BB936962 ( RCC09977 )

[UP]


[1][TOP]
>UniRef100_Q43558 Proline rich protein n=1 Tax=Medicago sativa RepID=Q43558_MEDSA
          Length = 228

 Score =  199 bits (505), Expect = 1e-49
 Identities = 100/125 (80%), Positives = 105/125 (84%), Gaps = 8/125 (6%)
 Frame = +3

Query: 147 MGTH-IVLVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPP 323
           MGTH IVLVVGLICAVF S GAQQ PSTSPN+SPAPPTPP NTPPTTPQASPPPVQS+PP
Sbjct: 1   MGTHHIVLVVGLICAVFSSVGAQQAPSTSPNSSPAPPTPPANTPPTTPQASPPPVQSSPP 60

Query: 324 TAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPV-------TPPPAS 482
             QSSPPPVQ+SPPP QS PPPV QSSPPPVS+ PPPVQ SPPP P+       TPPPAS
Sbjct: 61  PVQSSPPPVQSSPPPAQSTPPPV-QSSPPPVSA-PPPVQQSPPPTPLTPPPVQSTPPPAS 118

Query: 483 PPPAS 497
           PPPAS
Sbjct: 119 PPPAS 123

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 39/100 (39%), Positives = 48/100 (48%), Gaps = 5/100 (5%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A  P   SP  +P  P P  +TPP  + P ASPPP    P T   + PP  A+PPP   A
Sbjct: 92  APPPVQQSPPPTPLTPPPVQSTPPPASPPPASPPPFSPPPATPPPATPP-PATPPP---A 147

Query: 381 PPPVQQSSPPPVSSTPPPVQ---SSPPPAPVTPPPASPPP 491
             P   SSPP  +  P P +    +P  APV  P  +P P
Sbjct: 148 LTPTPLSSPPATTPAPAPAKLKSKAPTLAPVLSPSDAPAP 187

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 36/86 (41%), Positives = 44/86 (51%), Gaps = 5/86 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ---SA 380
           PP++ P ASP P +PP  TPP  T P A+PPP  +  PT  SSPP    +P P +    A
Sbjct: 115 PPASPPPASPPPFSPPPATPPPATPPPATPPP--ALTPTPLSSPPATTPAPAPAKLKSKA 172

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPA 458
           P      SP   S  P P  SS  P+
Sbjct: 173 PTLAPVLSP---SDAPAPGLSSLSPS 195

[2][TOP]
>UniRef100_Q39763 Proline-rich cell wall protein n=1 Tax=Gossypium barbadense
           RepID=Q39763_GOSBA
          Length = 214

 Score =  117 bits (293), Expect = 4e-25
 Identities = 64/123 (52%), Positives = 78/123 (63%), Gaps = 12/123 (9%)
 Frame = +3

Query: 165 LVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTT------PQASPPPVQSAPPT 326
           L +  +  + V+    Q PS  P ++PAPPTPP +TPP T      P A+PPPV + PPT
Sbjct: 8   LFLSALLCIAVAGVLGQAPSNPPTSTPAPPTPPASTPPPTTQAPPTPTATPPPVSTPPPT 67

Query: 327 AQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQ---SSPPPA---PVTPPPASPP 488
             SSPPPV ASPPPV + PP    SSPPP  +TPPP     ++PPPA   P TPPPASPP
Sbjct: 68  --SSPPPVTASPPPVSTPPP----SSPPP--ATPPPASPPPATPPPASPPPATPPPASPP 119

Query: 489 PAS 497
           PA+
Sbjct: 120 PAT 122

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/104 (50%), Positives = 64/104 (61%), Gaps = 10/104 (9%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP-----PTNTPPTTPQASPPPVQSAPPTAQSSPP--PVQASPPPVQ 374
           P ST P  + APPTP     P +TPP  P +SPPPV ++PP   + PP  P  A+PPP  
Sbjct: 40  PASTPPPTTQAPPTPTATPPPVSTPP--PTSSPPPVTASPPPVSTPPPSSPPPATPPPAS 97

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPA---PVTPPPASPPPAS 497
             P     +SPPP  +TPPP  +SPPPA   P TPPPA+PPPA+
Sbjct: 98  PPPATPPPASPPP--ATPPP--ASPPPATPPPATPPPATPPPAT 137

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 47/93 (50%), Positives = 61/93 (65%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP++SP    A P P +  PP++P  + PP  S PP   ++PPP  ASPPP  + PPP  
Sbjct: 65  PPTSSPPPVTASPPPVSTPPPSSPPPATPPPASPPP---ATPPP--ASPPP--ATPPP-- 115

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            +SPPP  +TPPP  ++PPPA  TPPPA+PPPA
Sbjct: 116 -ASPPP--ATPPP--ATPPPA--TPPPATPPPA 141

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 47/96 (48%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           P ST P +SP P TPP  +PP  T P ASPPP         ++PPP  ASPPP  + PPP
Sbjct: 79  PVSTPPPSSPPPATPPPASPPPATPPPASPPP---------ATPPP--ASPPP--ATPPP 125

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              ++PPP  +TPPP  ++PPPAP+  PPA+ P  S
Sbjct: 126 ---ATPPP--ATPPP--ATPPPAPLASPPATVPAIS 154

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 41/98 (41%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A  PP+T P ASP P TPP  +PP  T P A+PPP         ++PPP    P P+ S 
Sbjct: 96  ASPPPATPPPASPPPATPPPASPPPATPPPATPPP---------ATPPPATPPPAPLASP 146

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           P  V   SP     T PP   +  PAP T   A+P PA
Sbjct: 147 PATVPAISPVQTPLTSPPAPPTEAPAP-TLGAATPGPA 183

[3][TOP]
>UniRef100_B8AG26 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8AG26_ORYSI
          Length = 218

 Score =  116 bits (290), Expect = 9e-25
 Identities = 62/119 (52%), Positives = 76/119 (63%), Gaps = 9/119 (7%)
 Frame = +3

Query: 165 LVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQA--SPPPVQSA---PPTA 329
           LV+ L+ A   SA AQQPP+ SP   PAP  PP+NTPP TP +  +PPP   A   PP A
Sbjct: 6   LVLALLVA---SAAAQQPPTQSP---PAPNAPPSNTPPPTPPSPTTPPPAPPAPTTPPPA 59

Query: 330 QSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPP-VQSSPPPAPVTP---PPASPPPA 494
            ++PPP   +PPP  + PPP   ++PPP  +TPPP   S PPPAP TP   PPA+PPPA
Sbjct: 60  PTTPPPAPTTPPPAPTTPPPSPPATPPPAPTTPPPSPPSQPPPAPATPPPSPPATPPPA 118

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 45/95 (47%), Positives = 58/95 (61%), Gaps = 4/95 (4%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPP--TNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP-VQSAPPP 389
           P+T P A PAP TPP    TPP  P   PP   + PP+  ++PPP   +PPP   S PPP
Sbjct: 43  PTTPPPAPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPATPPPAPTTPPPSPPSQPPP 102

Query: 390 VQQSSPPPVSSTPPPVQSSPPPA-PVTPPPASPPP 491
              + PP   +TPPP  ++PPP+ P+ PPPA+PPP
Sbjct: 103 APATPPPSPPATPPPAPATPPPSPPLAPPPATPPP 137

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 42/93 (45%), Positives = 53/93 (56%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P  T+P  +P  P P   TPP +P A+PPP  + PP    SPP   + PPP  + PPP  
Sbjct: 58  PAPTTPPPAPTTPPPAPTTPPPSPPATPPPAPTTPP---PSPP---SQPPPAPATPPPSP 111

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            ++PPP  +TPPP     PP    PPPA+PPPA
Sbjct: 112 PATPPPAPATPPPSPPLAPPPATPPPPATPPPA 144

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 39/91 (42%), Positives = 49/91 (53%), Gaps = 1/91 (1%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPPPVQ 395
           P+T P A   PP  P  TPP  P   PP   S PP A ++PPP   A+PPP  + PPP  
Sbjct: 67  PTTPPPAPTTPPPSPPATPPPAPTTPPPSPPSQPPPAPATPPPSPPATPPPAPATPPPSP 126

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
             +PPP  +TPPP  + PP     P P++ P
Sbjct: 127 PLAPPP--ATPPPPATPPPALAPAPTPSTAP 155

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 40/97 (41%), Positives = 55/97 (56%), Gaps = 8/97 (8%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSA-PPTAQSSPPPVQASPPPVQS-APPPV 392
           P+T P + PA P P   TPP +P + PPP  +  PP+  ++PPP  A+PPP    APPP 
Sbjct: 74  PTTPPPSPPATPPPAPTTPPPSPPSQPPPAPATPPPSPPATPPPAPATPPPSPPLAPPP- 132

Query: 393 QQSSPPPVSSTPPPVQSSPPP------APVTPPPASP 485
             ++PPP ++ PP +  +P P      AP T P  SP
Sbjct: 133 --ATPPPPATPPPALAPAPTPSTAPTVAPTTAPTVSP 167

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 36/97 (37%), Positives = 49/97 (50%), Gaps = 5/97 (5%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           P+T P + P+ P P   TPP +P A+PPP  + PP +    PP    PPP  + PPP   
Sbjct: 89  PTTPPPSPPSQPPPAPATPPPSPPATPPPAPATPPPSPPLAPPPATPPPP--ATPPPA-- 144

Query: 399 SSPPPVSSTPPPVQSSPPP-----APVTPPPASPPPA 494
            +P P  ST P V  +  P     +P TP P +  P+
Sbjct: 145 LAPAPTPSTAPTVAPTTAPTVSPISPKTPAPTAATPS 181

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 38/98 (38%), Positives = 45/98 (45%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P A   PP  P  TPP  P   PP    APP A   PP   A+PPP   AP P  
Sbjct: 96  PPSQPPPAPATPPPSPPATPPPAPATPPPSPPLAPPPATPPPP---ATPPPA-LAPAPTP 151

Query: 396 QSSPPPVSSTPPPVQ----SSPPPAPVTPPPASPPPAS 497
            ++P    +T P V      +P P   TP P+  P A+
Sbjct: 152 STAPTVAPTTAPTVSPISPKTPAPTAATPSPSLSPTAT 189

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 34/91 (37%), Positives = 43/91 (47%), Gaps = 2/91 (2%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A A  PPS      PAP TPP + P   P A+PPP  + PP    +P P  A      +A
Sbjct: 103 APATPPPSPPATPPPAPATPPPSPPLAPPPATPPPPATPPPALAPAPTPSTAPTVAPTTA 162

Query: 381 P--PPVQQSSPPPVSSTPPPVQSSPPPAPVT 467
           P   P+   +P P ++TP P   SP   P T
Sbjct: 163 PTVSPISPKTPAPTAATPSP-SLSPTATPTT 192

[4][TOP]
>UniRef100_Q39789 Proline-rich cell wall protein n=1 Tax=Gossypium hirsutum
           RepID=Q39789_GOSHI
          Length = 214

 Score =  114 bits (285), Expect = 3e-24
 Identities = 63/123 (51%), Positives = 77/123 (62%), Gaps = 12/123 (9%)
 Frame = +3

Query: 165 LVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTT------PQASPPPVQSAPPT 326
           L +  +  + V+    Q PS  P ++PA PTPP +TPP T      P A+PPPV + PPT
Sbjct: 8   LFLSALLCIAVAGVLGQAPSNPPTSTPATPTPPASTPPPTTQAPPTPTATPPPVSTPPPT 67

Query: 327 AQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQ---SSPPPA---PVTPPPASPP 488
             SSPPPV ASPPPV + PP    SSPPP  +TPPP     ++PPPA   P TPPPASPP
Sbjct: 68  --SSPPPVTASPPPVSTPPP----SSPPP--ATPPPASPPPATPPPASPPPATPPPASPP 119

Query: 489 PAS 497
           PA+
Sbjct: 120 PAT 122

 Score =  102 bits (253), Expect = 2e-20
 Identities = 60/115 (52%), Positives = 73/115 (63%), Gaps = 3/115 (2%)
 Frame = +3

Query: 162 VLVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP 341
           + V G++     +     P + +P AS  PPT  T  PP TP A+PPPV + PPT  SSP
Sbjct: 16  IAVAGVLGQAPSNPPTSTPATPTPPASTPPPT--TQAPP-TPTATPPPVSTPPPT--SSP 70

Query: 342 PPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPA---PVTPPPASPPPAS 497
           PPV ASPPPV + PP    SSPPP  +TPPP  +SPPPA   P +PPPA+PPPAS
Sbjct: 71  PPVTASPPPVSTPPP----SSPPP--ATPPP--ASPPPATPPPASPPPATPPPAS 117

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/104 (50%), Positives = 64/104 (61%), Gaps = 10/104 (9%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP-----PTNTPPTTPQASPPPVQSAPPTAQSSPP--PVQASPPPVQ 374
           P ST P  + APPTP     P +TPP  P +SPPPV ++PP   + PP  P  A+PPP  
Sbjct: 40  PASTPPPTTQAPPTPTATPPPVSTPP--PTSSPPPVTASPPPVSTPPPSSPPPATPPPAS 97

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPA---PVTPPPASPPPAS 497
             P     +SPPP  +TPPP  +SPPPA   P TPPPA+PPPA+
Sbjct: 98  PPPATPPPASPPP--ATPPP--ASPPPATPPPATPPPATPPPAT 137

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 47/93 (50%), Positives = 61/93 (65%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP++SP    A P P +  PP++P  + PP  S PP   ++PPP  ASPPP  + PPP  
Sbjct: 65  PPTSSPPPVTASPPPVSTPPPSSPPPATPPPASPPP---ATPPP--ASPPP--ATPPP-- 115

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            +SPPP  +TPPP  ++PPPA  TPPPA+PPPA
Sbjct: 116 -ASPPP--ATPPP--ATPPPA--TPPPATPPPA 141

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 47/96 (48%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           P ST P +SP P TPP  +PP  T P ASPPP         ++PPP  ASPPP  + PPP
Sbjct: 79  PVSTPPPSSPPPATPPPASPPPATPPPASPPP---------ATPPP--ASPPP--ATPPP 125

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              ++PPP  +TPPP  ++PPPAP+  PPA+ P  S
Sbjct: 126 ---ATPPP--ATPPP--ATPPPAPLASPPATVPAIS 154

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 41/98 (41%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A  PP+T P ASP P TPP  +PP  T P A+PPP         ++PPP    P P+ S 
Sbjct: 96  ASPPPATPPPASPPPATPPPASPPPATPPPATPPP---------ATPPPATPPPAPLASP 146

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           P  V   SP     T PP   +  PAP T   A+P PA
Sbjct: 147 PATVPAISPVQTPLTSPPAPPTEAPAP-TLGAATPGPA 183

[5][TOP]
>UniRef100_B9FLI1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9FLI1_ORYSJ
          Length = 518

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/101 (55%), Positives = 61/101 (60%), Gaps = 7/101 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT-----PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           PP   P +SP PP      PP ++PP    + PPPV S PP   S PPPV + PPPV S 
Sbjct: 122 PPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVPSPPPPVSSPPPPVSSP 181

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPAS--PPPAS 497
           PPPV  S PPPVSS PPPV S PPP    PPP S  PPPAS
Sbjct: 182 PPPVS-SPPPPVSSPPPPVSSPPPPVHSPPPPVSSPPPPAS 221

 Score =  108 bits (271), Expect = 1e-22
 Identities = 53/95 (55%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNA---SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PP  SP     SP PP P ++ PP    + PPPV S PP   S PPPV + PPPV S PP
Sbjct: 110 PPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVPSPPP 169

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PV  S PPPVSS PPPV S PPP    PPP S PP
Sbjct: 170 PVS-SPPPPVSSPPPPVSSPPPPVSSPPPPVSSPP 203

 Score =  108 bits (269), Expect = 2e-22
 Identities = 54/96 (56%), Positives = 58/96 (60%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASP---APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PP  SP   P   +PP PP  +PP    + PPPV S PP   S PPPV + PPPV S PP
Sbjct: 117 PPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVPSPPPPVSSPPP 176

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
           PV  S PPPVSS PPPV S PPP    PPP  SPPP
Sbjct: 177 PVS-SPPPPVSSPPPPVSSPPPPVSSPPPPVHSPPP 211

 Score =  105 bits (262), Expect = 2e-21
 Identities = 53/95 (55%), Positives = 55/95 (57%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQAS---PPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           P   SP    A P PP  +PP  P  S   PPPV S PP   S PPPV + PPPV S PP
Sbjct: 103 PHHDSPPPPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPP 162

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PV  S PPPVSS PPPV S PPP    PPP S PP
Sbjct: 163 PVP-SPPPPVSSPPPPVSSPPPPVSSPPPPVSSPP 196

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 47/85 (55%), Positives = 52/85 (61%), Gaps = 3/85 (3%)
 Frame = +3

Query: 246 APPTPPTNTPPTTPQASPPPVQSAPPTAQSS---PPPVQASPPPVQSAPPPVQQSSPPPV 416
           +PP P  ++PP    + PPPV S PP    S   PPPV + PPPV S PPPV  S PPPV
Sbjct: 99  SPPPPHHDSPPPPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPPVP-SPPPPV 157

Query: 417 SSTPPPVQSSPPPAPVTPPPASPPP 491
           SS PPPV S PPP    PPP S PP
Sbjct: 158 SSPPPPVPSPPPPVSSPPPPVSSPP 182

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 44/93 (47%), Positives = 48/93 (51%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP    + P PP  +PP    + PPPV S PP   S PPPV + PPPV S PPPV 
Sbjct: 148 PPVPSPPPPVSSPPPPVPSPPPPVSSPPPPVSSPPPPVSSPPPPVSSPPPPVSSPPPPVH 207

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            S PPPVSS PPP          T  P    PA
Sbjct: 208 -SPPPPVSSPPPPASDVVYCTNTTRYPTCTSPA 239

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 36/68 (52%), Positives = 41/68 (60%)
 Frame = +3

Query: 288 QASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVT 467
           ++ PPP   +PP  ++SPPP   SPPP    PPP     PPPV S PPPV S PPP P  
Sbjct: 98  KSPPPPHHDSPPPPRASPPPPVYSPPP----PPPRSSPPPPPVYSPPPPVSSPPPPVPSP 153

Query: 468 PPPASPPP 491
           PPP S PP
Sbjct: 154 PPPVSSPP 161

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 42/80 (52%), Positives = 44/80 (55%), Gaps = 12/80 (15%)
 Frame = +3

