP +  P
Sbjct: 445 ASSPPPPAPEGHTPSPPKSSPPEEKSP 471

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 56/150 (37%), Positives = 70/150 (46%), Gaps = 14/150 (9%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           PTP S   S  P P +P G     P  +PP +     P S   +P PP+ +G    TPS 
Sbjct: 406 PTPESESSS--PPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGH---TPSP 460

Query: 190 PPSSDCTPPSQDSPPSDPTP-TTPSTPT--TPSGGYYNSPPQDSSPP-----------TD 327
           P SS   PP + SPP  PT  T+P TP   TPS    +SPP++ SPP             
Sbjct: 461 PKSS---PPEEKSPPIPPTSHTSPPTPEEYTPSPP-KSSPPEEKSPPPHSPEKSPPSEAH 516

Query: 328 PTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
           PT T PS  + P+    +SPP     PS P
Sbjct: 517 PTSTPPSEKSPPTPAEESSPPTPEKSPSPP 546

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 57/157 (36%), Positives = 72/157 (45%), Gaps = 21/157 (13%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY-- 171
            + +P PP       PTP  SPP  G   P+ +P S S  S      PTP+P S   S+  
Sbjct: 592  EKSPPPPETKSPPTPTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEE 651

Query: 172  ----NPTPSTPPSSDCTPPSQ----DSPPSD-----PTPTTPSTPTTPSGGYYNSPPQDS 312
                +P  STPP  + +PPS      SPPS+     P+PT  S+P +       SP + +
Sbjct: 652  YVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKST 711

Query: 313  SPPTDPTPTTPSTPT----TPSGGYYNSP-PQDSSPP 408
             PP  P P  P TPT     PS   Y  P P  SSPP
Sbjct: 712  PPPEKPLP--PHTPTINSSPPSEEEYMPPSPVKSSPP 746

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 47/153 (30%), Positives = 70/153 (45%), Gaps = 17/153 (11%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
           +P PP+ +G     P S P      PTP   + S   PP     TPSPP        +P 
Sbjct: 414 SPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSP-PPPAPEGHTPSPPKSSPPEEKSPP 472

Query: 187 TPPSSDCTPPS---------QDSPPSDPTPTTPSTPTTPSGGYY--NSPPQDSSPPT--- 324
            PP+S  +PP+         + SPP + +P   S   +P    +  ++PP + SPPT   
Sbjct: 473 IPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSTPPSEKSPPTPAE 532

Query: 325 DPTPTTPSTPTTPSGGYYNSPP---QDSSPPSD 414
           + +P TP    +P  G+  +PP   + SSPP +
Sbjct: 533 ESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPE 565

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 50/156 (32%), Positives = 71/156 (45%), Gaps = 20/156 (12%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP- 183
           +P PP+ +G    TPS P      + +P  P  S  SPP   + TPSPP        +P 
Sbjct: 447 SPPPPAPEGH---TPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPP 503

Query: 184 -----STPPSS---DCTPPSQDSPPS---DPTPTTPSTPTTPSGGYYNSPP---QDSSPP 321
                 +PPS      TPPS+ SPP+   + +P TP    +P  G+  +PP   + SSPP
Sbjct: 504 PHSPEKSPPSEAHPTSTPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPP 563

Query: 322 TD-----PTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
            +     P P   S+P   +      PP+ S PP +
Sbjct: 564 PEAHVSSPPPEKSSSPPPEAHVSPPPPPEKSPPPPE 599

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 56/152 (36%), Positives = 74/152 (48%), Gaps = 17/152 (11%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD-SGGSPPGSYDPTPSPPSGDGSYNPTP- 183
           PTP S   S  P P +P G     P  SPP + S   PP S+   P+P      Y P+P 
Sbjct: 439 PTPESEASS--PPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPE----EYTPSPP 492

Query: 184 -STPPSSDCTPP--SQDSPPSD--PTPTTPSTPTTPSGGYYNSPP---QDSSPP-----T 324
            S+PP     PP   + SPPS+  PT T PS  + P+    +SPP   +  SPP     T
Sbjct: 493 KSSPPEEKSPPPHSPEKSPPSEAHPTSTPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGT 552

Query: 325 DPTPTTPSTPTTPSGGYYNSPP--QDSSPPSD 414
            P+P   S+P  P   + +SPP  + SSPP +
Sbjct: 553 PPSPVKSSSP--PPEAHVSSPPPEKSSSPPPE 582

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 45/145 (31%), Positives = 62/145 (42%), Gaps = 6/145 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSY------NPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG 165
            PTPTP S   S+      +P  S+PP      P+ +P S S  S      P+P+P S   
Sbjct: 638  PTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSSPP 697

Query: 166  SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
            S+       P+    PP +  PP   TPT  S+P +       SP + S PP + +   P
Sbjct: 698  SHEEYVPPSPAKSTPPPEKPLPPH--TPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPPP 755

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPL 420
            S   +        PP  SSPP  P+
Sbjct: 756  SPVESV------LPPVKSSPPHAPV 774

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 52/157 (33%), Positives = 68/157 (43%), Gaps = 20/157 (12%)
 Frame = +1

Query: 4    PTPTP-----PSGDG--SYNPTPSSPPGGGSYDP-TPSP------------PSDSGGSPP 123
            PTPTP     P G    S+ P  SSPP   S  P TP+P            PS +  +PP
Sbjct: 604  PTPTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPP 663

Query: 124  GSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPP 303
                   SPP    S+ P  S+PPS +  PP   +P S P       P +P+      PP
Sbjct: 664  ---PEEKSPP----SHTPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKS--TPPP 714

Query: 304  QDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
            +   PP   TPT  S+P +       SP + S PP++
Sbjct: 715  EKPLPP--HTPTINSSPPSEEEYMPPSPVKSSPPPAE 749

[109][TOP]
>UniRef100_Q18756 Collagen sequence x-hybridizing protein 1 n=2 Tax=Caenorhabditis
           elegans RepID=Q18756_CAEEL
          Length = 589

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 55/147 (37%), Positives = 72/147 (48%), Gaps = 8/147 (5%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--D 162
           DP+  PPSG   G +NP+ + P GG  G +DP+ +PPS   G PPG +DP+ +PPSG   
Sbjct: 246 DPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPS---GGPPGPFDPSGAPPSGGPP 302

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGG-YYNSPPQDSSPPTDPTPT 339
           G ++P+ + P      PP   +P   P    P  P  PSG      PP   +P   P   
Sbjct: 303 GPFDPSGAQPSGG---PPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSG 359

Query: 340 TPSTPTTPSGGYYNSPPQDSSP-PSDP 417
            P  P  PSG    +PP    P P DP
Sbjct: 360 GPPGPFDPSG----APPSGGPPGPFDP 382

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 56/147 (38%), Positives = 73/147 (49%), Gaps = 8/147 (5%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--D 162
           DP+  PPSG   G +NP+ + P GG  G +DP+ +PPS   G PPG +DP+ +PPSG   
Sbjct: 336 DPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPS---GGPPGPFDPSGAPPSGGPP 392

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGG-YYNSPPQDSSPPTDPTPT 339
           G ++P+   PPS    PP   +P   P    P  P  PSG      PP   +P   P   
Sbjct: 393 GPFDPS-GAPPSGG--PPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSG 449

Query: 340 TPSTPTTPSGGYYNSPPQDSSP-PSDP 417
            P  P  PSG    +PP    P P +P
Sbjct: 450 GPPGPFNPSG----APPSGGPPGPFNP 472

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 56/147 (38%), Positives = 73/147 (49%), Gaps = 8/147 (5%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--D 162
           +P+  PPSG   G ++P+ + P GG  G +DP+ +PPS   G PPG +DP+ +PPSG   
Sbjct: 351 NPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPS---GGPPGPFDPSGAPPSGGPP 407

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGG-YYNSPPQDSSPPTDPTPT 339
           G +NP+   PPS    PP   +P   P    P  P  PSG      PP   +P   P   
Sbjct: 408 GPFNPS-GAPPSGG--PPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSG 464

Query: 340 TPSTPTTPSGGYYNSPPQDSSP-PSDP 417
            P  P  PSG    +PP    P P DP
Sbjct: 465 GPPGPFNPSG----APPSGGPPGPFDP 487

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 54/148 (36%), Positives = 72/148 (48%), Gaps = 7/148 (4%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--D 162
           DP+  PPSG   G +NP+ + P GG  G ++P+ +PPS   G PPG ++P+ +PPSG   
Sbjct: 396 DPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPS---GGPPGPFNPSGAPPSGGPP 452

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGG-YYNSPPQDSSPPTDPTPT 339
           G +NP+   PPS    PP   +P   P    P  P  PSG      PP   +P   P   
Sbjct: 453 GPFNPS-GAPPSGG--PPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSG 509

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P  P  PSG   +  P    P   P+P
Sbjct: 510 GPPGPFDPSGAPPSGMPPVPLPTDLPIP 537

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 58/151 (38%), Positives = 76/151 (50%), Gaps = 12/151 (7%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--D 162
           +P+  PPSG   G ++P+ + P GG  G ++P+ +PPS   G PPG +DP+ +PPSG   
Sbjct: 201 NPSEAPPSGGPTGPFDPSGAPPSGGPPGPFNPSGAPPS---GGPPGPFDPSGAPPSGGPP 257

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPT 339
           G +NP+   PPS    PP    P   P    P  P  PSG    +PP    P P DP+  
Sbjct: 258 GPFNPS-GAPPSGG--PPGPFDPSGAPPSGGPPGPFDPSG----APPSGGPPGPFDPSGA 310

Query: 340 TPS----TPTTPSGGYYNSPPQDSSP-PSDP 417
            PS     P  PSG    +PP    P P DP
Sbjct: 311 QPSGGPPGPFNPSG----APPSGGPPGPFDP 337

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 58/151 (38%), Positives = 76/151 (50%), Gaps = 12/151 (7%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--D 162
           DP+  PPSG   G ++P+ + P GG  G ++P+ +PPS   G PPG +DP+ +PPSG   
Sbjct: 291 DPSGAPPSGGPPGPFDPSGAQPSGGPPGPFNPSGAPPS---GGPPGPFDPSGAPPSGGPP 347

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPT 339
           G +NP+   PPS    PP    P   P    P  P  PSG    +PP    P P DP+  
Sbjct: 348 GPFNPS-GAPPSGG--PPGPFDPSGAPPSGGPPGPFDPSG----APPSGGPPGPFDPSGA 400

Query: 340 TPS----TPTTPSGGYYNSPPQDSSP-PSDP 417
            PS     P  PSG    +PP    P P +P
Sbjct: 401 PPSGGPPGPFNPSG----APPSGGPPGPFNP 427

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 61/162 (37%), Positives = 80/162 (49%), Gaps = 23/162 (14%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--D 162
           DP+  PPSG   G ++P+ + P GG  G +DP+ +PPS   G PPG ++P+ +PPSG   
Sbjct: 366 DPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPS---GGPPGPFNPSGAPPSGGPP 422

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSG--------GYYN---SPPQD 309
           G +NP+   PPS    PP   +P   P    P  P  PSG        G +N   +PP  
Sbjct: 423 GPFNPS-GAPPSGG--PPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSG 479

Query: 310 SSP-PTDPTPTTPS----TPTTPSGGYYNSPPQDSSP-PSDP 417
             P P DP+   PS     P  PSG    +PP    P P DP
Sbjct: 480 GPPGPFDPSGAPPSGGPPGPFNPSG----APPSGGPPGPFDP 517

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 62/163 (38%), Positives = 80/163 (49%), Gaps = 24/163 (14%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--D 162
           DP+  PPSG   G +NP+ + P GG  G +DP+ +PPS   G PPG ++P+ +PPSG   
Sbjct: 216 DPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPS---GGPPGPFNPSGAPPSGGPP 272

Query: 163 GSYNPT-------PSTPPSSDCTPPSQDSP-PSDPTPTTPS----TPTTPSGGYYNSPPQ 306
           G ++P+       P  P      PPS   P P DP+   PS     P  PSG    +PP 
Sbjct: 273 GPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAQPSGGPPGPFNPSG----APPS 328

Query: 307 DSSP-PTDPTPTTPS----TPTTPSGGYYNSPPQDSSP-PSDP 417
              P P DP+   PS     P  PSG    +PP    P P DP
Sbjct: 329 GGPPGPFDPSGAPPSGGPPGPFNPSG----APPSGGPPGPFDP 367

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 58/151 (38%), Positives = 74/151 (49%), Gaps = 12/151 (7%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--D 162
           DP+  PPSG   G + P+ + P GG  G ++P+ +PPS   G P G +DP+ +PPSG   
Sbjct: 171 DPSGAPPSGGPPGPFGPSGAPPSGGPPGPFNPSEAPPS---GGPTGPFDPSGAPPSGGPP 227

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPT 339
           G +NP+   PPS    PP    P   P    P  P  PSG    +PP    P P DP+  
Sbjct: 228 GPFNPS-GAPPSGG--PPGPFDPSGAPPSGGPPGPFNPSG----APPSGGPPGPFDPSGA 280

Query: 340 TPS----TPTTPSGGYYNSPPQDSSP-PSDP 417
            PS     P  PSG    +PP    P P DP
Sbjct: 281 PPSGGPPGPFDPSG----APPSGGPPGPFDP 307

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 56/151 (37%), Positives = 74/151 (49%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4   PTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--DG 165
           P+  PPSG   G +NP+ + P GG  G +DP+ +PPS   G PPG ++P+ +PPSG   G
Sbjct: 187 PSGAPPSGGPPGPFNPSEAPPSGGPTGPFDPSGAPPS---GGPPGPFNPSGAPPSGGPPG 243

Query: 166 SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPTT 342
            ++P+   PPS    PP   +P   P    P  P  PSG    +PP    P P DP+   
Sbjct: 244 PFDPS-GAPPSGG--PPGPFNPSGAPPSGGPPGPFDPSG----APPSGGPPGPFDPSGAP 296

Query: 343 PS----TPTTPSGGYYNSPPQDSSPPSDPLP 423
           PS     P  PSG   +  P     PS   P
Sbjct: 297 PSGGPPGPFDPSGAQPSGGPPGPFNPSGAPP 327

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 58/151 (38%), Positives = 75/151 (49%), Gaps = 12/151 (7%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--D 162
           +P+  PPSG   G ++P+ + P GG  G +DP+ +PPS   G PPG +DP+ + PSG   
Sbjct: 261 NPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPS---GGPPGPFDPSGAQPSGGPP 317

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPT 339
           G +NP+   PPS    PP    P   P    P  P  PSG    +PP    P P DP+  
Sbjct: 318 GPFNPS-GAPPSGG--PPGPFDPSGAPPSGGPPGPFNPSG----APPSGGPPGPFDPSGA 370

Query: 340 TPS----TPTTPSGGYYNSPPQDSSP-PSDP 417
            PS     P  PSG    +PP    P P DP
Sbjct: 371 PPSGGPPGPFDPSG----APPSGGPPGPFDP 397

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 60/148 (40%), Positives = 73/148 (49%), Gaps = 11/148 (7%)
 Frame = +1

Query: 7   TPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--DGS 168
           T  PPSG   G ++P+ + P GG  G +DP+ +PPS   G PPG + P+ +PPSG   G 
Sbjct: 143 TGAPPSGGPPGPFDPSGAPPSGGPPGLFDPSGAPPS---GGPPGPFGPSGAPPSGGPPGP 199

Query: 169 YNPTPSTPPSSDCTPPSQDS--PPS--DPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           +NP+   PPS   T P   S  PPS   P P  PS    PSGG    PP    P   P  
Sbjct: 200 FNPS-EAPPSGGPTGPFDPSGAPPSGGPPGPFNPS-GAPPSGG----PPGPFDPSGAPPS 253

Query: 337 TTPSTPTTPSGGYYNSPPQDSSP-PSDP 417
             P  P  PSG    +PP    P P DP
Sbjct: 254 GGPPGPFNPSG----APPSGGPPGPFDP 277

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 54/147 (36%), Positives = 72/147 (48%), Gaps = 8/147 (5%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--D 162
           DP+  PPSG   G ++P+ + P GG  G + P+ +PPS   G PPG ++P+ +PPSG   
Sbjct: 156 DPSGAPPSGGPPGLFDPSGAPPSGGPPGPFGPSGAPPS---GGPPGPFNPSEAPPSGGPT 212

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGG-YYNSPPQDSSPPTDPTPT 339
           G ++P+   PPS    PP   +P   P    P  P  PSG      PP   +P   P   
Sbjct: 213 GPFDPS-GAPPSGG--PPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSG 269

Query: 340 TPSTPTTPSGGYYNSPPQDSSP-PSDP 417
            P  P  PSG    +PP    P P DP
Sbjct: 270 GPPGPFDPSG----APPSGGPPGPFDP 292

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 54/147 (36%), Positives = 71/147 (48%), Gaps = 8/147 (5%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--D 162
           DP+   PSG   G +NP+ + P GG  G +DP+ +PPS   G PPG ++P+ +PPSG   
Sbjct: 306 DPSGAQPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPS---GGPPGPFNPSGAPPSGGPP 362

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGG-YYNSPPQDSSPPTDPTPT 339
           G ++P+   PPS    PP    P   P    P  P  PSG      PP   +P   P   
Sbjct: 363 GPFDPS-GAPPSGG--PPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSG 419

Query: 340 TPSTPTTPSGGYYNSPPQDSSP-PSDP 417
            P  P  PSG    +PP    P P +P
Sbjct: 420 GPPGPFNPSG----APPSGGPPGPFNP 442

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 53/147 (36%), Positives = 72/147 (48%), Gaps = 8/147 (5%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--D 162
           +P+  PPSG   G ++P+ + P GG  G ++P+ +PPS   G PPG +DP+ +PPSG   
Sbjct: 321 NPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPS---GGPPGPFDPSGAPPSGGPP 377

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGG-YYNSPPQDSSPPTDPTPT 339
           G ++P+   PPS    PP    P   P    P  P  PSG      PP   +P   P   
Sbjct: 378 GPFDPS-GAPPSGG--PPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSG 434

Query: 340 TPSTPTTPSGGYYNSPPQDSSP-PSDP 417
            P  P  PSG    +PP    P P +P
Sbjct: 435 GPPGPFNPSG----APPSGGPPGPFNP 457

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 56/151 (37%), Positives = 76/151 (50%), Gaps = 12/151 (7%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--D 162
           DP+  PPSG   G ++P+ + P GG  G +DP+ + PS   G PPG ++P+ +PPSG   
Sbjct: 276 DPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAQPS---GGPPGPFNPSGAPPSGGPP 332

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP-PTDPTPT 339
           G ++P+   PPS    PP   +P   P    P  P  PSG    +PP    P P DP+  
Sbjct: 333 GPFDPS-GAPPSGG--PPGPFNPSGAPPSGGPPGPFDPSG----APPSGGPPGPFDPSGA 385

Query: 340 TPS----TPTTPSGGYYNSPPQDSSP-PSDP 417
            PS     P  PSG    +PP    P P +P
Sbjct: 386 PPSGGPPGPFDPSG----APPSGGPPGPFNP 412

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 56/163 (34%), Positives = 78/163 (47%), Gaps = 22/163 (13%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPSDSGGSPPGSYDPTPSPPSGD-- 162
           +P+  PPSG   G +NP+ + P GG  G ++P+ +PPS   G PPG ++P+ +PPSG   
Sbjct: 426 NPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPS---GGPPGPFNPSGAPPSGGPP 482

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT- 339
           G ++P+   PPS    PP   +P   P    P  P  PSG    +PP  S  P  P PT 
Sbjct: 483 GPFDPS-GAPPSGG--PPGPFNPSGAPPSGGPPGPFDPSG----APP--SGMPPVPLPTD 533

Query: 340 ------TPS---------TPTTPSGGYYNSPPQDSSPPSDPLP 423
                 +PS          P+ P+G   +  P     PS P P
Sbjct: 534 LPIPSESPSFFQWIFGRPKPSGPAGPAPSGEPPGPFDPSGPPP 576

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 52/149 (34%), Positives = 65/149 (43%), Gaps = 13/149 (8%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGG-----GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG--DGS 168
           P P     S  P PS+   G     G +  T +PPS   G PPG +DP+ +PPSG   G 
Sbjct: 113 PRPSRSPHSDAPEPSAATDGFELVFGKHHSTGAPPS---GGPPGPFDPSGAPPSGGPPGL 169

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDS-SPPTDPTPTTP 345
           ++P+   PPS    PP    P   P    P  P  PS     +PP    + P DP+   P
Sbjct: 170 FDPS-GAPPSGG--PPGPFGPSGAPPSGGPPGPFNPS----EAPPSGGPTGPFDPSGAPP 222

Query: 346 S----TPTTPSGGYYNSPPQDSSP-PSDP 417
           S     P  PSG    +PP    P P DP
Sbjct: 223 SGGPPGPFNPSG----APPSGGPPGPFDP 247

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 54/160 (33%), Positives = 73/160 (45%), Gaps = 23/160 (14%)
 Frame = +1

Query: 1   DPTPTPPSGD--GSYNPTPSSPPGG--GSYDPTPSPPS-------DSGGS-----PPGSY 132
           +P+  PPSG   G +NP+ + P GG  G ++P+ +PPS       D  G+     PPG +
Sbjct: 441 NPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPF 500

Query: 133 DPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPT-TPSGGYYNSPPQD 309
           +P+ +PPSG       P  P      PPS    P  P PT    P+ +PS   +      
Sbjct: 501 NPSGAPPSGG------PPGPFDPSGAPPS--GMPPVPLPTDLPIPSESPSFFQWIFGRPK 552

Query: 310 SSPPTDPTPT-TPSTPTTPSGGYYNSPPQDSS-----PPS 411
            S P  P P+  P  P  PSG     PP +SS     PPS
Sbjct: 553 PSGPAGPAPSGEPPGPFDPSG----PPPSESSEGSGIPPS 588

[110][TOP]
>UniRef100_P05142 Proline-rich protein HaeIII subfamily 1 n=1 Tax=Mus musculus
           RepID=PRH1_MOUSE
          Length = 261

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 55/144 (38%), Positives = 57/144 (39%), Gaps = 5/144 (3%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYNPT 180
           P PP G     P    PPGG    P P PP   G  PPG   P P    PP G     P 
Sbjct: 52  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGGPQPRPPQGPPPPGGPQQRPP 105

Query: 181 PSTPPSS--DCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
              PP       PP    PP  P P  P  P  P GG    PPQ   PP  P P  P  P
Sbjct: 106 QGPPPPGGPQQRPPQGPPPPGGPQPRPPQGPPPP-GGPQLRPPQGPPPPAGPQPRPPQGP 164

Query: 355 TTPSGGYYNSPPQDSSPPSDPLPR 426
             P+G     PPQ   PP+ P PR
Sbjct: 165 PPPAGP-QPRPPQ-GPPPTGPQPR 186

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 52/145 (35%), Positives = 56/145 (38%), Gaps = 6/145 (4%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS------PPGSYDPTPSPPSGDGSY 171
           P PP G     P    PPGG    P   PP   G        PP    P P PP G    
Sbjct: 80  PPPPGGPQPRPPQGPPPPGGPQQRPPQGPPPPGGPQQRPPQGPPPPGGPQPRPPQG---- 135

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
              P  P      PP    PP+ P P  P  P  P+G     PPQ   PPT P P  P+ 
Sbjct: 136 ---PPPPGGPQLRPPQGPPPPAGPQPRPPQGPPPPAGP-QPRPPQ-GPPPTGPQP-RPTQ 189

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLPR 426
              P+GG    PPQ   PP  P PR
Sbjct: 190 GPPPTGGPQQRPPQGPPPPGGPQPR 214

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 53/139 (38%), Positives = 54/139 (38%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP       P P   PGG    P P PP   G  PPG   P P PP G       P  
Sbjct: 41  PRPPVNGSQQGPPP---PGG----PQPRPPQ--GPPPPGG--PQPRPPQG-------PPP 82

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           P      PP    PP  P    P  P  P GG    PPQ   PP  P P  P  P  P G
Sbjct: 83  PGGPQPRPPQGPPPPGGPQQRPPQGP-PPPGGPQQRPPQGPPPPGGPQPRPPQGP-PPPG 140

Query: 370 GYYNSPPQDSSPPSDPLPR 426
           G    PPQ   PP+ P PR
Sbjct: 141 GPQLRPPQGPPPPAGPQPR 159

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 51/140 (36%), Positives = 56/140 (40%), Gaps = 4/140 (2%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYD----PTPSPPSGDGSYNP 177
           P PP G     P    PPGG    P P PP   G  PPG         P PP+G     P
Sbjct: 108 PPPPGGPQQRPPQGPPPPGG----PQPRPPQ--GPPPPGGPQLRPPQGPPPPAGPQPRPP 161

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
               PP+     P Q  PP+ P P  P+    P+GG    PPQ   PP  P P  P  P 
Sbjct: 162 QGPPPPAGPQPRPPQGPPPTGPQP-RPTQGPPPTGGPQQRPPQGPPPPGGPQPRPPQGP- 219

Query: 358 TPSGGYYNSPPQDSSPPSDP 417
            P GG   SP Q   P   P
Sbjct: 220 PPPGGPQPSPTQGPPPTGGP 239

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 44/141 (31%), Positives = 52/141 (36%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P   PP G     P    PP  G   P P PP      PP    P P PP G        
Sbjct: 133 PQGPPPPGGPQLRPPQGPPPPAG---PQPRPPQ----GPPPPAGPQPRPPQG-------- 177

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP+     P+Q  PP+      P     P GG    PPQ   PP  P P +P+    P
Sbjct: 178 -PPPTGPQPRPTQGPPPTGGPQQRPPQGPPPPGGPQPRPPQGPPPPGGPQP-SPTQGPPP 235

Query: 364 SGGYYNSPPQDSSPPSDPLPR 426
           +GG   +PP   +    P  R
Sbjct: 236 TGGPQQTPPLAGNTQGPPQGR 256

[111][TOP]
>UniRef100_UPI000155BC7D PREDICTED: similar to zonadhesin, partial n=1 Tax=Ornithorhynchus
            anatinus RepID=UPI000155BC7D
          Length = 1553

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 65/179 (36%), Positives = 87/179 (48%), Gaps = 37/179 (20%)
 Frame = +1

Query: 1    DPT----PTPPSGDGSYNPTPSSPPGG---------GSYDPT-PSPPSDSGGSPPGSYDP 138
            DPT    PT P+ D     TP++ P G         G  DPT P+ P+D    PPG  DP
Sbjct: 725  DPTRPTGPTDPTADPPGTSTPTAKPPGPTDPTSKPPGPTDPTRPTGPTDPSTKPPGPTDP 784

Query: 139  T-PSPPSGDGSYNPTPSTPPSSDCTP--PSQDSPPSDPT-----PTTPSTPTTPSGGYYN 294
            T P+ P+   +  P+P+ P S    P  P++ + P+DP+     PT P+ PT P+     
Sbjct: 785  TRPTGPTDPSTEPPSPTDPTSRPTGPTDPTRPTGPTDPSTKPPGPTDPTRPTGPTDPSTE 844

Query: 295  SP-PQD-SSPPTDPT-------PTTPST----PTTPSGGYYNSPPQDSSP--PSDPLPR 426
            SP P D +S PT PT       PT PST    PT P+     + P  S P  P++P PR
Sbjct: 845  SPSPTDPTSRPTGPTDPTGPTGPTDPSTKPTGPTDPTANPPGTSPPTSKPPGPTEPTPR 903

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 57/149 (38%), Positives = 76/149 (51%), Gaps = 8/149 (5%)
 Frame = +1

Query: 1    DPT-PTPPSGDGSYNPTPSSPPGG--GSYDPT-PSPPSDSGGSPPGSYDPTPSPPSGDGS 168
            DPT PT P+   + +P+P+ P     G  DPT P+ P+D    P G  DPT +PP   G+
Sbjct: 831  DPTRPTGPTDPSTESPSPTDPTSRPTGPTDPTGPTGPTDPSTKPTGPTDPTANPP---GT 887

Query: 169  YNPTPSTPPSSDCTPPSQDSPPSDPT--PTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
              PT   P  ++ TP  +   P+DPT  PT P+ PT P+G     P  + + PTDPT   
Sbjct: 888  SPPTSKPPGPTEPTP--RPPGPTDPTSRPTGPTDPTGPTGP--TDPSTEPTGPTDPTDNP 943

Query: 343  P--STPTTPSGGYYNSPPQDSSPPSDPLP 423
            P  STPT    G    P  +   P+DP P
Sbjct: 944  PCTSTPTAKPPG-PTDPSTEPPTPTDPTP 971

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 58/161 (36%), Positives = 79/161 (49%), Gaps = 22/161 (13%)
 Frame = +1

Query: 1    DPT-PTPPSGDGSYNPTPSSPPGG--GSYDPT-PSPPSDSGGSPPGSYDPT-PSPPSGDG 165
            DPT PT P+   +  P+P+ P     G  DPT P+ P+D    PPG  DPT P+ P+   
Sbjct: 783  DPTRPTGPTDPSTEPPSPTDPTSRPTGPTDPTRPTGPTDPSTKPPGPTDPTRPTGPTDPS 842

Query: 166  SYNPTPSTPPSSDCTPPSQDSP--PSDPT--PTTPSTPTTPSGGYYNSPPQDSSP-PTDP 330
            + +P+P+ P S    P     P  P+DP+  PT P+ PT    G   SPP    P PT+P
Sbjct: 843  TESPSPTDPTSRPTGPTDPTGPTGPTDPSTKPTGPTDPTANPPG--TSPPTSKPPGPTEP 900

Query: 331  TP------------TTPSTPTTPSGGYYNSPPQDSSPPSDP 417
            TP            T P+ PT P+G     P  + + P+DP
Sbjct: 901  TPRPPGPTDPTSRPTGPTDPTGPTGP--TDPSTEPTGPTDP 939

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 57/153 (37%), Positives = 71/153 (46%), Gaps = 16/153 (10%)
 Frame = +1