Query: 288 QASPPPV--QSAPPTAQSSPPPVQA----------SPPPVQSAPPPVQQSSPPPVSSTPP 431
           + SPPP    S PP   S PPPV +           PPPV S PPPV  S PPPV S PP
Sbjct: 97  EKSPPPPHHDSPPPPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPV-SSPPPPVPSPPP 155

Query: 432 PVQSSPPPAPVTPPPASPPP 491
           PV S PPP P  PPP S PP
Sbjct: 156 PVSSPPPPVPSPPPPVSSPP 175

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 35/86 (40%), Positives = 44/86 (51%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP    + P PP ++PP    + PPPV S PP   S PPPV + PPPV S+PPP  
Sbjct: 162 PPVPSPPPPVSSPPPPVSSPPPPVSSPPPPVSSPPPPVSSPPPPVHSPPPPV-SSPPPPA 220

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPP 473
                  ++T  P  +SP   P   P
Sbjct: 221 SDVVYCTNTTRYPTCTSPAYCPSRCP 246

[6][TOP]
>UniRef100_A2Y786 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2Y786_ORYSI
          Length = 493

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/101 (55%), Positives = 61/101 (60%), Gaps = 7/101 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT-----PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           PP   P +SP PP      PP ++PP    + PPPV S PP   S PPPV + PPPV S 
Sbjct: 97  PPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVPSPPPPVSSPPPPVSSP 156

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPAS--PPPAS 497
           PPPV  S PPPVSS PPPV S PPP    PPP S  PPPAS
Sbjct: 157 PPPVS-SPPPPVSSPPPPVSSPPPPVHSPPPPVSSPPPPAS 196

 Score =  108 bits (271), Expect = 1e-22
 Identities = 53/95 (55%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNA---SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PP  SP     SP PP P ++ PP    + PPPV S PP   S PPPV + PPPV S PP
Sbjct: 85  PPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVPSPPP 144

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PV  S PPPVSS PPPV S PPP    PPP S PP
Sbjct: 145 PVS-SPPPPVSSPPPPVSSPPPPVSSPPPPVSSPP 178

 Score =  108 bits (269), Expect = 2e-22
 Identities = 54/96 (56%), Positives = 58/96 (60%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASP---APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PP  SP   P   +PP PP  +PP    + PPPV S PP   S PPPV + PPPV S PP
Sbjct: 92  PPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVPSPPPPVSSPPP 151

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
           PV  S PPPVSS PPPV S PPP    PPP  SPPP
Sbjct: 152 PVS-SPPPPVSSPPPPVSSPPPPVSSPPPPVHSPPP 186

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 49/92 (53%), Positives = 51/92 (55%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P   SP    A P PP  +PP  P  S PP    PP   S PPPV + PPPV S PPPV 
Sbjct: 78  PYHDSPPPPRASPPPPVYSPPPPPPRSSPP----PPPVYSPPPPVSSPPPPVPSPPPPVS 133

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            S PPPV S PPPV S PPP    PPP S PP
Sbjct: 134 -SPPPPVPSPPPPVSSPPPPVSSPPPPVSSPP 164

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 47/85 (55%), Positives = 52/85 (61%), Gaps = 3/85 (3%)
 Frame = +3

Query: 246 APPTPPTNTPPTTPQASPPPVQSAPPTAQSS---PPPVQASPPPVQSAPPPVQQSSPPPV 416
           +PP P  ++PP    + PPPV S PP    S   PPPV + PPPV S PPPV  S PPPV
Sbjct: 74  SPPPPYHDSPPPPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPPVP-SPPPPV 132

Query: 417 SSTPPPVQSSPPPAPVTPPPASPPP 491
           SS PPPV S PPP    PPP S PP
Sbjct: 133 SSPPPPVPSPPPPVSSPPPPVSSPP 157

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 44/93 (47%), Positives = 48/93 (51%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP    + P PP  +PP    + PPPV S PP   S PPPV + PPPV S PPPV 
Sbjct: 123 PPVPSPPPPVSSPPPPVPSPPPPVSSPPPPVSSPPPPVSSPPPPVSSPPPPVSSPPPPVH 182

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            S PPPVSS PPP          T  P    PA
Sbjct: 183 -SPPPPVSSPPPPASDVVYCTNTTRYPTCTSPA 214

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 36/68 (52%), Positives = 41/68 (60%)
 Frame = +3

Query: 288 QASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVT 467
           ++ PPP   +PP  ++SPPP   SPPP    PPP     PPPV S PPPV S PPP P  
Sbjct: 73  KSPPPPYHDSPPPPRASPPPPVYSPPP----PPPRSSPPPPPVYSPPPPVSSPPPPVPSP 128

Query: 468 PPPASPPP 491
           PPP S PP
Sbjct: 129 PPPVSSPP 136

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 42/80 (52%), Positives = 44/80 (55%), Gaps = 12/80 (15%)
 Frame = +3

Query: 288 QASPPPV--QSAPPTAQSSPPPVQA----------SPPPVQSAPPPVQQSSPPPVSSTPP 431
           + SPPP    S PP   S PPPV +           PPPV S PPPV  S PPPV S PP
Sbjct: 72  EKSPPPPYHDSPPPPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPV-SSPPPPVPSPPP 130

Query: 432 PVQSSPPPAPVTPPPASPPP 491
           PV S PPP P  PPP S PP
Sbjct: 131 PVSSPPPPVPSPPPPVSSPP 150

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 35/86 (40%), Positives = 44/86 (51%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP    + P PP ++PP    + PPPV S PP   S PPPV + PPPV S+PPP  
Sbjct: 137 PPVPSPPPPVSSPPPPVSSPPPPVSSPPPPVSSPPPPVSSPPPPVHSPPPPV-SSPPPPA 195

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPP 473
                  ++T  P  +SP   P   P
Sbjct: 196 SDVVYCTNTTRYPTCTSPAYCPSRCP 221

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +3

Query: 351 QASPPPVQSAPPPVQQSSPPPV-SSTPPPVQSSPPPAPVTPPPASPPPAS 497
           ++ PPP   +PPP + S PPPV S  PPP +SSPPP PV    + PPP S
Sbjct: 73  KSPPPPYHDSPPPPRASPPPPVYSPPPPPPRSSPPPPPVY---SPPPPVS 119

[7][TOP]
>UniRef100_B9N4U0 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9N4U0_POPTR
          Length = 499

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/98 (55%), Positives = 58/98 (59%), Gaps = 4/98 (4%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPT----PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           Q PP   P  SP PP     PP ++PP    + PPPVQS PP   S PPPV + PPPV S
Sbjct: 402 QSPPPPPPVHSPPPPVQSPPPPVHSPPPPVHSPPPPVQSPPPPVHSPPPPVHSPPPPVHS 461

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PPPV  S PPPV S PPPV S PPP    PP  SPPP
Sbjct: 462 PPPPVH-SPPPPVQSPPPPVHSPPPPVHSPPPVQSPPP 498

 Score =  110 bits (274), Expect = 6e-23
 Identities = 54/93 (58%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP     PP PP ++PP   Q+ PPPV S PP   S PPPVQ+ PPPV S PPPV 
Sbjct: 399 PPVQSP-----PPPPPVHSPPPPVQSPPPPVHSPPPPVHSPPPPVQSPPPPVHSPPPPV- 452

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
            S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 453 HSPPPPVHSPPPPVHSPPPPVQSPPPPVHSPPP 485

 Score =  103 bits (257), Expect = 6e-21
 Identities = 51/94 (54%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           +P   S +   +PP P  + PP  P  SPPP VQS PP   S PPPV + PPPVQS PPP
Sbjct: 385 RPVDCSKDKFHSPPPPVQSPPPPPPVHSPPPPVQSPPPPVHSPPPPVHSPPPPVQSPPPP 444

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           V  S PPPV S PPPV S PPP    PPP   PP
Sbjct: 445 VH-SPPPPVHSPPPPVHSPPPPVHSPPPPVQSPP 477

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 40/73 (54%), Positives = 44/73 (60%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP      P PP ++PP    + PPPV S PP   S PPPVQ+ PPPV S PPPV 
Sbjct: 429 PPVHSPPPPVQSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPVHSPPPPVH 488

Query: 396 QSSPPPVSSTPPP 434
             SPPPV S PPP
Sbjct: 489 --SPPPVQSPPPP 499

[8][TOP]
>UniRef100_Q3EC03 Uncharacterized protein At2g14890.2 n=1 Tax=Arabidopsis thaliana
           RepID=Q3EC03_ARATH
          Length = 176

 Score =  111 bits (278), Expect = 2e-23
 Identities = 60/112 (53%), Positives = 75/112 (66%), Gaps = 3/112 (2%)
 Frame = +3

Query: 171 VGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPV 350
           + +IC V ++    Q P++ P A+PAPPTP   TPP  P A+PPPV SAPP   +SPPPV
Sbjct: 7   IAVICIVLIAGVTGQAPTSPPTATPAPPTP--TTPP--PAATPPPV-SAPPPVTTSPPPV 61

Query: 351 QASPPPVQSAPPPVQQSSPPPVS---STPPPVQSSPPPAPVTPPPASPPPAS 497
             +PPP  + PPPV  SSPPP S   +TPPPV S PPP   +PPPA+PPP +
Sbjct: 62  TTAPPPA-NPPPPV--SSPPPASPPPATPPPVASPPPPV-ASPPPATPPPVA 109

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 43/99 (43%), Positives = 50/99 (50%), Gaps = 1/99 (1%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A    P S+ P ASP P TPP    P  P ASPPP  + PP   + PP   ASPP    A
Sbjct: 68  ANPPPPVSSPPPASPPPATPPPVASPPPPVASPPP--ATPPPVATPPPAPLASPPAQVPA 125

Query: 381 P-PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           P P  +  SP P  S+ PP+ SS  P P T    SP P+
Sbjct: 126 PAPTTKPDSPSPSPSSSPPLPSSDAPGPST-DSISPAPS 163

[9][TOP]
>UniRef100_Q9C5S0 Classical arabinogalactan protein 9 n=1 Tax=Arabidopsis thaliana
           RepID=AGP9_ARATH
          Length = 191

 Score =  111 bits (278), Expect = 2e-23
 Identities = 60/112 (53%), Positives = 75/112 (66%), Gaps = 3/112 (2%)
 Frame = +3

Query: 171 VGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPV 350
           + +IC V ++    Q P++ P A+PAPPTP   TPP  P A+PPPV SAPP   +SPPPV
Sbjct: 7   IAVICIVLIAGVTGQAPTSPPTATPAPPTP--TTPP--PAATPPPV-SAPPPVTTSPPPV 61

Query: 351 QASPPPVQSAPPPVQQSSPPPVS---STPPPVQSSPPPAPVTPPPASPPPAS 497
             +PPP  + PPPV  SSPPP S   +TPPPV S PPP   +PPPA+PPP +
Sbjct: 62  TTAPPPA-NPPPPV--SSPPPASPPPATPPPVASPPPPV-ASPPPATPPPVA 109

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 43/99 (43%), Positives = 50/99 (50%), Gaps = 1/99 (1%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A    P S+ P ASP P TPP    P  P ASPPP  + PP   + PP   ASPP    A
Sbjct: 68  ANPPPPVSSPPPASPPPATPPPVASPPPPVASPPP--ATPPPVATPPPAPLASPPAQVPA 125

Query: 381 P-PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           P P  +  SP P  S+ PP+ SS  P P T    SP P+
Sbjct: 126 PAPTTKPDSPSPSPSSSPPLPSSDAPGPST-DSISPAPS 163

[10][TOP]
>UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis
           thaliana RepID=Q9XIL9_ARATH
          Length = 727

 Score =  110 bits (275), Expect = 5e-23
 Identities = 52/93 (55%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P  SP PP PP ++PP    + PPPV S PP   S PPPV + PPPV S PPPV 
Sbjct: 527 PPPPPPVYSPPPP-PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVY 585

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
              PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 586 SPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPP 618

 Score =  104 bits (259), Expect = 4e-21
 Identities = 51/99 (51%), Positives = 56/99 (56%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT----PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP   P  SP PP     PP ++PP    + PPPV S PP   S PPPV + PPP   +P
Sbjct: 536 PPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSP 595

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA---SPPP 491
           PP   S PPPV S PPPV S PPP PV  PP    SPPP
Sbjct: 596 PPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPP 634

 Score =  103 bits (257), Expect = 6e-21
 Identities = 51/94 (54%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP   P  SP PP P  + PP  P  SPPP V S PP   S PPPV + PPPV S PPPV
Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPV 577

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
               PP  S  PPPV S PPP    PPP  SPPP
Sbjct: 578 HSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPP 611

 Score =  102 bits (253), Expect = 2e-20
 Identities = 55/105 (52%), Positives = 58/105 (55%), Gaps = 13/105 (12%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT-------PPTNTPPTTPQA----SPPPVQSAPPTAQSSPPPVQASP 362
           PP  SP  SP PP        PP  +PP  P       PPPV S PP   S PPPV + P
Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPP 560

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           PPV S PPPV  S PPPV S PPPV S PPP   +PPP   SPPP
Sbjct: 561 PPVHSPPPPV-HSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPP 604

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 50/95 (52%), Positives = 54/95 (56%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPPPVQSAPPPV 392
           PP  SP      P PP ++PP    + PPPV S PP    S PPPV + PPPV S PPPV
Sbjct: 554 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPV 613

Query: 393 -QQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
                PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 614 YSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPP 648

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 51/97 (52%), Positives = 55/97 (56%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216 PPSTSPNASPA-PPTPPTNTPPTTPQASPPPVQSAPPT--AQSSPPPVQASPPPVQSAPP 386
           PP  SP   P   P PP ++PP    + PPPV S PP     S PPPV + PPPV S PP
Sbjct: 582 PPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPP 641

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PV  S PPPV S PPP   SPPP PV  PP  PP  S
Sbjct: 642 PVY-SPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMS 677

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 50/95 (52%), Positives = 54/95 (56%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP  SP      P PP ++PP    + PPP V S PP   S PPPV + PPPV S PPP 
Sbjct: 561 PPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 620

Query: 393 Q-QSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
              S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 621 PVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPP 655

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 53/97 (54%), Positives = 56/97 (57%), Gaps = 5/97 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPP--VQSAPP 386
           PP  SP      P PP  +PP  P  SPPP V S PP   S PPPV + PPP  V S PP
Sbjct: 568 PPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPP 627

Query: 387 PVQQSSPPPVSSTPPPVQSSPPP--APVTPPPASPPP 491
           PV  S PPPV S PPPV S PPP  +P  PP  SPPP
Sbjct: 628 PVF-SPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPP 663

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 47/95 (49%), Positives = 52/95 (54%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPPPV 392
           PP  SP      P PP ++PP    + PPPV S PP   S PPP V + PPPV S PPPV
Sbjct: 547 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPV 606

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
               PP  S  PPP   SPPP   +PPP   SPPP
Sbjct: 607 HSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPP 641

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 50/94 (53%), Positives = 56/94 (59%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP--VQASPPPVQSAPPP 389
           P  + P    +PP PP ++PP    + PPPV S PP   S PPP  V + PPPV S PPP
Sbjct: 576 PVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPP 635

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           V  S PPPV S PPPV S PPP PV  PP  PPP
Sbjct: 636 VH-SPPPPVYSPPPPVYSPPPP-PVKSPP--PPP 665

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 49/97 (50%), Positives = 55/97 (56%), Gaps = 7/97 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTP--QASPPPVQSAPPTAQSSPPPVQASPPPVQS-APP 386
           PP  SP      P PP  +PP  P   + PPPV S PP   S PPPV + PPPV S  PP
Sbjct: 597 PPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPP 656

Query: 387 PVQQSSPPPVSSTP--PPVQSSPP-PAPV-TPPPASP 485
           PV+   PPPV S P  PP  SSPP   PV +PPP +P
Sbjct: 657 PVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTP 693

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/95 (50%), Positives = 53/95 (55%), Gaps = 1/95 (1%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           ++ P   P  SP PP+P  ++PP  P  SPPP    PP     PPP   SPPP    PPP
Sbjct: 490 RRSPPPPPVHSPPPPSP-IHSPPPPPVYSPPP---PPPVYSPPPPPPVYSPPP----PPP 541

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
           V  S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 542 VH-SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 575

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 51/107 (47%), Positives = 56/107 (52%), Gaps = 14/107 (13%)
 Frame = +3

Query: 213 QPPSTSP------NASP-----APPTPPTNTPPT-TPQASPPPVQSAPPTAQSSPPPVQA 356
           QPP  SP      + SP     +PP PP ++PP  +P  SPPP    PP     PPP   
Sbjct: 470 QPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPP----PPVYSPPPPPPVY 525

Query: 357 SPPPVQSAPPPVQQ-SSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
           SPPP    PPPV     PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 526 SPPP----PPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 568

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 46/97 (47%), Positives = 52/97 (53%), Gaps = 6/97 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP-VQSAPPPV 392
           PP  SP     PP PP ++PP    + PPPV S PP   S PPPV + PPP V+S PPP 
Sbjct: 611 PPVYSP-----PPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPP 665

Query: 393 QQSSP--PPVSSTPP---PVQSSPPPAPVTPPPASPP 488
             S P  PP  S+PP   PV S PP  P     A PP
Sbjct: 666 VYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPP 702

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 41/96 (42%), Positives = 47/96 (48%), Gaps = 2/96 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A  PP++ P  S   P      P  +PQ + P  QS     +S PPP   SPPP    P 
Sbjct: 450 ASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPP----PS 505

Query: 387 PVQQSSPPPVSS--TPPPVQSSPPPAPVTPPPASPP 488
           P+    PPPV S   PPPV S PPP PV  PP  PP
Sbjct: 506 PIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPP 541

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 40/99 (40%), Positives = 49/99 (49%), Gaps = 8/99 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTP--QASPPPVQSAPPTAQSSPP--PVQASPPPVQSAP 383
           PP   P+       PP ++PPT+P   ++P PV    P  +S  P  P   SP   + +P
Sbjct: 434 PPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSP 493

Query: 384 PPVQQSSPPPV----SSTPPPVQSSPPPAPVTPPPASPP 488
           PP    SPPP     S  PPPV S PPP PV  PP  PP
Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPP 532

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 46/116 (39%), Positives = 51/116 (43%), Gaps = 23/116 (19%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP--PPVQSAPP 386
           QPP  SP      P  P N  P   + SPPP Q        SPPP  + P  PPV S P 
Sbjct: 410 QPPKESPQ-----PNDPYNQSPVKFRRSPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPS 464

Query: 387 PVQQSSPP-------------PV----SSTPPPVQSSPPPAPVTPPP----ASPPP 491
           PV +  PP             PV    S  PPPV S PPP+P+  PP     SPPP
Sbjct: 465 PVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPP 520

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 47/112 (41%), Positives = 58/112 (51%), Gaps = 20/112 (17%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT----PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP   P  SP PP     PP ++PP    + PPPV S P      PPPV++ PPP   +P
Sbjct: 616 PPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPP------PPPVKSPPPPPVYSP 669

Query: 384 P--PVQQSSPP---PVSSTPPPVQS----SPPPAP--VTPP-----PASPPP 491
           P  P + SSPP   PV+S PP   S    +PPP+   + PP      ASPPP
Sbjct: 670 PLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPSEEFIIPPFIGHQYASPPP 721

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 37/90 (41%), Positives = 43/90 (47%), Gaps = 16/90 (17%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPP--VQSAP--PTAQSSPP---PVQASPPPVQ 374
           PP  SP      P PP  +PP  P  SPPP  V S P  P   SSPP   PV + PP   
Sbjct: 634 PPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTP 693

Query: 375 S----APPPVQQSSPPP-----VSSTPPPV 437
           S    APPP ++   PP      +S PPP+
Sbjct: 694 SQTVEAPPPSEEFIIPPFIGHQYASPPPPM 723

[11][TOP]
>UniRef100_A9PGI2 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
           RepID=A9PGI2_POPTR
          Length = 196

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/114 (50%), Positives = 76/114 (66%), Gaps = 3/114 (2%)
 Frame = +3

Query: 162 VLVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP 341
           V+++ LIC + ++  + Q P+TSP A+PAPPTP ++ PP T   +PPPV + PP  QS P
Sbjct: 7   VILLSLIC-ISIAGVSGQAPATSPTAAPAPPTPTSSPPPAT---TPPPVSAPPPVTQSPP 62

Query: 342 PPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPA---PVTPPPASPPPA 494
           P   A+PPPV SAPPP       P  +TPPP  ++PPPA   P TPPPA+PPPA
Sbjct: 63  P---ATPPPV-SAPPPATPPPATPPPATPPP--ATPPPATPPPATPPPATPPPA 110

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 44/97 (45%), Positives = 56/97 (57%), Gaps = 6/97 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPP-TPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PP+T P  S  PP TPP  TPP  T P A+PPP  + PP A  +PPP  A+PPP  + PP
Sbjct: 62  PPATPPPVSAPPPATPPPATPPPATPPPATPPP--ATPPPA--TPPP--ATPPP--AVPP 113

Query: 387 PVQQSSPPPVSSTPPPVQ---SSPPPAPVTPPPASPP 488
           P   ++PP +   P P +    SP P+P+   P SPP
Sbjct: 114 PAPLAAPPALVPAPAPSKPKLKSPAPSPLALSPPSPP 150

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 42/95 (44%), Positives = 53/95 (55%), Gaps = 2/95 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP+T P A+P P TPP  TPP  T P A+PPP  + PP A   P P+ A+PP +  AP P
Sbjct: 73  PPATPPPATPPPATPPPATPPPATPPPATPPP--ATPPPAVPPPAPL-AAPPALVPAPAP 129

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              S P   S  P P+  SPP    +PP  +P P+
Sbjct: 130 ---SKPKLKSPAPSPLALSPP----SPPTGAPAPS 157

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 36/87 (41%), Positives = 42/87 (48%), Gaps = 2/87 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNT-PPTT-PQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A  PP+T P A+P P TPP  T PP T P A PPP   A P A   P P  + P     A
Sbjct: 80  ATPPPATPPPATPPPATPPPATPPPATPPPAVPPPAPLAAPPA-LVPAPAPSKPKLKSPA 138

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAP 461
           P P+  S P P +  P P   +  P P
Sbjct: 139 PSPLALSPPSPPTGAPAPSLGASSPGP 165

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/84 (41%), Positives = 43/84 (51%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A  PP+T P A+P P TPP   PP  P A+PP +  AP  A S P     +P P+  +PP
Sbjct: 90  ATPPPATPPPATPPPATPPPAVPPPAPLAAPPALVPAP--APSKPKLKSPAPSPLALSPP 147

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPA 458
                SPP  +  P    SSP PA
Sbjct: 148 -----SPPTGAPAPSLGASSPGPA 166

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 25/44 (56%), Positives = 31/44 (70%)
 Frame = +3

Query: 366 PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           P  +  PP   SSPPP ++TPPPV S+PPP   +PPPA+PPP S
Sbjct: 29  PTAAPAPPTPTSSPPP-ATTPPPV-SAPPPVTQSPPPATPPPVS 70

[12][TOP]
>UniRef100_A9P8J4 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P8J4_POPTR
          Length = 196

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/114 (50%), Positives = 76/114 (66%), Gaps = 3/114 (2%)
 Frame = +3

Query: 162 VLVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP 341
           V+++ LIC + ++  + Q P+TSP A+PAPPTP ++ PP T   +PPPV + PP  QS P
Sbjct: 7   VILLSLIC-ISIAGVSGQAPATSPTATPAPPTPTSSPPPAT---TPPPVSAPPPVTQSPP 62

Query: 342 PPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPA---PVTPPPASPPPA 494
           P   A+PPPV SAPPP       P  +TPPP  ++PPPA   P TPPPA+PPPA
Sbjct: 63  P---ATPPPV-SAPPPATPPPATPPPATPPP--ATPPPATPPPATPPPATPPPA 110

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 44/97 (45%), Positives = 56/97 (57%), Gaps = 6/97 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPP-TPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PP+T P  S  PP TPP  TPP  T P A+PPP  + PP A  +PPP  A+PPP  + PP
Sbjct: 62  PPATPPPVSAPPPATPPPATPPPATPPPATPPP--ATPPPA--TPPP--ATPPP--AVPP 113

Query: 387 PVQQSSPPPVSSTPPPVQ---SSPPPAPVTPPPASPP 488
           P   ++PP +   P P +    SP P+P+   P SPP
Sbjct: 114 PAPLAAPPALVPAPAPSKPKLKSPAPSPLALSPPSPP 150

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 42/95 (44%), Positives = 53/95 (55%), Gaps = 2/95 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP+T P A+P P TPP  TPP  T P A+PPP  + PP A   P P+ A+PP +  AP P
Sbjct: 73  PPATPPPATPPPATPPPATPPPATPPPATPPP--ATPPPAVPPPAPL-AAPPALVPAPAP 129

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              S P   S  P P+  SPP    +PP  +P P+
Sbjct: 130 ---SKPKLKSPAPSPLALSPP----SPPTGAPAPS 157

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 36/87 (41%), Positives = 42/87 (48%), Gaps = 2/87 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNT-PPTT-PQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A  PP+T P A+P P TPP  T PP T P A PPP   A P A   P P  + P     A
Sbjct: 80  ATPPPATPPPATPPPATPPPATPPPATPPPAVPPPAPLAAPPA-LVPAPAPSKPKLKSPA 138

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAP 461
           P P+  S P P +  P P   +  P P
Sbjct: 139 PSPLALSPPSPPTGAPAPSLGASSPGP 165

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/84 (41%), Positives = 43/84 (51%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A  PP+T P A+P P TPP   PP  P A+PP +  AP  A S P     +P P+  +PP
Sbjct: 90  ATPPPATPPPATPPPATPPPAVPPPAPLAAPPALVPAP--APSKPKLKSPAPSPLALSPP 147

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPA 458
                SPP  +  P    SSP PA
Sbjct: 148 -----SPPTGAPAPSLGASSPGPA 166

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 25/44 (56%), Positives = 31/44 (70%)
 Frame = +3

Query: 366 PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           P  +  PP   SSPPP ++TPPPV S+PPP   +PPPA+PPP S
Sbjct: 29  PTATPAPPTPTSSPPP-ATTPPPV-SAPPPVTQSPPPATPPPVS 70

[13][TOP]
>UniRef100_B9RZI2 Protein binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RZI2_RICCO
          Length = 829

 Score =  108 bits (271), Expect = 1e-22
 Identities = 57/105 (54%), Positives = 62/105 (59%), Gaps = 5/105 (4%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPP----TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP 365
           S   Q PP T+P  SP+PP     PPT +PP    + PPPV S PP   S PPPV + PP
Sbjct: 627 SPPGQSPPPTTPEQSPSPPGQSPPPPTQSPPPPVNSPPPPVYSPPP--PSPPPPVHSPPP 684

Query: 366 PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPPAS 497
           PV S PPP   S PPPV S PPPV S PPP    PPP  SPPP S
Sbjct: 685 PVYSPPPP---SPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPS 726

 Score =  105 bits (262), Expect = 2e-21
 Identities = 53/90 (58%), Positives = 58/90 (64%), Gaps = 1/90 (1%)
 Frame = +3

Query: 225 TSPNASPAPPTPPTNTPPTTPQASP-PPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQS 401
           TSP    +P  P  + PPTTP+ SP PP QS PP  QS PPPV + PPPV S PPP   S
Sbjct: 618 TSPTLEQSPSPPGQSPPPTTPEQSPSPPGQSPPPPTQSPPPPVNSPPPPVYSPPPP---S 674

Query: 402 SPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PPPV S PPPV S PPP+P  PP  SPPP
Sbjct: 675 PPPPVHSPPPPVYSPPPPSP-PPPVHSPPP 703

 Score =  102 bits (255), Expect = 1e-20
 Identities = 50/94 (53%), Positives = 55/94 (58%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP      P PP  +PP  P + PPPV S PP   S PPPV + PPPV S PPP  
Sbjct: 670 PPPPSPPPPVHSPPPPVYSPP--PPSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPSP 727

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
            S PPP+ S PPPV S PPP   +PPP   SPPP
Sbjct: 728 PSPPPPMHSPPPPVYSPPPPPVRSPPPPVHSPPP 761

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/94 (52%), Positives = 56/94 (59%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPPPV 392
           PP  SP      P PP ++PP    + PPPV S PP +  SPPP + + PPPV S PPP 
Sbjct: 689 PPPPSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPSPPSPPPPMHSPPPPVYSPPPPP 748

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
            +S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 749 VRSPPPPVHSPPPPVHSPPPPIYSPPPPRFSPPP 782

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 50/94 (53%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP-VQSAPPPV 392
           PP  SP   P  P PP ++PP    + PPPV S PP   S PPP   SPPP + S PPPV
Sbjct: 684 PPVYSP--PPPSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPSPPSPPPPMHSPPPPV 741

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
               PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 742 YSPPPPPVRSPPPPVHSPPPPVHSPPPPIYSPPP 775

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 50/97 (51%), Positives = 56/97 (57%), Gaps = 5/97 (5%)
 Frame = +3

Query: 216 PPSTSPNA-SPAPP--TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PPS  P   SP PP  +PP  +PP    + PPPV S PP   S PPPV + PPP   +PP
Sbjct: 672 PPSPPPPVHSPPPPVYSPPPPSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPSPPSPP 731

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           P   S PPPV S PPP   SPPP   +PPP   SPPP
Sbjct: 732 PPMHSPPPPVYSPPPPPVRSPPPPVHSPPPPVHSPPP 768

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 46/93 (49%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPPPV 392
           P  + P    +PP P  + PP +P + PPP+ S PP   S PPP V++ PPPV S PPPV
Sbjct: 704 PVHSPPPPVHSPPPPVYSPPPPSPPSPPPPMHSPPPPVYSPPPPPVRSPPPPVHSPPPPV 763

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             S PPP+ S PPP  S PPP    PPP S PP
Sbjct: 764 H-SPPPPIYSPPPPRFSPPPPRFSPPPPTSSPP 795

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 47/92 (51%), Positives = 55/92 (59%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP   P+PP P  + PP      PPPV+S PP   S PPPV + PPP+ S PPP  
Sbjct: 722 PPPPSP---PSPPPPMHSPPPPVYSPPPPPVRSPPPPVHSPPPPVHSPPPPIYSPPPP-- 776

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           + SPPP   +PPP  SSPPP   TP  A+PPP
Sbjct: 777 RFSPPPPRFSPPPPTSSPPP---TPTVAAPPP 805

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 50/95 (52%), Positives = 60/95 (63%), Gaps = 7/95 (7%)
 Frame = +3

Query: 228 SPNASPAPPTPPTN-TPPTTPQASPPPVQSAPPTA--QSSPPPVQASPPPVQSAPPPVQQ 398
           SP ++P+P +P ++ T PT  Q+  PP QS PPT   QS  PP Q+ PPP QS PPPV  
Sbjct: 603 SPTSTPSPESPLSSPTSPTLEQSPSPPGQSPPPTTPEQSPSPPGQSPPPPTQSPPPPVN- 661

Query: 399 SSPPPVSS----TPPPVQSSPPPAPVTPPPASPPP 491
           S PPPV S    +PPP   SPPP   +PPP SPPP
Sbjct: 662 SPPPPVYSPPPPSPPPPVHSPPPPVYSPPPPSPPP 696

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/102 (46%), Positives = 59/102 (57%), Gaps = 11/102 (10%)
 Frame = +3

Query: 219 PSTSP----NASPAPPTPPTNTPPTTPQASPPPVQ--SAP--PTAQSSPPPVQASPPPV- 371
           P+TSP    N+S   PTP   + P +P ++P P    S+P  PT + SP P   SPPP  
Sbjct: 578 PTTSPSPEYNSSEPSPTPSPESEPQSPTSTPSPESPLSSPTSPTLEQSPSPPGQSPPPTT 637

Query: 372 --QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             QS  PP Q  SPPP + +PPP  +SPPP   +PPP SPPP
Sbjct: 638 PEQSPSPPGQ--SPPPPTQSPPPPVNSPPPPVYSPPPPSPPP 677

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 43/99 (43%), Positives = 52/99 (52%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP     PP P         ++ PPPV S PP   S PPP+  SPPP + +PPP +
Sbjct: 739 PPVYSP-----PPPPV--------RSPPPPVHSPPPPVHSPPPPIY-SPPPPRFSPPPPR 784

Query: 396 QSSPPPVSSTPP-PVQSSPPPAPVTPPP------ASPPP 491
            S PPP SS PP P  ++PPP     PP      +SPPP
Sbjct: 785 FSPPPPTSSPPPTPTVAAPPPEDFILPPNIGFQYSSPPP 823

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 53/166 (31%), Positives = 60/166 (36%), Gaps = 74/166 (44%)
 Frame = +3

Query: 216  PPSTSPNAS--PAPPTPPT-----------NTPPTT-PQASPPPVQSAPPTAQSSPPPVQ 353
            PP+TSP+ S  P+ PT PT           +TPPTT P  SP P +   PT   SP P  
Sbjct: 513  PPATSPSPSSEPSEPTSPTTSPSPSSEPLESTPPTTSPSLSPEPSEPTSPTTSPSPSPEP 572

Query: 354  ASP----------------------------------------------------PPVQS 377
            + P                                                    PP QS
Sbjct: 573  SEPTSPTTSPSPEYNSSEPSPTPSPESEPQSPTSTPSPESPLSSPTSPTLEQSPSPPGQS 632

Query: 378  APP--------PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             PP        P  QS PPP  S PPPV S PPP    PPP+ PPP
Sbjct: 633  PPPTTPEQSPSPPGQSPPPPTQSPPPPVNSPPPPVYSPPPPSPPPP 678

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 40/105 (38%), Positives = 53/105 (50%), Gaps = 15/105 (14%)
 Frame = +3

Query: 219 PSTSPNASPAP--PTPPTNTP--------PTTPQASPPP----VQSAPPTAQSSPPPVQA 356
           P+TSP+ SP P  PTPP  +P        PT+P  SP P    ++S PPT   S  P  +
Sbjct: 498 PTTSPSPSPEPSEPTPPATSPSPSSEPSEPTSPTTSPSPSSEPLESTPPTTSPSLSPEPS 557

Query: 357 SP-PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
            P  P  S  P  + S P   +++P P  +S  P+P TP P S P
Sbjct: 558 EPTSPTTSPSPSPEPSEPTSPTTSPSPEYNSSEPSP-TPSPESEP 601

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 39/94 (41%), Positives = 44/94 (46%), Gaps = 5/94 (5%)
 Frame = +3

Query: 225 TSPNASPAP-PTPPTNTPP-TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           TSP  SP+P P P   TPP T+P  S  P +   PT   SP     S  P++S PP    
Sbjct: 496 TSPTTSPSPSPEPSEPTPPATSPSPSSEPSEPTSPTTSPSP-----SSEPLESTPPTTSP 550

Query: 399 S-SPPPVSSTPPPVQSSPPPAPVTP--PPASPPP 491
           S SP P   T P    SP P P  P  P  SP P
Sbjct: 551 SLSPEPSEPTSPTTSPSPSPEPSEPTSPTTSPSP 584

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 39/101 (38%), Positives = 47/101 (46%), Gaps = 8/101 (7%)
 Frame = +3

Query: 219 PSTSPNASPAP-------PTPPTNTPPTTPQASPPPVQSAPPTAQS-SPPPVQASPPPVQ 374
           PST P+ S  P       PTP T   PT    SP P Q   PT Q+ S  P   SP   +
Sbjct: 424 PSTPPSTSYGPTPSTPYVPTPSTPYVPTPSTPSPSPPQQEVPTPQTPSSEPYNPSPGGHR 483

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            +P P  + S P   +T P    SP P+  TPP  SP P+S
Sbjct: 484 ESPTPSPEPSKPTSPTTSP--SPSPEPSEPTPPATSPSPSS 522

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 39/112 (34%), Positives = 48/112 (42%), Gaps = 18/112 (16%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPT-NTP----PTTPQASPPPVQSAPPTAQSSPP-----------P 347
           PPSTS   +P+ P  PT +TP    P+TP  SPP  +   P   SS P           P
Sbjct: 427 PPSTSYGPTPSTPYVPTPSTPYVPTPSTPSPSPPQQEVPTPQTPSSEPYNPSPGGHRESP 486