Query: 1    DPT--PTPPSGD-GSYNPTPSSPPGGGSYDPTPSPPSDSG--GSPPGSYDPTPSPPSGDG 165
            DPT  PT P+   G   PT  S    G  DPT +PP  S     PPG  +PTP PP    
Sbjct: 850  DPTSRPTGPTDPTGPTGPTDPSTKPTGPTDPTANPPGTSPPTSKPPGPTEPTPRPPGPTD 909

Query: 166  SYN----PTPSTPPSSDCTPPSQDSPPSDPTPTTP--STPTTPSGGYYNSPPQDSSPPTD 327
              +    PT  T P+    P ++ + P+DPT   P  STPT    G    P  +   PTD
Sbjct: 910  PTSRPTGPTDPTGPTGPTDPSTEPTGPTDPTDNPPCTSTPTAKPPG-PTDPSTEPPTPTD 968

Query: 328  PTP-----TTPSTPTTPSGGYYNSPPQDSSPPS 411
            PTP      TP+  TTPS    ++P   S PP+
Sbjct: 969  PTPDVTTSQTPTASTTPSPITGSTPAPGSCPPN 1001

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 61/176 (34%), Positives = 70/176 (39%), Gaps = 38/176 (21%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSG--GSPPGSYDPTPSPPSGDGSYNP 177
            PT  PP       PT       G  DPT  PP  S     PPG  DPT  PP       P
Sbjct: 716  PTAKPPGPTDPTRPT-------GPTDPTADPPGTSTPTAKPPGPTDPTSKPPGPTDPTRP 768

Query: 178  T-----------------------PSTPPSSDCTPPSQDSPPSDPT----PTTPST---- 264
            T                       PST P S   P S+ + P+DPT    PT PST    
Sbjct: 769  TGPTDPSTKPPGPTDPTRPTGPTDPSTEPPSPTDPTSRPTGPTDPTRPTGPTDPSTKPPG 828

Query: 265  ---PTTPSGGYYNSPPQDSSPPTDPT--PTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
               PT P+G     P  +S  PTDPT  PT P+ PT P+G     P    + P+DP
Sbjct: 829  PTDPTRPTGP--TDPSTESPSPTDPTSRPTGPTDPTGPTGP--TDPSTKPTGPTDP 880

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 53/151 (35%), Positives = 69/151 (45%), Gaps = 19/151 (12%)
 Frame = +1

Query: 31   GSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCT 210
            G     P++ P G +    P+ P+D    PPG+  PT  PP   G  +PT   P  +D T
Sbjct: 710  GCQETGPTAKPPGPTDPTRPTGPTDPTADPPGTSTPTAKPP---GPTDPTSKPPGPTDPT 766

Query: 211  PPSQDSPPS--DPTPTTPSTPTTPSGGYYNSPPQDSSP------PTDPT----PTTPST- 351
             P+  + PS   P PT P+ PT P+      PP  + P      PTDPT    PT PST 
Sbjct: 767  RPTGPTDPSTKPPGPTDPTRPTGPTDP-STEPPSPTDPTSRPTGPTDPTRPTGPTDPSTK 825

Query: 352  ------PTTPSGGYYNSPPQDSSPPSDPLPR 426
                  PT P+G     P  +S  P+DP  R
Sbjct: 826  PPGPTDPTRPTGP--TDPSTESPSPTDPTSR 854

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 55/152 (36%), Positives = 77/152 (50%), Gaps = 13/152 (8%)
 Frame = +1

Query: 1    DPT-PTPPSGDGSYNPTPSSP--PGGGSYDPTPSP-PSDSGGSPPGSYDPTPSPPSGDGS 168
            DPT PT P+   +  P P+ P  P G +   T SP P+D    P G  DPT      D S
Sbjct: 812  DPTRPTGPTDPSTKPPGPTDPTRPTGPTDPSTESPSPTDPTSRPTGPTDPTGPTGPTDPS 871

Query: 169  YNPTPSTPPSSD---CTPPSQDSP-PSDPTPTTP--STPTT-PSGGYYNSPPQDSSPPTD 327
              PT  T P+++    +PP+   P P++PTP  P  + PT+ P+G      P D + PT 
Sbjct: 872  TKPTGPTDPTANPPGTSPPTSKPPGPTEPTPRPPGPTDPTSRPTG------PTDPTGPTG 925

Query: 328  PT--PTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
            PT   T P+ PT P+    ++PP  S+P + P
Sbjct: 926  PTDPSTEPTGPTDPT----DNPPCTSTPTAKP 953

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 50/156 (32%), Positives = 64/156 (41%), Gaps = 18/156 (11%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            DPT  PP      +P  S PPG     P P  P+D    P G  DPT      D S  PT
Sbjct: 879  DPTANPPGT----SPPTSKPPGPTEPTPRPPGPTDPTSRPTGPTDPTGPTGPTDPSTEPT 934

Query: 181  PSTPPSSD--CT------PPSQDSP---PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTD 327
              T P+ +  CT      PP    P   P  PT  TP   T+ +       P  S+ P+ 
Sbjct: 935  GPTDPTDNPPCTSTPTAKPPGPTDPSTEPPTPTDPTPDVTTSQT-------PTASTTPSP 987

Query: 328  PTPTTPSTPTTPSGGYY-----NSPP--QDSSPPSD 414
             T +TP+  + P   +Y     + PP  +D SP  D
Sbjct: 988  ITGSTPAPGSCPPNSHYDLCVSSCPPTCEDRSPDCD 1023

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 46/137 (33%), Positives = 62/137 (45%), Gaps = 16/137 (11%)
 Frame = +1

Query: 1    DPTPTPPSG-DGSYNPTPSSPPGG--GSYDPTPSP--PSDSGGSPPGSYDPTPSPPSG-D 162
            +PTP PP   D +  PT  + P G  G  DP+  P  P+D   +PP +  PT  PP   D
Sbjct: 899  EPTPRPPGPTDPTSRPTGPTDPTGPTGPTDPSTEPTGPTDPTDNPPCTSTPTAKPPGPTD 958

Query: 163  GSYNPTPSTPPSSDCTP---PSQDSPPSDPTPTTPSTPTTPSGGYY-----NSPP--QDS 312
             S  P   T P+ D T    P+  + PS  T +TP+  + P   +Y     + PP  +D 
Sbjct: 959  PSTEPPTPTDPTPDVTTSQTPTASTTPSPITGSTPAPGSCPPNSHYDLCVSSCPPTCEDR 1018

Query: 313  SPPTDPTPTTPSTPTTP 363
            SP  D  P  P     P
Sbjct: 1019 SPDCD-LPCQPGCACDP 1034

[112][TOP]
>UniRef100_C6AA19 Autotransporter n=1 Tax=Bartonella grahamii as4aup RepID=C6AA19_BARGA
          Length = 1212

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 59/155 (38%), Positives = 72/155 (46%), Gaps = 14/155 (9%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            DPTP   S   S   TP+  P   S DP+   P+DS  S      PTP+P +     +PT
Sbjct: 727  DPTPADSSSSSSVPITPTPAPSAPS-DPSDPTPADSSSSSSVPITPTPAPSAPSDPSDPT 785

Query: 181  PSTPPSSDCTP------PSQDSPPSDPTPTTPST----PTTPSGGYYNSPPQDSSPPTDP 330
            P+   SS   P      PS  S PSDP PT PS+    P TP+     S P D   P+DP
Sbjct: 786  PADSSSSSSVPITPTPAPSAPSDPSDPIPTDPSSSSSVPITPTPAL--SEPSD---PSDP 840

Query: 331  TP----TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            TP    ++ S P TP+       P   S PSDP P
Sbjct: 841  TPADSSSSSSVPITPT-----PVPSAPSDPSDPTP 870

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 56/155 (36%), Positives = 71/155 (45%), Gaps = 14/155 (9%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            DP P   S   S   TP+  P   S DP+   P+DS  S      PTP+P +     +PT
Sbjct: 671  DPVPADSSSSSSVPITPTPAPSAPS-DPSDPVPADSSSSSSVPITPTPAPSAPSDPSDPT 729

Query: 181  PSTPPSSDCTP------PSQDSPPSDPTP----TTPSTPTTPSGGYYNSPPQDSSPPTDP 330
            P+   SS   P      PS  S PSDPTP    ++ S P TP+       P   S P+DP
Sbjct: 730  PADSSSSSSVPITPTPAPSAPSDPSDPTPADSSSSSSVPITPT-----PAPSAPSDPSDP 784

Query: 331  TP----TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            TP    ++ S P TP+       P   S PSDP+P
Sbjct: 785  TPADSSSSSSVPITPT-----PAPSAPSDPSDPIP 814

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 55/155 (35%), Positives = 69/155 (44%), Gaps = 14/155 (9%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            DP PT  S   S   TP +P      DP+   P+DS  S      PTP+P +     +P 
Sbjct: 643  DPVPTDSSSSSSVPITP-TPALSEPSDPSDPVPADSSSSSSVPITPTPAPSAPSDPSDPV 701

Query: 181  PSTPPSSDCTP------PSQDSPPSDPTP----TTPSTPTTPSGGYYNSPPQDSSPPTDP 330
            P+   SS   P      PS  S PSDPTP    ++ S P TP+       P   S P+DP
Sbjct: 702  PADSSSSSSVPITPTPAPSAPSDPSDPTPADSSSSSSVPITPT-----PAPSAPSDPSDP 756

Query: 331  TP----TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            TP    ++ S P TP+       P   S PSDP P
Sbjct: 757  TPADSSSSSSVPITPT-----PAPSAPSDPSDPTP 786

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 48/126 (38%), Positives = 61/126 (48%), Gaps = 5/126 (3%)
 Frame = +1

Query: 1    DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            DPTP   S   S   TP+  P   S DP+   P+DS  S      PTP+P +     +P 
Sbjct: 755  DPTPADSSSSSSVPITPTPAPSAPS-DPSDPTPADSSSSSSVPITPTPAPSAPSDPSDPI 813

Query: 181  PSTPPSSDC---TPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP--PTDPTPTTP 345
            P+ P SS     TP    S PSDP+  TP+  ++ S       P  S+P  P+DPTPT P
Sbjct: 814  PTDPSSSSSVPITPTPALSEPSDPSDPTPADSSSSSSVPITPTPVPSAPSDPSDPTPTDP 873

Query: 346  STPTTP 363
              PT P
Sbjct: 874  -VPTPP 878

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 51/148 (34%), Positives = 61/148 (41%), Gaps = 8/148 (5%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY--NP 177
            PTP P +     +P P+      S   TP+P   +   P    DPTP+  S   S    P
Sbjct: 687  PTPAPSAPSDPSDPVPADSSSSSSVPITPTPAPSAPSDPS---DPTPADSSSSSSVPITP 743

Query: 178  TPSTPPSSDCTPP------SQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
            TP+    SD + P      S  S P  PTP  PS P+ PS          SS P  PTP 
Sbjct: 744  TPAPSAPSDPSDPTPADSSSSSSVPITPTP-APSAPSDPSDPTPADSSSSSSVPITPTP- 801

Query: 340  TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             PS P+ PS      P   SS P  P P
Sbjct: 802  APSAPSDPSDPIPTDPSSSSSVPITPTP 829

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 51/154 (33%), Positives = 66/154 (42%), Gaps = 16/154 (10%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSS-------PPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGS 168
            P PPS     +PTPSS       P      DP+   P+DS  S      PTP+       
Sbjct: 610  PIPPSPSAPVDPTPSSSVPITPTPAPSAPSDPSDPVPTDSSSSSSVPITPTPALSEPSDP 669

Query: 169  YNPTPSTPPSSDC---TPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP--PTDPT 333
             +P P+   SS     TP    S PSDP+   P+  ++ S       P  S+P  P+DPT
Sbjct: 670  SDPVPADSSSSSSVPITPTPAPSAPSDPSDPVPADSSSSSSVPITPTPAPSAPSDPSDPT 729

Query: 334  P----TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P    ++ S P TP+       P   S PSDP P
Sbjct: 730  PADSSSSSSVPITPT-----PAPSAPSDPSDPTP 758

[113][TOP]
>UniRef100_C0PPC0 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0PPC0_MAIZE
          Length = 199

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 52/151 (34%), Positives = 69/151 (45%), Gaps = 13/151 (8%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           PTP  P      N  P +PP G   +P P+P +   G+PP +  PT +PP    +  P P
Sbjct: 29  PTPNAPPA----NSPPQAPPAG---NPPPAPQAPPAGNPPPA--PTATPPPAPTTPPPAP 79

Query: 184 STPPSSDCT--------PPSQDSPPSDPTPTTPSTPTTPSGGYYNS-PPQDSSPPTDPTP 336
           +TPP +  T        PP+  +PP  P  + P  PTTP      S PP  ++PP  P  
Sbjct: 80  TTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPPSPPM 139

Query: 337 TTPS----TPTTPSGGYYNSPPQDSSPPSDP 417
            TP+    +P TPS     SP    SP   P
Sbjct: 140 ATPAASPKSPKTPSPAAATSPAPSLSPAGTP 170

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 49/129 (37%), Positives = 66/129 (51%), Gaps = 3/129 (2%)
 Frame = +1

Query: 43  PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP-SPPSGDGSYNPTPSTPPSSDCTPPS 219
           PTP++PP      P  +PP+   G+PP    P P +PP+G+    PT + PP+    PP+
Sbjct: 29  PTPNAPPANS---PPQAPPA---GNPP----PAPQAPPAGNPPPAPTATPPPAPTTPPPA 78

Query: 220 QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPP--Q 393
             +PP  PT T P  PTTP       PP  ++PP  P  + P  PTTP      SPP   
Sbjct: 79  PTTPPPAPT-TPPPAPTTP-------PPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAP 130

Query: 394 DSSPPSDPL 420
            + PPS P+
Sbjct: 131 ATPPPSPPM 139

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 37/102 (36%), Positives = 49/102 (48%), Gaps = 1/102 (0%)
 Frame = +1

Query: 115 SPPGSYDPTPS-PPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYY 291
           SPP    PTP+ PP+      P    PP +   PP+ + PP+ PT T P  PTTP     
Sbjct: 22  SPPAQPPPTPNAPPANSPPQAPPAGNPPPAPQAPPAGNPPPA-PTATPPPAPTTPPPAPT 80

Query: 292 NSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
             PP  ++PP  PT   P+  T P     + PP  ++PP  P
Sbjct: 81  TPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSP 122

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 44/123 (35%), Positives = 56/123 (45%)
 Frame = +1

Query: 55  SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPP 234
           SPP      P P+P +    SPP       +PP+G+    P P  PP+ +  P    +PP
Sbjct: 22  SPPA----QPPPTPNAPPANSPP------QAPPAGNPP--PAPQAPPAGNPPPAPTATPP 69

Query: 235 SDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
             PT T P  PTTP       PP  ++PP  PT   PS P +P       PP   SPP+ 
Sbjct: 70  PAPT-TPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPP---SPPAS 125

Query: 415 PLP 423
           P P
Sbjct: 126 PPP 128

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 43/116 (37%), Positives = 55/116 (47%), Gaps = 6/116 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           PT TPP    +  P P++PP      P P+ P  +  +PP +  PT  PPS   S  P P
Sbjct: 64  PTATPPPAPTTPPPAPTTPP------PAPTTPPPAPTTPPPA--PTTPPPSPPASPPPAP 115

Query: 184 STPPSSD--CTPPSQDSPPSDPTPTTPS----TPTTPSGGYYNSPPQDSSPPTDPT 333
           +TPP S     PP+  +PP  P   TP+    +P TPS     SP    SP   PT
Sbjct: 116 TTPPPSPPASPPPAPATPPPSPPMATPAASPKSPKTPSPAAATSPAPSLSPAGTPT 171

[114][TOP]
>UniRef100_B9RLA3 ATP binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RLA3_RICCO
          Length = 811

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 54/142 (38%), Positives = 66/142 (46%), Gaps = 3/142 (2%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP-TP 183
           +P PPS     N   +SPP   +  P  SPP  S  SPP    P+P PPS     NP +P
Sbjct: 167 SPPPPS-----NTPTTSPPPSSARPPANSPPPASL-SPPQESPPSPPPPSSKPPENPPSP 220

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST--PT 357
             PP++   PP+   P   P P TPS P T S     SPP  S PP   +P  P+   PT
Sbjct: 221 PPPPATPSEPPTNSPPSPPPPPATPSEPPTNS-----SPPPVSVPPPRRSPPGPAATPPT 275

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
           T      ++PP  S PP    P
Sbjct: 276 TSPPPPASTPPASSPPPPASAP 297

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 54/148 (36%), Positives = 66/148 (44%), Gaps = 10/148 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDP----TPSPPSDSGGSPPGSYDPTP-----SPPS 156
           PTP PP    S  PT S PP   + DP    +P PP      PP     TP      PP+
Sbjct: 109 PTPQPPVA--SPPPTTSPPPPSPNADPPTSNSPPPPQSPVQLPPPPVSSTPPATPSDPPT 166

Query: 157 GDGSYNPTPST-PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT 333
                + TP+T PP S   PP+   PP+  +P   S P+ P        P  S PP +P 
Sbjct: 167 SPPPPSNTPTTSPPPSSARPPANSPPPASLSPPQESPPSPP--------PPSSKPPENP- 217

Query: 334 PTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
           P+ P  P TPS    NSPP    PP+ P
Sbjct: 218 PSPPPPPATPSEPPTNSPPSPPPPPATP 245

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 62/157 (39%), Positives = 71/157 (45%), Gaps = 22/157 (14%)
 Frame = +1

Query: 4   PTPT---PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSG----------GSPPGSYDPTP 144
           P PT   PP    +  PT +SPP   S    P PP  S             PP S  PT 
Sbjct: 118 PPPTTSPPPPSPNADPPTSNSPPPPQSPVQLPPPPVSSTPPATPSDPPTSPPPPSNTPTT 177

Query: 145 SPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTT---------PSTPTTPSGGYYNS 297
           SPP    S  P  ++PP +  +PP Q+SPPS P P++         P  P TPS    NS
Sbjct: 178 SPPPS--SARPPANSPPPASLSPP-QESPPSPPPPSSKPPENPPSPPPPPATPSEPPTNS 234

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPP 408
           PP   SPP  P P TPS P T S     SPP  S PP
Sbjct: 235 PP---SPP--PPPATPSEPPTNS-----SPPPVSVPP 261

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 51/144 (35%), Positives = 64/144 (44%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS     NP            P+P PP  +   PP +  P+P PP    S  PT 
Sbjct: 204 PSPPPPSSKPPENP------------PSPPPPPATPSEPPTNSPPSPPPPPATPSEPPTN 251

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP-STPTT 360
           S+PP     PP +  P    TP T S P   S    +SPP  +S P + +P  P S   T
Sbjct: 252 SSPPPVSVPPPRRSPPGPAATPPTTSPPPPASTPPASSPPPPASAPPENSPPPPASIAPT 311

Query: 361 PSGGYYNSPP---QDSSPPSDPLP 423
           PS    N+PP   +   PPS P P
Sbjct: 312 PS----NAPPPPGRTPFPPSQPTP 331

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 53/148 (35%), Positives = 70/148 (47%), Gaps = 11/148 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP    S  PT +SPP       TPS P  +   PP S  P    P G  +  PT 
Sbjct: 218 PSPPPPPATPSEPPT-NSPPSPPPPPATPSEPPTNSSPPPVSVPPPRRSPPGPAATPPTT 276

Query: 184 STPPSSDCTPPSQDSPP--SDPTPTTPSTPTTPSGGYYNSPP---QDSSPPTDPTP---- 336
           S PP +  TPP+   PP  S P   +P  P + +    N+PP   +   PP+ PTP    
Sbjct: 277 SPPPPAS-TPPASSPPPPASAPPENSPPPPASIAPTPSNAPPPPGRTPFPPSQPTPSPSN 335

Query: 337 TTPSTPTTPSGGYYNSPPQ--DSSPPSD 414
           +TP+  T+P     + PP    S+PPSD
Sbjct: 336 STPNASTSPPLITLSPPPPSLSSAPPSD 363

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 48/131 (36%), Positives = 61/131 (46%), Gaps = 8/131 (6%)
 Frame = +1

Query: 55  SPPGGGSYDPTPSPPSDSGGSPPGSYDP-TPSPPSGDGSYNPTPS----TPPSSDCTPPS 219
           SPP   S  P P P + S    P    P TPSPPS       TPS    +PP ++ + P+
Sbjct: 58  SPPLQSS-PPPPDPLTTSPIPQPNVTTPSTPSPPS------QTPSAVVVSPPPANASAPT 110

Query: 220 QDSPPSDPTPTTPSTPTTPSGG--YYNSPPQDSSPPTDPTPTTPST-PTTPSGGYYNSPP 390
              P + P PTT   P +P+      NSPP   SP   P P   ST P TPS    + PP
Sbjct: 111 PQPPVASPPPTTSPPPPSPNADPPTSNSPPPPQSPVQLPPPPVSSTPPATPSDPPTSPPP 170

Query: 391 QDSSPPSDPLP 423
             ++P + P P
Sbjct: 171 PSNTPTTSPPP 181

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 52/149 (34%), Positives = 64/149 (42%), Gaps = 10/149 (6%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPS----SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYN 174
           TP+PPS       TPS    SPP   +  PTP PP     SPP    PT SPP       
Sbjct: 86  TPSPPS------QTPSAVVVSPPPANASAPTPQPPV---ASPP----PTTSPP------- 125

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT--PTTP- 345
                PPS +  PP+ +SPP   +P                PP  S+PP  P+  PT+P 
Sbjct: 126 -----PPSPNADPPTSNSPPPPQSPVQ-----------LPPPPVSSTPPATPSDPPTSPP 169

Query: 346 ---STPTTPSGGYYNSPPQDSSPPSDPLP 423
              +TPTT        PP +S PP+   P
Sbjct: 170 PPSNTPTTSPPPSSARPPANSPPPASLSP 198

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 36/113 (31%), Positives = 47/113 (41%), Gaps = 19/113 (16%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYN 174
           P  TPP+   +  P P+S P   S  P  S P ++   PP S  PTPS   PP G   + 
Sbjct: 269 PAATPPT---TSPPPPASTPPASSPPPPASAPPENSPPPPASIAPTPSNAPPPPGRTPFP 325

Query: 175 PTPSTPPSSDCTPPSQDSPP----------------SDPTPTTPSTPTTPSGG 285
           P+  TP  S+ TP +  SPP                SD   + P    +P  G
Sbjct: 326 PSQPTPSPSNSTPNASTSPPLITLSPPPPSLSSAPPSDNNTSAPENSKSPGDG 378

[115][TOP]
>UniRef100_Q6FX25 Similarities with uniprot|P08640 Saccharomyces cerevisiae YIR019c
           STA1 n=1 Tax=Candida glabrata RepID=Q6FX25_CANGA
          Length = 790

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 55/142 (38%), Positives = 69/142 (48%), Gaps = 3/142 (2%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGG-SYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNPT 180
           TPTPP    S +P+PS  P    S  P+PSP      SP  S  P+PSP PS   S +P+
Sbjct: 324 TPTPPGLSSSPSPSPSPKPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPS 383

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPSTPT 357
           PS  PS   +P    SP   P+P +PS   + S G   SP    SP   P+P+ +PS   
Sbjct: 384 PSPKPSPSPSPSPSPSPSPSPSP-SPSPSPSFSPGPKPSPSPKPSPSPSPSPSPSPSPSP 442

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
           +PS     SP    SP   P P
Sbjct: 443 SPSPSPSPSPSPSPSPSPSPSP 464

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 56/147 (38%), Positives = 74/147 (50%), Gaps = 6/147 (4%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP---PSGDGS 168
           P+P+P PS   S +P+PS SP    S  P+PSP      SP  S  P+PSP   PS   S
Sbjct: 342 PSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPKPSPSPSPSPSPSPS 401

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
            +P+PS  PS   +P  + SP   P+P+ +PS   +PS     SP    SP   P+P +P
Sbjct: 402 PSPSPSPSPSPSFSPGPKPSPSPKPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSP-SP 460

Query: 346 STPTTPSGGYYNSPPQDSSPPSDPLPR 426
           S   +PS     SP    SP   P P+
Sbjct: 461 SPSPSPSPSPSPSPSPSPSPSFSPGPK 487

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 53/144 (36%), Positives = 70/144 (48%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYN 174
           P+P+P PS   S +P+PS SP    S  P+P P      SP  S  P+PSP PS   S++
Sbjct: 356 PSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPKPSPSPSPSPSPSPSPSPSPSPSPSPSFS 415

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
           P P   PS   +P    SP   P+P+ +PS   +PS     SP    SP   P+P +PS 
Sbjct: 416 PGPKPSPSPKPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSP-SPSP 474

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLP 423
             +PS  +   P    SP   P P
Sbjct: 475 SPSPSPSFSPGPKPSPSPKPSPSP 498

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 56/145 (38%), Positives = 72/145 (49%), Gaps = 5/145 (3%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYN 174
           P+P+P PS   S +P+PS SP    S  P+PSP      SP  S  P+PSP PS   S +
Sbjct: 346 PSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPKPSPSPSPSPSPSPSPSPS 405

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPS 348
           P+PS  PS    P    SP   P+P+ +PS   +PS     SP    SP   P+P+ +PS
Sbjct: 406 PSPSPSPSFSPGPKPSPSPKPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPS 465

Query: 349 TPTTPSGGYYNSPPQDSSPPSDPLP 423
              +PS     SP    SP   P P
Sbjct: 466 PSPSPSPSPSPSPSPSFSPGPKPSP 490

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 53/148 (35%), Positives = 72/148 (48%), Gaps = 8/148 (5%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-----PSGDG 165
           P+P+P PS   S +P+PS  P   S  P+PSP    G  P  S  P+PSP     PS   
Sbjct: 382 PSPSPKPSPSPSPSPSPSPSPSP-SPSPSPSPSFSPGPKPSPSPKPSPSPSPSPSPSPSP 440

Query: 166 SYNPTPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPT- 339
           S +P+PS  PS   +P    SP   P+P+ +PS   +PS  +   P    SP   P+P+ 
Sbjct: 441 SPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSFSPGPKPSPSPKPSPSPSP 500

Query: 340 TPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           +PS   +PS     SP     P  +P P
Sbjct: 501 SPSPSPSPSPSPSPSPSPSPYPSPNPFP 528

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 56/146 (38%), Positives = 71/146 (48%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP---PSGDGS 168
           P+P+P PS   S +P+PS SP    S  P+PSP      SP  S  P+PSP   PS   S
Sbjct: 336 PSPSPKPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPKPSPSPSPS 395

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
            +P+PS  PS   +P    SP   P+P+  PS   +PS     SP    SP   P+P +P
Sbjct: 396 PSPSPSPSPSPSPSPSPSFSPGPKPSPSPKPSPSPSPSPSPSPSPSPSPSPSPSPSP-SP 454

Query: 346 STPTTPSGGYYNSPPQDSSPPSDPLP 423
           S   +PS     SP    SP   P P
Sbjct: 455 SPSPSPSPSPSPSPSPSPSPSPSPSP 480

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 55/146 (37%), Positives = 70/146 (47%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYN 174
           P+P+P PS   S +P+PS SP    S  P+PSP       P  S  P PSP PS   S +
Sbjct: 378 PSPSPSPSPKPSPSPSPSPSPSPSPSPSPSPSPSPSFSPGPKPSPSPKPSPSPSPSPSPS 437

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT---TP 345
           P+PS  PS   +P    SP   P+P +PS   +PS     SP    SP   P+P+   +P
Sbjct: 438 PSPSPSPSPSPSPSPSPSPSPSPSP-SPSPSPSPSPSPSPSPSPSFSPGPKPSPSPKPSP 496

Query: 346 STPTTPSGGYYNSPPQDSSPPSDPLP 423
           S   +PS     SP    SP   P P
Sbjct: 497 SPSPSPSPSPSPSPSPSPSPSPSPYP 522

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 58/151 (38%), Positives = 73/151 (48%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPS-SPPGGGSYDPTPSP-PSDS---GGSPPGSYDPTPSP-PSGD 162
           P+P+P PS   S +P+PS SP    S  P+PSP PS S     SP  S+ P P P PS  
Sbjct: 366 PSPSPSPSPSPSPSPSPSPSPKPSPSPSPSPSPSPSPSPSPSPSPSPSFSPGPKPSPSPK 425

Query: 163 GSYNPTPSTPPSSDCTPPSQDSPPSDPTPT---TPSTPTTPSGGYYNSPPQDSSPPTDPT 333
            S +P+PS  PS   +P    SP   P+P+   +PS   +PS     SP    SP   P 
Sbjct: 426 PSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSFSPG 485

Query: 334 P-TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  +PS   +PS     SP    SP   P P
Sbjct: 486 PKPSPSPKPSPSPSPSPSPSPSPSPSPSPSP 516

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 50/140 (35%), Positives = 64/140 (45%), Gaps = 3/140 (2%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYN 174
           P+P+P PS   S++P P  SP    S  P+PSP      SP  S  P+PSP PS   S +
Sbjct: 402 PSPSPSPSPSPSFSPGPKPSPSPKPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPS 461

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           P+PS  PS   +P    SP   P P  PS    PS     SP    SP   P+P+   +P
Sbjct: 462 PSPSPSPSPSPSPSPSPSPSFSPGP-KPSPSPKPSPSPSPSPSPSPSPSPSPSPSPSPSP 520

Query: 355 TTPSGGYYNSPPQDSSPPSD 414
                 +  S    S  PS+
Sbjct: 521 YPSPNPFPISNSSTSLSPSN 540

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 52/144 (36%), Positives = 65/144 (45%), Gaps = 3/144 (2%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNP 177
           D   TP    G ++P  SS      Y PTP P   S  SP  S  P+PSP PS   S +P
Sbjct: 303 DVPETPSCQIGFWDPINSS-----CYTPTP-PGLSSSPSPSPSPKPSPSPSPSPSPSPSP 356

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           +PS  PS   +P    SP   P+P+ +PS   +PS     SP    SP   P+P+   +P
Sbjct: 357 SPSPSPSPSPSPSPSPSPSPSPSPSPSPSPKPSPSPSPSPSPSPSPSPSPSPSPSPSFSP 416