Query: 348 VQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTP--PPASPPPAS 497
             +  P   ++P      SP P   TPP    SP   P  P  P  SP P+S
Sbjct: 487 TPSPEPSKPTSPTTSPSPSPEPSEPTPPATSPSPSSEPSEPTSPTTSPSPSS 538

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 34/107 (31%), Positives = 47/107 (43%), Gaps = 14/107 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P   +P++ P  P+P  +    TP  SP P +   PT   SP P  + P P  ++P P  
Sbjct: 465 PTPQTPSSEPYNPSPGGHRESPTP--SPEPSKPTSPTTSPSPSPEPSEPTPPATSPSPSS 522

Query: 396 QSSPP------------PVSSTPPPVQS--SPPPAPVTPPPASPPPA 494
           + S P            P+ STPP      SP P+  T P  SP P+
Sbjct: 523 EPSEPTSPTTSPSPSSEPLESTPPTTSPSLSPEPSEPTSPTTSPSPS 569

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 37/114 (32%), Positives = 44/114 (38%), Gaps = 17/114 (14%)
 Frame = +3

Query: 204 GAQQPPSTSPNAS--PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           G+  P S  P+    P P TP   TP T P  S  P  S P     S P V   P P   
Sbjct: 399 GSSTPSSPRPSTPSVPTPSTPYVPTPSTPPSTSYGPTPSTPYVPTPSTPYV---PTPSTP 455

Query: 378 APPPVQQSSPPPVSSTPPPVQSSP---------------PPAPVTPPPASPPPA 494
           +P P QQ  P P + +  P   SP               P +P T P  SP P+
Sbjct: 456 SPSPPQQEVPTPQTPSSEPYNPSPGGHRESPTPSPEPSKPTSPTTSPSPSPEPS 509

[14][TOP]
>UniRef100_UPI0000E125D3 Os05g0552600 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000E125D3
          Length = 510

 Score =  108 bits (270), Expect = 2e-22
 Identities = 56/103 (54%), Positives = 62/103 (60%), Gaps = 11/103 (10%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT-----PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP--PVQ 374
           PP   P +SP PP      PP ++PP    + PPPV S PP   S PPPV  SPP  P+ 
Sbjct: 91  PPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVPSPPPPVPTSPPPSPLP 150

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPP--APVTPPP--ASPPP 491
           S PPPV  S PPPVSS PPPV SSPPP   P  PPP  +SPPP
Sbjct: 151 SPPPPVPSSPPPPVSSPPPPVPSSPPPPVVPSPPPPVLSSPPP 193

 Score =  104 bits (260), Expect = 3e-21
 Identities = 53/99 (53%), Positives = 60/99 (60%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216 PPSTSPNA---SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PP  SP     SP PP P ++ PP    + PPPV S PP   S PPPV + PPPV S PP
Sbjct: 79  PPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVPSPPP 138

Query: 387 PVQQSSPP-PVSSTPPPVQSSPPP---APVTPPPASPPP 491
           PV  S PP P+ S PPPV SSPPP   +P  P P+SPPP
Sbjct: 139 PVPTSPPPSPLPSPPPPVPSSPPPPVSSPPPPVPSSPPP 177

 Score =  103 bits (258), Expect = 5e-21
 Identities = 52/100 (52%), Positives = 59/100 (59%), Gaps = 8/100 (8%)
 Frame = +3

Query: 216 PPSTSPNASP---APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PP  SP   P   +PP PP  +PP    + PPPV S PP   S PPPV + PPPV ++PP
Sbjct: 86  PPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVPSPPPPVPTSPP 145

Query: 387 PVQQSSPPP--VSSTPPPVQSSPPPAPVTPPP---ASPPP 491
           P    SPPP   SS PPPV S PPP P +PPP    SPPP
Sbjct: 146 PSPLPSPPPPVPSSPPPPVSSPPPPVPSSPPPPVVPSPPP 185

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 49/88 (55%), Positives = 56/88 (63%), Gaps = 6/88 (6%)
 Frame = +3

Query: 246 APPTPPTNTPPTTPQASPPPVQSAPPTAQSS---PPPVQASPPPVQSAPPPVQQSSPPPV 416
           +PP P  ++PP    + PPPV S PP    S   PPPV + PPPV S PPPV  S PPPV
Sbjct: 68  SPPPPHHDSPPPPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPPVP-SPPPPV 126

Query: 417 SSTPPPVQSSPPPAPVTPPPA---SPPP 491
           SS PPPV S PPP P +PPP+   SPPP
Sbjct: 127 SSPPPPVPSPPPPVPTSPPPSPLPSPPP 154

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 50/96 (52%), Positives = 56/96 (58%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P   SP    A P PP  +PP  P  S PP    PP   S PPPV + PPPV S PPPV 
Sbjct: 72  PHHDSPPPPRASPPPPVYSPPPPPPRSSPP----PPPVYSPPPPVSSPPPPVPSPPPPVS 127

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPP----PASPPP 491
            S PPPV S PPPV +SPPP+P+  P    P+SPPP
Sbjct: 128 -SPPPPVPSPPPPVPTSPPPSPLPSPPPPVPSSPPP 162

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 50/99 (50%), Positives = 59/99 (59%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP--PVQASPPPVQSAPPP 389
           PP  SP    + P PP  +PP    + PPPV S PP   +SPP  P+ + PPPV S+PPP
Sbjct: 103 PPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVPSPPPPVPTSPPPSPLPSPPPPVPSSPPP 162

Query: 390 VQQSSPPPVSSTPPP--VQSSPPPAPVTPPP---ASPPP 491
              S PPPV S+PPP  V S PPP   +PPP   ASPPP
Sbjct: 163 PVSSPPPPVPSSPPPPVVPSPPPPVLSSPPPPVVASPPP 201

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 51/99 (51%), Positives = 56/99 (56%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQAS--PPPVQSAPPP 389
           P S+ P   P+PP P ++ PP  P   PP   S PP+   SPPP   S  PPPV S PPP
Sbjct: 111 PVSSPPPPVPSPPPPVSSPPPPVPSPPPPVPTSPPPSPLPSPPPPVPSSPPPPVSSPPPP 170

Query: 390 VQQSSPPP-VSSTPPPVQSSPPPAPVTPPP----ASPPP 491
           V  S PPP V S PPPV SSPPP  V  PP     SPPP
Sbjct: 171 VPSSPPPPVVPSPPPPVLSSPPPPVVASPPPPVVPSPPP 209

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 49/96 (51%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P S+ P   P+PP P   +PP +P  SPPP     P   S PPPV + PPPV S+PPP  
Sbjct: 125 PVSSPPPPVPSPPPPVPTSPPPSPLPSPPP-----PVPSSPPPPVSSPPPPVPSSPPPPV 179

Query: 396 QSSPPP--VSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP  +SS PPPV +SPPP PV P P  PPP +
Sbjct: 180 VPSPPPPVLSSPPPPVVASPPP-PVVPSP--PPPGA 212

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 36/68 (52%), Positives = 41/68 (60%)
 Frame = +3

Query: 288 QASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVT 467
           ++ PPP   +PP  ++SPPP   SPPP    PPP     PPPV S PPPV S PPP P  
Sbjct: 67  KSPPPPHHDSPPPPRASPPPPVYSPPP----PPPRSSPPPPPVYSPPPPVSSPPPPVPSP 122

Query: 468 PPPASPPP 491
           PPP S PP
Sbjct: 123 PPPVSSPP 130

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/85 (48%), Positives = 49/85 (57%), Gaps = 8/85 (9%)
 Frame = +3

Query: 216 PPSTSPNASPA-----PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP--VQASPPPVQ 374
           PP   P+  P      PP+P  + PP  P + PPPV S PP   SSPPP  V + PPPV 
Sbjct: 129 PPPPVPSPPPPVPTSPPPSPLPSPPPPVPSSPPPPVSSPPPPVPSSPPPPVVPSPPPPVL 188

Query: 375 SAPPP-VQQSSPPPVSSTPPPVQSS 446
           S+PPP V  S PPPV  +PPP  +S
Sbjct: 189 SSPPPPVVASPPPPVVPSPPPPGAS 213

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 37/94 (39%), Positives = 50/94 (53%), Gaps = 3/94 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPP--TAQSSPPPVQASPPP-VQSAPP 386
           P S  P+  P+PP P  ++PP    + PPPV S+PP     S PPPV +SPPP V ++PP
Sbjct: 141 PTSPPPSPLPSPPPPVPSSPPPPVSSPPPPVPSSPPPPVVPSPPPPVLSSPPPPVVASPP 200

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           P    SPPP  ++     ++    P    PA  P
Sbjct: 201 PPVVPSPPPPGASDVVYCTNKTRYPTCTSPAYCP 234

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 38/94 (40%), Positives = 46/94 (48%), Gaps = 8/94 (8%)
 Frame = +3

Query: 216 PPSTSPNASP----APPTPPTNTPPTTPQASPPPVQSAPP--TAQSSPPPVQASPPP--V 371
           PPS  P+  P    +PP P ++ PP  P + PPPV  +PP     S PPPV ASPPP  V
Sbjct: 145 PPSPLPSPPPPVPSSPPPPVSSPPPPVPSSPPPPVVPSPPPPVLSSPPPPVVASPPPPVV 204

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPP 473
            S PPP         + T  P  +SP   P   P
Sbjct: 205 PSPPPPGASDVVYCTNKTRYPTCTSPAYCPSRCP 238

[15][TOP]
>UniRef100_Q9SPM1 Extensin-like protein n=1 Tax=Solanum lycopersicum
           RepID=Q9SPM1_SOLLC
          Length = 711

 Score =  108 bits (269), Expect = 2e-22
 Identities = 55/94 (58%), Positives = 58/94 (61%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP  SP    A P PP ++PP  P ASPPP V S PP   S PPPV + PPPV S PPPV
Sbjct: 454 PPVHSPPPPVASPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPV 513

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
             S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 514 A-SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 546

 Score =  107 bits (268), Expect = 3e-22
 Identities = 52/93 (55%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP    A P PP ++PP    + PPPV S PP   S PPPV + PPPV S PPPV 
Sbjct: 504 PPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVASPPPPV- 562

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
            S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 563 HSPPPPVHSPPPPVHSPPPPVASPPPPVHSPPP 595

 Score =  107 bits (267), Expect = 4e-22
 Identities = 53/95 (55%), Positives = 59/95 (62%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASP-APPTPPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP T P   P   P PP ++PP  P ASPPP V S PP   S PPPV + PPP  ++PPP
Sbjct: 424 PPKTLPPPPPKTSPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPPVASPPP 483

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPP-ASPPP 491
              S PPPV+S PPPV S PPP    PPP ASPPP
Sbjct: 484 PVHSPPPPVASPPPPVHSPPPPVHSPPPPVASPPP 518

 Score =  107 bits (267), Expect = 4e-22
 Identities = 54/94 (57%), Positives = 58/94 (61%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASP-APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP  SP   P A P PP ++PP    + PPPV S PP   S PPPV + PPPV S PPPV
Sbjct: 468 PPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPV 527

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPP-ASPPP 491
             S PPPV S PPPV S PPP    PPP ASPPP
Sbjct: 528 H-SPPPPVHSPPPPVHSPPPPVHSPPPPVASPPP 560

 Score =  107 bits (267), Expect = 4e-22
 Identities = 52/95 (54%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP      P PP ++PP    + PPPV S PP   S PPPV + PPPV S PPPV 
Sbjct: 518 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPV- 576

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPA---SPPP 491
            S PPPV+S PPPV S PPP PV  PP    SPPP
Sbjct: 577 HSPPPPVASPPPPVHSPPPPPPVASPPPPVHSPPP 611

 Score =  107 bits (266), Expect = 5e-22
 Identities = 52/93 (55%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP    A P PP ++PP    + PPPV S PP   S PPPV + PPPV S PPPV 
Sbjct: 483 PPVHSPPPPVASPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPPV- 541

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
            S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 542 HSPPPPVHSPPPPVASPPPPVHSPPPPVHSPPP 574

 Score =  106 bits (265), Expect = 7e-22
 Identities = 51/93 (54%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP      P PP ++PP    + PPPV S PP   S PPPV + PPPV S PPPV 
Sbjct: 490 PPVASPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVH 549

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
            S PPPV+S PPPV S PPP    PPP  SPPP
Sbjct: 550 -SPPPPVASPPPPVHSPPPPVHSPPPPVHSPPP 581

 Score =  106 bits (264), Expect = 9e-22
 Identities = 52/95 (54%), Positives = 56/95 (58%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP      P PP ++PP    + PPPV S PP   S PPPV + PPPV S PPPV 
Sbjct: 511 PPVASPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPV- 569

Query: 396 QSSPPPVSSTPPPVQSSPPPA---PVTPPPASPPP 491
            S PPPV S PPPV S PPP    P  PP ASPPP
Sbjct: 570 HSPPPPVHSPPPPVASPPPPVHSPPPPPPVASPPP 604

 Score =  105 bits (262), Expect = 2e-21
 Identities = 52/99 (52%), Positives = 55/99 (55%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT------PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           P +  PN SP PP       P T+ PP      PPPV S PP   S PPPV + PPPV S
Sbjct: 413 PTTPKPNPSPPPPKTLPPPPPKTSPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHS 472

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
            PPP   S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 473 PPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPVHSPPP 511

 Score =  105 bits (262), Expect = 2e-21
 Identities = 53/96 (55%), Positives = 56/96 (58%), Gaps = 5/96 (5%)
 Frame = +3

Query: 219 PSTSPNASPAPPT----PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           P   P ASP PP     PP  +PP    + PPPV S PP   S PPPV + PPPV S PP
Sbjct: 473 PPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPVHSPPP 532

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
           PV  S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 533 PV-HSPPPPVHSPPPPVHSPPPPVASPPPPVHSPPP 567

 Score =  105 bits (262), Expect = 2e-21
 Identities = 52/93 (55%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP      P PP  +PP    + PPPV S PP   S PPPV + PPPV S PPPV 
Sbjct: 497 PPVHSPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVA 556

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPP-ASPPP 491
            S PPPV S PPPV S PPP    PPP ASPPP
Sbjct: 557 -SPPPPVHSPPPPVHSPPPPVHSPPPPVASPPP 588

 Score =  104 bits (260), Expect = 3e-21
 Identities = 54/94 (57%), Positives = 57/94 (60%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP    A P PP ++PP      PPPV S PP   S PPPV + PPPV S PPPV 
Sbjct: 574 PPVHSPPPPVASPPPPVHSPPP-----PPPVASPPPPVHSPPPPVASPPPPVHSPPPPVA 628

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPP-ASPPPA 494
            S PPPV S PPPV S PPP    PPP ASPPPA
Sbjct: 629 -SPPPPVHSPPPPVHSPPPPVHSPPPPVASPPPA 661

 Score =  104 bits (259), Expect = 4e-21
 Identities = 51/94 (54%), Positives = 55/94 (58%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASP-APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP TSP     +PP PP  +PP    + PPPV S PP   S PPP  ASPPP   +PPP 
Sbjct: 432 PPKTSPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPPVASPPPPVHSPPPP 491

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
             S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 492 VASPPPPVHSPPPPVHSPPPPVASPPPPVHSPPP 525

 Score =  103 bits (258), Expect = 5e-21
 Identities = 50/94 (53%), Positives = 55/94 (58%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP      P PP ++PP    + PPPV S PP   S PPPV + PPPV S PPPV 
Sbjct: 532 PPVHSPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPPVASPPPPVH 591

Query: 396 Q-SSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
               PPPV+S PPPV S PPP    PPP  SPPP
Sbjct: 592 SPPPPPPVASPPPPVHSPPPPVASPPPPVHSPPP 625

 Score =  103 bits (256), Expect = 8e-21
 Identities = 52/95 (54%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA--SPPPVQSAPPP 389
           PP  SP    A P PP ++PP    + PPPV S PP   S PPPV +   PPPV S PPP
Sbjct: 546 PPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPPPVASPPPP 605

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
           V  S PPPV+S PPPV S PPP    PPP  SPPP
Sbjct: 606 V-HSPPPPVASPPPPVHSPPPPVASPPPPVHSPPP 639

 Score =  102 bits (254), Expect = 1e-20
 Identities = 51/94 (54%), Positives = 55/94 (58%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP      P PP  +PP    + PPPV S PP   S PPPV + PPPV S PPP  
Sbjct: 539 PPVHSPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPPP 598

Query: 396 QSS-PPPVSSTPPPVQSSPPPAPVTPPP-ASPPP 491
            +S PPPV S PPPV S PPP    PPP ASPPP
Sbjct: 599 VASPPPPVHSPPPPVASPPPPVHSPPPPVASPPP 632

 Score =  102 bits (254), Expect = 1e-20
 Identities = 51/95 (53%), Positives = 54/95 (56%), Gaps = 4/95 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT----PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP   P ASP PP     PP  +PP    + PPPV S PP   S PPPV + PPPV S P
Sbjct: 593 PPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPP 652

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           PPV    P  V S PPPV S PPPAPV  PP  PP
Sbjct: 653 PPVASPPPALVFSPPPPVHSPPPPAPVMSPP--PP 685

 Score =  101 bits (251), Expect = 3e-20
 Identities = 50/94 (53%), Positives = 56/94 (59%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASP-APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP  SP   P A P PP ++PP    + PPPV S PP   +SPPP   SPPP  ++PPP 
Sbjct: 439 PPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPP 498

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
             S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 499 VHSPPPPVHSPPPPVASPPPPVHSPPPPVHSPPP 532

 Score =  100 bits (248), Expect = 7e-20
 Identities = 51/94 (54%), Positives = 55/94 (58%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP     PP PP  +PP    + PPPV S PP   S PPPV + PPPV S PPPV 
Sbjct: 588 PPVHSP-----PPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPVH 642

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
            S PPPV S PPPV S PP    +PPP   SPPP
Sbjct: 643 -SPPPPVHSPPPPVASPPPALVFSPPPPVHSPPP 675

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 51/95 (53%), Positives = 55/95 (57%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP--VQASPPPVQSAPPP 389
           PP  SP      P PP ++PP    + PPPV S PP   S PPP  V + PPPV S PPP
Sbjct: 553 PPVASPPPPVHSPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPPPVASPPPPVHSPPPP 612

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
           V  S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 613 VA-SPPPPVHSPPPPVASPPPPVHSPPPPVHSPPP 646