Query: 355 -TTPSGGYYNSPPQDSSPPSDPLP 423
              PS     SP    SP   P P
Sbjct: 417 GPKPSPSPKPSPSPSPSPSPSPSP 440

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 47/139 (33%), Positives = 65/139 (46%), Gaps = 3/139 (2%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYN 174
           P+P+P PS   S +P+PS SP    S  P+PSP      SP  S  P+PSP PS      
Sbjct: 428 PSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSFSPGPK 487

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
           P+PS  PS   +P    SP   P+P +PS   +P       P  +SS    P+  +  + 
Sbjct: 488 PSPSPKPSPSPSPSPSPSPSPSPSP-SPSPSPSPYPSPNPFPISNSSTSLSPSNISMHSY 546

Query: 355 TTPSGGYYNSPPQDSSPPS 411
           ++   G   SP    S P+
Sbjct: 547 SSLYTGDPESPTNTKSIPT 565

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 41/116 (35%), Positives = 53/116 (45%), Gaps = 3/116 (2%)
 Frame = +1

Query: 88  PSPPSDSGG--SPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPT-TP 258
           P  PS   G   P  S   TP+PP    S +P+PS  PS   +P    SP   P+P+ +P
Sbjct: 305 PETPSCQIGFWDPINSSCYTPTPPGLSSSPSPSPSPKPSPSPSPSPSPSPSPSPSPSPSP 364

Query: 259 STPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
           S   +PS     SP    SP   P+P +PS   +PS     SP    SP   P P+
Sbjct: 365 SPSPSPSPSPSPSPSPSPSPSPKPSP-SPSPSPSPSPSPSPSPSPSPSPSFSPGPK 419

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 45/123 (36%), Positives = 59/123 (47%), Gaps = 4/123 (3%)
 Frame = +1

Query: 4   PTPTP-PSGDGSYNPTPS-SPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYN 174
           P+P+P PS   S +P+PS SP    S  P+PSP       P  S  P PSP PS   S +
Sbjct: 446 PSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSFSPGPKPSPSPKPSPSPSPSPSPS 505

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSG-GYYNSPPQDSSPPTDPTPTTPST 351
           P+PS  PS   +P    SP   P  +  ST  +PS    ++     +  P  PT  T S 
Sbjct: 506 PSPSPSPSPSPSPSPYPSPNPFPI-SNSSTSLSPSNISMHSYSSLYTGDPESPT-NTKSI 563

Query: 352 PTT 360
           PT+
Sbjct: 564 PTS 566

[116][TOP]
>UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B541C
          Length = 661

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 61/147 (41%), Positives = 70/147 (47%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDP-TPS-PPSGD-GSYN 174
           P+P+ P    S + TPS PP   S  P+PSP   S  SPP S  P TPS PPS    S +
Sbjct: 431 PSPSTPLPLPSTS-TPSPPPSPPSSTPSPSP---STPSPPPSRPPSTPSLPPSRPPSSPS 486

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT----PTT 342
           P P  PP     PP    PPS P PT+ + P T S   Y SPP    PP  P     P+ 
Sbjct: 487 PPPPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYS---YPSPPPPPPPPPPPVTYNYPSP 543

Query: 343 PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  P+ P    Y SPP    PPS   P
Sbjct: 544 PPPPSLPVTYNYPSPPPPPPPPSYNYP 570

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 51/145 (35%), Positives = 59/145 (40%), Gaps = 4/145 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PPS   S +P+  SPP          PPS    SP     P P PP       P P
Sbjct: 447 PPPSPPSSTPSPSPSTPSPPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPP 506

Query: 184 STPPSSDCTPPSQDS----PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
           S PP +  TPP   S    PP  P P  P T   PS     S P   + P+ P P  P +
Sbjct: 507 SQPPPTSLTPPVTYSYPSPPPPPPPPPPPVTYNYPSPPPPPSLPVTYNYPSPPPPPPPPS 566

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLPR 426
              P+  YY   P    PP  P PR
Sbjct: 567 YNYPAPTYYYPSPSPRPPPPPPRPR 591

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 57/145 (39%), Positives = 68/145 (46%), Gaps = 7/145 (4%)
 Frame = +1

Query: 7   TPTP---PSGDGSYN-PTPSSP---PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG 165
           TPT    P    +YN P+PS+P   P   +  P PSPPS    S P     TPSPP    
Sbjct: 415 TPTSSSQPIPSVTYNYPSPSTPLPLPSTSTPSPPPSPPS----STPSPSPSTPSPP---- 466

Query: 166 SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
                PS PPS+   PPS+  PPS P+P  P  P  P       PP    PP+ P PT+ 
Sbjct: 467 -----PSRPPSTPSLPPSR--PPSSPSPPPPPPPPPPP-----RPPPPPPPPSQPPPTSL 514

Query: 346 STPTTPSGGYYNSPPQDSSPPSDPL 420
           + P T S   Y SPP    PP  P+
Sbjct: 515 TPPVTYS---YPSPPPPPPPPPPPV 536

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 47/133 (35%), Positives = 61/133 (45%), Gaps = 2/133 (1%)
 Frame = +1

Query: 31  GSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYN-PTPSTP-PSSD 204
           G+   T SS     + D +  P +    SP  S   + S P    +YN P+PSTP P   
Sbjct: 384 GTSTSTSSSTYDYSTQDYSSKPSTSI--SPDYSTPTSSSQPIPSVTYNYPSPSTPLPLPS 441

Query: 205 CTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNS 384
            + PS   PPS P+ T   +P+TPS      P   S PP+ P P++PS P  P       
Sbjct: 442 TSTPSP--PPSPPSSTPSPSPSTPSPPPSRPPSTPSLPPSRP-PSSPSPPPPPPPPPPPR 498

Query: 385 PPQDSSPPSDPLP 423
           PP    PPS P P
Sbjct: 499 PPPPPPPPSQPPP 511

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 43/154 (27%), Positives = 64/154 (41%), Gaps = 13/154 (8%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTP-SPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           PTPT      +   T S+ P   ++  T  + PS    +   +   + +       Y+  
Sbjct: 345 PTPTTTQASTTTYTTSSTTPSSTAFTATSVTEPSSLVTTGTSTSTSSSTYDYSTQDYSSK 404

Query: 181 PSTPPSSDCTPPSQDSPP------SDPTPTTP------STPTTPSGGYYNSPPQDSSPPT 324
           PST  S D + P+  S P      + P+P+TP      STP+ P     ++P    S P+
Sbjct: 405 PSTSISPDYSTPTSSSQPIPSVTYNYPSPSTPLPLPSTSTPSPPPSPPSSTPSPSPSTPS 464

Query: 325 DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
            P    PSTP+ P     +SP     PP  P PR
Sbjct: 465 PPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPR 498

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 50/162 (30%), Positives = 62/162 (38%), Gaps = 21/162 (12%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYD---------PTPSPPS 156
           P+P PP       P P  PP      P PS P  +  +PP +Y          P P P  
Sbjct: 485 PSPPPP-------PPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPPV- 536

Query: 157 GDGSYN-PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSP-PQDSSPPTDP 330
              +YN P+P  PPS    P + + P   P P  PS        YY SP P+   PP  P
Sbjct: 537 ---TYNYPSPPPPPS---LPVTYNYPSPPPPPPPPSYNYPAPTYYYPSPSPRPPPPPPRP 590

Query: 331 TPTTP-----STPTTPSGGYYNSP-----PQDSSPPSDPLPR 426
            P+ P       P  P   Y   P     P+   PP  P P+
Sbjct: 591 RPSRPRPIITPKPIPPRATYLPPPRLTPQPRTYLPPPTPTPQ 632

[117][TOP]
>UniRef100_UPI00015DEFD0 proline rich protein HaeIII subfamily 1 n=1 Tax=Mus musculus
           RepID=UPI00015DEFD0
          Length = 261

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 57/169 (33%), Positives = 58/169 (34%), Gaps = 30/169 (17%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPS---PPSGDGSYNPT 180
           P PP G     P    PPGG    P P PP   G  PPG   P P    PP G     P 
Sbjct: 52  PPPPGGPQPRPPQGPPPPGG----PQPRPPQ--GPPPPGVPQPRPPQGPPPPGGPQQRPP 105

Query: 181 PSTPPSS--DCTPPSQDSPPSDPTPTTPSTPTTPSG-------------GYYNSPPQDSS 315
              PP       PP    PP  P P  P  P  P G             G    PPQ   
Sbjct: 106 QGPPPPGGPQHRPPQGPPPPGGPQPRPPQGPPPPGGPQLRPPQGPPPPAGPQPRPPQGPP 165

Query: 316 PPTDPTPTTPSTPTT------------PSGGYYNSPPQDSSPPSDPLPR 426
           PP  P P  P  P T            P+GG    PPQ   PP  P PR
Sbjct: 166 PPAGPQPRPPQGPPTTGPQPRPTQGPPPTGGPQQRPPQGPPPPGGPQPR 214

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 54/139 (38%), Positives = 56/139 (40%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP       P P   PGG    P P PP   G  PPG   P P PP G     P P  
Sbjct: 41  PRPPVNGSQQGPPP---PGG----PQPRPPQ--GPPPPGG--PQPRPPQGP----PPPGV 85

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           P      PP    PP  P    P  P  P GG  + PPQ   PP  P P  P  P  P G
Sbjct: 86  PQP---RPPQGPPPPGGPQQRPPQGP-PPPGGPQHRPPQGPPPPGGPQPRPPQGP-PPPG 140

Query: 370 GYYNSPPQDSSPPSDPLPR 426
           G    PPQ   PP+ P PR
Sbjct: 141 GPQLRPPQGPPPPAGPQPR 159

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 50/142 (35%), Positives = 56/142 (39%), Gaps = 4/142 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYD----PTPSPPSGDGSY 171
           P   PP G   + P    PP GG   P P PP   G  PPG         P PP+G    
Sbjct: 105 PQGPPPPGGPQHRPPQGPPPPGG---PQPRPPQ--GPPPPGGPQLRPPQGPPPPAGPQPR 159

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            P    PP+     P Q  P + P P  P+    P+GG    PPQ   PP  P P  P  
Sbjct: 160 PPQGPPPPAGPQPRPPQGPPTTGPQP-RPTQGPPPTGGPQQRPPQGPPPPGGPQPRPPQG 218

Query: 352 PTTPSGGYYNSPPQDSSPPSDP 417
           P  P GG   SP Q   P   P
Sbjct: 219 P-PPPGGPQPSPTQGPPPTGGP 239

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 45/145 (31%), Positives = 54/145 (37%), Gaps = 6/145 (4%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSP------PGSYDPTPSPPSGDGSY 171
           P PP G     P    PPGG    P   PP  +G  P      P    P P PP G  + 
Sbjct: 122 PPPPGGPQPRPPQGPPPPGGPQLRPPQGPPPPAGPQPRPPQGPPPPAGPQPRPPQGPPTT 181

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            P P          P+Q  PP+      P     P GG    PPQ   PP  P P +P+ 
Sbjct: 182 GPQPR---------PTQGPPPTGGPQQRPPQGPPPPGGPQPRPPQGPPPPGGPQP-SPTQ 231

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLPR 426
              P+GG   +PP   +    P  R
Sbjct: 232 GPPPTGGPQQTPPLAGNTQGPPQGR 256

[118][TOP]
>UniRef100_Q7TLR4 Putative uncharacterized protein n=1 Tax=Choristoneura fumiferana
           MNPV RepID=Q7TLR4_NPVCF
          Length = 251

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 51/141 (36%), Positives = 69/141 (48%), Gaps = 2/141 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSYNPT 180
           P PTPP       P+P+ PP      P+P+PP     +PP +  PTP P PS      P+
Sbjct: 43  PPPTPPP-----TPSPTPPP-----TPSPTPPPTPSPTPPPTPSPTPPPTPSPTLPPTPS 92

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPT-TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
           P+ PP+   TPP   SP   PTP+ TPS   +P+     SP    +P   P+PT  +TP 
Sbjct: 93  PTLPPTPSPTPPPTPSPTPSPTPSPTPSPTPSPTP----SPTPSPTPSATPSPTPSATPL 148

Query: 358 TPSGGYYNSPPQDSSPPSDPL 420
             S     +PP   SP  +P+
Sbjct: 149 PTSS---PTPPPTPSPLGEPM 166

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 52/144 (36%), Positives = 67/144 (46%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P PTPP       P P+ PP      P+P+PP     +PP +  PTP P        P+P
Sbjct: 35  PWPTPPP-----TPPPTPPP-----TPSPTPPPTPSPTPPPTPSPTPPP-------TPSP 77

Query: 184 STPPSSDCTPPSQDSP--PSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTPT-TPST 351
           + PP+   T P   SP  P  P+PT P TP+ TPS     +P    SP   PTP+ TPS 
Sbjct: 78  TPPPTPSPTLPPTPSPTLPPTPSPTPPPTPSPTPSPTPSPTPSPTPSPTPSPTPSPTPSA 137

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLP 423
             +P+      P    +PP  P P
Sbjct: 138 TPSPTPSATPLPTSSPTPPPTPSP 161

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 45/115 (39%), Positives = 56/115 (48%), Gaps = 1/115 (0%)
 Frame = +1

Query: 82  PTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPS 261
           PTP P      +PP +  PTP P        P+P+ PP+   TPP   SP   PTP +P+
Sbjct: 33  PTPWP------TPPPTPPPTPPP-------TPSPTPPPTPSPTPPPTPSPTPPPTP-SPT 78

Query: 262 TPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT-TPSGGYYNSPPQDSSPPSDPLP 423
            P TPS       P  + PPT P+PT P TP+ TPS     +P    SP   P P
Sbjct: 79  PPPTPS-PTLPPTPSPTLPPT-PSPTPPPTPSPTPSPTPSPTPSPTPSPTPSPTP 131

[119][TOP]
>UniRef100_Q4A263 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
           RepID=Q4A263_EHV86
          Length = 403

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 55/125 (44%), Positives = 64/125 (51%)
 Frame = +1

Query: 46  TPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQD 225
           TP  PP      P P PPS    SPP S  P  SPPS      P PS+PPSS  +PP   
Sbjct: 135 TPPPPP------PPPPPPS----SPPPSPPPPSSPPS------PPPSSPPSSPPSPPPSP 178

Query: 226 SPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSP 405
            P S P+P   S P+ P     +SPP  SSPP+ P  + PS+P        +SPP  SSP
Sbjct: 179 PPSSPPSPPPSSPPSPPPSPPPSSPP--SSPPSSPPSSPPSSPP-------SSPP--SSP 227

Query: 406 PSDPL 420
           PS PL
Sbjct: 228 PSPPL 232

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 50/120 (41%), Positives = 58/120 (48%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P PSSPP      P+P PPS     PP S  P  SPPS      P P
Sbjct: 138 PPPPPP-------PPPSSPP------PSPPPPSSPPSPPPSS--PPSSPPS------PPP 176

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PPSS  +PP    P   P+P   S P++P     +SPP  SSPP+ P  + PS P  P
Sbjct: 177 SPPPSSPPSPPPSSPPSPPPSPPPSSPPSSPPSSPPSSPP--SSPPSSPPSSPPSPPLQP 234

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 35/85 (41%), Positives = 43/85 (50%), Gaps = 6/85 (7%)
 Frame = +1

Query: 181 PSTPPSSDC-TPPSQDSPPSDPT--PTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
           P  P  S C TPP    PP  P+  P +P  P++P     +SPP  SSPP+ P    PS+
Sbjct: 125 PCAPMLSCCLTPPPPPPPPPPPSSPPPSPPPPSSPPSPPPSSPP--SSPPSPPPSPPPSS 182

Query: 352 PTTPSGGYYNSPPQD---SSPPSDP 417
           P +P      SPP     SSPPS P
Sbjct: 183 PPSPPPSSPPSPPPSPPPSSPPSSP 207

[120][TOP]
>UniRef100_Q9FFW5 Similarity to protein kinase n=1 Tax=Arabidopsis thaliana
           RepID=Q9FFW5_ARATH
          Length = 681

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 60/152 (39%), Positives = 71/152 (46%), Gaps = 14/152 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTP--SSPPGGGSYDPTP----SPPSDSGGSPPGSYDPTPSPPSGDG 165
           P  +PP    S  P P  SSPP   S  P+P    SPP     SPP        PPS   
Sbjct: 44  PPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPA 103

Query: 166 SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPS---GGYYNSPPQDSSPPTDPTP 336
           +   TP  PP +   PP  D+ PS P PTT + P  PS    G   SPP ++  P  P+P
Sbjct: 104 T---TPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSP 160

Query: 337 TTPSTPTT-----PSGGYYNSPPQDSSPPSDP 417
           +TP TPTT     P      SPP  SS P+DP
Sbjct: 161 STP-TPTTTTSPPPPPATSASPP--SSNPTDP 189

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 57/161 (35%), Positives = 71/161 (44%), Gaps = 21/161 (13%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNP---------TPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPP- 153
           P  +PPS + S            TPS+PP      P PSPP     SPP     +P PP 
Sbjct: 8   PILSPPSSNSSTTAPPPLQTQPTTPSAPP---PVTPPPSPPQ----SPPPVVSSSPPPPV 60

Query: 154 --SGDGSYNPTPSTPPSSDCTPPSQDSPP-----SDPTPTTP-STPTTPSGGYYNSPPQD 309
             S   S +P PS P  +   P    SPP     + P P+TP +TP  P       PP D
Sbjct: 61  VSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPD 120

Query: 310 SSPPTDPTPTTPSTPTTPS---GGYYNSPPQDSSPPSDPLP 423
           +S P+ P PTT + P  PS    G   SPP ++  P  P P
Sbjct: 121 AS-PSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSP 160

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 47/145 (32%), Positives = 60/145 (41%), Gaps = 12/145 (8%)
 Frame = +1

Query: 7   TPTPPSGDGSYNP-TPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           +P PP    S  P TP++ P       +P PP D+  SPP      P P         TP
Sbjct: 87  SPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETP 146

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSP------PQDSSPPTDPTPTTP 345
           S PP    +PP     PS PTPTT ++P  P     + P      P   +PP  P P  P
Sbjct: 147 S-PPGETPSPPKPS--PSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTPLPVVP 203

Query: 346 -----STPTTPSGGYYNSPPQDSSP 405
                + PT P+    N+    SSP
Sbjct: 204 REKPIAKPTGPASNNGNNTLPSSSP 228

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 44/130 (33%), Positives = 56/130 (43%), Gaps = 10/130 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSY-DPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P P+PP          SSPP       P PS P+ +  +PP +  P P P +      PT
Sbjct: 70  PPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPT 129

Query: 181 PSTPPSSDCTPPSQDSP------PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
            + PP      P  ++P      PS P P+ PSTPT  +      PP  S+ P    PT 
Sbjct: 130 TTNPPPKPSPSPPGETPSPPGETPSPPKPS-PSTPTPTTTTSPPPPPATSASPPSSNPTD 188

Query: 343 PST---PTTP 363
           PST   P TP
Sbjct: 189 PSTLAPPPTP 198

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 45/123 (36%), Positives = 57/123 (46%), Gaps = 18/123 (14%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P P +      PT ++PP      P+PSPP ++  SPPG    TPSPP    S  PTP
Sbjct: 115 PPPPPDASPSPPAPTTTNPPP----KPSPSPPGETP-SPPGE---TPSPPKPSPS-TPTP 165

Query: 184 ST-------------PPSSDCTPPSQDSPPSDPTPTTP-----STPTTPSGGYYNSPPQD 309
           +T             PPSS+ T PS  +PP  P P  P     + PT P+    N+    
Sbjct: 166 TTTTSPPPPPATSASPPSSNPTDPSTLAPPPTPLPVVPREKPIAKPTGPASNNGNNTLPS 225

Query: 310 SSP 318
           SSP
Sbjct: 226 SSP 228

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 47/141 (33%), Positives = 57/141 (40%), Gaps = 3/141 (2%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P P     S N + ++PP   +   TPS P      PP +  P PSPP        +   
Sbjct: 6   PLPILSPPSSNSSTTAPPPLQTQPTTPSAP------PPVT--PPPSPPQSPPPVVSSSPP 57

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQD---SSPPTDPTPTTPSTPTT 360
           PP     PPS   PPS P  T+P  PT  S     SPP     +SPP     TTP  P  
Sbjct: 58  PPVVSSPPPSSSPPPSPPVITSPP-PTVAS-----SPPPPVVIASPPPSTPATTPPAPPQ 111

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
                 + PP   + PS P P
Sbjct: 112 T----VSPPPPPDASPSPPAP 128

[121][TOP]
>UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q948Y6_VOLCA
          Length = 1143

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 54/137 (39%), Positives = 60/137 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP       P+P SPP   S  P PSPP      PP S  P PSPP       P P
Sbjct: 513 PSPRPP------RPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP-------PPP 559

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PP     PPS   PPS P P +P  P +P       PP   SPP  P P  P  P+ P
Sbjct: 560 SPPP-----PPSPPPPPSPPPPPSPPPPPSP-----RHPP---SPPPRPRPPRPQPPSPP 606

Query: 364 SGGYYNSPPQDSSPPSD 414
           S       P   SP +D
Sbjct: 607 S-------PSPPSPRTD 616

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 52/127 (40%), Positives = 55/127 (43%)
 Frame = +1

Query: 43  PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQ 222
           P P SP       P+P PP  S  SPP    P PSPP       P PS PP     PPS 
Sbjct: 500 PPPPSPLLTSPRPPSPRPPRPSPPSPP----PPPSPP-------PPPSPPP-----PPSP 543

Query: 223 DSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSS 402
             PPS P P  PS P  PS     SPP   SPP  P+P  P +P  P        P    
Sbjct: 544 PPPPSPPPP--PSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRPQ 601

Query: 403 PPSDPLP 423
           PPS P P
Sbjct: 602 PPSPPSP 608

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 55/141 (39%), Positives = 61/141 (43%), Gaps = 2/141 (1%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PPS      P  +SP       P PSPPS     PP S  P PSPP       P PS 
Sbjct: 500 PPPPS------PLLTSPRPPSPRPPRPSPPSPP---PPPSPPPPPSPP-------PPPSP 543

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           PP     PPS   PPS P P +P  P +P       PP    PP+ P P +P  P +P  
Sbjct: 544 PP-----PPSPPPPPSPPPPPSPPPPPSPP-----PPPSPPPPPSPPPPPSPRHPPSPPP 593

Query: 370 GYYNSPPQDSSP--PSDPLPR 426
                 PQ  SP  PS P PR
Sbjct: 594 RPRPPRPQPPSPPSPSPPSPR 614

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 48/125 (38%), Positives = 53/125 (42%)
 Frame = +1

Query: 52  SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSP 231
           +SPP    + P P  P  +   PP    P PSPPS      P PS PP     PPS   P
Sbjct: 494 TSPP----FVPPPPSPLLTSPRPPSPRPPRPSPPSPP----PPPSPPP-----PPSPPPP 540

Query: 232 PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           PS P P +P             PP    PP+ P P  PS P  PS     SPP   SPP 
Sbjct: 541 PSPPPPPSP-------------PP----PPSPPPP--PSPPPPPSPPPPPSPPPPPSPPP 581

Query: 412 DPLPR 426
            P PR
Sbjct: 582 PPSPR 586

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 39/100 (39%), Positives = 43/100 (43%), Gaps = 6/100 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP       P P SPP   S  P PSPP      PP S  P PSPP      +P P
Sbjct: 535 PSPPPPPSP----PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHP-P 589

Query: 184 STPPS------SDCTPPSQDSPPSDPTPTTPSTPTTPSGG 285
           S PP          +PPS  SPPS  T    +  T P  G
Sbjct: 590 SPPPRPRPPRPQPPSPPSP-SPPSPRTDNVVAWITQPDTG 628

[122][TOP]
>UniRef100_Q09085 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q09085_PHAVU
          Length = 368

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 53/143 (37%), Positives = 62/143 (43%), Gaps = 5/143 (3%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSY-DPTPSPPSGDGSYNPT 180
           P+P+PP      +P P SP     Y     PP D    PP  Y  P P  PS    Y   
Sbjct: 166 PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYK 225

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNS-PPQDSSPPTD---PTPTTPS 348
              PPS    PP     P  P+P+ P +P+ P   YY S PP D SPP      +P  PS
Sbjct: 226 SPPPPSPSPPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPS 285

Query: 349 TPTTPSGGYYNSPPQDSSPPSDP 417
            P+ P   YY SPP  S  P  P
Sbjct: 286 -PSPPPPYYYKSPPPPSPSPPPP 307

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 58/153 (37%), Positives = 66/153 (43%), Gaps = 14/153 (9%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           DP+P PP    S  P   SPP    Y    SPP  S   PP  Y  +P PPS        
Sbjct: 199 DPSPPPPYYYKSPPPPSPSPPPPYYYK---SPPPPSPSPPPPYYYKSPPPPS-------- 247

Query: 181 PSTPPSSDCTPPS--QDSPPSDPTPTTP--------STPTTPSGGYYNSPPQDSSPPTDP 330
           PS PPS    PP   +  PP DP+P  P         +P+ P   YY SPP  S  P  P
Sbjct: 248 PSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 307

Query: 331 ----TPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
               +P  PS P  P+  YY SPP  S  P  P
Sbjct: 308 YYYKSPPPPS-PDPPTPYYYKSPPPPSPSPPPP 339

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 56/150 (37%), Positives = 65/150 (43%), Gaps = 15/150 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT--PSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           P P  PS    Y  +P  P     Y P    SPP  S   PP  Y  +P PPS      P
Sbjct: 131 PPPPSPSPSPYYYKSPPPPHKDPYYPPYYYKSPPPPSPSPPPPYYYKSPPPPS------P 184

Query: 178 TPSTPPSSDCTPPSQDSPPSD---PTPTTPSTPTTPSGGYYNSPPQDS-SP--------P 321
           +P  P      PP   SPP      +P  PS P+ P   YY SPP  S SP        P
Sbjct: 185 SPPPPYYYKSPPPPDPSPPPPYYYKSPPPPS-PSPPPPYYYKSPPPPSPSPPPPYYYKSP 243

Query: 322 TDPTPTTPSTPTTPSGGYYNS-PPQDSSPP 408
             P+P+ P +P+ P   YY S PP D SPP
Sbjct: 244 PPPSPSPPPSPSPPPPYYYKSPPPPDPSPP 273

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 55/151 (36%), Positives = 65/151 (43%), Gaps = 13/151 (8%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP-PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P+P+PP      +P P  P P    Y  +P PPS S   PP  Y  +P PPS      P+
Sbjct: 182 PSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPS--PPPPYYYKSPPPPS------PS 233

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTP--------STPTTPSGGYYNSPPQ-DSSPPTD-- 327
           P  P      PP   SPP  P+P  P          P+ P   YY SPP    SPP    
Sbjct: 234 PPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYY 293

Query: 328 -PTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
             +P  PS P+ P   YY SPP  S  P  P
Sbjct: 294 YKSPPPPS-PSPPPPYYYKSPPPPSPDPPTP 323

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 49/143 (34%), Positives = 57/143 (39%), Gaps = 14/143 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTP-----SPPSDSGGSPPGSYDPTPSPPSGDGS 168
           P+P+PP      +P P SP    S  P P     SPP      PP  Y  +P PPS    
Sbjct: 230 PSPSPPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPS---- 285

Query: 169 YNPTPSTPPSSDCTPPSQDSPP-----SDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDP- 330
             P+P  P      PP   SPP       P P +P  PT     YY SPP  S  P  P 
Sbjct: 286 --PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPDPPTP---YYYKSPPPPSPSPPPPY 340

Query: 331 ---TPTTPSTPTTPSGGYYNSPP 390
              +P  P+    P    Y SPP
Sbjct: 341 YYVSPPPPTKSPPPPAYSYASPP 363

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 52/160 (32%), Positives = 62/160 (38%), Gaps = 31/160 (19%)
 Frame = +1

Query: 37  YNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSY-DPTPSPPSGDGSYNPTPSTPPSSDCTP 213
           ++PTP   P    Y     PP     SPP  Y  P P  PS    Y  +P  P      P
Sbjct: 101 HSPTPYHKP----YYYNSPPPPYYYKSPPYYYKSPPPPSPSPSPYYYKSPPPPHKDPYYP 156

Query: 214 PSQDSPPSDPTPT----------TPSTPTTPSGGYYNS-PPQDSSPP-----TDPTPTTP 345
           P     P  P+P+           P +P+ P   YY S PP D SPP       P P +P
Sbjct: 157 PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSP 216

Query: 346 S-------------TPTTPSGGYYNSPPQDS-SPPSDPLP 423
           S             +P+ P   YY SPP  S SPP  P P
Sbjct: 217 SPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPSPSP 256

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 45/113 (39%), Positives = 48/113 (42%), Gaps = 5/113 (4%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           DP+P PP    S  P PS  P    Y  +P PPS S   PP  Y  +P PPS      P 
Sbjct: 269 DPSPPPPYYYKS-PPPPSPSPPPPYYYKSPPPPSPS--PPPPYYYKSPPPPS------PD 319

Query: 181 PSTPPSSDCTPPSQDSPPS-----DPTPTTPSTPTTPSGGYYNSPPQDSSPPT 324
           P TP      PP   SPP       P P T S P  P    Y SPP    PPT
Sbjct: 320 PPTPYYYKSPPPPSPSPPPPYYYVSPPPPTKSPP--PPAYSYASPP----PPT 366

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 43/132 (32%), Positives = 52/132 (39%), Gaps = 3/132 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP-PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P+P+PP      +P P  P P    Y  +P PPS S   P     P P  PS    Y   
Sbjct: 252 PSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 311

Query: 181 PSTPPSSDCTPPS--QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
              PPS D   P   +  PP  P+P  P         YY SPP    PPT        +P
Sbjct: 312 SPPPPSPDPPTPYYYKSPPPPSPSPPPPY--------YYVSPP----PPT-------KSP 352

Query: 355 TTPSGGYYNSPP 390
             P+  Y + PP
Sbjct: 353 PPPAYSYASPPP 364

[123][TOP]
>UniRef100_B9RKQ3 ATP binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RKQ3_RICCO
          Length = 670

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 54/148 (36%), Positives = 71/148 (47%), Gaps = 11/148 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGS-YDPTPSPPSGDGSYNPT 180
           PTPT P    +  P P++P       P   PP+     PP +   P P+ P+       T
Sbjct: 4   PTPTSPPSTNTTAPPPATPAAPPPSTPAAPPPATPAAPPPATPAAPPPATPAAPPPAPVT 63