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 51/106 (48%), Positives = 57/106 (53%), Gaps = 12/106 (11%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTP-PTTPQ---------ASPPPVQS-APPTAQSSPPPVQA 356
           + PP T     P+ PT P   P P  P+         + PPPV S  PP   S PPPV +
Sbjct: 399 KDPPKTVTPPKPSTPTTPKPNPSPPPPKTLPPPPPKTSPPPPVHSPPPPPVASPPPPVHS 458

Query: 357 SPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
            PPPV S PPPV    PPPV+S PPPV S PPP    PPP  SPPP
Sbjct: 459 PPPPVASPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPP 504

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 47/101 (46%), Positives = 54/101 (53%), Gaps = 2/101 (1%)
 Frame = +3

Query: 195 VSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           VS   Q P       +P  P+ PT TP   P   PP     PP   S PPPV + PPP  
Sbjct: 391 VSREGQSPKDPPKTVTPPKPSTPT-TPKPNPSPPPPKTLPPPPPKTSPPPPVHSPPPPPV 449

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           ++PPP   S PPPV+S PPPV S PPP   +PPP   SPPP
Sbjct: 450 ASPPPPVHSPPPPVASPPPPVHSPPPPPVASPPPPVHSPPP 490

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 51/102 (50%), Positives = 56/102 (54%), Gaps = 10/102 (9%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP    A P PP ++PP    + PPPV S PP   S PPPV + PPPV S PP + 
Sbjct: 604 PPVHSPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPPVASPPPALV 663

Query: 396 QSSPPPVSSTPP--PVQSSPPPA--PVTPPP------ASPPP 491
            S PPPV S PP  PV S PPP    V  PP      ASPPP
Sbjct: 664 FSPPPPVHSPPPPAPVMSPPPPTFEDVALPPTLGSLYASPPP 705

[16][TOP]
>UniRef100_C4J5K1 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C4J5K1_MAIZE
          Length = 231

 Score =  107 bits (266), Expect = 5e-22
 Identities = 51/110 (46%), Positives = 63/110 (57%), Gaps = 13/110 (11%)
 Frame = +3

Query: 207 AQQPPSTSP--NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A  PP   P  N  PAP  PP   PP  P A+PPP  + PP A ++PPP   +PPP  + 
Sbjct: 36  ANSPPQAPPAGNPPPAPQAPPAGNPPPAPTATPPPAPTTPPPAPTTPPPAPTTPPPAPTT 95

Query: 381 PPPV-------QQSSPPPVSSTPPP-VQSSPPPAPVTPPPA---SPPPAS 497
           PPP          +SPPP  +TPPP   +SPPPAP TPPP+   +PPPA+
Sbjct: 96  PPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPPSPPMAPPPAT 145

 Score =  106 bits (264), Expect = 9e-22
 Identities = 59/116 (50%), Positives = 70/116 (60%), Gaps = 12/116 (10%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPA---PPTPPTNTPPTTPQA----SPPPVQSA-PPTAQSS 338
           CA   S  AQ PP+  PNA PA   P  PP   PP  PQA    +PPP  +A PP A ++
Sbjct: 17  CAAQQSPPAQPPPT--PNAPPANSPPQAPPAGNPPPAPQAPPAGNPPPAPTATPPPAPTT 74

Query: 339 PPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQ-SSPPPAPVTP---PPASPPPA 494
           PPP   +PPP  + PPP   ++PPP  +TPPP   +SPPPAP TP   PPASPPPA
Sbjct: 75  PPPAPTTPPPAPTTPPPAP-TTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPA 129

 Score =  105 bits (262), Expect = 2e-21
 Identities = 53/110 (48%), Positives = 66/110 (60%), Gaps = 4/110 (3%)
 Frame = +3

Query: 177 LICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQA-SPPPVQSAPPTAQSSPPPVQ 353
           ++  +  S  AQQ P   P   P P  PP N+PP  P A +PPP   APP A + PP   
Sbjct: 9   VLVLLIASCAAQQSPPAQP--PPTPNAPPANSPPQAPPAGNPPPAPQAPP-AGNPPPAPT 65

Query: 354 ASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTP---PPASPPPA 494
           A+PPP  + PPP   ++PPP  +TPPP  ++PPPAP TP   PPASPPPA
Sbjct: 66  ATPPPAPTTPPPA-PTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPA 114

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 46/95 (48%), Positives = 56/95 (58%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPP--TNTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPP 386
           PP+ +    PAP TPP    TPP  P  +PPP  + PP A ++PPP   ASPPP  + PP
Sbjct: 61  PPAPTATPPPAPTTPPPAPTTPPPAP-TTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPP 119

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           P   +SPPP  +TPPP     PP    PPPA+PPP
Sbjct: 120 PSPPASPPPAPATPPPSPPMAPPPATPPPPATPPP 154

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 43/98 (43%), Positives = 56/98 (57%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPPPV 392
           P  T+P  +P  P P   TPP  P   PP   ++PP A ++PPP   ASPPP  + PPP 
Sbjct: 77  PAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPPS 136

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPA---SPPPAS 497
              +PPP  +TPPP  + PPPA  TP P+   +PPP +
Sbjct: 137 PPMAPPP--ATPPPPATPPPPAAPTPAPSVAPTPPPVA 172

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 40/93 (43%), Positives = 50/93 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P  T+P  +P  P P   TPP  P   PP   + PP+  +SPPP   +PPP   A PP  
Sbjct: 70  PAPTTPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPA 129

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            ++PPP     PP  + PPPA   PPPA+P PA
Sbjct: 130 PATPPPSPPMAPPPATPPPPA-TPPPPAAPTPA 161

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/97 (44%), Positives = 56/97 (57%), Gaps = 5/97 (5%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           P+T P + PA P P   TPP +P ASPPP  + PP +    PP  A+PPP  + PPP   
Sbjct: 100 PTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPPSPPMAPP-PATPPPPATPPPPAAP 158

Query: 399 SSPPPVSSTPPPV--QSSPPPAPVTPPPA---SPPPA 494
           +  P V+ TPPPV   ++ P +P TP PA   SP P+
Sbjct: 159 TPAPSVAPTPPPVATPAASPKSPKTPSPAAATSPAPS 195

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 34/90 (37%), Positives = 45/90 (50%), Gaps = 1/90 (1%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-PPVQSAPPPVQ 395
           P+T P + PA P P   TPP +P  +PPP  + PP   + PPP   +P P V   PPPV 
Sbjct: 115 PTTPPPSPPASPPPAPATPPPSPPMAPPP--ATPPPPATPPPPAAPTPAPSVAPTPPPVA 172

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
             +  P S   P   ++  PAP   P  +P
Sbjct: 173 TPAASPKSPKTPSPAAATSPAPSLSPAGTP 202

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 34/84 (40%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP-PPVQASPPPVQS-APPP 389
           PPS   +  PAP TPP + P   P A+PPP  + PP A  +P P V  +PPPV + A  P
Sbjct: 119 PPSPPASPPPAPATPPPSPPMAPPPATPPPPATPPPPAAPTPAPSVAPTPPPVATPAASP 178

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAP 461
               +P P ++T P    SP   P
Sbjct: 179 KSPKTPSPAAATSPAPSLSPAGTP 202

[17][TOP]
>UniRef100_A9P9Z1 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P9Z1_POPTR
          Length = 207

 Score =  107 bits (266), Expect = 5e-22
 Identities = 62/115 (53%), Positives = 75/115 (65%), Gaps = 3/115 (2%)
 Frame = +3

Query: 162 VLVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP 341
           V+ + LIC V +   + Q P+TSP A+PAPPT  T T    P  S PP  SAPP    SP
Sbjct: 7   VIFLSLICIV-IGGVSGQAPATSPTATPAPPTATTPTTSPPPATSTPPPVSAPPPVTQSP 65

Query: 342 PPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPA---PVTPPPASPPPAS 497
           PP  A+PPPV SAPPP   +SPPP  +TPPP  ++PPPA   P TPPPA+PPPA+
Sbjct: 66  PP--ATPPPV-SAPPP---ASPPP--ATPPP--ATPPPATPPPATPPPATPPPAT 110

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 44/98 (44%), Positives = 55/98 (56%), Gaps = 7/98 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           P S  P ASP P TPP  TPP  T P A+PPP  + PP A  +PPP  A+PPP  + PPP
Sbjct: 72  PVSAPPPASPPPATPPPATPPPATPPPATPPP--ATPPPA--TPPP--ATPPP--AVPPP 123

Query: 390 VQQSSPPPVSSTPPPVQS-----SPPPAPVTPPPASPP 488
              +SPP +   P P  S     +P P+P+   P +PP
Sbjct: 124 APLASPPALVPAPAPAPSKSKLKAPAPSPLASSPPAPP 161

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 43/98 (43%), Positives = 53/98 (54%), Gaps = 2/98 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A  PP+T P A+P P TPP  TPP  T P A+PPP  + PP A   P P+ ASPP +  A
Sbjct: 79  ASPPPATPPPATPPPATPPPATPPPATPPPATPPP--ATPPPAVPPPAPL-ASPPALVPA 135

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           P P    S    +  P P+ SSPP     PP  +P P+
Sbjct: 136 PAPAPSKSKLK-APAPSPLASSPP----APPTGAPAPS 168

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 39/95 (41%), Positives = 48/95 (50%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS- 377
           A  PP+T P A+P P TPP  TPP  T P A+PPP    PP   +SPP +  +P P  S 
Sbjct: 84  ATPPPATPPPATPPPATPPPATPPPATPPPATPPPA-VPPPAPLASPPALVPAPAPAPSK 142

Query: 378 ------APPPVQQSSPPPVSSTPPPVQSSPPPAPV 464
                 AP P+  S P P +  P P   +  P PV
Sbjct: 143 SKLKAPAPSPLASSPPAPPTGAPAPSLGASSPGPV 177

[18][TOP]
>UniRef100_UPI0001982EE5 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982EE5
          Length = 746

 Score =  106 bits (265), Expect = 7e-22
 Identities = 54/98 (55%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = +3

Query: 216 PPSTSPNA---SPAPPTPPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP  SP     SP PP P  + PP TP  SPPP V S PP   S PPPVQ+ PPP+ S  
Sbjct: 565 PPVRSPPPPVFSPPPPIPVRSPPPPTPVRSPPPSVSSPPPPEHSPPPPVQSPPPPLYSPS 624

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPP--APVTPPPASPPP 491
           PPV    PPPV S PPPV+S PPP  +P  PP +SPPP
Sbjct: 625 PPVHSPPPPPVHSPPPPVRSPPPPVSSPPPPPVSSPPP 662

 Score =  106 bits (264), Expect = 9e-22
 Identities = 50/98 (51%), Positives = 59/98 (60%), Gaps = 5/98 (5%)
 Frame = +3

Query: 210 QQPPSTSPNASPAP----PTPPTNTPPTTPQASPPPVQS-APPTAQSSPPPVQASPPPVQ 374
           + PP  +P  SP P    P PP ++PP   Q+ PPP+ S +PP     PPPV + PPPV+
Sbjct: 584 RSPPPPTPVRSPPPSVSSPPPPEHSPPPPVQSPPPPLYSPSPPVHSPPPPPVHSPPPPVR 643

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           S PPPV    PPPVSS PPPV S PPP    PPP S P
Sbjct: 644 SPPPPVSSPPPPPVSSPPPPVHSPPPPVSSPPPPVSSP 681

 Score =  103 bits (258), Expect = 5e-21
 Identities = 50/94 (53%), Positives = 56/94 (59%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P  SP PPTP   +PP +  + PPP  S PP  QS PPP+ +  PPV S PPP  
Sbjct: 577 PPPPIPVRSPPPPTP-VRSPPPSVSSPPPPEHSPPPPVQSPPPPLYSPSPPVHSPPPPPV 635

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
            S PPPV S PPPV S PPP   +PPP   SPPP
Sbjct: 636 HSPPPPVRSPPPPVSSPPPPPVSSPPPPVHSPPP 669

 Score =  101 bits (252), Expect = 2e-20
 Identities = 48/92 (52%), Positives = 54/92 (58%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP      P+PP ++PP      PPPV S PP  +S PPPV + PPP  S+PPP  
Sbjct: 611 PPVQSPPPPLYSPSPPVHSPP------PPPVHSPPPPVRSPPPPVSSPPPPPVSSPPPPV 664

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            S PPPVSS PPPV S  PP    PPP S PP
Sbjct: 665 HSPPPPVSSPPPPVSSPHPPVAFPPPPVSSPP 696

 Score =  101 bits (251), Expect = 3e-20
 Identities = 49/95 (51%), Positives = 57/95 (60%), Gaps = 4/95 (4%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPT-TPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PS  P  + +PP P   TPPT TP+ SP P+ S PP   S+PPPV++ PPPV S PPP+ 
Sbjct: 523 PSPHPPKTSSPPPPHKATPPTPTPKPSPAPISSPPPPVHSTPPPVRSPPPPVFSPPPPIP 582

Query: 396 QSSPP---PVSSTPPPVQSSPPPAPVTPPPASPPP 491
             SPP   PV S PP V S PPP    PPP   PP
Sbjct: 583 VRSPPPPTPVRSPPPSVSSPPPPEHSPPPPVQSPP 617

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 52/113 (46%), Positives = 60/113 (53%), Gaps = 21/113 (18%)
 Frame = +3

Query: 216 PPSTSPNASPAP---PTPPTNT---------------PPTTPQASPPP---VQSAPPTAQ 332
           PP+ +P  SPAP   P PP ++               PP  P  SPPP   V+S PP+  
Sbjct: 541 PPTPTPKPSPAPISSPPPPVHSTPPPVRSPPPPVFSPPPPIPVRSPPPPTPVRSPPPSVS 600

Query: 333 SSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           S PPP  + PPPVQS PPP+   SPP  S  PPPV S PPP    PPP S PP
Sbjct: 601 SPPPPEHSPPPPVQSPPPPLYSPSPPVHSPPPPPVHSPPPPVRSPPPPVSSPP 653

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 50/100 (50%), Positives = 59/100 (59%), Gaps = 5/100 (5%)
 Frame = +3

Query: 210 QQPPSTSPNASP---APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           Q PP    + SP   +PP PP ++PP   ++ PPPV S PP   SSPPP   SPPP  S+
Sbjct: 614 QSPPPPLYSPSPPVHSPPPPPVHSPPPPVRSPPPPVSSPPPPPVSSPPPPVHSPPPPVSS 673

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPP--APVTPPPASPPPA 494
           PPP   S  PPV+  PPPV S PPP  +P  PP  SPP A
Sbjct: 674 PPPPVSSPHPPVAFPPPPVSSPPPPVHSPPPPPVFSPPSA 713

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 51/106 (48%), Positives = 59/106 (55%), Gaps = 14/106 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTP---QASPPPVQSAPPTAQSSPPPVQASPP--PVQSA 380
           PP TS    P   TPPT TP  +P    + PPPV S PP  +S PPPV + PP  PV+S 
Sbjct: 527 PPKTSSPPPPHKATPPTPTPKPSPAPISSPPPPVHSTPPPVRSPPPPVFSPPPPIPVRSP 586

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA---------SPPP 491
           PPP    SPPP  S+PPP + SPPP   +PPP          SPPP
Sbjct: 587 PPPTPVRSPPPSVSSPPPPEHSPPPPVQSPPPPLYSPSPPVHSPPP 632

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/106 (49%), Positives = 62/106 (58%), Gaps = 15/106 (14%)
 Frame = +3

Query: 219 PSTSPNASPAPPTP-PTNTPPTTPQASPPPVQSAPPTAQSSPP---------PVQASPPP 368
           PS SP ++P  PTP PT TP   P   PP   S PP  +++PP         P+ + PPP
Sbjct: 500 PSPSPVSAPPTPTPTPTPTPKPKPSPHPPKTSSPPPPHKATPPTPTPKPSPAPISSPPPP 559

Query: 369 VQSAPPPVQQSSPPPVSSTPP--PVQSSPPPAPVTPPP---ASPPP 491
           V S PPPV+ S PPPV S PP  PV+S PPP PV  PP   +SPPP
Sbjct: 560 VHSTPPPVR-SPPPPVFSPPPPIPVRSPPPPTPVRSPPPSVSSPPP 604

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 52/102 (50%), Positives = 60/102 (58%), Gaps = 10/102 (9%)
 Frame = +3

Query: 219 PSTSPNASPAPPTP-PTNTPPTTPQASP-PPVQSAPPTAQSSPPPV---QASPPPVQSAP 383
           P  SP+   APPTP PT TP   P+ SP PP  S+PP    + PP    + SP P+ S P
Sbjct: 498 PQPSPSPVSAPPTPTPTPTPTPKPKPSPHPPKTSSPPPPHKATPPTPTPKPSPAPISSPP 557

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP-----ASPPPA 494
           PPV  S+PPPV S PPPV S PPP PV  PP      SPPP+
Sbjct: 558 PPVH-STPPPVRSPPPPVFSPPPPIPVRSPPPPTPVRSPPPS 598

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 48/105 (45%), Positives = 60/105 (57%), Gaps = 13/105 (12%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTA---------QSSPPPVQASPPP 368
           PP+ +P  +P P   P+  PP T  + PPP ++ PPT           S PPPV ++PPP
Sbjct: 508 PPTPTPTPTPTPKPKPSPHPPKT-SSPPPPHKATPPTPTPKPSPAPISSPPPPVHSTPPP 566

Query: 369 VQSAPPPVQQSSPP-PVSSTPPPVQ-SSPPPAPVTPPPA--SPPP 491
           V+S PPPV    PP PV S PPP    SPPP+  +PPP   SPPP
Sbjct: 567 VRSPPPPVFSPPPPIPVRSPPPPTPVRSPPPSVSSPPPPEHSPPP 611

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 53/123 (43%), Positives = 60/123 (48%), Gaps = 29/123 (23%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTT---------------PQASPPPVQSAPPTAQSSP- 341
           Q  PS SP+     P PP +TPPT                PQ SP PV SAPPT   +P 
Sbjct: 458 QPHPSPSPSPPKPQPAPPKSTPPTPKPRPSPPKSVPSTPKPQPSPSPV-SAPPTPTPTPT 516

Query: 342 ----------PPVQASPPPVQSAPPPVQ--QSSPPPVSSTPPPVQSSPPPAPVTPPPA-S 482
                     PP  +SPPP   A PP    + SP P+SS PPPV S+PPP    PPP  S
Sbjct: 517 PTPKPKPSPHPPKTSSPPPPHKATPPTPTPKPSPAPISSPPPPVHSTPPPVRSPPPPVFS 576

Query: 483 PPP 491
           PPP
Sbjct: 577 PPP 579

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 35/74 (47%), Positives = 40/74 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P  + P    +PP PP ++PP    + PPPV S PP   S  PPV   PPPV S PPPV 
Sbjct: 641 PVRSPPPPVSSPPPPPVSSPPPPVHSPPPPVSSPPPPVSSPHPPVAFPPPPVSSPPPPVH 700

Query: 396 QSSPPPVSSTPPPV 437
              PPPV S P  V
Sbjct: 701 SPPPPPVFSPPSAV 714

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 37/86 (43%), Positives = 44/86 (51%), Gaps = 1/86 (1%)
 Frame = +3

Query: 237 ASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP-PPVQASPPPVQSAPPPVQQSSPPP 413
           +SP  P PP  +P T P AS P    +PPT +  P P    SPP  Q APP     +P P
Sbjct: 429 SSPPKPRPPVRSP-TPPPASTP---RSPPTPKPQPHPSPSPSPPKPQPAPPKSTPPTPKP 484

Query: 414 VSSTPPPVQSSPPPAPVTPPPASPPP 491
             S P  V S+P P P +P P S PP
Sbjct: 485 RPSPPKSVPSTPKPQP-SPSPVSAPP 509

[19][TOP]
>UniRef100_UPI0001982E0B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982E0B
          Length = 222

 Score =  106 bits (265), Expect = 7e-22
 Identities = 59/120 (49%), Positives = 71/120 (59%), Gaps = 8/120 (6%)
 Frame = +3

Query: 162 VLVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP 341
           +LV+GL+C VF   G Q P    P A+PAPPTP      TTP ASPP   ++PP   SSP
Sbjct: 6   LLVLGLVCIVFAGVGGQAPAG-GPTATPAPPTP------TTPAASPPTAVTSPPA--SSP 56

Query: 342 PPVQASPP--PVQSAPPPVQQSSPPPVSSTPPPVQ---SSPPPA---PVTPPPASPPPAS 497
           PPV A PP  P  + PPP       P  +TPPP     ++PPPA   P TPPPA+PPPA+
Sbjct: 57  PPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPAT 116

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 48/96 (50%), Positives = 62/96 (64%), Gaps = 2/96 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A  PP+T P A+P P TPP  TPP  T P A+PPP  + PP A  +PPP  A+PPP  + 
Sbjct: 70  ATPPPATPPPATPPPATPPPATPPPATPPPATPPP--ATPPPA--TPPP--ATPPP--AT 121

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           PPP   ++PPP  +TPPP  ++PPPA +  PPA+ P
Sbjct: 122 PPP---ATPPP--ATPPP--ATPPPAHLASPPAAVP 150

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 42/98 (42%), Positives = 50/98 (51%), Gaps = 2/98 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A  PP+T P A+P P TPP  TPP  T P A+PPP    P T   + PP  A+PPP  + 
Sbjct: 80  ATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPP-PATPPP--AT 136

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PPP   +SPP     P P      PA    P  + PPA
Sbjct: 137 PPPAHLASPPAAVPAPAPSTKVKSPALAPSPLTNSPPA 174

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 40/96 (41%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A  PP+T P A+P P TPP  TPP  T P A+PPP    P T   + PP  A+PPP   A
Sbjct: 85  ATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPP-PATPPPAHLA 143

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
            PP    +P P +    P  +   P+P+T  P +PP
Sbjct: 144 SPPAAVPAPAPSTKVKSPALA---PSPLTNSPPAPP 176

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/105 (41%), Positives = 51/105 (48%), Gaps = 9/105 (8%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPP--PVQ 374
           A  PP+T P A+P P TPP  TPP  T P A+PPP    P T   + PP    PP  P  
Sbjct: 75  ATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPP 134

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPA----PVT-PPPASPPPA 494
           + PPP   +SPP     P P      PA    P+T  PPA P  A
Sbjct: 135 ATPPPAHLASPPAAVPAPAPSTKVKSPALAPSPLTNSPPAPPAEA 179

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 44/100 (44%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQ-ASPPPVQS 377
           A  PP+T P A+P P TPP  TPP  T P A+PPP  + PP A  +PPP   ASPP    
Sbjct: 95  ATPPPATPPPATPPPATPPPATPPPATPPPATPPP--ATPPPA--TPPPAHLASPPAAVP 150

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           AP P  +   P ++  P P+ +SPP     PP  +P P S
Sbjct: 151 APAPSTKVKSPALA--PSPLTNSPP----APPAEAPGPIS 184

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/93 (43%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPP---V 371
           A  PP+T P A+P P TPP  TPP  T P A+PPP  + PP   +SPP    +P P   V
Sbjct: 100 ATPPPATPPPATPPPATPPPATPPPATPPPATPPPA-TPPPAHLASPPAAVPAPAPSTKV 158

Query: 372 QS---APPPVQQSSPPPVSSTPPPVQSSPPPAP 461
           +S   AP P+  S P P +  P P+     PAP
Sbjct: 159 KSPALAPSPLTNSPPAPPAEAPGPISGGISPAP 191

[20][TOP]
>UniRef100_A7QW77 Chromosome chr3 scaffold_199, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7QW77_VITVI
          Length = 290

 Score =  106 bits (265), Expect = 7e-22
 Identities = 59/120 (49%), Positives = 71/120 (59%), Gaps = 8/120 (6%)
 Frame = +3

Query: 162 VLVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP 341
           +LV+GL+C VF   G Q P    P A+PAPPTP      TTP ASPP   ++PP   SSP
Sbjct: 74  LLVLGLVCIVFAGVGGQAPAG-GPTATPAPPTP------TTPAASPPTAVTSPPA--SSP 124

Query: 342 PPVQASPP--PVQSAPPPVQQSSPPPVSSTPPPVQ---SSPPPA---PVTPPPASPPPAS 497
           PPV A PP  P  + PPP       P  +TPPP     ++PPPA   P TPPPA+PPPA+
Sbjct: 125 PPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPAT 184

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 48/96 (50%), Positives = 62/96 (64%), Gaps = 2/96 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A  PP+T P A+P P TPP  TPP  T P A+PPP  + PP A  +PPP  A+PPP  + 
Sbjct: 138 ATPPPATPPPATPPPATPPPATPPPATPPPATPPP--ATPPPA--TPPP--ATPPP--AT 189

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           PPP   ++PPP  +TPPP  ++PPPA +  PPA+ P
Sbjct: 190 PPP---ATPPP--ATPPP--ATPPPAHLASPPAAVP 218

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 42/98 (42%), Positives = 50/98 (51%), Gaps = 2/98 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A  PP+T P A+P P TPP  TPP  T P A+PPP    P T   + PP  A+PPP  + 
Sbjct: 148 ATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPP-PATPPP--AT 204

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PPP   +SPP     P P      PA    P  + PPA
Sbjct: 205 PPPAHLASPPAAVPAPAPSTKVKSPALAPSPLTNSPPA 242

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 40/96 (41%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A  PP+T P A+P P TPP  TPP  T P A+PPP    P T   + PP  A+PPP   A
Sbjct: 153 ATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPP-PATPPPAHLA 211

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
            PP    +P P +    P  +   P+P+T  P +PP
Sbjct: 212 SPPAAVPAPAPSTKVKSPALA---PSPLTNSPPAPP 244

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/105 (41%), Positives = 51/105 (48%), Gaps = 9/105 (8%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPP--PVQ 374
           A  PP+T P A+P P TPP  TPP  T P A+PPP    P T   + PP    PP  P  
Sbjct: 143 ATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPP 202

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPA----PVT-PPPASPPPA 494
           + PPP   +SPP     P P      PA    P+T  PPA P  A
Sbjct: 203 ATPPPAHLASPPAAVPAPAPSTKVKSPALAPSPLTNSPPAPPAEA 247

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 44/100 (44%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQ-ASPPPVQS 377
           A  PP+T P A+P P TPP  TPP  T P A+PPP  + PP A  +PPP   ASPP    
Sbjct: 163 ATPPPATPPPATPPPATPPPATPPPATPPPATPPP--ATPPPA--TPPPAHLASPPAAVP 218

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           AP P  +   P ++  P P+ +SPP     PP  +P P S
Sbjct: 219 APAPSTKVKSPALA--PSPLTNSPP----APPAEAPGPIS 252

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/93 (43%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPP---V 371
           A  PP+T P A+P P TPP  TPP  T P A+PPP  + PP   +SPP    +P P   V
Sbjct: 168 ATPPPATPPPATPPPATPPPATPPPATPPPATPPPA-TPPPAHLASPPAAVPAPAPSTKV 226

Query: 372 QS---APPPVQQSSPPPVSSTPPPVQSSPPPAP 461
           +S   AP P+  S P P +  P P+     PAP
Sbjct: 227 KSPALAPSPLTNSPPAPPAEAPGPISGGISPAP 259

[21][TOP]
>UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK6_CHLRE
          Length = 738

 Score =  106 bits (264), Expect = 9e-22
 Identities = 48/94 (51%), Positives = 51/94 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P  SP PP PP   PP+ P  SPPP    PP+    PPP    PPP +  PP   
Sbjct: 335 PPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPP 394

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP S  PPP  S PPP P  PPP SPPP S
Sbjct: 395 PPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPS 428

 Score =  102 bits (254), Expect = 1e-20
 Identities = 49/100 (49%), Positives = 51/100 (51%), Gaps = 6/100 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP  P  SPPP    PP   S PPP    PPP    PPP  
Sbjct: 298 PPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSP 357

Query: 396 QS------SPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                   SPPP S  PPP  S PPP P  PPP SPPP S
Sbjct: 358 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPS 397

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 45/94 (47%), Positives = 51/94 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+     PP  + PPP    PPP  
Sbjct: 211 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 267

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              PPP S  PPP    PPP P +PPP SPPP S
Sbjct: 268 PPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPS 301

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 44/92 (47%), Positives = 50/92 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+    PPP    PPP    PPP  
Sbjct: 226 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 282

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           +  PPP  S PPP    P P P +PPP SPPP
Sbjct: 283 RPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 314

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 47/93 (50%), Positives = 51/93 (54%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP  +PP  P   PPP    PP   S PPP   SPPP  S PPP  
Sbjct: 293 PPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPP---SPPPPPPPSPPPPPSPPPPPP 349

Query: 396 QSSPPPVSSTP-PPVQSSPPPAPVTPPPASPPP 491
              PPP    P PP  S PPP+P  PPP SPPP
Sbjct: 350 PRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 382

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 47/94 (50%), Positives = 52/94 (55%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP  +PP  P  SPPP    PP +   PPP +  PPP  S PPP  
Sbjct: 241 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPP---PPPPSPPPPPPPRPPPPPPPSPPPPSP 297

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PP  S PPP  S PPP P  PPP SPPP S
Sbjct: 298 PPPSPPPPSPPPP--SPPPPPPPRPPPPSPPPPS 329

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 46/96 (47%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP  +PP  P + PPP    PP     PPP  + PPP    PPP  
Sbjct: 231 PPPSPPPPSPPPPSPPPPSPP--PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPP 288

Query: 396 QSSPPPVSSTPP--PVQSSPPPAPVTPPPASPPPAS 497
             SPPP S  PP  P  S PPP+P  PPP  PPP S
Sbjct: 289 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPS 324

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 46/96 (47%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-PPVQSAPPPVQ 395
           P   P   P PP PP+  PP+ P  SPPP    PP+    PPP    P PP  S PPP  
Sbjct: 276 PPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPP 335

Query: 396 QSSPPPVSSTPPPVQSSPPPAPV--TPPPASPPPAS 497
            S PPP S  PPP    PPP+P   +PPP SPPP S
Sbjct: 336 PSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPS 371

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 47/105 (44%), Positives = 53/105 (50%), Gaps = 11/105 (10%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PPS  P   P+PP P  P+  PP  P+  PPP  S PP +   P P   SPPP    PPP
Sbjct: 257 PPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 316

Query: 390 VQQ---------SSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             +         S PPP   +PPP  S PPP P  PPP SPPP S
Sbjct: 317 PPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPS 361

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/91 (49%), Positives = 50/91 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP  S PP +   P P   SPPP    PP   
Sbjct: 196 PPPSPPPPSPPPPSPP---PPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPSPP 251

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
             SPPP S  PPP  S PPP P +PPP  PP
Sbjct: 252 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 282

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/96 (46%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP--PVQSAPPP 389
           PP + P  SP PP PP+  PP  P   PPP    PP    SPPP    PP  P  S PPP
Sbjct: 251 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPP 310

Query: 390 VQQSSPPP--VSSTPPPVQSSPPPAPVTPPPASPPP 491
                PPP     +PPP    PPP P  PPP SPPP
Sbjct: 311 SPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPP 346

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 48/102 (47%), Positives = 53/102 (51%), Gaps = 8/102 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPPPVQSAPP- 386
           PPS  P   P+PP PP   PP  P  SPPP    PP+    S PPP    PPP +  PP 
Sbjct: 265 PPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPS 324

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPV-----TPPPASPPPAS 497
           P   S PPP   +PPP  S PPP P      +PPP SPPP S
Sbjct: 325 PPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPS 366

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 44/96 (45%), Positives = 51/96 (53%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP +P   PPP    PP  +  PPP  + PPP    P P  
Sbjct: 246 PPPSPPPPSPPPPSPPP-PPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPP 304

Query: 396 QSSPPPVSSTPPPVQ----SSPPPAPVTPPPASPPP 491
            S PPP    PPP +    S PPP+P  PPP SPPP
Sbjct: 305 PSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPP 340

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 43/91 (47%), Positives = 47/91 (51%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP  +PP  P  SPPP     P   S PPP   SPPP    PPP  
Sbjct: 353 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPP---SPPPPSPPPPPPP 409

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
              PPP    PPP    P P P +PPP SPP
Sbjct: 410 SPPPPPPPRPPPPSPPPPSPPPPSPPPPSPP 440

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 44/94 (46%), Positives = 49/94 (52%), Gaps = 3/94 (3%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP-PVQSAPPPVQ 395
           P   P   P PP+PP  +PP  P  SPPP  S PP     PPP    PP P   +PPP  
Sbjct: 312 PPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPS 371

Query: 396 QSSPPPVSSTPPPVQSSPPPA--PVTPPPASPPP 491
              PPP S  PPP    PPP+  P +PPP SPPP
Sbjct: 372 PPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPP 405

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 49/104 (47%), Positives = 55/104 (52%), Gaps = 2/104 (1%)
 Frame = +3

Query: 186 AVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP 365
           A+F S     P S +   SP PP+PP   PP+ P  SPPP  S PP +   P P   SPP
Sbjct: 171 ALFDSQNDCCPLSQANVPSPPPPSPP---PPSPPPPSPPP-PSPPPPSPPPPSPPPPSPP 226

Query: 366 PVQSAPPPVQQSSPPPVSSTP--PPVQSSPPPAPVTPPPASPPP 491
           P    PP     SPPP S  P  PP  S PPP+P  PPP SPPP
Sbjct: 227 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 270

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 46/105 (43%), Positives = 51/105 (48%), Gaps = 2/105 (1%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPAPPT--PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA 356
           C     A    PP  SP     PP+  PP+  PP+ P  SPPP  S PP +   P P   
Sbjct: 179 CCPLSQANVPSPPPPSP----PPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPP 233

Query: 357 SPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           SPPP    PP     SPPP S  PP     PPP+P  PPP SPPP
Sbjct: 234 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 278

[22][TOP]
>UniRef100_C0PPC0 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0PPC0_MAIZE
          Length = 199

 Score =  106 bits (264), Expect = 9e-22
 Identities = 59/116 (50%), Positives = 70/116 (60%), Gaps = 12/116 (10%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPA---PPTPPTNTPPTTPQA----SPPPVQSA-PPTAQSS 338
           CA   S  AQ PP+  PNA PA   P  PP   PP  PQA    +PPP  +A PP A ++
Sbjct: 17  CAAQQSPPAQPPPT--PNAPPANSPPQAPPAGNPPPAPQAPPAGNPPPAPTATPPPAPTT 74

Query: 339 PPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQ-SSPPPAPVTP---PPASPPPA 494
           PPP   +PPP  + PPP   ++PPP  +TPPP   +SPPPAP TP   PPASPPPA
Sbjct: 75  PPPAPTTPPPAPTTPPPAP-TTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPA 129

 Score =  105 bits (262), Expect = 2e-21
 Identities = 53/110 (48%), Positives = 66/110 (60%), Gaps = 4/110 (3%)
 Frame = +3

Query: 177 LICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQA-SPPPVQSAPPTAQSSPPPVQ 353
           ++  +  S  AQQ P   P   P P  PP N+PP  P A +PPP   APP A + PP   
Sbjct: 9   VLVLLIASCAAQQSPPAQP--PPTPNAPPANSPPQAPPAGNPPPAPQAPP-AGNPPPAPT 65

Query: 354 ASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTP---PPASPPPA 494
           A+PPP  + PPP   ++PPP  +TPPP  ++PPPAP TP   PPASPPPA
Sbjct: 66  ATPPPAPTTPPPA-PTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPA 114

 Score =  105 bits (261), Expect = 2e-21
 Identities = 51/107 (47%), Positives = 61/107 (57%), Gaps = 10/107 (9%)
 Frame = +3

Query: 207 AQQPPSTSP--NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A  PP   P  N  PAP  PP   PP  P A+PPP  + PP A ++PPP   +PPP  + 
Sbjct: 36  ANSPPQAPPAGNPPPAPQAPPAGNPPPAPTATPPPAPTTPPPAPTTPPPAPTTPPPAPTT 95

Query: 381 PPPV-------QQSSPPPVSSTPPP-VQSSPPPAPVTPPPASPPPAS 497
           PPP          +SPPP  +TPPP   +SPPPAP TPPP SPP A+
Sbjct: 96  PPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPP-SPPMAT 141

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/97 (44%), Positives = 54/97 (55%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPT--NTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPP 386
           PP+ +    PAP TPP    TPP  P  +PPP  + PP A ++PPP   ASPPP  + PP
Sbjct: 61  PPAPTATPPPAPTTPPPAPTTPPPAP-TTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPP 119