Query: 181 PSTPPSSDCTPPS-------QDSPPSDPTPTTP-STPTTPSGGYYN-SPPQDS-SPPTDP 330
           PS PP +  TP S          PPS P+P+ P STP+ PS      SPP +S + P+ P
Sbjct: 64  PSAPPPAPATPSSPPPTSSSSPPPPSTPSPSPPTSTPSPPSPPSTTPSPPTNSGTTPSTP 123

Query: 331 TPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
           TPTT S P  P+    +S P   SPPS+
Sbjct: 124 TPTTRSPPAPPT----SSSPSPPSPPSN 147

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 58/145 (40%), Positives = 72/145 (49%), Gaps = 20/145 (13%)
 Frame = +1

Query: 43  PTPSSPPGGGSYDPTPS-----PPSDSGGSPPGSYDPTPSPPSGDGSYNP-TPSTPPSSD 204
           PTP+SPP   +  P P+     PPS     PP +  P   PP+   +  P TP+ PP + 
Sbjct: 4   PTPTSPPSTNTTAPPPATPAAPPPSTPAAPPPAT--PAAPPPATPAAPPPATPAAPPPAP 61

Query: 205 CT---PPSQDSPPSDPTPT---TPSTPTTPSGGYYNSPPQDSSPP-TDPTP-----TTPS 348
            T   PP   + PS P PT   +P  P+TPS     S P   SPP T P+P     TTPS
Sbjct: 62  VTPSAPPPAPATPSSPPPTSSSSPPPPSTPSPSPPTSTPSPPSPPSTTPSPPTNSGTTPS 121

Query: 349 TPTTPSGGYYNSPPQDS--SPPSDP 417
           TP TP+     +PP  S  SPPS P
Sbjct: 122 TP-TPTTRSPPAPPTSSSPSPPSPP 145

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/125 (37%), Positives = 62/125 (49%), Gaps = 2/125 (1%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPS-PPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P P  P+       TPS+PP   +   TPS PP  S  SPP    P+PSPP+      P+
Sbjct: 49  PPPATPAAPPPAPVTPSAPPPAPA---TPSSPPPTSSSSPPPPSTPSPSPPTS----TPS 101

Query: 181 PSTPPSSDCTPPSQD-SPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
           P +PPS+  +PP+   + PS PTPTT S P               +PPT  +P+ PS P+
Sbjct: 102 PPSPPSTTPSPPTNSGTTPSTPTPTTRSPP---------------APPTSSSPSPPSPPS 146

Query: 358 TPSGG 372
             S G
Sbjct: 147 NSSSG 151

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/100 (41%), Positives = 50/100 (50%), Gaps = 7/100 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDP----TPSP-PSDSGGSPPGSYDPTPSPPSGDGS 168
           P P  PS       TPSSPP   S  P    TPSP P  S  SPP     TPSPP+  G+
Sbjct: 59  PAPVTPSAPPPAPATPSSPPPTSSSSPPPPSTPSPSPPTSTPSPPSPPSTTPSPPTNSGT 118

Query: 169 YNPTPSTPPSSDCTPPSQ--DSPPSDPTPTTPSTPTTPSG 282
              TPSTP  +  +PP+    S PS P+P + S+    +G
Sbjct: 119 ---TPSTPTPTTRSPPAPPTSSSPSPPSPPSNSSSGISTG 155

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/91 (38%), Positives = 45/91 (49%), Gaps = 8/91 (8%)
 Frame = +1

Query: 175 PTPSTPPSSDCTPPSQDSP----PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
           PTP++PPS++ T P   +P    PS P    P+TP  P      +PP  +     P P T
Sbjct: 4   PTPTSPPSTNTTAPPPATPAAPPPSTPAAPPPATPAAPPPATPAAPPPATPAAPPPAPVT 63

Query: 343 PSTPTTPSGGYYNSPPQDSS----PPSDPLP 423
           PS P  P+    +SPP  SS    PPS P P
Sbjct: 64  PSAP-PPAPATPSSPPPTSSSSPPPPSTPSP 93

[124][TOP]
>UniRef100_A8JKC9 Predicted protein (Fragment) n=1 Tax=Chlamydomonas reinhardtii
           RepID=A8JKC9_CHLRE
          Length = 120

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 53/142 (37%), Positives = 70/142 (49%), Gaps = 2/142 (1%)
 Frame = +1

Query: 4   PTPTPPSGD-GSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGS-YDPTPSPPSGDGSYNP 177
           P+P PPS + GS  P+P+ P       P+P+PPS   GSPP S   P+P PPS      P
Sbjct: 2   PSPAPPSPEPGSPPPSPAPP---SPQPPSPAPPSPEPGSPPPSPAPPSPKPPS------P 52

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
            P +P      PPS   PP  P P +P+ P+   G    SPP   +PP+ P P +P+ P+
Sbjct: 53  APPSPEQPGSPPPS--PPPPRPQPPSPAPPSPEPG----SPPPSPAPPS-PQPPSPAPPS 105

Query: 358 TPSGGYYNSPPQDSSPPSDPLP 423
                     P+  SPP  P P
Sbjct: 106 ----------PEPGSPPPSPAP 117

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 41/115 (35%), Positives = 52/115 (45%), Gaps = 1/115 (0%)
 Frame = +1

Query: 4   PTPTPPSGD-GSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P+P PPS + GS  P+P +PP      P P  P   G  PP    P P PPS        
Sbjct: 26  PSPAPPSPEPGSPPPSP-APPSPKPPSPAPPSPEQPGSPPPSPPPPRPQPPS-------- 76

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
           P+ P     +PP   +PPS P P +P+ P+          P+  SPP  P PT P
Sbjct: 77  PAPPSPEPGSPPPSPAPPS-PQPPSPAPPS----------PEPGSPPPSPAPTQP 120

[125][TOP]
>UniRef100_B4MN10 GK16584 n=1 Tax=Drosophila willistoni RepID=B4MN10_DROWI
          Length = 390

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 59/151 (39%), Positives = 66/151 (43%), Gaps = 16/151 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGG------GSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG 165
           P+P  P    +  P PS PP G      G  + TPS P  +   P   Y   P+PPS  G
Sbjct: 226 PSPLEPQ---TPPPRPSVPPVGEYLPPSGDNEVTPSQPQPTAPIP--GYGQPPAPPSPPG 280

Query: 166 -SYNPTPSTPPSSD--CTPPSQDSPPSDPTPT----TPSTPTTPSGGYYNSPPQDSSPPT 324
            S+ P P TPPS       P   SPPS P PT     PS P  P   Y   PP   SPP 
Sbjct: 281 PSFQPRPPTPPSPQGPTYQPLPPSPPSPPEPTYQPLPPSPPAPPQQTYQPLPPSPPSPPA 340

Query: 325 DPTPT---TPSTPTTPSGGYYNSPPQDSSPP 408
            P PT   +P  P  P    Y  PP  SSPP
Sbjct: 341 PPQPTYQPSPPAPPAPPTQEYGQPP--SSPP 369

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 55/151 (36%), Positives = 65/151 (43%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP-PGGGSYDPTP----SPPSDSGGSPPGSYDPTPSPPSGDGS 168
           P P PP       P P+ P P   +Y P+P    +PP      P G Y     PPSGD  
Sbjct: 199 PKPRPPIRPQPPAPVPTQPRPTSPTYRPSPLEPQTPPPRPSVPPVGEY----LPPSGDNE 254

Query: 169 YNPT---PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNS-PPQDSSPPTDPT- 333
             P+   P+ P      PP+  SPP       P TP +P G  Y   PP   SPP +PT 
Sbjct: 255 VTPSQPQPTAPIPGYGQPPAPPSPPGPSFQPRPPTPPSPQGPTYQPLPPSPPSPP-EPTY 313

Query: 334 -PTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P  PS P  P   Y   PP   SPP+ P P
Sbjct: 314 QPLPPSPPAPPQQTYQPLPPSPPSPPAPPQP 344

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 56/159 (35%), Positives = 65/159 (40%), Gaps = 18/159 (11%)
 Frame = +1

Query: 4   PTPTPPSGDGSYN------PTPSSPPGG----GSYDPTPSPPSDSGGSPPG--SYDPTPS 147
           P P PPSG+G  +      P P+ P  G     +  P P  P  S G PP   +  P PS
Sbjct: 38  PFPPPPSGNGIEDSGLIPAPAPTVPDAGYVPPQTQPPAPPRPRPSYGQPPAQPAPPPQPS 97

Query: 148 PPSGDGSYNPTPST-PPSSDCTPPSQDSPPSD-----PTPTTPSTPTTPSGGYYNSPPQD 309
           P  G     P P   PP S   PPSQ +PP       P PT P+ P  P       PP  
Sbjct: 98  PSYGQPPAQPVPPPRPPPSVGPPPSQPAPPRPSPSYGPPPTQPAPPPRP-------PPSV 150

Query: 310 SSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
             PP+ P P  P  P  PS  Y   P Q    P  P P+
Sbjct: 151 GPPPSQPAP-PPPPPPRPSPTYGQPPAQPPRQPQPPAPQ 188

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 52/141 (36%), Positives = 61/141 (43%), Gaps = 13/141 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP-SPPSG-DGSYNP 177
           P PT P       P P SPPG       P+PPS  G +    Y P P SPPS  + +Y P
Sbjct: 260 PQPTAPIPGYGQPPAPPSPPGPSFQPRPPTPPSPQGPT----YQPLPPSPPSPPEPTYQP 315

Query: 178 TPSTPPSSDCTPPSQD------SPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
            P +PP+    PP Q       SPPS P P  P+        Y  SPP   +PPT     
Sbjct: 316 LPPSPPA----PPQQTYQPLPPSPPSPPAPPQPT--------YQPSPPAPPAPPTQEYGQ 363

Query: 340 TPSTPTT-----PSGGYYNSP 387
            PS+P       P G  YN P
Sbjct: 364 PPSSPPEAGSLGPDGYNYNKP 384

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 53/156 (33%), Positives = 57/156 (36%), Gaps = 16/156 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPP---------GGGSYDPTPSP-PSDSGGSPPGSYDPTPSPP 153
           P P P   D  Y P  + PP         G     P P P PS S G PP    P P PP
Sbjct: 55  PAPAPTVPDAGYVPPQTQPPAPPRPRPSYGQPPAQPAPPPQPSPSYGQPPAQPVPPPRPP 114

Query: 154 SGDGS--YNPTPSTPPSSDCTPPSQDSPPSDPTPTT---PSTPTTPSGGYYNSPPQDSSP 318
              G     P P  P  S   PP+Q +PP  P P+    PS P  P        P    P
Sbjct: 115 PSVGPPPSQPAPPRPSPSYGPPPTQPAPPPRPPPSVGPPPSQPAPPPPPPPRPSPTYGQP 174

Query: 319 PTDPTPTTPSTPTTPSGGYYNSPPQDS-SPPSDPLP 423
           P  P P  P  P    G  Y  P Q    PP  P P
Sbjct: 175 PAQP-PRQPQPPAPQPGPEYLPPDQPKPRPPIRPQP 209

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 51/147 (34%), Positives = 57/147 (38%), Gaps = 9/147 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPP----GGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSY 171
           P P+P  G     P P   P    G     P P  PS S G PP    P P PP   G  
Sbjct: 94  PQPSPSYGQPPAQPVPPPRPPPSVGPPPSQPAPPRPSPSYGPPPTQPAPPPRPPPSVGPP 153

Query: 172 NPTPSTPPSSDCTP-PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDS-SPPTDPTPTTP 345
              P+ PP     P P+   PP+ P P  P  P    G  Y  P Q    PP  P P  P
Sbjct: 154 PSQPAPPPPPPPRPSPTYGQPPAQP-PRQPQPPAPQPGPEYLPPDQPKPRPPIRPQPPAP 212

Query: 346 STPTTP---SGGYYNSPPQDSSPPSDP 417
             PT P   S  Y  SP +  +PP  P
Sbjct: 213 -VPTQPRPTSPTYRPSPLEPQTPPPRP 238

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 55/167 (32%), Positives = 62/167 (37%), Gaps = 27/167 (16%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPG---------GGSY----DPTPSPPSDSGGSPPGSYDPTP 144
           P P PP    +Y   P+ PP          G  Y     P P PP       P    P P
Sbjct: 160 PPPPPPRPSPTYGQPPAQPPRQPQPPAPQPGPEYLPPDQPKPRPPIRPQPPAPVPTQPRP 219

Query: 145 SPPSGDGSYNPTPSTPPSSDCTPPSQDS--------PPSDPTPTTPS--TPTTPSGGYYN 294
           + P+    Y P+P  P     TPP + S        PPS     TPS   PT P  G Y 
Sbjct: 220 TSPT----YRPSPLEPQ----TPPPRPSVPPVGEYLPPSGDNEVTPSQPQPTAPIPG-YG 270

Query: 295 SPPQDSSPPTDPTPTTPSTPTTPSGGYYN----SPPQDSSPPSDPLP 423
            PP   SPP       P TP +P G  Y     SPP    P   PLP
Sbjct: 271 QPPAPPSPPGPSFQPRPPTPPSPQGPTYQPLPPSPPSPPEPTYQPLP 317

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 51/185 (27%), Positives = 64/185 (34%), Gaps = 47/185 (25%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
           P PP    SY P P+ P       P P PP   G  P     P P PP    +Y   P+ 
Sbjct: 124 PAPPRPSPSYGPPPTQPA------PPPRPPPSVGPPPSQPAPPPPPPPRPSPTYGQPPAQ 177

Query: 190 PPSS----------DCTPPSQDSP------------PSDPTPTTPS-------------T 264
           PP            +  PP Q  P            P+ P PT+P+              
Sbjct: 178 PPRQPQPPAPQPGPEYLPPDQPKPRPPIRPQPPAPVPTQPRPTSPTYRPSPLEPQTPPPR 237

Query: 265 PTTPSGGYYNSPPQDSS-PPTDPTPTT-------PSTPTTPSGGYYN----SPPQDSSPP 408
           P+ P  G Y  P  D+   P+ P PT        P  P +P G  +     +PP    P 
Sbjct: 238 PSVPPVGEYLPPSGDNEVTPSQPQPTAPIPGYGQPPAPPSPPGPSFQPRPPTPPSPQGPT 297

Query: 409 SDPLP 423
             PLP
Sbjct: 298 YQPLP 302

[126][TOP]
>UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B501E
          Length = 406

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 50/151 (33%), Positives = 58/151 (38%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYD--PTPSPPSGDGSYNP 177
           P P PP    +Y P P    G     P P PP   G  PP +Y   P P PP    +Y+P
Sbjct: 187 PPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSP 246

Query: 178 TPSTPPSSDCTPPSQDSPPSDPT---PTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
            P  PP     PP+   PP  P    P  P  P  P+   Y  PP    PP  P  + P 
Sbjct: 247 PPPPPPP---PPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPP 303

Query: 349 TPT------TPSGGYYNSPPQDSSPPSDPLP 423
            P        P   Y   PP    PP+ P P
Sbjct: 304 PPAYGPPPPPPPPAYAPPPPPAYGPPAPPPP 334

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 51/158 (32%), Positives = 55/158 (34%), Gaps = 18/158 (11%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG------ 165
           P P PP    SY P P    G     P P PP   G  PP +Y P P PP          
Sbjct: 118 PPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGP 177

Query: 166 ----SYNPTPSTPPS------SDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSS 315
               +Y P P  PP           PP+   PP  P P  P     P    Y  PP    
Sbjct: 178 PPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPP 237

Query: 316 PPTDP--TPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PP  P  +P  P  P  P   Y   PP    PP  P P
Sbjct: 238 PPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPP 275

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 49/154 (31%), Positives = 54/154 (35%), Gaps = 14/154 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG------ 165
           P P PP    +Y P P    G     P P PP   G  PP +Y P P PP          
Sbjct: 164 PPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGP 223

Query: 166 ----SYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT 333
               +Y P P  PP     PP+   PP  P P  P+    P    Y  PP    PP    
Sbjct: 224 PPPPAYGPPPPPPPPP--PPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAA 281

Query: 334 ----PTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
               P  P  P  P   Y   PP    PP  P P
Sbjct: 282 YAYGPPPPPPPPPPPPAYSPPPPPAYGPPPPPPP 315

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 50/148 (33%), Positives = 58/148 (39%), Gaps = 7/148 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSY----DPTPSPPSGDGSY 171
           P P PP    +Y+P P  PP        P PP+  G  PP +Y     P P PP    +Y
Sbjct: 233 PPPPPPPPPPAYSPPPPPPP--------PPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAY 284

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS- 348
            P P  PP     PP   SPP  P    P  P  P+  Y   PP    PP  P P  P  
Sbjct: 285 GPPPPPPPP---PPPPAYSPPPPPAYGPPPPPPPPA--YAPPPPPAYGPPAPPPPPPPPP 339

Query: 349 --TPTTPSGGYYNSPPQDSSPPSDPLPR 426
              P  P   Y   PP  +  P  P P+
Sbjct: 340 AYAPPPPPPAYAPPPPPPAYAPPPPPPK 367

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 48/139 (34%), Positives = 54/139 (38%), Gaps = 3/139 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP    +Y P P  PP  G   P P PP     SPP    P P PP    +Y P P
Sbjct: 210 PPPPPPPPPPAYGPPP--PPAYGPPPPPPPPPPPPAYSPP----PPPPPPPPPAAYGPPP 263

Query: 184 STPPSSDCTPPSQDSPPSDP---TPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP 354
             PP+    PP    PP       P  P  P  P   Y   PP    PP  P P   + P
Sbjct: 264 --PPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPPPPPPPAYAPP 321

Query: 355 TTPSGGYYNSPPQDSSPPS 411
             P+ G    PP    PP+
Sbjct: 322 PPPAYGPPAPPPPPPPPPA 340

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 46/144 (31%), Positives = 50/144 (34%), Gaps = 9/144 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP    +Y P P    G     P P PP   G  PP +Y P P PP       P P
Sbjct: 141 PPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPP-------PPP 193

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQD---------SSPPTDPTP 336
             P      PP+   PP  P P  P     P    Y  PP           S PP  P P
Sbjct: 194 PPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPPPP 253

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPP 408
             P+    P    Y  PP    PP
Sbjct: 254 PPPAAYGPPPPPAYGPPPPPPPPP 277

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 48/152 (31%), Positives = 53/152 (34%), Gaps = 16/152 (10%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGG-------SYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGS 168
           P PP   G   P P  PP          +Y P P PP      PP +Y P P P  G   
Sbjct: 154 PPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPP---PPPPAYGPPPPPAYGPPP 210

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDP---------TPTTPSTPTTPSGGYYNSPPQDSSPP 321
             P P  PP+    PP    PP  P         +P  P  P  P   Y   PP    PP
Sbjct: 211 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPP 270

Query: 322 TDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
             P P     P  P+   Y  PP    PP  P
Sbjct: 271 PPPPP-----PPPPAAYAYGPPPPPPPPPPPP 297

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 49/156 (31%), Positives = 54/156 (34%), Gaps = 16/156 (10%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP+      P   +PP   +Y P P PP      PP SY P P P     +Y P P
Sbjct: 90  PPPPPPAYAPPPPPPAYAPPPPPAYAPPPPPPPPP---PPPSYGPPPPP-----AYGPPP 141

Query: 184 STPPS------SDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT---- 333
             PP           PP+   PP  P P  P     P    Y  PP    PP  P     
Sbjct: 142 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPP 201

Query: 334 ------PTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
                 P  P  P  P   Y   PP    PP  P P
Sbjct: 202 PPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPP 237

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 50/160 (31%), Positives = 56/160 (35%), Gaps = 20/160 (12%)
 Frame = +1

Query: 4   PTPTPPSGD---------GSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS 156
           P P PP+ D         G   P   +PP    Y P P PP+ +   PP +Y P P P  
Sbjct: 56  PPPPPPAYDDCDEIVLVPGKPAPPAYAPPPP-VYAPPPPPPAYAPPPPPPAYAPPPPPAY 114

Query: 157 GDGSYNPTPSTPPS-SDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT 333
                 P P  PPS     PP+   PP  P P  P     P    Y  PP    PP  P 
Sbjct: 115 APPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPA 174

Query: 334 ----------PTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
                     P  P  P  P   Y   PP    PP  P P
Sbjct: 175 YGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPP 214

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 49/149 (32%), Positives = 58/149 (38%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSY----DPTPSPPSGDGSY 171
           P P PP    +Y P P  PP  G   P P PP      PP +Y     P P PP    +Y
Sbjct: 248 PPPPPPPPPAAYGPPP--PPAYGPPPPPPPPP------PPAAYAYGPPPPPPPPPPPPAY 299

Query: 172 NPTPSTPPSSDCTPPSQD---SPPSDPT--PTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           +P P  PP+    PP      +PP  P   P  P  P  P   Y   PP  +  P  P P
Sbjct: 300 SPPP--PPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPPPPP 357

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
                P  P   Y  +P     PP+ P P
Sbjct: 358 AYAPPPPPPK--YSPAPIVVYGPPAPPPP 384

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 45/146 (30%), Positives = 53/146 (36%), Gaps = 19/146 (13%)
 Frame = +1

Query: 43  PTPSSPPGGGSYDPT---------PSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPP 195
           P P  PP   +YD           P+PP+ +   PP  Y P P PP+    Y P P  P 
Sbjct: 52  PAPQPPPPPPAYDDCDEIVLVPGKPAPPAYA--PPPPVYAPPPPPPA----YAPPPPPPA 105

Query: 196 SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT----------PTTP 345
            +   PP+   PP  P P  P +   P    Y  PP    PP  P           P  P
Sbjct: 106 YAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPP 165

Query: 346 STPTTPSGGYYNSPPQDSSPPSDPLP 423
             P  P   Y   PP    PP  P P
Sbjct: 166 PPPPPPPPAYGPPPPPAYGPPPPPPP 191

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 43/138 (31%), Positives = 48/138 (34%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP    +Y P P  PP        P PP      PP +Y P P PP       P  
Sbjct: 273 PPPPPPPAAYAYGPPPPPPP--------PPPPPAYSPPPPPAYGPPPPPPP------PAY 318

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           + PP     PP   +PP  P P     P  P   Y   PP  +  P  P P     P   
Sbjct: 319 APPPPPAYGPP---APPPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPKYSPAPIVV 375

Query: 364 SGGYYNSPPQDSSPPSDP 417
            G     PP    PP  P
Sbjct: 376 YG-----PPAPPPPPPAP 388

[127][TOP]
>UniRef100_UPI000038411B COG3210: Large exoproteins involved in heme utilization or adhesion
            n=1 Tax=Magnetospirillum magnetotacticum MS-1
            RepID=UPI000038411B
          Length = 1444

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 60/162 (37%), Positives = 83/162 (51%), Gaps = 21/162 (12%)
 Frame = +1

Query: 1    DPTP----TPPSGDGSYNPTP---SSPPGGGSYDPTP----SPPSDS----GGSPPGSYD 135
            DPTP    TPP+     +PTP   ++PP     DPTP    +PP+D       +PP   D
Sbjct: 596  DPTPVVDTTPPA-----DPTPVVDTTPPA----DPTPVVDTTPPADPTPVVDTTPPA--D 644

Query: 136  PTP----SPPSGDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
            PTP    +PP+     +PTP   T P +D TP    +PP+DPTP   +TP         +
Sbjct: 645  PTPVVDTTPPA-----DPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADP-----T 694

Query: 298  PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P  D++PP DPTPT  +TP         +P +D++PP +P P
Sbjct: 695  PVVDTTPPADPTPTEDNTPPVEP-----TPTEDNTPPVEPTP 731

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 60/161 (37%), Positives = 83/161 (51%), Gaps = 22/161 (13%)
 Frame = +1

Query: 1    DPTP----TPPSGDGSYNPTP---SSPPGGGSYDPTP----SPPSDS----GGSPPGSYD 135
            DPTP    TPP+     +PTP   ++PP     DPTP    +PP+D       +PP   D
Sbjct: 608  DPTPVVDTTPPA-----DPTPVVDTTPPA----DPTPVVDTTPPADPTPVVDTTPPA--D 656

Query: 136  PTP----SPPSGDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
            PTP    +PP+     +PTP   T P +D TP    +PP+DPTP   +TP         +
Sbjct: 657  PTPVVDTTPPA-----DPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADP-----T 706

Query: 298  PPQDSSPPTDPTPTTPST-PTTPSGGYYNSPPQDSSPPSDP 417
            P +D++PP +PTPT  +T P  P+    N+PP +  PP  P
Sbjct: 707  PTEDNTPPVEPTPTEDNTPPVEPTPTEDNTPPVEPGPPVTP 747

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 60/162 (37%), Positives = 82/162 (50%), Gaps = 21/162 (12%)
 Frame = +1

Query: 1   DPTP----TPPSGDGSYNPTP---SSPPGGGSYDPTP----SPPSDS----GGSPPGSYD 135
           DPTP    TPP+     +PTP   ++PP     DPTP    +PP+D       +PP   D
Sbjct: 488 DPTPVVDTTPPA-----DPTPVVDTTPPA----DPTPVVDTTPPADPTPVVDTTPPA--D 536

Query: 136 PTP----SPPSGDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
           PTP    +PP+     +PTP   T P +D TP    +PP+DPTP   +TP         +
Sbjct: 537 PTPVVDTTPPA-----DPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADP-----T 586

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  D++PP DPTP   +TP         +P  D++PP+DP P
Sbjct: 587 PVVDTTPPADPTPVVDTTPPADP-----TPVVDTTPPADPTP 623

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 60/162 (37%), Positives = 82/162 (50%), Gaps = 21/162 (12%)
 Frame = +1

Query: 1   DPTP----TPPSGDGSYNPTP---SSPPGGGSYDPTP----SPPSDS----GGSPPGSYD 135
           DPTP    TPP+     +PTP   ++PP     DPTP    +PP+D       +PP   D
Sbjct: 512 DPTPVVDTTPPA-----DPTPVVDTTPPA----DPTPVVDTTPPADPTPVVDTTPPA--D 560

Query: 136 PTP----SPPSGDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
           PTP    +PP+     +PTP   T P +D TP    +PP+DPTP   +TP         +
Sbjct: 561 PTPVVDTTPPA-----DPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADP-----T 610

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  D++PP DPTP   +TP         +P  D++PP+DP P
Sbjct: 611 PVVDTTPPADPTPVVDTTPPADP-----TPVVDTTPPADPTP 647

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 60/162 (37%), Positives = 82/162 (50%), Gaps = 21/162 (12%)
 Frame = +1

Query: 1   DPTP----TPPSGDGSYNPTP---SSPPGGGSYDPTP----SPPSDS----GGSPPGSYD 135
           DPTP    TPP+     +PTP   ++PP     DPTP    +PP+D       +PP   D
Sbjct: 536 DPTPVVDTTPPA-----DPTPVVDTTPPA----DPTPVVDTTPPADPTPVVDTTPPA--D 584

Query: 136 PTP----SPPSGDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
           PTP    +PP+     +PTP   T P +D TP    +PP+DPTP   +TP         +
Sbjct: 585 PTPVVDTTPPA-----DPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADP-----T 634

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  D++PP DPTP   +TP         +P  D++PP+DP P
Sbjct: 635 PVVDTTPPADPTPVVDTTPPADP-----TPVVDTTPPADPTP 671

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 60/162 (37%), Positives = 82/162 (50%), Gaps = 21/162 (12%)
 Frame = +1

Query: 1   DPTP----TPPSGDGSYNPTP---SSPPGGGSYDPTP----SPPSDS----GGSPPGSYD 135
           DPTP    TPP+     +PTP   ++PP     DPTP    +PP+D       +PP   D
Sbjct: 548 DPTPVVDTTPPA-----DPTPVVDTTPPA----DPTPVVDTTPPADPTPVVDTTPPA--D 596

Query: 136 PTP----SPPSGDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
           PTP    +PP+     +PTP   T P +D TP    +PP+DPTP   +TP         +
Sbjct: 597 PTPVVDTTPPA-----DPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADP-----T 646

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  D++PP DPTP   +TP         +P  D++PP+DP P
Sbjct: 647 PVVDTTPPADPTPVVDTTPPADP-----TPVVDTTPPADPTP 683

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 60/162 (37%), Positives = 82/162 (50%), Gaps = 21/162 (12%)
 Frame = +1

Query: 1   DPTP----TPPSGDGSYNPTP---SSPPGGGSYDPTP----SPPSDS----GGSPPGSYD 135
           DPTP    TPP+     +PTP   ++PP     DPTP    +PP+D       +PP   D
Sbjct: 560 DPTPVVDTTPPA-----DPTPVVDTTPPA----DPTPVVDTTPPADPTPVVDTTPPA--D 608

Query: 136 PTP----SPPSGDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
           PTP    +PP+     +PTP   T P +D TP    +PP+DPTP   +TP         +
Sbjct: 609 PTPVVDTTPPA-----DPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADP-----T 658

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  D++PP DPTP   +TP         +P  D++PP+DP P
Sbjct: 659 PVVDTTPPADPTPVVDTTPPADP-----TPVVDTTPPADPTP 695

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 60/162 (37%), Positives = 82/162 (50%), Gaps = 21/162 (12%)
 Frame = +1

Query: 1   DPTP----TPPSGDGSYNPTP---SSPPGGGSYDPTP----SPPSDS----GGSPPGSYD 135
           DPTP    TPP+     +PTP   ++PP     DPTP    +PP+D       +PP   D
Sbjct: 572 DPTPVVDTTPPA-----DPTPVVDTTPPA----DPTPVVDTTPPADPTPVVDTTPPA--D 620

Query: 136 PTP----SPPSGDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
           PTP    +PP+     +PTP   T P +D TP    +PP+DPTP   +TP         +
Sbjct: 621 PTPVVDTTPPA-----DPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADP-----T 670

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  D++PP DPTP   +TP         +P  D++PP+DP P
Sbjct: 671 PVVDTTPPADPTPVVDTTPPADP-----TPVVDTTPPADPTP 707

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 59/162 (36%), Positives = 82/162 (50%), Gaps = 21/162 (12%)
 Frame = +1