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           P   +SPPP  +TPPP      PA     P +P PA+
Sbjct: 120 PSPPASPPPAPATPPPSPPMATPAASPKSPKTPSPAA 156

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 37/94 (39%), Positives = 46/94 (48%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPPPV 392
           P  T+P  +P  P P   TPP  P   PP   ++PP A ++PPP   ASPPP  + PPP 
Sbjct: 77  PAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPP- 135

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
             S P    +  P    +P PA  T P  S  PA
Sbjct: 136 --SPPMATPAASPKSPKTPSPAAATSPAPSLSPA 167

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 36/91 (39%), Positives = 49/91 (53%), Gaps = 1/91 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQ-SSPPPVQASPPPVQSAPPPV 392
           P  T+P  +P  P P   TPP +P ASPPP  + PP +  +SPPP  A+PPP   +PP  
Sbjct: 84  PAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPP---SPPMA 140

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
             ++ P    TP P  ++  PAP   P  +P
Sbjct: 141 TPAASPKSPKTPSPA-AATSPAPSLSPAGTP 170

[23][TOP]
>UniRef100_B9HRV2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HRV2_POPTR
          Length = 711

 Score =  106 bits (264), Expect = 9e-22
 Identities = 54/95 (56%), Positives = 60/95 (63%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP+ SP  S   P PP ++PP  P  SPPP + S PP   S PPPV + PPPV S PPPV
Sbjct: 418 PPAHSPPPSIHFPPPPVHSPPPPPVHSPPPPIYSPPPLVYSPPPPVHSPPPPVHSPPPPV 477

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           Q S PPPV S PPPV S PPP   +PPP   SPPP
Sbjct: 478 Q-SFPPPVHSPPPPVHSPPPPPVYSPPPPVHSPPP 511

 Score =  105 bits (263), Expect = 1e-21
 Identities = 49/93 (52%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P  + P    +PP PP  +PP    + PPPV S PP  QS PPPV + PPP+ S PPP  
Sbjct: 483 PVHSPPPPVHSPPPPPVYSPPPPVHSPPPPVYSPPPLVQSPPPPVHSPPPPLHSPPPPPV 542

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
            S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 543 YSPPPPVHSPPPPVHSPPPPIQSPPPPVHSPPP 575

 Score =  103 bits (257), Expect = 6e-21
 Identities = 52/95 (54%), Positives = 56/95 (58%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPA-PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP  SP   P   P PP  +PP    + PPPV S PP   S PPPVQ+ PPPV S PPPV
Sbjct: 432 PPVHSPPPPPVHSPPPPIYSPPPLVYSPPPPVHSPPPPVHSPPPPVQSFPPPVHSPPPPV 491

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPP--ASPPP 491
               PPPV S PPPV S PPP   +PPP   SPPP
Sbjct: 492 HSPPPPPVYSPPPPVHSPPPPV-YSPPPLVQSPPP 525

 Score =  102 bits (253), Expect = 2e-20
 Identities = 51/96 (53%), Positives = 57/96 (59%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP  SP      P PP ++PP    + PPP V S PP   S PPPV + PPP+QS PPPV
Sbjct: 511 PPVYSPPPLVQSPPPPVHSPPPPLHSPPPPPVYSPPPPVHSPPPPVHSPPPPIQSPPPPV 570

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVT---PPPASPPP 491
               PPP+ S PPPVQS PPP PV    PP  SPPP
Sbjct: 571 HSPPPPPIHSPPPPVQSLPPP-PVNSPLPPVHSPPP 605

 Score =  100 bits (250), Expect = 4e-20
 Identities = 49/93 (52%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP      P PP ++PP    + PPPVQS PP   S PPPV + PPP   +PPP  
Sbjct: 447 PPIYSPPPLVYSPPPPVHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPVYSPPPPV 506

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
            S PPPV S PP VQS PPP    PPP  SPPP
Sbjct: 507 HSPPPPVYSPPPLVQSPPPPVHSPPPPLHSPPP 539

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 51/100 (51%), Positives = 56/100 (56%), Gaps = 8/100 (8%)
 Frame = +3

Query: 216 PPSTSP----NASPAP---PTPPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPPV 371
           PP  SP     + P P   P PP ++PP  P  SPPP V S PP   S PP VQ+ PPPV
Sbjct: 468 PPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPVYSPPPPVHSPPPPVYSPPPLVQSPPPPV 527

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            S PPP+    PPPV S PPPV S PPP    PPP   PP
Sbjct: 528 HSPPPPLHSPPPPPVYSPPPPVHSPPPPVHSPPPPIQSPP 567

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 49/93 (52%), Positives = 52/93 (55%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP      P P   +PP    + PPPV S PP  QS PPPV + PPPV S PPP  
Sbjct: 440 PPVHSPPPPIYSPPPLVYSPPPPVHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPV 499

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
            S PPPV S PPPV S PP     PPP  SPPP
Sbjct: 500 YSPPPPVHSPPPPVYSPPPLVQSPPPPVHSPPP 532

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 49/102 (48%), Positives = 60/102 (58%), Gaps = 6/102 (5%)
 Frame = +3

Query: 210 QQPPSTSPNASP---APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA-SPPPVQS 377
           Q PP    +  P   +PP PP  +PP    + PPPV S PP  QS PPPV +  PPP+ S
Sbjct: 521 QSPPPPVHSPPPPLHSPPPPPVYSPPPPVHSPPPPVHSPPPPIQSPPPPVHSPPPPPIHS 580

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPP--APVTPPPASPPPAS 497
            PPPVQ   PPPV+S  PPV S PPP  +P +P  + PPP +
Sbjct: 581 PPPPVQSLPPPPVNSPLPPVHSPPPPVHSPTSPIHSHPPPVN 622

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 47/95 (49%), Positives = 53/95 (55%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP      P PP  +PP   Q+ PPPV S PP   S PPP   SPPP   +PPP  
Sbjct: 497 PPVYSPPPPVHSPPPPVYSPPPLVQSPPPPVHSPPPPLHSPPPPPVYSPPPPVHSPPPPV 556

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
            S PPP+ S PPPV S PPP   +PPP   + PPP
Sbjct: 557 HSPPPPIQSPPPPVHSPPPPPIHSPPPPVQSLPPP 591

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 48/100 (48%), Positives = 57/100 (57%), Gaps = 4/100 (4%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPT--PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           G   PP +S +  P   +  PP ++PP +    PPPV S PP    SPPP   SPPP+  
Sbjct: 398 GVHSPPPSSQSLPPLVHSLPPPAHSPPPSIHFPPPPVHSPPPPPVHSPPPPIYSPPPLVY 457

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP--ASPPP 491
           +PPP   S PPPV S PPPVQS PPP    PPP  + PPP
Sbjct: 458 SPPPPVHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPP 497

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 46/94 (48%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPA-PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPPP 389
           PP  SP   P   P PP ++PP    + PPP+QS PP   S PPP + + PPPVQS PPP
Sbjct: 532 PPLHSPPPPPVYSPPPPVHSPPPPVHSPPPPIQSPPPPVHSPPPPPIHSPPPPVQSLPPP 591

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              S  PPV S PPPV S   P    PPP + PP
Sbjct: 592 PVNSPLPPVHSPPPPVHSPTSPIHSHPPPVNSPP 625

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 50/96 (52%), Positives = 58/96 (60%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSP-PPVQASPPPVQSAPPP 389
           PP  SP      P PP ++PP  P  + PPPVQS PP   +SP PPV + PPPV S   P
Sbjct: 554 PPVHSPPPPIQSPPPPVHSPPPPPIHSPPPPVQSLPPPPVNSPLPPVHSPPPPVHSPTSP 613

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           +  S PPPV+S PPPVQS PPP   +PPP   SP P
Sbjct: 614 IH-SHPPPVNSPPPPVQSLPPPPVNSPPPPVHSPTP 648

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 47/97 (48%), Positives = 51/97 (52%), Gaps = 6/97 (6%)
 Frame = +3

Query: 219 PSTSPNASPAPPT-----PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           P   P  SP PP      PP N+P     + PPPV S      S PPPV + PPPVQS P
Sbjct: 573 PPPPPIHSPPPPVQSLPPPPVNSPLPPVHSPPPPVHSPTSPIHSHPPPVNSPPPPVQSLP 632

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP-ASPPP 491
           PP   S PPPV S  PP+ S  PP    PPP  SPPP
Sbjct: 633 PPPVNSPPPPVHSPTPPIHSPSPPLHSPPPPIRSPPP 669

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 46/95 (48%), Positives = 53/95 (55%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASP--APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP  SP   P  +PP P  + PP    +  PPV S PP   S   P+ + PPPV S PPP
Sbjct: 568 PPVHSPPPPPIHSPPPPVQSLPPPPVNSPLPPVHSPPPPVHSPTSPIHSHPPPVNSPPPP 627

Query: 390 VQQSSPPPVSSTPPPVQSSPPPA-PVTPPPASPPP 491
           VQ   PPPV+S PPPV S  PP    +PP  SPPP
Sbjct: 628 VQSLPPPPVNSPPPPVHSPTPPIHSPSPPLHSPPP 662

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 48/99 (48%), Positives = 56/99 (56%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS-SPPPVQASPPPVQSAPPPV 392
           PP  SP      P PP ++P +   + PPPV S PP  QS  PPPV + PPPV S  PP+
Sbjct: 591 PPVNSPLPPVHSPPPPVHSPTSPIHSHPPPVNSPPPPVQSLPPPPVNSPPPPVHSPTPPI 650

Query: 393 QQSSPP------PVSSTPPPVQSSPPPAPVTPPPASPPP 491
              SPP      P+ S PPPV  SPPP  V+PPP  PPP
Sbjct: 651 HSPSPPLHSPPPPIRSPPPPV-FSPPPVIVSPPP--PPP 686

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/96 (43%), Positives = 52/96 (54%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAP---PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PP    +  P P   P PP ++PP    +   P+ S PP   S PPPVQ+ PPP  ++PP
Sbjct: 581 PPPPVQSLPPPPVNSPLPPVHSPPPPVHSPTSPIHSHPPPVNSPPPPVQSLPPPPVNSPP 640

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
           P   S  PP+ S  PP+ S PPP    PPP  SPPP
Sbjct: 641 PPVHSPTPPIHSPSPPLHSPPPPIRSPPPPVFSPPP 676

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 52/103 (50%), Positives = 57/103 (55%), Gaps = 11/103 (10%)
 Frame = +3

Query: 216 PPSTSPNA---SPAPPT----PPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPPV 371
           PP  SP     SP PP     PP ++PP    + PPP V S PP   S PPPV + PP V
Sbjct: 461 PPVHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPVYSPPPPVHSPPPPVYSPPPLV 520

Query: 372 QSAPPPVQQSSPPPVSST--PPPVQSSPPPAPVTPPPA-SPPP 491
           QS PPPV   SPPP   +  PPPV S PPP    PPP  SPPP
Sbjct: 521 QSPPPPVH--SPPPPLHSPPPPPVYSPPPPVHSPPPPVHSPPP 561

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 46/103 (44%), Positives = 56/103 (54%), Gaps = 11/103 (10%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQA-SPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP  SP +      PP N+PP   Q+  PPPV S PP   S  PP+ +  PP+ S PPP+
Sbjct: 605 PPVHSPTSPIHSHPPPVNSPPPPVQSLPPPPVNSPPPPVHSPTPPIHSPSPPLHSPPPPI 664

Query: 393 QQSSPPPVSSTPPPVQSSPPPAP-----VTPPP-----ASPPP 491
           +  SPPP   +PPPV  SPPP P     + PP      ASPPP
Sbjct: 665 R--SPPPPVFSPPPVIVSPPPPPPEEDFILPPNLGFQYASPPP 705

[24][TOP]
>UniRef100_B6U1N0 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6U1N0_MAIZE
          Length = 299

 Score =  105 bits (262), Expect = 2e-21
 Identities = 56/126 (44%), Positives = 69/126 (54%), Gaps = 21/126 (16%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPA-----------------PPTPPTNTPPTTPQASPPPVQ 311
           C    S  AQ PP+  PNA PA                 PP  PT TPP  P  +PPP  
Sbjct: 17  CTAQQSPPAQPPPT--PNAPPANSPPQAPPAGNPPPAGNPPPAPTATPPPAP-TTPPPAP 73

Query: 312 SAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPP-VQSSPPPAPVTPPPA--- 479
           + PP A ++PPP   +PPP  + PPP   +SPPP  +TPPP   +SPPPAP TPPP+   
Sbjct: 74  TTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPPSPPM 133

Query: 480 SPPPAS 497
           +PPPA+
Sbjct: 134 APPPAT 139

 Score =  104 bits (259), Expect = 4e-21
 Identities = 49/106 (46%), Positives = 63/106 (59%), Gaps = 10/106 (9%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           Q PP+ +P  +  PP  PT TPP  P  +PPP  + PP A ++PPP   +PPP  + PPP
Sbjct: 41  QAPPAGNPPPAGNPPPAPTATPPPAP-TTPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPP 99

Query: 390 VQQSSPPPVSSTPPPVQ-SSPPPAPVTPPPAS---------PPPAS 497
              +SPPP  +TPPP   +SPPPAP TPPP+          PPPA+
Sbjct: 100 SPPASPPPAPTTPPPSPPASPPPAPATPPPSPPMAPPPATPPPPAT 145

 Score =  102 bits (255), Expect = 1e-20
 Identities = 52/118 (44%), Positives = 66/118 (55%), Gaps = 12/118 (10%)
 Frame = +3

Query: 177 LICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQA-SPPPVQSAPPTAQSSPPPVQ 353
           ++  +  S  AQQ P   P   P P  PP N+PP  P A +PPP  + PP   ++PPP  
Sbjct: 9   VLVLLIASCTAQQSPPAQP--PPTPNAPPANSPPQAPPAGNPPPAGNPPPAPTATPPPAP 66

Query: 354 ASPPPVQSAPPPVQQSSPPPVSSTPPPV--------QSSPPPAPVTP---PPASPPPA 494
            +PPP  + PPP   ++PPP  +TPPP          +SPPPAP TP   PPASPPPA
Sbjct: 67  TTPPPAPTTPPPAP-TTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPA 123

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 46/95 (48%), Positives = 56/95 (58%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPT--NTPPTTPQASPPPVQSAPPTAQSSPPPVQ-ASPPPVQSAPP 386
           PP+ +    PAP TPP    TPP  P  +PPP  + PP A ++PPP   ASPPP  + PP
Sbjct: 55  PPAPTATPPPAPTTPPPAPTTPPPAP-TTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPP 113

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           P   +SPPP  +TPPP     PP    PPPA+PPP
Sbjct: 114 PSPPASPPPAPATPPPSPPMAPPPATPPPPATPPP 148

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 40/93 (43%), Positives = 50/93 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P  T+P  +P  P P   TPP  P   PP   + PP+  +SPPP   +PPP   A PP  
Sbjct: 64  PAPTTPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPA 123

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            ++PPP     PP  + PPPA   PPPA+P PA
Sbjct: 124 PATPPPSPPMAPPPATPPPPA-TPPPPAAPTPA 155

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 40/89 (44%), Positives = 51/89 (57%), Gaps = 1/89 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPPPV 392
           P  T+P  +P  P P   TPP  P   PP   ++PP A ++PPP   ASPPP  + PPP 
Sbjct: 71  PAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPPS 130

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPA 479
              +PPP  +TPPP  + PPPA  TP P+
Sbjct: 131 PPMAPPP--ATPPPPATPPPPAAPTPAPS 157

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 29/68 (42%), Positives = 38/68 (55%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           P+T P + PA P P   TPP +P ASPPP  + PP +    PP  A+PPP  + PPP   
Sbjct: 94  PTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPPSPPMAPP-PATPPPPATPPPPAAP 152

Query: 399 SSPPPVSS 422
           +  P V +
Sbjct: 153 TPAPSVGT 160

[25][TOP]
>UniRef100_C0Z219 AT2G14890 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z219_ARATH
          Length = 171

 Score =  105 bits (261), Expect = 2e-21
 Identities = 56/108 (51%), Positives = 72/108 (66%), Gaps = 2/108 (1%)
 Frame = +3

Query: 171 VGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQ--ASPPPVQSAPPTAQSSPP 344
           + +IC V ++    Q P++ P A+PAPPTP T  P  TP   ++PPPV S PP   +SPP
Sbjct: 7   IAVICIVLIAGVTGQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVSSPPP---ASPP 63

Query: 345 PVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           P  A+PPPV S PPPV  +SPPP  +TPPPV ++PPPAP+  PPA  P
Sbjct: 64  P--ATPPPVASPPPPV--ASPPP--ATPPPV-ATPPPAPLASPPAQVP 104

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 43/97 (44%), Positives = 50/97 (51%), Gaps = 1/97 (1%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP- 383
           A  P S+ P ASP P TPP    P  P ASPPP  + PP   + PP   ASPP    AP 
Sbjct: 50  APPPVSSPPPASPPPATPPPVASPPPPVASPPP--ATPPPVATPPPAPLASPPAQVPAPA 107

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           P  +  SP P  S+ PP+ SS  P P T    SP P+
Sbjct: 108 PTTKPDSPSPSPSSSPPLPSSDAPGPST-DSISPAPS 143

[26][TOP]
>UniRef100_Q40150 Tomato cell wall HRGP (hydroxproline-rich glycoprotein) (Fragment)
           n=1 Tax=Solanum lycopersicum RepID=Q40150_SOLLC
          Length = 93

 Score =  104 bits (259), Expect = 4e-21
 Identities = 51/93 (54%), Positives = 53/93 (56%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP T P     PP P T+ PP      PPPV S PP   S PPPV + PPPV S PPP  
Sbjct: 4   PPKTLP-----PPPPKTSPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPPV 58

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
            S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 59  ASPPPPVHSPPPPVASPPPPVHSPPPPVHSPPP 91

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 47/84 (55%), Positives = 52/84 (61%), Gaps = 2/84 (2%)
 Frame = +3

Query: 246 APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPPPVQQSSPPPVSS 422
           +PP P T  PP    + PPPV S PP   +SPPP V + PPPV S PPPV    PPPV+S
Sbjct: 1   SPPPPKTLPPPPPKTSPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPPVAS 60

Query: 423 TPPPVQSSPPPAPVTPPPA-SPPP 491
            PPPV S PPP    PPP  SPPP
Sbjct: 61  PPPPVHSPPPPVASPPPPVHSPPP 84

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 44/81 (54%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = +3