Query: 1   DPTP----TPPSGDGSYNPTP---SSPPGGGSYDPTP----SPPSDS----GGSPPGSYD 135
           DPTP    TPP+     +PTP   ++PP     DPTP    +PP+D       +PP   D
Sbjct: 584 DPTPVVDTTPPA-----DPTPVVDTTPPA----DPTPVVDTTPPADPTPVVDTTPPA--D 632

Query: 136 PTP----SPPSGDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
           PTP    +PP+     +PTP   T P +D TP    +PP+DPTP   +TP         +
Sbjct: 633 PTPVVDTTPPA-----DPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADP-----T 682

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  D++PP DPTP   +TP         +P +D++PP +P P
Sbjct: 683 PVVDTTPPADPTPVVDTTPPADP-----TPTEDNTPPVEPTP 719

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 58/154 (37%), Positives = 78/154 (50%), Gaps = 21/154 (13%)
 Frame = +1

Query: 1    DPTP----TPPSGDGSYNPTP---SSPPGGGSYDPTP----SPPSDS----GGSPPGSYD 135
            DPTP    TPP+     +PTP   ++PP     DPTP    +PP+D       +PP   D
Sbjct: 620  DPTPVVDTTPPA-----DPTPVVDTTPPA----DPTPVVDTTPPADPTPVVDTTPPA--D 668

Query: 136  PTP----SPPSGDGSYNPTP--STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
            PTP    +PP+     +PTP   T P +D TP    +PP+DPTPT  +TP         +
Sbjct: 669  PTPVVDTTPPA-----DPTPVVDTTPPADPTPVVDTTPPADPTPTEDNTPPVEP-----T 718

Query: 298  PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDS 399
            P +D++PP +PTPT  +TP    G     P  DS
Sbjct: 719  PTEDNTPPVEPTPTEDNTPPVEPGPPVTPPSNDS 752

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 53/146 (36%), Positives = 74/146 (50%), Gaps = 9/146 (6%)
 Frame = +1

Query: 13  TPPSGDGSYNPTP---SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP----SPPSGDGSY 171
           TPP+     +PTP   ++PP     DPTP   +    +PP   DPTP    +PP+     
Sbjct: 484 TPPA-----DPTPVVDTTPPA----DPTPVVDT----TPPA--DPTPVVDTTPPA----- 523

Query: 172 NPTP--STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
           +PTP   T P +D TP    +PP+DPTP   +TP         +P  D++PP DPTP   
Sbjct: 524 DPTPVVDTTPPADPTPVVDTTPPADPTPVVDTTPPADP-----TPVVDTTPPADPTPVVD 578

Query: 346 STPTTPSGGYYNSPPQDSSPPSDPLP 423
           +TP         +P  D++PP+DP P
Sbjct: 579 TTPPADP-----TPVVDTTPPADPTP 599

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 47/128 (36%), Positives = 66/128 (51%), Gaps = 7/128 (5%)
 Frame = +1

Query: 61  PGGGSYD-PTPSPPSDSGGSPPGSYDPTP----SPPSGDGSYNPTP--STPPSSDCTPPS 219
           PG   +D   P+P  D+  +PP   DPTP    +PP+     +PTP   T P +D TP  
Sbjct: 467 PGTARFDVEAPAPVVDT--TPPA--DPTPVVDTTPPA-----DPTPVVDTTPPADPTPVV 517

Query: 220 QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDS 399
             +PP+DPTP   +TP         +P  D++PP DPTP   +TP         +P  D+
Sbjct: 518 DTTPPADPTPVVDTTPPADP-----TPVVDTTPPADPTPVVDTTPPADP-----TPVVDT 567

Query: 400 SPPSDPLP 423
           +PP+DP P
Sbjct: 568 TPPADPTP 575

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 43/132 (32%), Positives = 62/132 (46%)
 Frame = +1

Query: 28  DGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDC 207
           DG+Y  TP +    G  D   +    +GG+ PG+       P+      P   T P +D 
Sbjct: 437 DGTYTFTPDAN-FHGEVDLHYTISDGNGGTVPGTARFDVEAPA------PVVDTTPPADP 489

Query: 208 TPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSP 387
           TP    +PP+DPTP   +TP         +P  D++PP DPTP   +TP         +P
Sbjct: 490 TPVVDTTPPADPTPVVDTTPPADP-----TPVVDTTPPADPTPVVDTTPPADP-----TP 539

Query: 388 PQDSSPPSDPLP 423
             D++PP+DP P
Sbjct: 540 VVDTTPPADPTP 551

[128][TOP]
>UniRef100_C1MZS3 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545
            RepID=C1MZS3_9CHLO
          Length = 3282

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 51/149 (34%), Positives = 60/149 (40%), Gaps = 9/149 (6%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P+P PP  +    PTP   P      P+P PP  +  SPP    P  SPP  D    P P
Sbjct: 964  PSPAPPPPERP--PTPVVAPSPAPPPPSPPPPQPAEPSPP----PPGSPPRPDAPSPPPP 1017

Query: 184  STPPSSDC-------TPPSQD--SPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
              PP+ D         PP+ D  SPP    P  P  P+ P  G   +P   S PP  P P
Sbjct: 1018 GRPPAPDAPSPPPPGRPPAPDAPSPPPPGRPPAPDAPSPPPPGRPPAPDAPSPPPPSPPP 1077

Query: 337  TTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              P  P+ P  G    P   S PP    P
Sbjct: 1078 PRPDAPSPPPPGLPPRPAAPSPPPPGQPP 1106

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/141 (34%), Positives = 58/141 (41%), Gaps = 6/141 (4%)
 Frame = +1

Query: 4    PTP-TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSY-DPTPSPPSGDGSYNP 177
            P P  PP+ D    P P +PP   +  P PSP       PP     P+P+PP  +    P
Sbjct: 918  PEPEAPPAPDALSPPPPRAPPEPVAASPPPSPAPPPPERPPTPVVAPSPAPPPPERPPTP 977

Query: 178  --TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDS--SPPTDPTPTTP 345
               PS  P     PP Q + PS P P +P  P  PS      PP     SPP    P  P
Sbjct: 978  VVAPSPAPPPPSPPPPQPAEPSPPPPGSPPRPDAPSPPPPGRPPAPDAPSPPPPGRPPAP 1037

Query: 346  STPTTPSGGYYNSPPQDSSPP 408
              P+ P  G   +P   S PP
Sbjct: 1038 DAPSPPPPGRPPAPDAPSPPP 1058

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 54/154 (35%), Positives = 64/154 (41%), Gaps = 15/154 (9%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDP-TPSPPSDSGGSPPGSYDPTPSPP----SGDGS 168
            P P PPS        PS PP G    P  PSPP    G PP    P+P PP    + D  
Sbjct: 983  PAPPPPSPPPPQPAEPSPPPPGSPPRPDAPSPPPP--GRPPAPDAPSPPPPGRPPAPDAP 1040

Query: 169  YNPTPSTPPSSDCT-------PPSQDSP---PSDPTPTTPSTPTTPSGGYYNSPPQDSSP 318
              P P  PP+ D         PP+ D+P   P  P P  P  P+ P  G    PP+ ++ 
Sbjct: 1041 SPPPPGRPPAPDAPSPPPPGRPPAPDAPSPPPPSPPPPRPDAPSPPPPGL---PPRPAA- 1096

Query: 319  PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
            P+ P P  P  P  P      SPP    PP  PL
Sbjct: 1097 PSPPPPGQPPAPAAP------SPP----PPGQPL 1120

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 49/155 (31%), Positives = 62/155 (40%), Gaps = 15/155 (9%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP---SPPSGDGSYN 174
            P+  PP       P P  PP   +   +P PP    G+PP S +P P   +PP+ D    
Sbjct: 883  PSSPPP-------PPPGLPPQPEAPAASPPPP----GAPPTSVEPPPEPEAPPAPDALSP 931

Query: 175  PTPSTPPS--SDCTPPSQDSPPSD----------PTPTTPSTPTTPSGGYYNSPPQDSSP 318
            P P  PP   +   PPS   PP +          P P  P  P TP      +PP  S P
Sbjct: 932  PPPRAPPEPVAASPPPSPAPPPPERPPTPVVAPSPAPPPPERPPTPVVAPSPAPPPPSPP 991

Query: 319  PTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
            P  P   +P  P +P      SPP    PP+   P
Sbjct: 992  PPQPAEPSPPPPGSPPRPDAPSPPPPGRPPAPDAP 1026

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 48/146 (32%), Positives = 61/146 (41%), Gaps = 6/146 (4%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTP--SPPSDSGGSPPGSYDPTPS--PPSGDGSY 171
            P P  P       P P +PP   +  P P  +PP     SPP S  P P   PP+   + 
Sbjct: 905  PPPGAPPTSVEPPPEPEAPPAPDALSPPPPRAPPEPVAASPPPSPAPPPPERPPTPVVAP 964

Query: 172  NPTPSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
            +P P  P  P +    PS   PP  P P  P+ P+ P  G   SPP+  +P + P P  P
Sbjct: 965  SPAPPPPERPPTPVVAPSPAPPPPSPPPPQPAEPSPPPPG---SPPRPDAP-SPPPPGRP 1020

Query: 346  STPTTPSGGYYNSPPQDSSPPSDPLP 423
              P  PS      PP    PP+   P
Sbjct: 1021 PAPDAPS------PPPPGRPPAPDAP 1040

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 48/130 (36%), Positives = 52/130 (40%), Gaps = 1/130 (0%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDP-TPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
            P+P PP G       PS PP G    P  PSPP    G PP    P+P PP G       
Sbjct: 1012 PSPPPP-GRPPAPDAPSPPPPGRPPAPDAPSPPPP--GRPPAPDAPSP-PPPGRPPAPDA 1067

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            PS PP S   PP +   PS P P  P  P  PS      PP     P  P+P  P  P  
Sbjct: 1068 PSPPPPS--PPPPRPDAPSPPPPGLPPRPAAPS----PPPPGQPPAPAAPSPPPPGQPLA 1121

Query: 361  PSGGYYNSPP 390
            P       PP
Sbjct: 1122 PIRVVTPEPP 1131

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 43/141 (30%), Positives = 52/141 (36%), Gaps = 5/141 (3%)
 Frame = +1

Query: 16   PPSGDGSYNPTPSSPPGGGSYDPTPSPPS-----DSGGSPPGSYDPTPSPPSGDGSYNPT 180
            PP G       PSSPP      P P PP      ++   PP      P PP  +    P 
Sbjct: 1267 PPPGAPPRPAAPSSPPPEAPEAPAPPPPEAPEAPEAPAPPPPEAPEAPPPPPPEAPEAPP 1326

Query: 181  PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
            P  PP      P   +PP    P  P  P  P       PP+    P   +P  P+ P+ 
Sbjct: 1327 P--PPPEAPEAPEAPAPPPPEAPEAPEAPAPP-------PPEAPVAPVVASPLPPAAPSP 1377

Query: 361  PSGGYYNSPPQDSSPPSDPLP 423
            P  G    P   +SPPS P P
Sbjct: 1378 PPPG--EPPAPVASPPSPPPP 1396

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 42/140 (30%), Positives = 50/140 (35%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
            P P PPS      P   SPP      P  +PP     SP       PSPP       P  
Sbjct: 1213 PVPAPPSPITPPQPEVRSPP------PPVAPPQPVAASPQPE---VPSPPPPVAPPQPVA 1263

Query: 184  STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            ++PP     P  + + PS P P  P  P  P       PP+    P  P P  P  P  P
Sbjct: 1264 ASPPPPGAPP--RPAAPSSPPPEAPEAPAPP-------PPEAPEAPEAPAPPPPEAPEAP 1314

Query: 364  SGGYYNSPPQDSSPPSDPLP 423
                   PP   +P + P P
Sbjct: 1315 ------PPPPPEAPEAPPPP 1328

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 43/161 (26%), Positives = 56/161 (34%), Gaps = 21/161 (13%)
 Frame = +1

Query: 4    PTP-TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD----------SGGSPPGSYDPTPSP 150
            P+P TPP  +    P P +PP   +  P P  PS           +   PP    P P+ 
Sbjct: 1218 PSPITPPQPEVRSPPPPVAPPQPVAASPQPEVPSPPPPVAPPQPVAASPPPPGAPPRPAA 1277

Query: 151  PSG------DGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDS 312
            PS       +    P P  P + +   P     P  P P  P  P  P       PP+  
Sbjct: 1278 PSSPPPEAPEAPAPPPPEAPEAPEAPAPPPPEAPEAPPPPPPEAPEAPP----PPPPEAP 1333

Query: 313  SPPTDPTPTTPSTPTTPSGGYYNSPPQDSSP----PSDPLP 423
              P  P P  P  P  P      +PP   +P     + PLP
Sbjct: 1334 EAPEAPAPPPPEAPEAPEA---PAPPPPEAPVAPVVASPLP 1371

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 39/138 (28%), Positives = 49/138 (35%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPST 189
            P PP  +    P   +PP   + +  P PP ++  +PP      P PP         P  
Sbjct: 1289 PAPPPPEAPEAPEAPAPPPPEAPEAPPPPPPEAPEAPP------PPPPE-------APEA 1335

Query: 190  PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
            P +    PP     P  P P  P  P  P      SP     PP  P+P  P  P  P  
Sbjct: 1336 PEAPAPPPPEAPEAPEAPAPPPPEAPVAP---VVASP----LPPAAPSPPPPGEPPAPVA 1388

Query: 370  GYYNSPPQDSSPPSDPLP 423
                SPP    P   P+P
Sbjct: 1389 ----SPPSPPPPGQPPVP 1402

[129][TOP]
>UniRef100_B9SHA4 ATP binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9SHA4_RICCO
          Length = 724

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 53/156 (33%), Positives = 70/156 (44%), Gaps = 20/156 (12%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTP 192
           +PPS DG   P PS  P   +    P P      SPP     +P PP+      P PS+P
Sbjct: 28  SPPSNDGKSPPPPSPDPLSETLLLAPPPAESDSNSPPPPTGQSPPPPNSPPPSEPPPSSP 87

Query: 193 PSSDCTPPSQDSPPSDPTPTTPSTPTTPS-GGYYNSPP----QDSSPP----TDPTPTTP 345
           P S+  PP    PPS  T  +P  P +PS     +SPP    ++ SPP    + P P + 
Sbjct: 88  PPSNSDPPPSSPPPSSSTAASPPPPLSPSPKATPHSPPPTPAKNESPPVSGQSSPPPPSD 147

Query: 346 STPTTPS----------GGYYNSPP-QDSSPPSDPL 420
           S  T PS          GG  + PP ++S  PS P+
Sbjct: 148 SEATPPSLEFVPPSGAAGGVQSPPPTRESVAPSSPV 183

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 50/143 (34%), Positives = 68/143 (47%), Gaps = 11/143 (7%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPP--SDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           +P PP+      P PSSPP   S  P  SPP  S +  SPP     +PSP +   S  PT
Sbjct: 70  SPPPPNSPPPSEPPPSSPPPSNSDPPPSSPPPSSSTAASPPPPL--SPSPKATPHSPPPT 127

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPS----TPTTPSGGYYNSPP-----QDSSPPTDPT 333
           P+   S   +  S   PPSD   T PS     P+  +GG  + PP       SSP ++  
Sbjct: 128 PAKNESPPVSGQSSPPPPSDSEATPPSLEFVPPSGAAGGVQSPPPTRESVAPSSPVSNTQ 187

Query: 334 PTTPSTPTTPSGGYYNSPPQDSS 402
           P + ++ TTPS    ++P Q +S
Sbjct: 188 PISSNSSTTPSRA-ASAPKQSAS 209

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 46/133 (34%), Positives = 62/133 (46%), Gaps = 11/133 (8%)
 Frame = +1

Query: 43  PTPSSPPGGGSYDPTPSPPSDSGGSPPG-SYDPTP-----SPPSGDGSYNPTPSTPPSSD 204
           P  ++PP   S      PPS+ G SPP  S DP       +PP  +   N  P  PP+  
Sbjct: 18  PLINTPPSANS------PPSNDGKSPPPPSPDPLSETLLLAPPPAESDSNSPP--PPTGQ 69

Query: 205 CTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPS-GGYYN 381
             PP    PPS+P P++P     PS    + PP  S PP+  T  +P  P +PS     +
Sbjct: 70  SPPPPNSPPPSEPPPSSPP----PSN---SDPPPSSPPPSSSTAASPPPPLSPSPKATPH 122

Query: 382 SPP----QDSSPP 408
           SPP    ++ SPP
Sbjct: 123 SPPPTPAKNESPP 135

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 49/138 (35%), Positives = 62/138 (44%), Gaps = 14/138 (10%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPP-SDSGGSPPGSYDPTP----SPPSGDG 165
           +P P+ P    S +P PSSPP   S   +P PP S S  + P S  PTP    SPP    
Sbjct: 81  EPPPSSPPPSNS-DPPPSSPPPSSSTAASPPPPLSPSPKATPHSPPPTPAKNESPPVSGQ 139

Query: 166 SYNPTPS----TPPSSDCTPPS-----QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSP 318
           S  P PS    TPPS +  PPS       SPP       PS+P +      N+ P  S+ 
Sbjct: 140 SSPPPPSDSEATPPSLEFVPPSGAAGGVQSPPPTRESVAPSSPVS------NTQPISSNS 193

Query: 319 PTDPTPTTPSTPTTPSGG 372
            T P+    +   + SGG
Sbjct: 194 STTPSRAASAPKQSASGG 211

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 42/119 (35%), Positives = 53/119 (44%), Gaps = 6/119 (5%)
 Frame = +1

Query: 88  PSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDC---TPPSQDSPPSDPTPTTP 258
           P PP  +  +PP +     SPPS DG   P PS  P S+     PP  +S  + P P T 
Sbjct: 15  PLPPLIN--TPPSAN----SPPSNDGKSPPPPSPDPLSETLLLAPPPAESDSNSPPPPTG 68

Query: 259 STPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT---PSGGYYNSPPQDSSPPSDPLPR 426
            +P  P     NSPP    PP+ P P+    P +   PS     SPP    PP  P P+
Sbjct: 69  QSPPPP-----NSPPPSEPPPSSPPPSNSDPPPSSPPPSSSTAASPP----PPLSPSPK 118

[130][TOP]
>UniRef100_B9H3S0 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9H3S0_POPTR
          Length = 686

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 50/141 (35%), Positives = 66/141 (46%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPT-PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P P+    D + +P  PS+P    +  P   PP+    SPP    P+P  PS    + P 
Sbjct: 2   PPPSTSQPDQTIDPPLPSTPSNPATPPPQSPPPAPPAASPPAPPPPSPIIPSTPPPFPPP 61

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           PS P S    PP+  +PPS PT   P++ T P       PP  +SPP   +PTTP T   
Sbjct: 62  PSPPASPPPAPPAL-TPPSPPTAPPPASTTAPPP----PPPISTSPPPRASPTTPVTSPP 116

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P      SPP    P +DP+P
Sbjct: 117 PPQAVSPSPP---PPANDPIP 134

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 49/145 (33%), Positives = 63/145 (43%), Gaps = 6/145 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDP---TPSPPSGDGSYN 174
           P P PPS      P P  PP      P P+PP+ +  SPP +  P   T  PP    S +
Sbjct: 42  PAPPPPSPIIPSTPPPFPPPPSPPASPPPAPPALTPPSPPTAPPPASTTAPPPPPPISTS 101

Query: 175 PTPSTPPSSDCT--PPSQDSPPSDPTPTT-PSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
           P P   P++  T  PP Q   PS P P   P  P T      NSPP  +  P +  P  P
Sbjct: 102 PPPRASPTTPVTSPPPPQAVSPSPPPPANDPIPPAT------NSPPPPTEKPPESPPALP 155

Query: 346 STPTTPSGGYYNSPPQDSSPPSDPL 420
           + P  P     +SPP  ++ P  P+
Sbjct: 156 TVPPPPPSSQSDSPPPTTNSPPPPI 180

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 52/164 (31%), Positives = 69/164 (42%), Gaps = 24/164 (14%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTP---------SSPPGGGSYDPTPSPPSDSGGSPPGSYDPT----- 141
           P P PPS   S  P P         ++PP   +  P P PP  +  SPP    PT     
Sbjct: 57  PFPPPPSPPASPPPAPPALTPPSPPTAPPPASTTAPPPPPPIST--SPPPRASPTTPVTS 114

Query: 142 PSPPSGDGSYNPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDS 312
           P PP       P P+    PP+++  PP  + PP  P P  P+ P  P     +SPP  +
Sbjct: 115 PPPPQAVSPSPPPPANDPIPPATNSPPPPTEKPPESP-PALPTVPPPPPSSQSDSPPPTT 173

Query: 313 SPPT-------DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           + P         P P+ PST +TP      +PP +SS    P P
Sbjct: 174 NSPPPPISTLQSPPPSIPSTSSTPPAISPPAPPVNSSVTGSPTP 217

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 46/131 (35%), Positives = 60/131 (45%), Gaps = 13/131 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD-----SGGSPPGSYDPTPSPPSGDGS 168
           P  T P    S     +SPP   +  P+P PP++     +  SPP    PT  PP    +
Sbjct: 97  PISTSPPPRASPTTPVTSPPPPQAVSPSPPPPANDPIPPATNSPP---PPTEKPPESPPA 153

Query: 169 YNPTPSTPPS--SDCTPPSQDSPP------SDPTPTTPSTPTTPSGGYYNSPPQDSSPPT 324
               P  PPS  SD  PP+ +SPP        P P+ PST +TP      +PP +SS   
Sbjct: 154 LPTVPPPPPSSQSDSPPPTTNSPPPPISTLQSPPPSIPSTSSTPPAISPPAPPVNSSVTG 213

Query: 325 DPTPTTPSTPT 357
            PTP  P+ PT
Sbjct: 214 SPTPPFPAIPT 224

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 35/104 (33%), Positives = 44/104 (42%), Gaps = 7/104 (6%)
 Frame = +1

Query: 136 PTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPT-------PTTPSTPTTPSGGYYN 294
           P PS    D + +P   + PS+  TPP Q  PP+ P        P +P  P+TP      
Sbjct: 2   PPPSTSQPDQTIDPPLPSTPSNPATPPPQSPPPAPPAASPPAPPPPSPIIPSTPPPFPPP 61

Query: 295 SPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
             P  S PP  P  T PS PT P      +PP      + P PR
Sbjct: 62  PSPPASPPPAPPALTPPSPPTAPPPASTTAPPPPPPISTSPPPR 105

[131][TOP]
>UniRef100_B7ZXA1 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B7ZXA1_MAIZE
          Length = 662

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 54/145 (37%), Positives = 68/145 (46%), Gaps = 13/145 (8%)
 Frame = +1

Query: 4   PTPTPPSGD--GSYNP---TPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGS 168
           P PT PS     + NP   TPS+PP      PTP+PP+ S   PP    P PSPPS    
Sbjct: 9   PAPTTPSAPPANATNPPPATPSAPPPAAPTPPTPTPPTPS---PPSPAAPPPSPPS---- 61

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPS--------GGYYNSPPQDSSPPT 324
               P+  P+S    PS  SP S  +P TP+TP+ PS        GG   SPP      +
Sbjct: 62  ---VPAPAPASTPVTPSAPSPSSPSSPGTPATPSPPSDTPSPPSSGGGGRSPPSSGGGRS 118

Query: 325 DPTPTTPSTPTTPSGGYYNSPPQDS 399
            P+  +P    +P GG  +S P  S
Sbjct: 119 TPSSHSPPKSHSPGGGGGSSGPSTS 143

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 55/128 (42%), Positives = 62/128 (48%), Gaps = 4/128 (3%)
 Frame = +1

Query: 46  TPSSPPGGGSYDP--TPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPS 219
           TPS+PP   +  P  TPS P  +  +PP    PTPSPPS        P+ PP S      
Sbjct: 13  TPSAPPANATNPPPATPSAPPPAAPTPPTPTPPTPSPPS--------PAAPPPS------ 58

Query: 220 QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS-TPTTPS-GGYYNSPPQ 393
              PPS P P   STP TPS     SP   SSP T  TP+ PS TP+ PS GG   SPP 
Sbjct: 59  ---PPSVPAPAPASTPVTPSAP---SPSSPSSPGTPATPSPPSDTPSPPSSGGGGRSPPS 112

Query: 394 DSSPPSDP 417
                S P
Sbjct: 113 SGGGRSTP 120

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 44/104 (42%), Positives = 51/104 (49%), Gaps = 8/104 (7%)
 Frame = +1

Query: 127 SYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDS---PPSDPTPTTPSTPTTPSGGYYNS 297
           S  PT +P         TPS PP++   PP       PP+ PTP TP TP TPS     +
Sbjct: 2   SSSPTAAPAP------TTPSAPPANATNPPPATPSAPPPAAPTPPTP-TPPTPSPPSPAA 54

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSP-----PQDSSPPSD 414
           PP   SPP+ P P   STP TPS    +SP     P   SPPSD
Sbjct: 55  PP--PSPPSVPAPAPASTPVTPSAPSPSSPSSPGTPATPSPPSD 96

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 40/114 (35%), Positives = 56/114 (49%), Gaps = 1/114 (0%)
 Frame = +1

Query: 73  SYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPT 252
           S  PT +P   +  +PP +   T  PP+       TPS PP +  TPP+    P+ PTP+
Sbjct: 2   SSSPTAAPAPTTPSAPPAN--ATNPPPA-------TPSAPPPAAPTPPT----PTPPTPS 48

Query: 253 TPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDS-SPPS 411
            PS    P        P  +S P  P+  +PS+P++P      SPP D+ SPPS
Sbjct: 49  PPSPAAPPPSPPSVPAPAPASTPVTPSAPSPSSPSSPGTPATPSPPSDTPSPPS 102

[132][TOP]
>UniRef100_B6UDN6 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6UDN6_MAIZE
          Length = 207

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 53/140 (37%), Positives = 71/140 (50%), Gaps = 8/140 (5%)
 Frame = +1

Query: 4   PTPTPPSGD--GSYNP---TPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDG- 165
           P PT PS     + NP   TPS+PP      PTP+PP+ S   PP    P PSPPS    
Sbjct: 9   PAPTTPSAPPANATNPPPATPSAPPPAAPTPPTPTPPTPS---PPSPAAPPPSPPSVPAP 65

Query: 166 SYNPTPSTPPSSDCTPPSQDSPPSDPTP--TTPSTPTTPSGGYYNSPPQDSSPPTDPTPT 339
           + + TP+TP +   + PS  S P+ P+P   TPS P++  GG   SPP      + P+  
Sbjct: 66  APSSTPATPSAPSPSSPSSPSTPATPSPPSDTPSPPSSGGGG--RSPPSSGGGRSTPSSH 123

Query: 340 TPSTPTTPSGGYYNSPPQDS 399
           +P    +P GG  +S P  S
Sbjct: 124 SPPKSHSPGGGGGSSGPSTS 143

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 54/132 (40%), Positives = 65/132 (49%), Gaps = 6/132 (4%)
 Frame = +1

Query: 46  TPSSPPGGGSYDP--TPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPS 219
           TPS+PP   +  P  TPS P  +  +PP    PTPSPPS        P+ PP S   PPS
Sbjct: 13  TPSAPPANATNPPPATPSAPPPAAPTPPTPTPPTPSPPS--------PAAPPPS---PPS 61

Query: 220 QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST----PTTPSGGYYNSP 387
             +P    TP TPS P +PS     S P   SPP+D TP+ PS+     + PS G   S 
Sbjct: 62  VPAPAPSSTPATPSAP-SPSSPSSPSTPATPSPPSD-TPSPPSSGGGGRSPPSSGGGRST 119

Query: 388 PQDSSPPSDPLP 423
           P   SPP    P
Sbjct: 120 PSSHSPPKSHSP 131

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 54/125 (43%), Positives = 60/125 (48%), Gaps = 3/125 (2%)
 Frame = +1

Query: 52  SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTP-PSSDCTPPSQDS 228
           SS P       TPS P  +  +PP +    P PP+      PTP TP P S   PP   S
Sbjct: 2   SSSPTAAPAPTTPSAPPANATNPPPATPSAP-PPAAPTPPTPTPPTPSPPSPAAPP--PS 58

Query: 229 PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS-TPTTP-SGGYYNSPPQDSS 402
           PPS P P   STP TPS     SP   SSP T  TP+ PS TP+ P SGG   SPP    
Sbjct: 59  PPSVPAPAPSSTPATPSA---PSPSSPSSPSTPATPSPPSDTPSPPSSGGGGRSPPSSGG 115

Query: 403 PPSDP 417
             S P
Sbjct: 116 GRSTP 120

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 42/102 (41%), Positives = 50/102 (49%), Gaps = 3/102 (2%)
 Frame = +1

Query: 127 SYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDS---PPSDPTPTTPSTPTTPSGGYYNS 297
           S  PT +P         TPS PP++   PP       PP+ PTP TP TP TPS     +
Sbjct: 2   SSSPTAAPAP------TTPSAPPANATNPPPATPSAPPPAAPTPPTP-TPPTPSPPSPAA 54

Query: 298 PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           PP   SPP+ P P   STP TPS    +SP    S P+ P P
Sbjct: 55  PPP--SPPSVPAPAPSSTPATPSAPSPSSP-SSPSTPATPSP 93

[133][TOP]
>UniRef100_B6SXS9 Receptor protein kinase PERK1 n=1 Tax=Zea mays RepID=B6SXS9_MAIZE
          Length = 689

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 51/129 (39%), Positives = 70/129 (54%), Gaps = 6/129 (4%)
 Frame = +1

Query: 43  PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP--TPSTPPSSD--CT 210
           P P++PP   +    P PP+    SPP    P P+PP    S  P  +PS PP +    +
Sbjct: 8   PAPTAPPAPPANATIP-PPATPSASPPTPTPPKPTPPPPAPSAPPPSSPSVPPPATPAVS 66

Query: 211 PPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS-TPTTPSGGYYNSP 387
           PPS  S P+ P+  +PS+P++P+     SPP D+  P   TP+ PS TP+ PS     SP
Sbjct: 67  PPSPSSTPATPSAPSPSSPSSPATPATPSPPSDTPSPPSDTPSPPSDTPSPPSD--TPSP 124

Query: 388 PQDS-SPPS 411
           P D+ SPPS
Sbjct: 125 PSDTPSPPS 133

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 58/142 (40%), Positives = 68/142 (47%), Gaps = 6/142 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P PT P    + N T   P    +  PTP+PP  +   PP    P PS PS      P  
Sbjct: 8   PAPTAPPAPPA-NATIPPPATPSASPPTPTPPKPTP-PPPAPSAPPPSSPSVPPPATPAV 65

Query: 184 STP-PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS-TPT 357
           S P PSS    PS  SP S  +P TP+TP+ PS     SPP D+  P   TP+ PS TP+
Sbjct: 66  SPPSPSSTPATPSAPSPSSPSSPATPATPSPPSD--TPSPPSDTPSPPSDTPSPPSDTPS 123

Query: 358 TPSGGYYNSPPQDS----SPPS 411
            PS     SPP  S    SPPS
Sbjct: 124 PPSD--TPSPPSSSGGGRSPPS 143

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 63/151 (41%), Positives = 70/151 (46%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           PTPTPP       PTP  PP      P PS P  S  S P    P  SPPS   S   TP
Sbjct: 33  PTPTPPK------PTP--PP------PAPSAPPPSSPSVPPPATPAVSPPS-PSSTPATP 77

Query: 184 STP-PSSDCTP--PSQDSPPSD---PTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPTPTT 342
           S P PSS  +P  P+  SPPSD   P   TPS P+ TP      SPP D+  P   TP+ 
Sbjct: 78  SAPSPSSPSSPATPATPSPPSDTPSPPSDTPSPPSDTP------SPPSDTPSPPSDTPSP 131

Query: 343 PSTP----TTPSGGYYNSPPQDSSPPSDPLP 423
           PS+     + PS G   S P   SPP    P
Sbjct: 132 PSSSGGGRSPPSSGGERSTPSSHSPPKSHSP 162

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 52/142 (36%), Positives = 64/142 (45%), Gaps = 10/142 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGG------SYDPTPSPPSDSGGSPPGS--YDPTPSPPSG 159
           PTP PP+       +PS PP         S   TP+ PS    S P S     TPSPPS 
Sbjct: 40  PTPPPPAPSAPPPSSPSVPPPATPAVSPPSPSSTPATPSAPSPSSPSSPATPATPSPPSD 99

Query: 160 DGSYNPTPSTPPSSDCTPPSQ-DSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
             S      +PPS   +PPS   SPPSD    TPS P++  GG   SPP      + P+ 
Sbjct: 100 TPSPPSDTPSPPSDTPSPPSDTPSPPSD----TPSPPSSSGGG--RSPPSSGGERSTPSS 153

Query: 337 TTPSTPTTPSG-GYYNSPPQDS 399
            +P    +P G G  +S P  S
Sbjct: 154 HSPPKSHSPGGEGGGSSGPSTS 175

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 45/126 (35%), Positives = 59/126 (46%), Gaps = 5/126 (3%)
 Frame = +1

Query: 52  SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSP 231
           SSP    +    P+PP+++   PP +  P+ SPP+      PTP  P     TPP     
Sbjct: 2   SSPTAAPAPTAPPAPPANATIPPPAT--PSASPPT------PTPPKP-----TPPPP--A 46

Query: 232 PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSP-----PQD 396
           PS P P++PS P          PP  ++P   P P+  STP TPS    +SP     P  
Sbjct: 47  PSAPPPSSPSVP----------PP--ATPAVSP-PSPSSTPATPSAPSPSSPSSPATPAT 93

Query: 397 SSPPSD 414
            SPPSD
Sbjct: 94  PSPPSD 99

[134][TOP]
>UniRef100_B3XYC5 Chitin-binding lectin n=1 Tax=Solanum lycopersicum var. cerasiforme
           RepID=B3XYC5_SOLLC
          Length = 365

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 54/129 (41%), Positives = 58/129 (44%)
 Frame = +1

Query: 40  NPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPS 219
           +P P SPP      P PSPP  S   PP    PTPSPP       P PS PP S   PPS
Sbjct: 97  SPPPPSPPPPSPSPPPPSPPPPSPSPPP----PTPSPPP------PAPSPPPPSP-PPPS 145

Query: 220 QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDS 399
              PP  P P +PS P          PP  S PP  P+P  P TP+ P       PP  S
Sbjct: 146 PSPPPPSPPPPSPSPP----------PPTPSPPPPSPSP-PPPTPSPP-------PPAPS 187

Query: 400 SPPSDPLPR 426
            PP  P PR
Sbjct: 188 PPP--PYPR 194

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 46/123 (37%), Positives = 54/123 (43%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P+PP    S  P    PP      PTPSPP  +   PP    P+P PPS     +P P
Sbjct: 99  PPPSPPPPSPSPPPPSPPPPSPSPPPPTPSPPPPAPSPPP----PSPPPPSP----SPPP 150

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
            +PP     PPS   PP  P+P  PS P+ P       PP  S PP  P+P  P      
Sbjct: 151 PSPP-----PPSPSPPPPTPSPPPPS-PSPP-------PPTPSPPPPAPSPPPPYPRCGM 197

Query: 364 SGG 372
            GG
Sbjct: 198 GGG 200

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 46/113 (40%), Positives = 51/113 (45%)
 Frame = +1

Query: 85  TPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPST 264
           TPSPP      PP    P+PSPP       P    PPS    PP+   PP  P+P  PS 
Sbjct: 95  TPSPP------PPSPPPPSPSPP-------PPSPPPPSPSPPPPTPSPPPPAPSPPPPS- 140

Query: 265 PTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
           P  PS     SPP  S PP  P+P  P TP+ P       PP  S PP  P P
Sbjct: 141 PPPPS----PSPPPPSPPPPSPSP-PPPTPSPPPPSPSPPPPTPSPPPPAPSP 188

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 50/142 (35%), Positives = 55/142 (38%), Gaps = 22/142 (15%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      PTPS PP   S  P   PP      PP    P+PSPP       PTP
Sbjct: 113 PSPPPPSPSPP-PPTPSPPPPAPSPPPPSPPPPSPSPPPPSPPPPSPSPPP------PTP 165

Query: 184 STPPSSDCTPPSQDSPPS---DPTPTTPSTPTTPSGGYYNS-----------------PP 303
           S PP S   PP   SPP     P P  P       GG   S                  P
Sbjct: 166 SPPPPSPSPPPPTPSPPPPAPSPPPPYPRCGMGGGGGKCKSNECCSIWSWCGTTESYCAP 225

Query: 304 QD--SSPPTDPTPTTPSTPTTP 363
           Q+  S  P  P+P+ P TP  P
Sbjct: 226 QNCQSQCPHTPSPSPPPTPPPP 247

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 48/141 (34%), Positives = 55/141 (39%), Gaps = 17/141 (12%)
 Frame = +1

Query: 52  SSPPGGGSYDPTPSPPSDSGGSPP--------------GSYDPTPSPPSGDGSYNPTPST 189
           SSPP      P P P    GG                 G+ +   +P +       TPS 
Sbjct: 39  SSPPPHEPSPPPPYPRCGMGGGDGKCKSNECCSIWSWCGTTESFCAPQNCQSQCPHTPSP 98

Query: 190 PPSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDPTPTTPS--TPTT 360
           PP S   PPS   PP  P P +PS  P TPS      PP  S PP  P P +PS   P+ 
Sbjct: 99  PPPSP-PPPSPSPPPPSPPPPSPSPPPPTPS----PPPPAPSPPPPSPPPPSPSPPPPSP 153

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
           P       PP  S PP  P P
Sbjct: 154 PPPSPSPPPPTPSPPPPSPSP 174

[135][TOP]
>UniRef100_A5BBR0 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BBR0_VITVI
          Length = 447

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 53/139 (38%), Positives = 70/139 (50%), Gaps = 2/139 (1%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS-PPGSYDPTPSPPSGDGSYNPTPSTP 192
           PP G     P PS PPG    +P+PSPP  +  + PPGS  P   PP   G+  P P+ P
Sbjct: 165 PPLGSPDA-PPPSGPPGS---EPSPSPPGSAPPTDPPGSAVP---PPGSTGA--PPPTGP 215

Query: 193 PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGG 372
           P S+ +P    SPP    PT P     P  G + +PP    P ++P P++P   + P  G
Sbjct: 216 PGSEPSP----SPPGSAPPTDPPGSAAPPPGSHGAPPPTGPPGSEPPPSSPG--SAPPPG 269

Query: 373 YYNSPPQ-DSSPPSDPLPR 426
              SPP+   +P S PLPR
Sbjct: 270 LPPSPPRTPGAPSSGPLPR 288

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 54/148 (36%), Positives = 66/148 (44%), Gaps = 8/148 (5%)
 Frame = +1

Query: 1   DPTPTPPSGDGSYNPTPSS--PPGG-GSYDPTPSPPSDSGGSPPGSYDPTPSPPSG---D 162
           +P+P+PP      +P  S+  PPG  G+  PT  P S+   SPPGS  PT  P S     
Sbjct: 182 EPSPSPPGSAPPTDPPGSAVPPPGSTGAPPPTGPPGSEPSPSPPGSAPPTDPPGSAAPPP 241

Query: 163 GSYN-PTPSTPPSSDCTPPSQDS-PPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           GS+  P P+ PP S+  P S  S PP    P+ P TP  PS G     P   SPP     
Sbjct: 242 GSHGAPPPTGPPGSEPPPSSPGSAPPPGLPPSPPRTPGAPSSG-----PLPRSPPRRSAA 296

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDPL 420
           T  S    P G     P +   P   PL
Sbjct: 297 TPASLLLRPHGRPLRFPLRRGRPGPSPL 324

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 35/101 (34%), Positives = 47/101 (46%), Gaps = 8/101 (7%)
 Frame = +1

Query: 145 SPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT 324
           +PP G     P PS PP S+ +P    SPP    PT P     P  G   +PP    P +
Sbjct: 164 APPLGSPDA-PPPSGPPGSEPSP----SPPGSAPPTDPPGSAVPPPGSTGAPPPTGPPGS 218

Query: 325 DPTPTTPST--PTTPSG------GYYNSPPQDSSPPSDPLP 423
           +P+P+ P +  PT P G      G + +PP    P S+P P
Sbjct: 219 EPSPSPPGSAPPTDPPGSAAPPPGSHGAPPPTGPPGSEPPP 259

[136][TOP]
>UniRef100_P04929 Histidine-rich glycoprotein n=1 Tax=Plasmodium lophurae
           RepID=HRPX_PLALO
          Length = 351

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 40/131 (30%), Positives = 46/131 (35%)
 Frame = +2

Query: 14  HHPQVMEVIIQPHQVHRVVEVMIQPHHRHQIAVEVLQEVMTQHHHHPQVMEVIIQLHQHP 193
           HHP+      + H+ H        PH  H             HHHHP      +  H H 
Sbjct: 80  HHPE------EHHEPHHEEHHHHHPHPHHH------------HHHHPPHHHHHLGHHHHH 121

Query: 194 HLATVHRHHKTHHHQTLPQQHPQPRQHHREVTTTHHHKTLHHQQTLPQQHPQPRQHHQEV 373
           H A  H HH+ HHH      H    +HH      HHH   HH       H  P  HH   
Sbjct: 122 HHAAHHHHHEEHHHHHHAAHHHHHEEHHHHHHAAHHHPWFHHHHLGYHHHHAPHHHHHHH 181

Query: 374 TTTHHHKTRHH 406
              HHH   HH
Sbjct: 182 HAPHHHHHHHH 192

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 42/132 (31%), Positives = 46/132 (34%)
 Frame = +2

Query: 14  HHPQVMEVIIQPHQVHRVVEVMIQPHHRHQIAVEVLQEVMTQHHHHPQVMEVIIQLHQHP 193
           HHP        PH  H        PHH H +           HHHH +        H H 
Sbjct: 96  HHPH-------PHHHHH----HHPPHHHHHLGHHHHHHHAAHHHHHEE--------HHHH 136

Query: 194 HLATVHRHHKTHHHQTLPQQHPQPRQHHREVTTTHHHKTLHHQQTLPQQHPQPRQHHQEV 373
           H A  H HH+ HHH      H  P  HH  +   HHH   HH       H     HH   
Sbjct: 137 HHAAHHHHHEEHHHHHHAAHH-HPWFHHHHLGYHHHHAPHHHHHHHHAPHHHHHHHHAPH 195

Query: 374 TTTHHHKTRHHH 409
              HHH   HHH
Sbjct: 196 HHHHHHHAPHHH 207

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 39/133 (29%), Positives = 48/133 (36%), Gaps = 1/133 (0%)
 Frame = +2

Query: 26  VMEVIIQPHQVHRVVEVMIQPHHRHQIAVEVLQEVMTQHHHHPQVM-EVIIQLHQHPHLA 202
           ++E  + P  +H       + HH H             HHHHP+   E   + H H H  
Sbjct: 47  LVEDTVHPEHLH-------EEHHHHHPEEHHEPHHEEHHHHHPEEHHEPHHEEHHHHH-- 97

Query: 203 TVHRHHKTHHHQTLPQQHPQPRQHHREVTTTHHHKTLHHQQTLPQQHPQPRQHHQEVTTT 382
             H HH  HHH      H     HH      HHH+  HH       H    +HH      
Sbjct: 98  -PHPHHHHHHHPPHHHHHLGHHHHHHHAAHHHHHEEHHHHHHAAHHH-HHEEHHHHHHAA 155

Query: 383 HHHKTRHHHQTLY 421
           HHH   HHH   Y
Sbjct: 156 HHHPWFHHHHLGY 168

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 44/146 (30%), Positives = 47/146 (32%), Gaps = 12/146 (8%)
 Frame = +2

Query: 8   PRHHPQVMEVIIQPHQVHRVVEVMIQPHHRHQIAVEVLQEVMTQHHH----HPQVMEVII 175
           P HH  +       H  H       + HH H  A     E    HHH    HP      +
Sbjct: 109 PHHHHHLGHHHHHHHAAHHHHHE--EHHHHHHAAHHHHHEEHHHHHHAAHHHPWFHHHHL 166

Query: 176 QLHQH--PHLATVHRH--HKTHHHQTLPQQHPQ----PRQHHREVTTTHHHKTLHHQQTL 331
             H H  PH    H H  H  HHH   P  H      P  HH      HHH   HH    
Sbjct: 167 GYHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHGHHH 226

Query: 332 PQQHPQPRQHHQEVTTTHHHKTRHHH 409
              H     HH      HHH   HHH
Sbjct: 227 HHHHHHGHHHHHHHHHGHHHHHHHHH 252

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 39/134 (29%), Positives = 39/134 (29%)
 Frame = +2

Query: 8   PRHHPQVMEVIIQPHQVHRVVEVMIQPHHRHQIAVEVLQEVMTQHHHHPQVMEVIIQLHQ 187
           P HH          H  H        PHH H             HHHH          H 
Sbjct: 184 PHHHHHHHHAPHHHHHHHHA------PHHHHH------HHHAPHHHHHHHHGHHHHHHHH 231

Query: 188 HPHLATVHRHHKTHHHQTLPQQHPQPRQHHREVTTTHHHKTLHHQQTLPQQHPQPRQHHQ 367
           H H    H HH  HHH      H     HH      HHH   HH       H     HH 
Sbjct: 232 HGHHHHHHHHHGHHHHH---HHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHH 288

Query: 368 EVTTTHHHKTRHHH 409
                HHH   HHH
Sbjct: 289 H----HHHDAHHHH 298

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 39/134 (29%), Positives = 39/134 (29%)
 Frame = +2

Query: 8   PRHHPQVMEVIIQPHQVHRVVEVMIQPHHRHQIAVEVLQEVMTQHHHHPQVMEVIIQLHQ 187
           P HH          H  H        PHH H             HHHH          H 
Sbjct: 194 PHHHHHHHHAPHHHHHHHHA------PHHHHH------HHHGHHHHHHHHHGHHHHHHHH 241

Query: 188 HPHLATVHRHHKTHHHQTLPQQHPQPRQHHREVTTTHHHKTLHHQQTLPQQHPQPRQHHQ 367
           H H    H HH  HHH      H     HH      HHH   HH       H     HH 
Sbjct: 242 HGHHHHHHHHHDAHHHH---HHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHH 298

Query: 368 EVTTTHHHKTRHHH 409
                HHH   HHH
Sbjct: 299 H----HHHDAHHHH 308

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 33/107 (30%), Positives = 34/107 (31%)
 Frame = +2

Query: 89  HHRHQIAVEVLQEVMTQHHHHPQVMEVIIQLHQHPHLATVHRHHKTHHHQTLPQQHPQPR 268
           HH H  A          HHHH    +     H H H    H HH  HH       H    
Sbjct: 248 HHHHHDAHHHHHHHHDAHHHHHHHHDAH---HHHHHHHDAHHHHHHHHDAHHHHHHHHDA 304

Query: 269 QHHREVTTTHHHKTLHHQQTLPQQHPQPRQHHQEVTTTHHHKTRHHH 409
            HH      HHH   HH       H     HH      HHH   HHH
Sbjct: 305 HHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHH----HHHDAHHHH 347

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 39/132 (29%), Positives = 40/132 (30%)
 Frame = +2

Query: 14  HHPQVMEVIIQPHQVHRVVEVMIQPHHRHQIAVEVLQEVMTQHHHHPQVMEVIIQLHQHP 193
           HHP      +  H  H        PHH H             HHHH          H H 
Sbjct: 157 HHPWFHHHHLGYHHHHA-------PHHHHH------HHHAPHHHHH----------HHHA 193

Query: 194 HLATVHRHHKTHHHQTLPQQHPQPRQHHREVTTTHHHKTLHHQQTLPQQHPQPRQHHQEV 373
                H HH  HHH      H  P  HH      HHH   HH       H     HH   
Sbjct: 194 PHHHHHHHHAPHHHH---HHHHAPHHHHHHHHGHHHHHHHHHGHHHHHHHHHGHHHHH-- 248

Query: 374 TTTHHHKTRHHH 409
              HHH   HHH
Sbjct: 249 ---HHHHDAHHH 257

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 39/135 (28%), Positives = 39/135 (28%), Gaps = 2/135 (1%)
 Frame = +2

Query: 8   PRHHPQVMEVIIQPHQVHRVVEVMIQPHHRHQIAVEVLQEVMTQHHHHPQVMEVIIQLHQ 187
           P HH         PH  H         HH H             HHHH          H 
Sbjct: 204 PHHHHHHHHA---PHHHHHHHHGHHHHHHHHH-----------GHHHHHHHHHGHHHHHH 249

Query: 188 HPHLATVHRHHK--THHHQTLPQQHPQPRQHHREVTTTHHHKTLHHQQTLPQQHPQPRQH 361
           H H A  H HH    HHH      H     HH      HHH   HH       H     H
Sbjct: 250 HHHDAHHHHHHHHDAHHHH---HHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHH 306

Query: 362 HQEVTTTHHHKTRHH 406
           H      HHH   HH
Sbjct: 307 HHHHHDAHHHHHHHH 321

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 31/106 (29%), Positives = 31/106 (29%)
 Frame = +2

Query: 89  HHRHQIAVEVLQEVMTQHHHHPQVMEVIIQLHQHPHLATVHRHHKTHHHQTLPQQHPQPR 268
           HH H  A          HHHH          H H      H HH  HHH      H    
Sbjct: 258 HHHHHDAHHHHHHHHDAHHHHH---------HHHDAHHHHHHHHDAHHHH---HHHHDAH 305

Query: 269 QHHREVTTTHHHKTLHHQQTLPQQHPQPRQHHQEVTTTHHHKTRHH 406
            HH      HHH   H        H     HH      HHH   HH
Sbjct: 306 HHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHH 351

[137][TOP]
>UniRef100_P14918 Extensin n=1 Tax=Zea mays RepID=EXTN_MAIZE
          Length = 267

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 55/152 (36%), Positives = 72/152 (47%), Gaps = 12/152 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP---PGGGSYDPTPSPPSDSGGSP---PGSYDPTPSPPS--- 156
           P PTPP+    Y P+P  P   P   +Y P+P PP+    +P   P +Y P+P PP+   
Sbjct: 88  PKPTPPT----YTPSPKPPTPKPTPPTYTPSPKPPATKPPTPKPTPPTYTPSPKPPTPKP 143

Query: 157 GDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
              +Y P+P  PP+   TPP+    P  PT  TP  PT P+  Y  SP   +  PT PT 
Sbjct: 144 TPPTYTPSPK-PPTPKPTPPTYTPSPKPPTHPTPK-PTPPT--YTPSPKPPTPKPTPPTY 199

Query: 337 TTPSTPTTPS---GGYYNSPPQDSSPPSDPLP 423
           T    P TP      Y  SP   ++ P  P P
Sbjct: 200 TPSPKPPTPKPTPPTYTPSPKPPATKPPTPKP 231

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 54/155 (34%), Positives = 75/155 (48%), Gaps = 14/155 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP---PGGGSYDPTPSPPSDSGGSP---PGSYDPTPSPPSGDG 165
           P PTPP+    Y P+P  P   P   +Y P+P PP+    +P   P +Y P+P PP+   
Sbjct: 51  PKPTPPT----YTPSPKPPTPKPTPPTYTPSPKPPATKPPTPKPTPPTYTPSPKPPTPKP 106

Query: 166 S---YNPTP----STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT 324
           +   Y P+P    + PP+   TPP+    P  PTP  P+ PT     Y  SP   +  PT
Sbjct: 107 TPPTYTPSPKPPATKPPTPKPTPPTYTPSPKPPTP-KPTPPT-----YTPSPKPPTPKPT 160

Query: 325 DPTPT-TPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
            PT T +P  PT P+     +PP  +  P  P P+
Sbjct: 161 PPTYTPSPKPPTHPTP--KPTPPTYTPSPKPPTPK 193

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 54/152 (35%), Positives = 69/152 (45%), Gaps = 14/152 (9%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP---PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPS------ 156
           P PTPP+    Y P+P  P   P   +Y P+P PP+      P +Y P+P PP+      
Sbjct: 125 PKPTPPT----YTPSPKPPTPKPTPPTYTPSPKPPTPK--PTPPTYTPSPKPPTHPTPKP 178

Query: 157 GDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPT-TPSGGYYNSPPQDSSPPTDPT 333
              +Y P+P  PP+   TPP+    P  PTP  P+ PT TPS      PP    P   PT
Sbjct: 179 TPPTYTPSPK-PPTPKPTPPTYTPSPKPPTP-KPTPPTYTPS----PKPPATKPPTPKPT 232

Query: 334 P----TTPSTPTTPSGGYYNSPPQDSSPPSDP 417
           P     TP  P T    Y  +PP   +P   P
Sbjct: 233 PPTYTPTPKPPATKPPTYTPTPPVSHTPSPPP 264

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 48/133 (36%), Positives = 62/133 (46%), Gaps = 9/133 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSP---PGGGSYDPTPSPPSDSGGSP-PGSYDPTPSPPSGDGS- 168
           P PTPP+    Y P+P  P   P   +Y P+P PP+     P P +Y P+P PP+   + 
Sbjct: 141 PKPTPPT----YTPSPKPPTPKPTPPTYTPSPKPPTHPTPKPTPPTYTPSPKPPTPKPTP 196

Query: 169 --YNPTPSTPPSSDCTPPSQDSPPSDPT--PTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
             Y P+P  PP+   TPP+    P  P   P TP  PT P+      PP    P   PTP
Sbjct: 197 PTYTPSPK-PPTPKPTPPTYTPSPKPPATKPPTPK-PTPPTYTPTPKPPATKPPTYTPTP 254

Query: 337 TTPSTPTTPSGGY 375
               TP+ P   Y
Sbjct: 255 PVSHTPSPPPPYY 267

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 48/142 (33%), Positives = 67/142 (47%), Gaps = 1/142 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P PTPP+    Y P+P  PP      P P+PP+ +    P +  P P+PP+   S  P  
Sbjct: 30  PKPTPPT----YTPSPK-PPASKPPTPKPTPPTYTPSPKPPT--PKPTPPTYTPSPKPPA 82

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS-TPTT 360
           + PP+   TPP+    P  PTP  P+ PT     Y  SP   ++ P  P PT P+ TP+ 
Sbjct: 83  TKPPTPKPTPPTYTPSPKPPTP-KPTPPT-----YTPSPKPPATKPPTPKPTPPTYTPSP 136

Query: 361 PSGGYYNSPPQDSSPPSDPLPR 426
                  +PP  +  P  P P+
Sbjct: 137 KPPTPKPTPPTYTPSPKPPTPK 158

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 49/142 (34%), Positives = 65/142 (45%), Gaps = 4/142 (2%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSP---PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           TPP+    Y P+P  P   P   +Y P+P PP+     PP    P P+PP+    Y P+P
Sbjct: 17  TPPT----YTPSPKPPTPKPTPPTYTPSPKPPASK---PP---TPKPTPPT----YTPSP 62

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPT-TPSTPTT 360
             PP+   TPP+  +P   P  T P TP      Y  SP   +  PT PT T +P  P T
Sbjct: 63  K-PPTPKPTPPTY-TPSPKPPATKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPAT 120

Query: 361 PSGGYYNSPPQDSSPPSDPLPR 426
                  +PP  +  P  P P+
Sbjct: 121 KPPTPKPTPPTYTPSPKPPTPK 142

[138][TOP]
>UniRef100_B5HN88 Putative uncharacterized protein n=1 Tax=Streptomyces sviceus ATCC
           29083 RepID=B5HN88_9ACTO
          Length = 265

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 52/126 (41%), Positives = 57/126 (45%), Gaps = 5/126 (3%)
 Frame = +1

Query: 31  GSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCT 210
           G Y   P    GGG  D TP PP D    PPG +  TP PP GD        TPP  D T
Sbjct: 114 GGYGDNPGHEEGGGYGDHTP-PPDDHHTPPPGGHH-TP-PPGGD-------HTPPPGDHT 163

Query: 211 PP---SQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT--DPTPTTPSTPTTPSGGY 375
           PP       PP D TP      T P GG +  PP D +PP   D TP      T P GG+
Sbjct: 164 PPPGGDHTPPPGDHTPPPGGDHTPPPGGDHTPPPGDHTPPPGGDHTPPPGGEHTPPPGGH 223

Query: 376 YNSPPQ 393
           +  PPQ
Sbjct: 224 HMPPPQ 229

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 49/134 (36%), Positives = 55/134 (41%), Gaps = 4/134 (2%)
 Frame = +1

Query: 19  PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPS 198
           P GD S     S   GGG Y   P      G    G Y   P    G G  + TP  PP 
Sbjct: 85  PHGDDSGYGDDSGQEGGGGYGDNP------GHEEGGGYGDNPGHEEGGGYGDHTP--PPD 136

Query: 199 SDCTPP--SQDSPP--SDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPS 366
              TPP     +PP   D TP  P   T P GG +  PP D +PP    P    TP  P 
Sbjct: 137 DHHTPPPGGHHTPPPGGDHTPP-PGDHTPPPGGDHTPPPGDHTPP----PGGDHTP--PP 189

Query: 367 GGYYNSPPQDSSPP 408
           GG +  PP D +PP
Sbjct: 190 GGDHTPPPGDHTPP 203

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 40/97 (41%), Positives = 46/97 (47%)
 Frame = +1

Query: 16  PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPP 195
           PP GD +  P   +PP GG + P   PP D   +PP   D TP PP GD        TPP
Sbjct: 150 PPGGDHTPPPGDHTPPPGGDHTP---PPGDH--TPPPGGDHTP-PPGGD-------HTPP 196

Query: 196 SSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQ 306
             D TPP    P  D TP      T P GG++  PPQ
Sbjct: 197 PGDHTPP----PGGDHTPPPGGEHTPPPGGHHMPPPQ 229

[139][TOP]
>UniRef100_B8AG26 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8AG26_ORYSI
          Length = 218

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 52/142 (36%), Positives = 66/142 (46%), Gaps = 4/142 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPT--PSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           P PTPPS      PT  P +PP   +  P P+ P  +  +PP +  PT  PPS   +  P
Sbjct: 36  PPPTPPS------PTTPPPAPPAPTTPPPAPTTPPPAPTTPPPA--PTTPPPSPPATPPP 87

Query: 178 TPSTPPSSDCT--PPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
            P+TPP S  +  PP+  +PP  P  T P  P TP       PP   SPP  P P TP  
Sbjct: 88  APTTPPPSPPSQPPPAPATPPPSPPATPPPAPATP-------PP---SPPLAPPPATPPP 137

Query: 352 PTTPSGGYYNSPPQDSSPPSDP 417
           P TP      +P   ++P   P
Sbjct: 138 PATPPPALAPAPTPSTAPTVAP 159

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 47/135 (34%), Positives = 64/135 (47%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           PT +PP+        P++PP   S  P P+PPS +  +PP +     +PP    +  P P
Sbjct: 21  PTQSPPA--------PNAPP---SNTPPPTPPSPT--TPPPAPPAPTTPPPAPTTPPPAP 67

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           +TPP +  TPP        P PTTP  P+ PS      PP  ++PP  P  T P  P TP
Sbjct: 68  TTPPPAPTTPPPSPPATPPPAPTTP-PPSPPS----QPPPAPATPPPSPPATPPPAPATP 122

Query: 364 SGGYYNSPPQDSSPP 408
                 +PP  + PP
Sbjct: 123 PPSPPLAPPPATPPP 137

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 43/114 (37%), Positives = 53/114 (46%), Gaps = 2/114 (1%)
 Frame = +1

Query: 82  PTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCT-PPSQDSPPSDPTPTTP 258
           PT SPP+ +   P  +  PTP  P+      P P+TPP +  T PP+  +PP  PT   P
Sbjct: 21  PTQSPPAPNA-PPSNTPPPTPPSPTTPPPAPPAPTTPPPAPTTPPPAPTTPPPAPTTPPP 79

Query: 259 STPTTPSGGYYNSPPQ-DSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
           S P TP       PP   S PP  P    PS P TP       PP  ++PP  P
Sbjct: 80  SPPATPPPAPTTPPPSPPSQPPPAPATPPPSPPATP-------PPAPATPPPSP 126

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 49/141 (34%), Positives = 61/141 (43%), Gaps = 3/141 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P P +   +    P SPP      PT  PPS     PP    P PSP          P
Sbjct: 63  PPPAPTTPPPAPTTPPPSPPATPPPAPTTPPPSPPSQPPPAPATPPPSP----------P 112

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT--PT-TPSTP 354
           +TPP +  TPP   SPP  P P TP  P TP      +P   ++P   PT  PT +P +P
Sbjct: 113 ATPPPAPATPP--PSPPLAPPPATPPPPATPPPALAPAPTPSTAPTVAPTTAPTVSPISP 170

Query: 355 TTPSGGYYNSPPQDSSPPSDP 417
            TP+     +P    SP + P
Sbjct: 171 KTPA-PTAATPSPSLSPTATP 190

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 52/152 (34%), Positives = 62/152 (40%), Gaps = 29/152 (19%)
 Frame = +1

Query: 4   PTPT-PPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P PT PP    +  P P++PP      PT  PPS     PP    P PSPPS       T
Sbjct: 51  PAPTTPPPAPTTPPPAPTTPPPA----PTTPPPSPPATPPPAPTTPPPSPPSQPPPAPAT 106

Query: 181 P-----STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT---- 333
           P     +TPP +  TPP   SPP  P P TP  P TP      +P   ++P   PT    
Sbjct: 107 PPPSPPATPPPAPATPPP--SPPLAPPPATPPPPATPPPALAPAPTPSTAPTVAPTTAPT 164

Query: 334 -----PTTP--------------STPTTPSGG 372
                P TP              +TPTT + G
Sbjct: 165 VSPISPKTPAPTAATPSPSLSPTATPTTDNSG 196

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 43/114 (37%), Positives = 51/114 (44%), Gaps = 6/114 (5%)
 Frame = +1

Query: 100 SDSGGSPPGSYDPTP-SPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTP 276
           S +   PP    P P +PPS     N  P TPPS    PP   +PP+  TP  P  PTTP
Sbjct: 14  SAAAQQPPTQSPPAPNAPPS-----NTPPPTPPSPTTPPP---APPAPTTP--PPAPTTP 63

Query: 277 SGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPP-----QDSSPPSDPLP 423
                  PP  ++PP  P  T P  PTTP     + PP        SPP+ P P
Sbjct: 64  PPAPTTPPPAPTTPPPSPPATPPPAPTTPPPSPPSQPPPAPATPPPSPPATPPP 117

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 36/110 (32%), Positives = 48/110 (43%), Gaps = 3/110 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSP---PSDSGGSPPGSYDPTPSPPSGDGSYN 174
           PT  PPS      P P++PP      P P+P   P     +PP +  P P+ P    +  
Sbjct: 89  PTTPPPSPPSQPPPAPATPPPSPPATPPPAPATPPPSPPLAPPPATPPPPATPPPALAPA 148

Query: 175 PTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT 324
           PTPST P+   T     SP S  TP   +   +PS     +P  D+S  T
Sbjct: 149 PTPSTAPTVAPTTAPTVSPISPKTPAPTAATPSPSLSPTATPTTDNSGAT 198

[140][TOP]
>UniRef100_Q9VZC2 CG15021 n=1 Tax=Drosophila melanogaster RepID=Q9VZC2_DROME
          Length = 420

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 52/149 (34%), Positives = 59/149 (39%), Gaps = 8/149 (5%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P PTPP+   SY P  + PP      P P P   +   PP SY P  +PP       P P
Sbjct: 82  PQPTPPAPRPSYGPPQTQPPR-----PPPQPTPSAPAPPPPSYGPPQTPPP-----RPPP 131

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
              PS+   PPS   PP  P P  P  PT  +      PPQ    P  P P  PS P+  
Sbjct: 132 QPTPSAPAPPPSY-GPPQTPPPRPPPQPTPSAPAPSYGPPQ----PQPPAPQPPSPPSPQ 186

Query: 364 SGGYYNSP--------PQDSSPPSDPLPR 426
            G  Y  P        P    PP  P PR
Sbjct: 187 PGPEYLPPDQPKPRPTPSRPQPPPPPPPR 215

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 56/144 (38%), Positives = 63/144 (43%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           PTP+ P+   SY P P +PP      PTPS P+ S G PP    P P PPS        P
Sbjct: 133 PTPSAPAPPPSYGP-PQTPPPRPPPQPTPSAPAPSYG-PPQPQPPAPQPPS-------PP 183

Query: 184 STPPSSDCTPPSQDSP---PSDPTPTTPSTPTT-PSGGYYNSPPQDSSPPTDPTPTTPST 351
           S  P  +  PP Q  P   PS P P  P  P   P+ GY   PP    PP  P PT    
Sbjct: 184 SPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPP---PPPPKPQPTPGYG 240

Query: 352 PTTPSGGYYNSPPQDSSPPSDPLP 423
           P TP  G    P Q +  P  P P
Sbjct: 241 PPTPPPG--PGPAQPAPQPPRPQP 262

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 50/145 (34%), Positives = 58/145 (40%), Gaps = 4/145 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P P +   SY P  + PP      P P PP  +  +P  SY P  + P       P P
Sbjct: 57  PGPAPSAPAPSYGPPQTRPP------PPPPPPQPTPPAPRPSYGPPQTQPP-----RPPP 105

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT-- 357
              PS+   PP    PP  P P  P  PT PS     +PP    PP  P P  P  PT  
Sbjct: 106 QPTPSAPAPPPPSYGPPQTPPPRPPPQPT-PSAP---APPPSYGPPQTPPPRPPPQPTPS 161

Query: 358 --TPSGGYYNSPPQDSSPPSDPLPR 426
              PS G     P    PPS P P+
Sbjct: 162 APAPSYGPPQPQPPAPQPPSPPSPQ 186

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 50/151 (33%), Positives = 59/151 (39%), Gaps = 13/151 (8%)
 Frame = +1

Query: 10  PTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS----PPGSYDPTPSPPSGDG---S 168
           PTPP G G   P P  P       P P PP    GS    PPG  + TP+ P        
Sbjct: 242 PTPPPGPGPAQPAPQPPR---PQPPRPQPPRPQPGSEYLPPPGENEVTPTQPQPTAPVPE 298

Query: 169 YNPTPSTPPSSDCTPPSQDSPPSD-PTPT---TPSTPTTPSGG--YYNSPPQDSSPPTDP 330
           Y P P  PP+     P   +PP+  P PT    P  P  P+ G  Y   PP   +PP   
Sbjct: 299 YGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPT 358

Query: 331 TPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
               P  P  P+ G    P     PP+ P P
Sbjct: 359 YQPQPPAPPAPAPG----PTYQPRPPAPPAP 385

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 51/144 (35%), Positives = 56/144 (38%), Gaps = 4/144 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P P  PP      PTPS P     +PP SY P  +PP       P P
Sbjct: 112 PAPPPPSYGPPQTPPPRPPP-----QPTPSAP-----APPPSYGPPQTPP-------PRP 154

Query: 184 STPPSSDCTPPSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP-- 354
              P+     PS   P P  P P  PS P+   G  Y  P Q    PT   P  P  P  
Sbjct: 155 PPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPP 214

Query: 355 -TTPSGGYYNSPPQDSSPPSDPLP 423
              P+ GY   PP    PP  P P
Sbjct: 215 RPQPTPGYGPPPP---PPPPKPQP 235

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 50/147 (34%), Positives = 56/147 (38%), Gaps = 7/147 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGS---PPGSYDPTPSPPSGDGSYN 174
           P PTP +   SY P    PP        PSPPS   G    PP    P P+P        
Sbjct: 156 PQPTPSAPAPSYGPPQPQPPA----PQPPSPPSPQPGPEYLPPDQPKPRPTP----SRPQ 207

Query: 175 PTPSTPPSSDCTP---PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
           P P  PP    TP   P    PP  P PT    P TP  G    P Q +  P  P P  P
Sbjct: 208 PPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPG--PGPAQPAPQPPRPQPPRP 265

Query: 346 STPTTPSGGYYNSPP-QDSSPPSDPLP 423
             P    G  Y  PP ++   P+ P P
Sbjct: 266 QPPRPQPGSEYLPPPGENEVTPTQPQP 292

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 52/152 (34%), Positives = 62/152 (40%), Gaps = 12/152 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P PTP  G     P P   P  G Y P P+PP   G + P    P P PP       P P
Sbjct: 216 PQPTPGYGPPPPPPPPKPQPTPG-YGP-PTPPPGPGPAQPAPQPPRPQPP------RPQP 267

Query: 184 STP-PSSDCTPP--SQDSPPSDPTPTT------PSTPTTPSGGYYN-SPPQDSSPPTDPT 333
             P P S+  PP    +  P+ P PT       P  P  P+G  Y   PP   +P   PT
Sbjct: 268 PRPQPGSEYLPPPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAPAPGPT 327

Query: 334 --PTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             P  P+ P    G  Y   P+  SPP+ P P
Sbjct: 328 YQPRPPAPPAPAPGPTYQ--PRPPSPPAPPAP 357

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 40/123 (32%), Positives = 52/123 (42%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P PT P  +  Y P P +PP G +Y   P PP+    +P  +Y P P  P       P P
Sbjct: 290 PQPTAPVPE--YGPPPPAPPAGPTYQ--PRPPAPPAPAPGPTYQPRPPAP-------PAP 338

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           +  P+    PPS  +PP+      P  P  P+ G    P     PP  P PT    P  P
Sbjct: 339 APGPTYQPRPPSPPAPPAPTYQPQPPAPPAPAPG----PTYQPRPPAPPAPTPEYGPPPP 394

Query: 364 SGG 372
           + G
Sbjct: 395 TSG 397

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 53/163 (32%), Positives = 62/163 (38%), Gaps = 23/163 (14%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSP---PSDSGGSPPGSYDPTPSPPSGDGSYN 174
           P P PP+      P+P SP  G  Y P   P   P+ S   PP    P P P  G G   
Sbjct: 170 PQPQPPAPQP---PSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGP-- 224

Query: 175 PTPSTPPSSDCTP------------PSQDSP-PSDPTPTTPSTPTTPSGGYYNSPPQDSS 315
           P P  PP    TP            P+Q +P P  P P  P  P    G  Y  PP ++ 
Sbjct: 225 PPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENE 284

Query: 316 -PPTDPTPTT------PSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             PT P PT       P  P  P+G     P     PP+ P P
Sbjct: 285 VTPTQPQPTAPVPEYGPPPPAPPAG-----PTYQPRPPAPPAP 322

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 50/147 (34%), Positives = 56/147 (38%), Gaps = 9/147 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           PTP+ P       P P   PG   Y P P PP       PG   PTP P  G     P P
Sbjct: 201 PTPSRPQPPPPPPPRPQPTPG---YGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQP 257

Query: 184 STPPSSDCTPP-----SQDSPP---SDPTPTTPSTPTTPSGGYYNSPPQDSSPPT-DPTP 336
             P      PP     S+  PP   ++ TPT P  PT P   Y   PP   + PT  P P
Sbjct: 258 PRPQPPRPQPPRPQPGSEYLPPPGENEVTPTQPQ-PTAPVPEYGPPPPAPPAGPTYQPRP 316

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPSDP 417
             P  P  P   Y   PP   +P   P
Sbjct: 317 PAPPAPA-PGPTYQPRPPAPPAPAPGP 342

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 43/113 (38%), Positives = 47/113 (41%), Gaps = 1/113 (0%)
 Frame = +1

Query: 88  PSPPSDSG-GSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPST 264
           P PP  SG G       P P+P +   SY P  + PP     PP    PP  PTP  P  
Sbjct: 40  PFPPPGSGNGIEDSGIGPGPAPSAPAPSYGPPQTRPPP----PP----PPPQPTPPAPR- 90

Query: 265 PTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
              PS G    PPQ + PP  P   TPS P  P   Y   PPQ   P   P P
Sbjct: 91  ---PSYG----PPQ-TQPPRPPPQPTPSAPAPPPPSY--GPPQTPPPRPPPQP 133

[141][TOP]
>UniRef100_B8NQ90 Nuclear pore glycoprotein p62, putative n=1 Tax=Aspergillus flavus
           NRRL3357 RepID=B8NQ90_ASPFN
          Length = 511

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 64/191 (33%), Positives = 81/191 (42%), Gaps = 51/191 (26%)
 Frame = +1

Query: 4   PTPTPPS-----GDGSYNPTPSSPPGGGSYDPTPSPPSD----SGGSPPGSYDPTPSPPS 156
           P+ TPP+     G+ +   T  SPP G +   + +PP+     SGG+PP    P+ +PP+
Sbjct: 224 PSGTPPTSGTETGEETGTETGGSPPSGSTPPTSGTPPTSGTPPSGGTPPTGSTPSGTPPT 283

Query: 157 GDGSYNPTPS-TPPSSDC------------------TPPSQDSPPSDPTPTTPSTPT--- 270
           GD     TPS TPP+S                    TPP+  +PPS  +P T  T T   
Sbjct: 284 GDVPTGDTPSGTPPTSGTETGEETGTETGGSPPSGSTPPTSGTPPSGGSPPTSGTETGEE 343

Query: 271 --TPSGGYYNSPPQDSSPPTDPTPTTPSTPT----TPSGGYYN--------------SPP 390
             T +GG   SPP   SPPT  TP T   PT     PS G                 SPP
Sbjct: 344 TGTETGG---SPPSGGSPPTSGTPPTGDVPTGSGTPPSSGTETGITTGEETGTSTGGSPP 400

Query: 391 QDSSPPSDPLP 423
               PPS   P
Sbjct: 401 TGGMPPSGGSP 411

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 65/171 (38%), Positives = 72/171 (42%), Gaps = 42/171 (24%)
 Frame = +1

Query: 31  GSYNPTPSSPPGG----GSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPS 198
           GS   + S PPGG    G   P    P  SGG+PPG   P+   P   G   PT  TPPS
Sbjct: 118 GSSTDSGSMPPGGMPPIGGMPPIGGMPP-SGGTPPGGMPPSGGTPP-TGGMPPTGGTPPS 175

Query: 199 S------DC---------TPPSQDSPPSDPTPTTPSTP--------TTPSG--------- 282
           S      DC         TPPS  +PPS  TP T  TP         TPSG         
Sbjct: 176 SGTDTCEDCEGGTPPSGGTPPSGGTPPSGGTPPTSGTPPTGDVPTGDTPSGTPPTSGTET 235

Query: 283 ------GYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDP 417
                     SPP  S+PPT  TP T  TP  PSGG   +PP  S+P   P
Sbjct: 236 GEETGTETGGSPPSGSTPPTSGTPPTSGTP--PSGG---TPPTGSTPSGTP 281

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 56/163 (34%), Positives = 72/163 (44%), Gaps = 26/163 (15%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP-GSYDPTPSPPSGDGSYNPTPST 189
           TPP+GD     TPS  P     +      +++GGSPP GS  PT   P   G+  P+  T
Sbjct: 212 TPPTGDVPTGDTPSGTPPTSGTETGEETGTETGGSPPSGSTPPTSGTPPTSGT-PPSGGT 270

Query: 190 PPSSDC---TPPSQDSPPSDPTPTTPSTPTTPSGGYY-----NSPPQDSSPPTDPTPTTP 345
           PP+      TPP+ D P  D    TP T  T +G         SPP  S+PPT  TP + 
Sbjct: 271 PPTGSTPSGTPPTGDVPTGDTPSGTPPTSGTETGEETGTETGGSPPSGSTPPTSGTPPSG 330

Query: 346 STPTT-----------------PSGGYYNSPPQDSSPPSDPLP 423
            +P T                 PSGG   SPP   +PP+  +P
Sbjct: 331 GSPPTSGTETGEETGTETGGSPPSGG---SPPTSGTPPTGDVP 370

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 62/177 (35%), Positives = 77/177 (43%), Gaps = 37/177 (20%)
 Frame = +1

Query: 4   PTPTPPSGD----GSYNPTPSSPPGGGSYDPTP----SPPSD----SGGSPPGSYDPTPS 147
           P   PPSG     G   PT  +PP  G+         +PPS     SGG+PP    P  S
Sbjct: 151 PGGMPPSGGTPPTGGMPPTGGTPPSSGTDTCEDCEGGTPPSGGTPPSGGTPPSGGTPPTS 210

Query: 148 --PPSGDGSYNPTPS-TPPSSDC------------TPPSQDSPPSDPTPTTPSTP----T 270
             PP+GD     TPS TPP+S              +PPS  +PP+  TP T  TP    T
Sbjct: 211 GTPPTGDVPTGDTPSGTPPTSGTETGEETGTETGGSPPSGSTPPTSGTPPTSGTPPSGGT 270

Query: 271 TPSGGYYNSPPQDSSPPTDPTPT-TPSTPTTPSGGYY-----NSPPQDSSPPSDPLP 423
            P+G   +  P     PT  TP+ TP T  T +G         SPP  S+PP+   P
Sbjct: 271 PPTGSTPSGTPPTGDVPTGDTPSGTPPTSGTETGEETGTETGGSPPSGSTPPTSGTP 327

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 52/151 (34%), Positives = 63/151 (41%), Gaps = 11/151 (7%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP-GSYDPTPSPPSGDGSYNPT 180
           P+ TPP+GD     TPS  P     +      +++GGSPP GS  PT   P   GS  PT
Sbjct: 277 PSGTPPTGDVPTGDTPSGTPPTSGTETGEETGTETGGSPPSGSTPPTSGTPPSGGS-PPT 335

Query: 181 PSTPPSSDC------TPPSQDSPPSDPTPTTPSTP----TTPSGGYYNSPPQDSSPPTDP 330
             T    +       +PPS  SPP+  TP T   P    T PS G            T  
Sbjct: 336 SGTETGEETGTETGGSPPSGGSPPTSGTPPTGDVPTGSGTPPSSGTETGITTGEETGTST 395

Query: 331 TPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             + P+    PSGG   SPP    PPS   P
Sbjct: 396 GGSPPTGGMPPSGG---SPPTGGMPPSGGTP 423

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 55/168 (32%), Positives = 67/168 (39%), Gaps = 32/168 (19%)
 Frame = +1

Query: 4   PTPTPPS-----GDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTP-------- 144
           P+ TPP+     G+ +   T  SPP G +   + +PPS  GGSPP S   T         
Sbjct: 292 PSGTPPTSGTETGEETGTETGGSPPSGSTPPTSGTPPS--GGSPPTSGTETGEETGTETG 349

Query: 145 -SPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPT-----------TPSTPTT----P 276
            SPPSG     PT  TPP+ D  P    +PPS  T T           T  +P T    P
Sbjct: 350 GSPPSGGSP--PTSGTPPTGD-VPTGSGTPPSSGTETGITTGEETGTSTGGSPPTGGMPP 406

Query: 277 SGGYYNS---PPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           SGG   +   PP   +PP   T          SG    S    SS  S
Sbjct: 407 SGGSPPTGGMPPSGGTPPNSGTECEACQGGNNSGNSSGSSSSSSSSSS 454

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 49/168 (29%), Positives = 65/168 (38%), Gaps = 35/168 (20%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYDPTPSPPS------DSGGSPPGSYDPTPS--PPSGD-- 162
           +PPSG  S  PT  +PP GGS  PT    +      ++GGSPP    P  S  PP+GD  
Sbjct: 314 SPPSG--STPPTSGTPPSGGS-PPTSGTETGEETGTETGGSPPSGGSPPTSGTPPTGDVP 370

Query: 163 -------------------------GSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTP 267
                                    G   PT   PPS   +PP+   PPS  TP    T 
Sbjct: 371 TGSGTPPSSGTETGITTGEETGTSTGGSPPTGGMPPSGG-SPPTGGMPPSGGTPPNSGTE 429

Query: 268 TTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
                G  NS     S  +  + ++ S+ ++ S    +S    SS  S
Sbjct: 430 CEACQGGNNSGNSSGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 477

[142][TOP]
>UniRef100_B6QUR5 Putative uncharacterized protein n=1 Tax=Penicillium marneffei ATCC
           18224 RepID=B6QUR5_PENMQ
          Length = 803

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 56/152 (36%), Positives = 75/152 (49%), Gaps = 15/152 (9%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSP-PSDSGGSPPGSYDPTPSP---------PS 156
           TPTP     S +P+PSSP    +  PTPSP PS S  S   +  PTPSP         PS
Sbjct: 252 TPTP-----SPHPSPSSPSTAYTTTPTPSPRPSPSSPSTASTTTPTPSPRPSPSSPSSPS 306

Query: 157 GDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
              +  PTPS  PS         +P + PTP+   +P++PS     S    ++P   P+P
Sbjct: 307 TASTTTPTPSPRPSPSSPSSPSTAPTTIPTPSPRPSPSSPSTA---STVSTTTPSPRPSP 363

Query: 337 TTPSTP-----TTPSGGYYNSPPQDSSPPSDP 417
           ++PSTP     TTP+   + SP   SSP + P
Sbjct: 364 SSPSTPSTASTTTPTPSPHPSPSSPSSPSTAP 395

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 64/160 (40%), Positives = 77/160 (48%), Gaps = 27/160 (16%)
 Frame = +1

Query: 7   TPTPPSGDGSYNPTPSSPPGGGSYDPTPSP-PSDSGGSPPGSYD---PTPSP-------- 150
           TPTP     S  P+PSSP    +  PTPSP PS S  S P +     PTPSP        
Sbjct: 271 TPTP-----SPRPSPSSPSTASTTTPTPSPRPSPSSPSSPSTASTTTPTPSPRPSPSSPS 325

Query: 151 -PSGDGSYNPTPSTPPS----------SDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNS 297
            PS   +  PTPS  PS          S  TP  + SP S  TP+T ST TTP+   + S
Sbjct: 326 SPSTAPTTIPTPSPRPSPSSPSTASTVSTTTPSPRPSPSSPSTPSTAST-TTPTPSPHPS 384

Query: 298 PPQDSSPPTDPTP-TTPS---TPTTPSGGYYNSPPQDSSP 405
           P   SSP T PT  +TPS   +P++PS     +P    SP
Sbjct: 385 PSSPSSPSTAPTTISTPSPHPSPSSPSTASTTTPTPSLSP 424

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 55/135 (40%), Positives = 68/135 (50%), Gaps = 8/135 (5%)
 Frame = +1

Query: 43  PTPSSPPGGGSYDPTPSP-PSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPS 219
           P+PSSP    +  PTPSP PS S  S   +  PTPSP     S    PST  ++  TP  
Sbjct: 240 PSPSSPSTVSTTTPTPSPHPSPSSPSTAYTTTPTPSPRPSPSS----PSTASTTTPTPSP 295

Query: 220 QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPT--PT-----TPSTPTTPSGGYY 378
           + SP S  +P+T ST TTP+     SP   SSP T PT  PT     +PS+P+T S    
Sbjct: 296 RPSPSSPSSPSTAST-TTPTPSPRPSPSSPSSPSTAPTTIPTPSPRPSPSSPSTASTVST 354

Query: 379 NSPPQDSSPPSDPLP 423
            +P    SP S   P
Sbjct: 355 TTPSPRPSPSSPSTP 369

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 56/153 (36%), Positives = 72/153 (47%), Gaps = 14/153 (9%)
 Frame = +1

Query: 7    TPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSD----SGGSPPGSYDPTPSPPSGDGSYN 174
            TPT  S   +   TP+  P      P+PS PS     S  +P  S  P+PS PS   +  
Sbjct: 582  TPTSASSSTASTTTPTPSPY-----PSPSTPSSLSTVSITTPTSSPHPSPSSPSTASTTT 636

Query: 175  PTPSTPPSSDCTPPSQDSPPSD--------PTPTTPSTPTTPSGGYYNSPPQD--SSPPT 324
            PTPS+PPS     PS  S PS          TP  P +P +PS     S   D  S PP+
Sbjct: 637  PTPSSPPS-----PSFPSSPSSLSTTSTTTNTPFPPPSPPSPSSSSTASITTDTLSPPPS 691

Query: 325  DPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             P+ ++PS+P+T S       P +S PPS P P
Sbjct: 692  PPSSSSPSSPSTVSITTDTLSP-ESPPPSPPSP 723

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 52/151 (34%), Positives = 63/151 (41%), Gaps = 29/151 (19%)
 Frame = +1

Query: 4    PTPTPPSG---------DGSYNPTPSSPPGGGSYDPTPS-PPSDSGGSPPGSYD------ 135
            P+P+ PS            S +P+PSSP    +  PTPS PPS S  S P S        
Sbjct: 602  PSPSTPSSLSTVSITTPTSSPHPSPSSPSTASTTTPTPSSPPSPSFPSSPSSLSTTSTTT 661

Query: 136  ----PTPSPPSGDGS---------YNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTP 276
                P PSPPS   S          +P PS P SS  + PS  S  +D        P+ P
Sbjct: 662  NTPFPPPSPPSPSSSSTASITTDTLSPPPSPPSSSSPSSPSTVSITTDTLSPESPPPSPP 721

Query: 277  SGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
            S  Y +S P  +S  T   P T S P T  G
Sbjct: 722  SPSYLSSLPASTSEDT-LVPATSSAPATSVG 751

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 46/134 (34%), Positives = 69/134 (51%), Gaps = 4/134 (2%)
 Frame = +1

Query: 4   PTPTP---PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSP-PSGDGSY 171
           PTP+P   PS   S +  P++ P   +  P PSP S S  S   +  P+P P PS     
Sbjct: 313 PTPSPRPSPSSPSSPSTAPTTIP---TPSPRPSPSSPSTASTVSTTTPSPRPSPS----- 364

Query: 172 NPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPST 351
             +PSTP ++  T P   +P   P+P++PS+P+T       +P   S+P   P+P++PST
Sbjct: 365 --SPSTPSTASTTTP---TPSPHPSPSSPSSPST-------APTTISTPSPHPSPSSPST 412

Query: 352 PTTPSGGYYNSPPQ 393
            +T +     SP Q
Sbjct: 413 ASTTTPTPSLSPYQ 426

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 47/128 (36%), Positives = 59/128 (46%), Gaps = 17/128 (13%)
 Frame = +1

Query: 85  TPSPPSDSGGSPPGSYD---PTPSPPSGDGSYNPTPSTPPSSD------CTPPSQDSPPS 237
           TP+  S S  S   S     P+PS PS   +  PTPS  PS         T P+    PS
Sbjct: 220 TPTSASSSTASTTTSTTYPPPSPSSPSTVSTTTPTPSPHPSPSSPSTAYTTTPTPSPRPS 279

Query: 238 DPTPTTPSTPTTPSGGYYNSPPQDSSP----PTDPTPT---TPSTPTTPSGGYYNSP-PQ 393
             +P+T ST TTP+     SP   SSP     T PTP+   +PS+P++PS      P P 
Sbjct: 280 PSSPSTAST-TTPTPSPRPSPSSPSSPSTASTTTPTPSPRPSPSSPSSPSTAPTTIPTPS 338

Query: 394 DSSPPSDP 417
               PS P
Sbjct: 339 PRPSPSSP 346

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 48/165 (29%), Positives = 62/165 (37%), Gaps = 31/165 (18%)
 Frame = +1

Query: 4    PTPTPPSGDGSYNPTPSSPPGGGSYD----------------PTPSPPSDSGGSPPG--- 126
            P+P+ PS   +  PTPSSPP                      P PSPPS S  S      
Sbjct: 624  PSPSSPSTASTTTPTPSSPPSPSFPSSPSSLSTTSTTTNTPFPPPSPPSPSSSSTASITT 683

Query: 127  -SYDPTPSPPSGDGSYNPT----------PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTT 273
             +  P PSPPS     +P+          P +PP S   PPS     S P  T+  T   
Sbjct: 684  DTLSPPPSPPSSSSPSSPSTVSITTDTLSPESPPPS---PPSPSYLSSLPASTSEDTLV- 739

Query: 274  PSGGYYNSPPQDSSPPTDPTPTTPST-PTTPSGGYYNSPPQDSSP 405
                    P   S+P T   P +    PT+ +GG  +S    + P
Sbjct: 740  --------PATSSAPATSVGPDSSMVWPTSTAGGAMDSSTSPTVP 776

[143][TOP]
>UniRef100_C5Z998 Putative uncharacterized protein Sb10g029260 n=1 Tax=Sorghum
           bicolor RepID=C5Z998_SORBI
          Length = 720

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 64/177 (36%), Positives = 78/177 (44%), Gaps = 40/177 (22%)
 Frame = +1

Query: 7   TPTPPSGDGSYN-PTPSSPPGGGSYDPTPSPPSDS----------------GGSPPGS-Y 132
           TP+ PS  GS   P+  SPPGG +    PSPP+D                 GGSPP S Y
Sbjct: 408 TPSHPSPPGSSTTPSHPSPPGGATTPSYPSPPTDGSSPKPSMPPSSGPSSHGGSPPSSGY 467

Query: 133 DPTPS----PPSGDGSYNPTPST------PPSSDCTP--PSQDSPPSDP-TPTTPSTPTT 273
            P P      PSG     P P+       PP +   P  P    PP  P TP+TP+TP T
Sbjct: 468 QPPPPSSGWAPSGQPVGVPPPAEHPGGVWPPHTPTAPGTPGSAYPPGTPGTPSTPTTPGT 527

Query: 274 PSGGY---YNSPPQDSSPPTDP-----TPTTPSTPTTPSGGY-YNSPPQDSSPPSDP 417
           P   +       P  + PPT P     +P+TP+TP TP   Y   +P    S PS P
Sbjct: 528 PGSAFPPTTPGAPGSTYPPTTPGAPGSSPSTPTTPGTPGSTYPPTTPGAPGSSPSTP 584

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 56/138 (40%), Positives = 66/138 (47%), Gaps = 1/138 (0%)
 Frame = +1

Query: 7   TPTPPSGDGSYN-PTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           TP+ PS  GS   P+  SPPG  +   TPS PS  GG+   SY   PSPP+ DGS +P P
Sbjct: 396 TPSYPSPPGSSTTPSHPSPPGSST---TPSHPSPPGGATTPSY---PSPPT-DGS-SPKP 447

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           S PPSS  +      P S   P  PS+   PSG     PP    P     P TP+ P TP
Sbjct: 448 SMPPSSGPSSHGGSPPSSGYQPPPPSSGWAPSGQPVGVPPPAEHPGGVWPPHTPTAPGTP 507

Query: 364 SGGYYNSPPQDSSPPSDP 417
              Y    P   S P+ P
Sbjct: 508 GSAYPPGTPGTPSTPTTP 525

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 62/169 (36%), Positives = 76/169 (44%), Gaps = 32/169 (18%)
 Frame = +1

Query: 7   TPTPPSGDGSYNP-----TPSSP--PG--GGSYDPTPS-------PPSDSGGSPPGSYDP 138
           TPT P   GS  P     TPS+P  PG  G ++ PT         PP+  G   PGS   
Sbjct: 500 TPTAPGTPGSAYPPGTPGTPSTPTTPGTPGSAFPPTTPGAPGSTYPPTTPGA--PGSSPS 557

Query: 139 TPSPPSGDGSYNP--TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPP--- 303
           TP+ P   GS  P  TP  P SS  TP +  +P S   PTTP  P+TP+   Y+ P    
Sbjct: 558 TPTTPGTPGSTYPPTTPGAPGSSPSTPTTPGTPGSTFPPTTPGAPSTPTTPGYHPPSPGG 617

Query: 304 ----------QDSSPPTDPTPTTPSTPTTPSGGY-YNSPPQDSSPPSDP 417
                     Q  +PP+ P       P  P+ G  Y+SPP    PPSDP
Sbjct: 618 GSPGGGHGGNQHGTPPSTPGSGGGVLPFPPAHGMPYSSPP---PPPSDP 663

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 51/143 (35%), Positives = 66/143 (46%), Gaps = 14/143 (9%)
 Frame = +1

Query: 19  PSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGS----YNPTPS 186
           PSG     P P+  PGG     TP+ P   G + P     TPS P+  G+    + PT  
Sbjct: 478 PSGQPVGVPPPAEHPGGVWPPHTPTAPGTPGSAYPPGTPGTPSTPTTPGTPGSAFPPTTP 537

Query: 187 TPPSSDCTPPSQDSPPSDP-TPTTPSTP------TTPS--GGYYNSPPQDSSPPTDPTPT 339
             P S   P +  +P S P TPTTP TP      TTP   G   ++P    +P +   PT
Sbjct: 538 GAPGSTYPPTTPGAPGSSPSTPTTPGTPGSTYPPTTPGAPGSSPSTPTTPGTPGSTFPPT 597

Query: 340 TPSTPTTP-SGGYYNSPPQDSSP 405
           TP  P+TP + GY+   P   SP
Sbjct: 598 TPGAPSTPTTPGYHPPSPGGGSP 620

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 51/148 (34%), Positives = 62/148 (41%), Gaps = 16/148 (10%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSP-----------PGGGSYDPTPS--PPSDSGGSPPGSYDPTP-- 144
            PT P   GS   TP++P           PG  S   TP   PPS  GGSP G +      
Sbjct: 571  PTTPGAPGSSPSTPTTPGTPGSTFPPTTPGAPSTPTTPGYHPPSPGGGSPGGGHGGNQHG 630

Query: 145  SPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT 324
            +PPS  GS       PP+      S   PPSDP    P  P    G  Y+SPP    P  
Sbjct: 631  TPPSTPGSGGGVLPFPPAHGMPYSSPPPPPSDPAGNQPFPPV--HGVSYSSPPPPLPPVY 688

Query: 325  DPTPTTPSTPTTPSGGY-YNSPPQDSSP 405
              +  +P  P  P  G  Y+SPP  ++P
Sbjct: 689  PVSYASPPPPLPPVYGVSYSSPPPPATP 716

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 50/145 (34%), Positives = 59/145 (40%), Gaps = 16/145 (11%)
 Frame = +1

Query: 25  GDGSYNPTPSSPPGGGSYD----PTPSPPSDS--GGSPPGSYDPTPSPPSGDGSYNPTPS 186
           G  +  P P        +D       +PP+    G  P G   P P P S   SY   PS
Sbjct: 345 GAPAQRPPPQCAAAAAPFDCRTAQCQAPPTSGTPGSGPGGPSQPLPPPGSTTPSY---PS 401

Query: 187 TPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTP---- 354
            P SS  T PS  SPP   + TTPS P+ P G    + P   SPPTD +   PS P    
Sbjct: 402 PPGSS--TTPSHPSPPG--SSTTPSHPSPPGGA---TTPSYPSPPTDGSSPKPSMPPSSG 454

Query: 355 ------TTPSGGYYNSPPQDSSPPS 411
                 + PS GY   PP     PS
Sbjct: 455 PSSHGGSPPSSGYQPPPPSSGWAPS 479

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 55/160 (34%), Positives = 67/160 (41%), Gaps = 22/160 (13%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGGGSYDP--TPSPPSDSGGSP-----PGS-YDPT----PSPP 153
            PT P   GS   TP++P   GS  P  TP  P  S  +P     PGS + PT    PS P
Sbjct: 546  PTTPGAPGSSPSTPTTPGTPGSTYPPTTPGAPGSSPSTPTTPGTPGSTFPPTTPGAPSTP 605

Query: 154  SGDGSYNPTP-STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGY-YNSPPQDSSPPTD 327
            +  G + P+P    P          +PPS P       P  P+ G  Y+SPP    PP+D
Sbjct: 606  TTPGYHPPSPGGGSPGGGHGGNQHGTPPSTPGSGGGVLPFPPAHGMPYSSPP---PPPSD 662

Query: 328  PTPTTPSTPTTPSGGYYNSPPQDSSP--------PSDPLP 423
            P    P  P    G  Y+SPP    P        P  PLP
Sbjct: 663  PAGNQPFPPV--HGVSYSSPPPPLPPVYPVSYASPPPPLP 700

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 42/134 (31%), Positives = 55/134 (41%)
 Frame = +1

Query: 22  SGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSS 201
           + DG +N  P +P         P P   +  +P          P       PT  TP S 
Sbjct: 335 TADGRWNCIPGAPA------QRPPPQCAAAAAPFDCRTAQCQAP-------PTSGTPGSG 381

Query: 202 DCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYN 381
              P     PP   TP+ PS P + +   + SPP  S+ P+ P+P  P   TTPS   Y 
Sbjct: 382 PGGPSQPLPPPGSTTPSYPSPPGSSTTPSHPSPPGSSTTPSHPSP--PGGATTPS---YP 436

Query: 382 SPPQDSSPPSDPLP 423
           SPP D S P   +P
Sbjct: 437 SPPTDGSSPKPSMP 450

[144][TOP]
>UniRef100_B9QFG7 Subtilisin-like protein TgSUB1, putative n=1 Tax=Toxoplasma gondii
           VEG RepID=B9QFG7_TOXGO
          Length = 545

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 50/141 (35%), Positives = 65/141 (46%), Gaps = 1/141 (0%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTP-SPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           P P PP+      PTP   P       TP S PS S  +PP +  P+P PP+   + +P+
Sbjct: 299 PPPPPPA-----QPTPQPQPHPPLQPETPPSAPSPSPRTPPSA--PSPPPPTPPSAPSPS 351

Query: 181 PSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTT 360
           P TPPS+    PS  +PP  P+P+ P+ P  PS      P   S  P  P P +P  P  
Sbjct: 352 PRTPPSAPS--PSPRTPPCAPSPSPPTPPCAPSPSPRTPPCAPSPSPPTPPPGSPHKPEP 409

Query: 361 PSGGYYNSPPQDSSPPSDPLP 423
            +  Y   P    SPP  P P
Sbjct: 410 QTPVYPEVPRSTRSPPPSPPP 430

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 52/144 (36%), Positives = 70/144 (48%), Gaps = 3/144 (2%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPT--PSPPSDSGGSPPGSYDPTPSPPSGDGSYNP 177
           P+P+P +   + +P P +PP   S  P   PS PS S  +PP +  P+PSPP+   + +P
Sbjct: 326 PSPSPRTPPSAPSPPPPTPPSAPSPSPRTPPSAPSPSPRTPPCA--PSPSPPTPPCAPSP 383

Query: 178 TPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPT 357
           +P TPP   C P    SPP+ P P +P  P   +  Y   P    SPP  P PT  +   
Sbjct: 384 SPRTPP---CAP--SPSPPTPP-PGSPHKPEPQTPVYPEVPRSTRSPPPSPPPTESAPEA 437

Query: 358 TPSG-GYYNSPPQDSSPPSDPLPR 426
            PS       PP  SSP S   P+
Sbjct: 438 PPSNTPSCRVPPCSSSPRSGSQPK 461

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 46/136 (33%), Positives = 66/136 (48%), Gaps = 1/136 (0%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTP 192
           TPPS     +P+P +PP      P+P PP     +PP +  P+PSP +   + +P+P TP
Sbjct: 321 TPPSAP---SPSPRTPPSA----PSPPPP-----TPPSA--PSPSPRTPPSAPSPSPRTP 366

Query: 193 PSSDCTP-PSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSG 369
           P   C P PS  +PP  P+P+  + P  PS      PP     P   TP  P  P +   
Sbjct: 367 P---CAPSPSPPTPPCAPSPSPRTPPCAPSPSPPTPPPGSPHKPEPQTPVYPEVPRSTRS 423

Query: 370 GYYNSPPQDSSPPSDP 417
              + PP +S+P + P
Sbjct: 424 PPPSPPPTESAPEAPP 439

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 53/156 (33%), Positives = 68/156 (43%), Gaps = 18/156 (11%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDP-------TPSPP------SDSGGSPPGSYDPTP 144
           P+P PP+   + +P+P +PP   S  P       +PSPP      S S  +PP +  P+P
Sbjct: 337 PSPPPPTPPSAPSPSPRTPPSAPSPSPRTPPCAPSPSPPTPPCAPSPSPRTPPCAPSPSP 396

Query: 145 SPPSGDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPT--TPSTP--TTPSGGYYNSPPQDS 312
             P     + P P TP   +  P S  SPP  P PT   P  P   TPS      PP  S
Sbjct: 397 PTPPPGSPHKPEPQTPVYPE-VPRSTRSPPPSPPPTESAPEAPPSNTPS---CRVPPCSS 452

Query: 313 SPPTDPTPTTP-STPTTPSGGYYNSPPQDSSPPSDP 417
           SP +   P  P    TTP     +SPP + S    P
Sbjct: 453 SPRSGSQPKPPQDNTTTPKMPSLSSPPTEHSTAQPP 488

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 43/124 (34%), Positives = 56/124 (45%)
 Frame = +1

Query: 52  SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSP 231
           S+PP      PTP P       PP   +  PS PS      P+P TPPS+   PP   +P
Sbjct: 297 STPPPPPPAQPTPQPQPH----PPLQPETPPSAPS------PSPRTPPSAPSPPP--PTP 344

Query: 232 PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPS 411
           PS P+P+  + P+ PS       P   +PP  P+P+ P+ P  PS      P   S  P 
Sbjct: 345 PSAPSPSPRTPPSAPS-------PSPRTPPCAPSPSPPTPPCAPSPSPRTPPCAPSPSPP 397

Query: 412 DPLP 423
            P P
Sbjct: 398 TPPP 401

[145][TOP]
>UniRef100_UPI000198316D PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI000198316D
          Length = 633

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 57/143 (39%), Positives = 72/143 (50%), Gaps = 9/143 (6%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS-- 186
           T PS D   +PTPSS     S D +P PPS+   SPP S + +P PP+     +P PS  
Sbjct: 7   TAPSSDSPPSPTPSSSSSPPSPDASP-PPSEFDASPP-SPNASPPPPAEQPPPSPAPSDD 64

Query: 187 -TPPSSDCT--PPSQDSPPSDPTPTTPS----TPTTPSGGYYNSPPQDSSPPTDPTPTTP 345
            TPP S     PP Q+SPPS P P + +    +P  PSG   + PP +  PP  P P +P
Sbjct: 65  STPPPSQSLSPPPPQNSPPSPPPPPSNNGSLPSPPPPSGSRRSPPPPNGVPP-PPPPRSP 123

Query: 346 STPTTPSGGYYNSPPQDSSPPSD 414
           S     S G    PP  +S  SD
Sbjct: 124 S-----SSGALAPPPGSTSSSSD 141

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 47/126 (37%), Positives = 60/126 (47%), Gaps = 4/126 (3%)
 Frame = +1

Query: 52  SSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCTPPSQDSP 231
           SSP    S D  PSP   S  SPP S D +P P   D S  P+P+  P     PP  + P
Sbjct: 3   SSPETAPSSDSPPSPTPSSSSSPP-SPDASPPPSEFDAS-PPSPNASP-----PPPAEQP 55

Query: 232 PSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS----TPTTPSGGYYNSPPQDS 399
           P  P P+  STP  P     + PP  +SPP+ P P + +    +P  PSG   + PP + 
Sbjct: 56  PPSPAPSDDSTP--PPSQSLSPPPPQNSPPSPPPPPSNNGSLPSPPPPSGSRRSPPPPNG 113

Query: 400 SPPSDP 417
            PP  P
Sbjct: 114 VPPPPP 119

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 36/114 (31%), Positives = 50/114 (43%), Gaps = 2/114 (1%)
 Frame = +1

Query: 13  TPPSGDGSYNPTPSSPPGGG--SYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPS 186
           +PPS + S  P    PP     S D TP P       PP +  P+P PP  +    P+P 
Sbjct: 40  SPPSPNASPPPPAEQPPPSPAPSDDSTPPPSQSLSPPPPQNSPPSPPPPPSNNGSLPSPP 99

Query: 187 TPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPS 348
            P  S  +PP  +  P  P P +PS     S G    PP  +S  +D + ++ S
Sbjct: 100 PPSGSRRSPPPPNGVPPPPPPRSPS-----SSGALAPPPGSTSSSSDDSSSSDS 148

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 34/94 (36%), Positives = 43/94 (45%), Gaps = 3/94 (3%)
 Frame = +1

Query: 151 PSGDGSYNPTPST---PPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPP 321
           PS D   +PTPS+   PPS D +PP  +   S P+P              + PP    PP
Sbjct: 9   PSSDSPPSPTPSSSSSPPSPDASPPPSEFDASPPSPNA------------SPPPPAEQPP 56

Query: 322 TDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             P P+  STP  P     + PP  +SPPS P P
Sbjct: 57  PSPAPSDDSTP--PPSQSLSPPPPQNSPPSPPPP 88

[146][TOP]
>UniRef100_Q7T5D9 Very large tegument protein n=1 Tax=Macacine herpesvirus 1
           RepID=Q7T5D9_CHV1
          Length = 3288

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 49/145 (33%), Positives = 67/145 (46%), Gaps = 9/145 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTP-SPPSDSGGSPPGSYDPTPSPPSGDGSYNPT 180
           PTP          PTP +PP  G+  PTP +PP+ +G +   S  PTP+ P+   S  PT
Sbjct: 411 PTPASRPPTPGAPPTPGAPPTPGA-PPTPGAPPTPAGPTTASSEPPTPAGPTTASSEPPT 469

Query: 181 PSTPPSSDCTPPS--------QDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTP 336
           P+ P ++   PP+           PP+   PT  S P TP+G     P     PPT   P
Sbjct: 470 PAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAG---RPPTPAGRPPTPANP 526

Query: 337 TTPSTPTTPSGGYYNSPPQDSSPPS 411
           T  S P TP+     +P  +  PP+
Sbjct: 527 TASSEPPTPNPEGAPAPSSNEQPPA 551

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/129 (36%), Positives = 58/129 (44%)
 Frame = +1

Query: 31  GSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCT 210
           G   PTP+S P      PTP  P   G  P     PTP+ P+   S  PTP+ P ++   
Sbjct: 407 GPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAGPTTASSE 466

Query: 211 PPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPP 390
           PP+    P+ PT T  S P TP+G     P     PPT   PT  S P TP+G     PP
Sbjct: 467 PPT----PAGPT-TASSEPPTPAG---RPPTPAGRPPTPANPTASSEPPTPAG----RPP 514

Query: 391 QDSSPPSDP 417
             +  P  P
Sbjct: 515 TPAGRPPTP 523

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/143 (33%), Positives = 68/143 (47%), Gaps = 10/143 (6%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPP--------GSYDPTPSPPSG 159
           PTP  P   G+  PTP +PP  G+  PTP+ P+ +   PP         S  PTP+ P+ 
Sbjct: 418 PTPGAPPTPGA-PPTPGAPPTPGA-PPTPAGPTTASSEPPTPAGPTTASSEPPTPAGPTT 475

Query: 160 DGSYNPTPS-TPPSSDCTPPSQDSPPSDPTPTTPS-TPTTPSGGYYNSPPQDSSPPTDPT 333
             S  PTP+  PP+    PP+  +P +   P TP+  P TP+G     PP  ++P     
Sbjct: 476 ASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAG----RPPTPANPTASSE 531

Query: 334 PTTPSTPTTPSGGYYNSPPQDSS 402
           P TP+    P+      PP  +S
Sbjct: 532 PPTPNPEGAPAPSSNEQPPAAAS 554

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 45/145 (31%), Positives = 61/145 (42%), Gaps = 7/145 (4%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           PTP  P+   S  PTP+ P    S  PTP+ P+ +   PP    P   PP+  G   PTP
Sbjct: 442 PTPAGPTTASSEPPTPAGPTTASSEPPTPAGPTTASSEPP---TPAGRPPTPAGR-PPTP 497

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
           + P +S   PP+    P    PT    P TP+    +S P   +P   P P++   P  P
Sbjct: 498 ANPTASS-EPPTPAGRP----PTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQP--P 550

Query: 364 SGGYYNSPPQ-------DSSPPSDP 417
           +    +   Q       D  PP  P
Sbjct: 551 AAASTDEATQKALDALRDRQPPEPP 575

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 51/151 (33%), Positives = 66/151 (43%), Gaps = 10/151 (6%)
 Frame = +1

Query: 4   PTPTPPSG-----DGSYNPTPSSPPG----GGSYDPTPSPPSDSGGSPPGSYDPTPSPPS 156
           PT TPPS       G ++P  +S P        +  TP     SGG         P PP+
Sbjct: 354 PTWTPPSSLEDLSAGRHHPKRASLPTRTRRSARHAATPFSRG-SGGDEQTRPAAGPRPPT 412

Query: 157 GDGSYNPTPSTPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPT-DPT 333
              S  PTP  PP+    PP+  +PP+   P TP+ PTT S    + PP  + P T    
Sbjct: 413 -PASRPPTPGAPPTPGA-PPTPGAPPTPGAPPTPAGPTTAS----SEPPTPAGPTTASSE 466

Query: 334 PTTPSTPTTPSGGYYNSPPQDSSPPSDPLPR 426
           P TP+ PTT S    + PP  +  P  P  R
Sbjct: 467 PPTPAGPTTAS----SEPPTPAGRPPTPAGR 493

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 38/135 (28%), Positives = 55/135 (40%), Gaps = 10/135 (7%)
 Frame = +1

Query: 43   PTPSSP----------PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTPSTP 192
            P PSSP          P  GS      P       PPG   PTP+ P+     NP  +T 
Sbjct: 2778 PAPSSPLQRPRRRAARPAVGSLTNLADP------HPPGPETPTPTSPTA----NPHATTA 2827

Query: 193  PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGG 372
             ++   PP   + P+ PT     TPT  + G  ++PP  ++P     P  P+ P  P+  
Sbjct: 2828 SATPAPPPVAATGPTRPTSPATPTPTVAAAGRASAPPAPAAPAAPAAPAAPAAPAAPAAP 2887

Query: 373  YYNSPPQDSSPPSDP 417
               + P   + P+ P
Sbjct: 2888 AAPAAPAAPAAPAAP 2902

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 49/159 (30%), Positives = 65/159 (40%), Gaps = 18/159 (11%)
 Frame = +1

Query: 1    DPTPTPPS-GDGSYNPTPSSP-PGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYN 174
            DP+P P   G G     PS+P P      P P  P D     PG     P   S  G   
Sbjct: 2721 DPSPRPNELGGGETAAAPSAPDPPPPQTVPAPERPRDDRAPAPGRVS-LPRRASRQG--R 2777

Query: 175  PTPSTP---PSSDCTPPSQDS-----PPSDPTPTTPSTPTTPSGGYYNS--------PPQ 306
            P PS+P   P      P+  S      P  P P TP TPT+P+   + +        PP 
Sbjct: 2778 PAPSSPLQRPRRRAARPAVGSLTNLADPHPPGPETP-TPTSPTANPHATTASATPAPPPV 2836

Query: 307  DSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSDPLP 423
             ++ PT PT     TPT  + G  ++PP  ++P +   P
Sbjct: 2837 AATGPTRPTSPATPTPTVAAAGRASAPPAPAAPAAPAAP 2875

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 39/142 (27%), Positives = 61/142 (42%), Gaps = 9/142 (6%)
 Frame = +1

Query: 10   PTPPSGDGSYNPTPSSPPGG-----GSYDPTPSPPSDSGGSPPGS-YDPTPS-PPSGDGS 168
            P PP   G   PTP+SP         S  P P P + +G + P S   PTP+   +G  S
Sbjct: 2805 PHPP---GPETPTPTSPTANPHATTASATPAPPPVAATGPTRPTSPATPTPTVAAAGRAS 2861

Query: 169  YNPTPSTP--PSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTT 342
              P P+ P  P++   P +  +P +   P  P+ P  P+     +P   ++P     P  
Sbjct: 2862 APPAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPA-----APAAPAAPAAPAAPAA 2916

Query: 343  PSTPTTPSGGYYNSPPQDSSPP 408
            P+ P  P+     + P  ++ P
Sbjct: 2917 PAAPAAPAAPAAPAAPAPAAVP 2938

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 32/121 (26%), Positives = 52/121 (42%), Gaps = 1/121 (0%)
 Frame = +1

Query: 58   PPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPT-PSTPPSSDCTPPSQDSPP 234
            PPG  +  PTP+ P+ +  +   S  P P P +  G   PT P+TP  +        +PP
Sbjct: 2807 PPGPET--PTPTSPTANPHATTASATPAPPPVAATGPTRPTSPATPTPTVAAAGRASAPP 2864

Query: 235  SDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPPQDSSPPSD 414
            +   P  P+ P  P+     +P   ++P     P  P+ P  P+     + P   + P+ 
Sbjct: 2865 APAAPAAPAAPAAPA-----APAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAA 2919

Query: 415  P 417
            P
Sbjct: 2920 P 2920

[147][TOP]
>UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q8L685_VOLCA
          Length = 1009

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 47/131 (35%), Positives = 48/131 (36%), Gaps = 2/131 (1%)
 Frame = +1

Query: 37  YNPTPSSPPGGGSYDPTPSPPS--DSGGSPPGSYDPTPSPPSGDGSYNPTPSTPPSSDCT 210
           YNP P SPP      P+P PPS      SPP    P P PP       P P  PP     
Sbjct: 207 YNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 266

Query: 211 PPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTPSGGYYNSPP 390
           PP    PP  P P  P  P  P       PP    PP  P P  P  P  P       PP
Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

Query: 391 QDSSPPSDPLP 423
               PP  P P
Sbjct: 327 PPPPPPPPPPP 337

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 48/140 (34%), Positives = 49/140 (35%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP       P P SPP      P PSPP      PP    P P PP       P P
Sbjct: 212 PSPPPPP------PLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 326 PPPPPPPPPPPPPPPPPPPP 345

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 47/140 (33%), Positives = 47/140 (33%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P P  PP      P P PP      PP    P P PP       P P
Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 349 PPPPPPPPPPPPPPPPPPPP 368

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 47/140 (33%), Positives = 47/140 (33%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  PLP
Sbjct: 657 PPPPPPPPPPPPPPPPPPLP 676

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 47/140 (33%), Positives = 47/140 (33%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                 SPP    PP  P P
Sbjct: 672 PPPLPPSPPPPPPPPPPPPP 691

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 47/140 (33%), Positives = 47/140 (33%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 677

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
           S      PP    PP  P P
Sbjct: 678 SPPPPPPPPPPPPPPPPPPP 697

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 48/140 (34%), Positives = 48/140 (34%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PPS      P P SPP      P P PP      PP    P P PP       P P
Sbjct: 217 PPPLPPS------PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 331 PPPPPPPPPPPPPPPPPPPP 350

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/140 (33%), Positives = 47/140 (33%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PPS P P
Sbjct: 663 PPPPPPPPPPPPLPPSPPPP 682

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/140 (33%), Positives = 47/140 (33%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP   SPP  P P
Sbjct: 666 PPPPPPPPPLPPSPPPPPPP 685

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 48/140 (34%), Positives = 49/140 (35%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PPS      P P SPP      P P PP      PP    P P PP       P P
Sbjct: 222 PSPPPPSPP----PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 338 PPPPPPPPPPPPPPPPPPPP 357

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 46/140 (32%), Positives = 47/140 (33%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P +P
Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 680 PPPPPPPPPPPPPPPPPPPP 699

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 46/140 (32%), Positives = 47/140 (33%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P +P  P
Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 683 PPPPPPPPPPPPPPPPPPPP 702

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 46/140 (32%), Positives = 47/140 (33%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP+ P P  P  P  P
Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 692 PPPPPPPPPPPHPPPPSPPP 711

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/140 (32%), Positives = 47/140 (33%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P+P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 354 PPPPPPPPPPPPPPPPPPPP 373

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/140 (32%), Positives = 47/140 (33%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                + PP    PP  P P
Sbjct: 673 PPLPPSPPPPPPPPPPPPPP 692

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/140 (32%), Positives = 47/140 (33%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P+ P
Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 681 PPPPPPPPPPPPPPPPPPPP 700

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 357 PPPPPPPPPPPPPPPPPPPP 376

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 359 PPPPPPPPPPPPPPPPPPPP 378

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 361 PPPPPPPPPPPPPPPPPPPP 380

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 362 PPPPPPPPPPPPPPPPPPPP 381

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 363 PPPPPPPPPPPPPPPPPPPP 382

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 364 PPPPPPPPPPPPPPPPPPPP 383

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 365 PPPPPPPPPPPPPPPPPPPP 384

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 366 PPPPPPPPPPPPPPPPPPPP 385

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 367 PPPPPPPPPPPPPPPPPPPP 386

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 368 PPPPPPPPPPPPPPPPPPPP 387

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 369 PPPPPPPPPPPPPPPPPPPP 388

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 370 PPPPPPPPPPPPPPPPPPPP 389

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 371 PPPPPPPPPPPPPPPPPPPP 390

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 372 PPPPPPPPPPPPPPPPPPPP 391

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 373 PPPPPPPPPPPPPPPPPPPP 392

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 374 PPPPPPPPPPPPPPPPPPPP 393

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 375 PPPPPPPPPPPPPPPPPPPP 394

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 376 PPPPPPPPPPPPPPPPPPPP 395

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 377 PPPPPPPPPPPPPPPPPPPP 396

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 378 PPPPPPPPPPPPPPPPPPPP 397

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 379 PPPPPPPPPPPPPPPPPPPP 398

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 380 PPPPPPPPPPPPPPPPPPPP 399

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 381 PPPPPPPPPPPPPPPPPPPP 400

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 382 PPPPPPPPPPPPPPPPPPPP 401

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 383 PPPPPPPPPPPPPPPPPPPP 402

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 384 PPPPPPPPPPPPPPPPPPPP 403

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 385 PPPPPPPPPPPPPPPPPPPP 404

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 386 PPPPPPPPPPPPPPPPPPPP 405

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 387 PPPPPPPPPPPPPPPPPPPP 406

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 388 PPPPPPPPPPPPPPPPPPPP 407

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 389 PPPPPPPPPPPPPPPPPPPP 408

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 390 PPPPPPPPPPPPPPPPPPPP 409

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 391 PPPPPPPPPPPPPPPPPPPP 410

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 392 PPPPPPPPPPPPPPPPPPPP 411

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 393 PPPPPPPPPPPPPPPPPPPP 412

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 394 PPPPPPPPPPPPPPPPPPPP 413

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 395 PPPPPPPPPPPPPPPPPPPP 414

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 396 PPPPPPPPPPPPPPPPPPPP 415

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 397 PPPPPPPPPPPPPPPPPPPP 416

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 398 PPPPPPPPPPPPPPPPPPPP 417

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 399 PPPPPPPPPPPPPPPPPPPP 418

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 400 PPPPPPPPPPPPPPPPPPPP 419

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 401 PPPPPPPPPPPPPPPPPPPP 420

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 402 PPPPPPPPPPPPPPPPPPPP 421

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 403 PPPPPPPPPPPPPPPPPPPP 422

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 404 PPPPPPPPPPPPPPPPPPPP 423

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 405 PPPPPPPPPPPPPPPPPPPP 424

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 406 PPPPPPPPPPPPPPPPPPPP 425

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 407 PPPPPPPPPPPPPPPPPPPP 426

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 408 PPPPPPPPPPPPPPPPPPPP 427

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 409 PPPPPPPPPPPPPPPPPPPP 428

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 410 PPPPPPPPPPPPPPPPPPPP 429

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 411 PPPPPPPPPPPPPPPPPPPP 430

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 412 PPPPPPPPPPPPPPPPPPPP 431

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 413 PPPPPPPPPPPPPPPPPPPP 432

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 414 PPPPPPPPPPPPPPPPPPPP 433

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 415 PPPPPPPPPPPPPPPPPPPP 434

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 416 PPPPPPPPPPPPPPPPPPPP 435

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP     PP    PP  P P  P  P  P       PP    PP  P P  P  P  P
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 364 SGGYYNSPPQDSSPPSDPLP 423
                  PP    PP  P P
Sbjct: 417 PPPPPPPPPPPPPPPPPPPP 436

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/140 (32%), Positives = 46/140 (32%)
 Frame = +1

Query: 4   PTPTPPSGDGSYNPTPSSPPGGGSYDPTPSPPSDSGGSPPGSYDPTPSPPSGDGSYNPTP 183
           P P PP       P P  PP      P P PP      PP    P P PP       P P
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

Query: 184 STPPSSDCTPPSQDSPPSDPTPTTPSTPTTPSGGYYNSPPQDSSPPTDPTPTTPSTPTTP 363
             PP