Query: 216 PPSTSPNASP-APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP TSP     +PP PP  +PP    + PPPV S PP   S PPP  ASPPP   +PPP 
Sbjct: 12  PPKTSPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPPVASPPPPVHSPPPP 71

Query: 393 QQSSPPPVSSTPPPVQSSPPP 455
             S PPPV S PPPV S PPP
Sbjct: 72  VASPPPPVHSPPPPVHSPPPP 92

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 39/75 (52%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +3

Query: 216 PPSTSPNASP-APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP  SP   P A P PP ++PP    + PPPV S PP   +SPPP   SPPP  ++PPP 
Sbjct: 19  PPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPP 78

Query: 393 QQSSPPPVSSTPPPV 437
             S PPPV S PPPV
Sbjct: 79  VHSPPPPVHSPPPPV 93

[27][TOP]
>UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK5_CHLRE
          Length = 853

 Score =  104 bits (259), Expect = 4e-21
 Identities = 46/94 (48%), Positives = 51/94 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P   P+PP PP  +PP  P  SPPP    PP+    PPP    P P   +PPP  
Sbjct: 270 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPS 329

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              PPP S  PPP  S PPP P +PPP SPPP S
Sbjct: 330 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 363

 Score =  103 bits (257), Expect = 6e-21
 Identities = 50/98 (51%), Positives = 55/98 (56%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS----SPPPVQASPPPVQSAP 383
           PP + P  SP PP+PP   PP+ P  SPPP    PP   S    SPPP    PPP  S P
Sbjct: 223 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 282

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PP   S PPP   +PPP  S PPP+P  PPP SPPP S
Sbjct: 283 PPPPPSPPPPPPPSPPP-PSPPPPSPPPPPPPSPPPPS 319

 Score =  103 bits (256), Expect = 8e-21
 Identities = 49/94 (52%), Positives = 54/94 (57%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP  +PP  P  SPPP    PP   S PPP   SPPP   +PPP  
Sbjct: 218 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP---SPPPPPPPSPPP--PSPPPPS 272

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              PPP S  PPP  S PPP P +PPP SPPP S
Sbjct: 273 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 306

 Score =  101 bits (251), Expect = 3e-20
 Identities = 48/93 (51%), Positives = 53/93 (56%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP  S PP +   PPP    PPP  S PPP  
Sbjct: 293 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPP-PSPPPPSPPPPPPPSPPPPPPPSPPPPPP 351

Query: 396 QSSPPPVSSTP-PPVQSSPPPAPVTPPPASPPP 491
            S PPP    P PP  S PPP+P  PPP SPPP
Sbjct: 352 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 384

 Score =  100 bits (249), Expect = 5e-20
 Identities = 47/97 (48%), Positives = 51/97 (52%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP PP+  PP  P   PPP  S PP +   P P   SPPP    PPP  
Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 380

Query: 396 QSSPPPVSSTPPPVQSSPP---PAPVTPPPASPPPAS 497
              PPP  S PPP   SPP   P P +PPP SPPP S
Sbjct: 381 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 417

 Score =  100 bits (248), Expect = 7e-20
 Identities = 49/96 (51%), Positives = 53/96 (55%), Gaps = 3/96 (3%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS-SPPPVQASPPPVQSAPPPVQ 395
           P   P  SP PP PP+  PP+ P  SPPP    PP+    SPPP    PPP  S PPP  
Sbjct: 382 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 441

Query: 396 QSSPPPV--SSTPPPVQSSPPPAPVTPPPASPPPAS 497
            S PPP   S  PPP  S PPP P +PPP SPPP S
Sbjct: 442 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 477

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 48/94 (51%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP   S PPP   SPPP     PP  
Sbjct: 241 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP-- 298

Query: 396 QSSPPPVSSTPPPVQSSPPPAPV--TPPPASPPP 491
             SPPP S  PPP  S PPP+P   +PPP SPPP
Sbjct: 299 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 332

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 47/94 (50%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP  +PP  P  SPPP    PP     PPP  + PPP   +PPP  
Sbjct: 409 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPP----PPPPSPPPPPPPSPPPPPPPSPPPPP 464

Query: 396 QSSPPPVSSTP--PPVQSSPPPAPVTPPPASPPP 491
             SPPP S  P  PP  S PPP+P  PPP SPPP
Sbjct: 465 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 498

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 48/103 (46%), Positives = 52/103 (50%), Gaps = 9/103 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS------ 377
           PP + P  SP PP PP+  PP  P   PPP  S PP    SPPP     PP  S      
Sbjct: 419 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 478

Query: 378 ---APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              +PPP     PPP S  PPP  S PPP P +PPP SPPP S
Sbjct: 479 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 521

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 49/97 (50%), Positives = 55/97 (56%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS-SPPPVQASPPPVQSAPPPV 392
           PPS  P   P+PP PP  +PP  P  SPPP    PP+    SPPP    PPP  S PPP 
Sbjct: 327 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 386

Query: 393 QQSSPPPVSSTPPPVQSSPPPA--PVTPPPASPPPAS 497
             S PPP   +PPP  S PPP+  P +PPP SPPP S
Sbjct: 387 PPSPPPPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPS 422

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 49/96 (51%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP   S PPP   SPPP    PPP  
Sbjct: 399 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP----PPPPS 451

Query: 396 QSSPPPVSSTPPPVQSSPPPAPV--TPPPASPPPAS 497
              PPP S  PPP  S PPP+P   +PPP SPPP S
Sbjct: 452 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 487

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 50/101 (49%), Positives = 55/101 (54%), Gaps = 7/101 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQ-------SAPPTAQSSPPPVQASPPPVQ 374
           PP + P  SP PP PP+  PP+ P  SPPP         S PP +   PPP    PPP  
Sbjct: 228 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 287

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           S PPP   S PPP  S PPP  S PPP P +PPP SPPP S
Sbjct: 288 SPPPPPPPSPPPP--SPPPP--SPPPPPPPSPPPPSPPPPS 324

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 49/109 (44%), Positives = 54/109 (49%), Gaps = 15/109 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS-SPPPVQASPPPVQSAPPPV 392
           PPS  P   P+PP PP  +PP  P  SPPP    PP+    SPPP    PPP  S PPP 
Sbjct: 441 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 500

Query: 393 QQSSPPPVSSTPPPVQ--------------SSPPPAPVTPPPASPPPAS 497
             S PPP   +PPP                S PPP+P  PPP SPPP S
Sbjct: 501 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPS 549

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 46/94 (48%), Positives = 50/94 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP  +PP      PPP    PP   S PPP   SPPP    PP   
Sbjct: 464 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 523

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP S  PP   S PPP P +PPP SPPP S
Sbjct: 524 PPSPPPPSPPPP---SPPPPPPPSPPPPSPPPPS 554

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 51/105 (48%), Positives = 55/105 (52%), Gaps = 11/105 (10%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ------- 374
           PP + P  SP PP PP+  PP+ P  SPPP    PP   S PPP   SPPP         
Sbjct: 298 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 357

Query: 375 SAPPPVQQS-SPPPVSSTPPPVQS---SPPPAPVTPPPASPPPAS 497
           S PPP     SPPP S  PPP  S    PPP+P  PPP SPPP S
Sbjct: 358 SPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 402

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 49/106 (46%), Positives = 55/106 (51%), Gaps = 1/106 (0%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQAS 359
           C +        PP + P  SP PP+PP   PP+ P  SPPP    PP+    SPPP    
Sbjct: 182 CPISTPGIPSPPPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 238

Query: 360 PPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PPP  S PPP    SPPP S  PPP  S PPP+P  P P  PPP S
Sbjct: 239 PPPPPSPPPP----SPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPS 280

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 47/93 (50%), Positives = 51/93 (54%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           P   P  SP PP PP+  PP+ P  SPPP  S PP +   PPP    PPP  S PPP   
Sbjct: 338 PPPPPPPSPPPPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 396

Query: 399 SSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           S PPP  S PPP    P P P +PPP SPPP S
Sbjct: 397 SPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPS 427

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 46/92 (50%), Positives = 50/92 (54%), Gaps = 1/92 (1%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           P   P  SP PP+PP  +PP  P  SPPP    PP    SPPP    PPP  S PPP   
Sbjct: 289 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP----SPPPPSPPPPPPPSPPPPPPP 344

Query: 399 SSPPPVSSTPPPVQSSPP-PAPVTPPPASPPP 491
           S PPP   +PPP    PP P P +PPP SPPP
Sbjct: 345 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 376

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 45/92 (48%), Positives = 49/92 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP  +PP      PPP    PP   S PPP   SPPP    PP   
Sbjct: 350 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 409

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             SPPP S  PP   S PPP+P  PPP SPPP
Sbjct: 410 PPSPPPPSPPPP---SPPPPSPPPPPPPSPPP 438

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 48/102 (47%), Positives = 52/102 (50%), Gaps = 8/102 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQ----SAPPTAQSSPPPVQASPPPVQSAP 383
           PPS  P   P+PP PP  +PP  P  SPPP      S PP +   P P   SPPP    P
Sbjct: 371 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 430

Query: 384 PPVQQSSPPPVSSTPPPVQSS----PPPAPVTPPPASPPPAS 497
           PP     PPP  S PPP   S    PPP+P  PPP SPPP S
Sbjct: 431 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 472

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 46/97 (47%), Positives = 51/97 (52%), Gaps = 4/97 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQ--SAPPTAQSSPPPVQASPP--PVQSAP 383
           PP + P  SP PP+PP  +PP  P  SPPP    S PP    SPPP    PP  P  S P
Sbjct: 311 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 370

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PP     PPP    PPP    PPP P  PPP+ PPP+
Sbjct: 371 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 407

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 47/94 (50%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQ--SAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP + P  SP PP+PP  +PP  P  SPPP    S PP    SPPP   SPPP    PP 
Sbjct: 355 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP--PSPPPPSPPPPS 412

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               SPPP S  PP     PPP+P  PPP SPPP
Sbjct: 413 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 446

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 48/94 (51%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQ--SAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP + P  SP PP+PP  +PP  P  SPPP    S PP    SPPP   SPPP    PP 
Sbjct: 469 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP--PSPPPPSPPPPS 526

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               SPPP S  PPP  S PPP+P  PPP+ PPP
Sbjct: 527 PPPPSPPPPSPPPPPPPSPPPPSP--PPPSPPPP 558

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 51/101 (50%), Positives = 55/101 (54%), Gaps = 7/101 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS----SPPPVQASPPPVQSAP 383
           PP + P  SP PP+PP   PP+ P  SPPP    PP   S    SPPP    PPP  S P
Sbjct: 208 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 264

Query: 384 PPVQQSSPPPVSSTPPPVQS---SPPPAPVTPPPASPPPAS 497
           PP    SPPP S  PPP  S    PPP+P  PPP SPPP S
Sbjct: 265 PP----SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 301

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 44/92 (47%), Positives = 48/92 (52%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           P   P  SP PP PP+  PP  P   PPP  S PP +   P P   SPPP    PPP   
Sbjct: 436 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 495

Query: 399 SSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
             PPP  S PPP   SPPP P  PPP+ PPP+
Sbjct: 496 PPPPPPPSPPPPPPPSPPP-PSPPPPSPPPPS 526

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 45/97 (46%), Positives = 49/97 (50%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P+  P PP  P   PP +P   PPP  S PP +   P P   SPPP    PPP  
Sbjct: 437 PPPPPPSPPPPPPPSPPPPPPPSPPPPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPPPP 494

Query: 396 QSSPPPVSSTPPPVQSSPP---PAPVTPPPASPPPAS 497
              PPP  S PPP   SPP   P P +PPP SPPP S
Sbjct: 495 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 531

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 31/60 (51%), Positives = 34/60 (56%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP   S PPP   SPPP  S PPP Q
Sbjct: 508 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPPPPSPPPP---SPPP-PSPPPPCQ 560

[28][TOP]
>UniRef100_Q9LJ64 Extensin protein-like n=1 Tax=Arabidopsis thaliana
           RepID=Q9LJ64_ARATH
          Length = 956

 Score =  103 bits (258), Expect = 5e-21
 Identities = 49/102 (48%), Positives = 59/102 (57%), Gaps = 4/102 (3%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPA---PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP 368
           S   ++  +TSP + P    PP PP ++PP    + PPP+ S PP   S PPPV + PPP
Sbjct: 628 SPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPP 687

Query: 369 VQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
              +PPP   S PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 688 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 729

 Score =  103 bits (256), Expect = 8e-21
 Identities = 50/96 (52%), Positives = 56/96 (58%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P  + P    +PP PP ++PP    + PPPV S PP   S PPPV + PPPV S PPPVQ
Sbjct: 673 PVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQ 732

Query: 396 QSSPPPVSSTPPPVQ-SSPPPAPVTPPPA---SPPP 491
              PPPV S PPP    SPPP PV  PP    SPPP
Sbjct: 733 SPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPP 768

 Score =  102 bits (254), Expect = 1e-20
 Identities = 51/97 (52%), Positives = 55/97 (56%), Gaps = 5/97 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP  SP      P PP ++PP  P  SPPP V S PP   S PPPV + PPPV S PPPV
Sbjct: 665 PPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPV 724

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPA----SPPP 491
               PP  S  PPPV S PPPAP+  PP     SPPP
Sbjct: 725 HSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPP 761

 Score =  101 bits (252), Expect = 2e-20
 Identities = 54/105 (51%), Positives = 58/105 (55%), Gaps = 7/105 (6%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPT----PPTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASP 362
           S     PP   P  SP PP     PP ++PP    + PPPV S PP    S PPPV + P
Sbjct: 641 SPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPP 700

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           PPV S PPPV  S PPPV S PPPV S PPP    PPP   SPPP
Sbjct: 701 PPVHSPPPPVH-SPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPP 744

 Score =  100 bits (248), Expect = 7e-20
 Identities = 51/105 (48%), Positives = 57/105 (54%), Gaps = 13/105 (12%)
 Frame = +3

Query: 216 PPSTSPNASPA-PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP-- 386
           PP  SP   P   P PP ++PP    + PPPV S PP   S PPPV + PPPVQS PP  
Sbjct: 679 PPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738

Query: 387 --------PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
                   P+    PPPV S PPPV S PPP   +PPP   SPPP
Sbjct: 739 VFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPP 783

 Score =  100 bits (248), Expect = 7e-20
 Identities = 50/97 (51%), Positives = 53/97 (54%), Gaps = 5/97 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP----VQASPPPVQSAP 383
           PP  SP      P PP ++PP    + PPPVQS PP    SPPP        PPPV S P
Sbjct: 701 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPP 760

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
           PPV    PPPV S PPPV S PPP    PPP  SPPP
Sbjct: 761 PPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 797

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 52/99 (52%), Positives = 56/99 (56%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPP-VQSAPPTA---QSSPPPVQASPPPVQSAP 383
            PP  SP      P PP ++PP   Q+ PPP V S PP A      PPPV + PPPV S P
Sbjct: 708  PPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPP 767

Query: 384  PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPPAS 497
            PP   S PPPV S PPPV S PPP    PPP  SPPP S
Sbjct: 768  PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPS 806

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 50/96 (52%), Positives = 55/96 (57%), Gaps = 3/96 (3%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           Q P   P  SP PP P  + PP    + PPPV S PP      PPV + PPPV S PPPV
Sbjct: 732 QSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPP------PPVHSPPPPVHSPPPPV 785

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPA---SPPP 491
             S PPPV S PPPV S PPP+P+  PP    SPPP
Sbjct: 786 H-SPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPP 820

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 48/99 (48%), Positives = 52/99 (52%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPP----VQSAPPTAQSSPPPVQASPPPVQSAP 383
            PP  SP      P PP  +PP  P  SPPP        PP   S PPPV + PPP   +P
Sbjct: 715  PPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSP 774

Query: 384  PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA---SPPP 491
            PP   S PPPV S PPPV S PPP    PPP+   SPPP
Sbjct: 775  PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPP 813

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/98 (55%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQAS--PPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PP  +P  SP PP  P ++PP  P  S  PPPV S PP   S PPPV + PPPV S PPP
Sbjct: 742  PPPPAPIYSPPPP--PVHSPPP-PVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 798

Query: 390  VQQSSPP-PVSSTPPPVQSSPPPAPVTP-PPASPPPAS 497
            V    PP P+ S PPPV  SPPP PVTP PPA+ P A+
Sbjct: 799  VHSPPPPSPIYSPPPPV-FSPPPKPVTPLPPATSPMAN 835

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 48/86 (55%), Positives = 54/86 (62%), Gaps = 3/86 (3%)
 Frame = +3

Query: 243 PAPPTPPTN-TPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVS 419
           P PP+P T  T  T+PQ+  PPV S PP     PPPV + PPPV S PPP+  S PPPV 
Sbjct: 624 PQPPSPSTEETKTTSPQS--PPVHSPPP-----PPPVHSPPPPVFSPPPPM-HSPPPPVY 675

Query: 420 STPPPVQSSPPPAPVTPPPA--SPPP 491
           S PPPV S PPP   +PPP   SPPP
Sbjct: 676 SPPPPVHSPPPPPVHSPPPPVHSPPP 701

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 47/106 (44%), Positives = 54/106 (50%), Gaps = 12/106 (11%)
 Frame = +3

Query: 210 QQPPST------SPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP--PPVQASPP 365
           +QPP T      SP      P  P +  P   +   PP  S   T  +SP  PPV + PP
Sbjct: 590 EQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPP 649

Query: 366 P--VQSAPPPVQQSSPPPVSSTPPPVQSSPPP--APVTPPPASPPP 491
           P  V S PPPV  S PPP+ S PPPV S PPP  +P  PP  SPPP
Sbjct: 650 PPPVHSPPPPVF-SPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP 694

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 48/146 (32%), Positives = 55/146 (37%), Gaps = 52/146 (35%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASP---------------PPVQSAPPTAQS--- 335
           Q+ P    +  P PP   T  P  +P+  P               PP Q  PP  ++   
Sbjct: 541 QETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQEQPPKTEAPKM 600

Query: 336 -SPP--------PVQASP-----------------------PPVQSAPPPVQ-QSSPPPV 416
            SPP        P  ASP                       PPV S PPP    S PPPV
Sbjct: 601 GSPPLESPVPNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPV 660

Query: 417 SSTPPPVQSSPPPAPVTPPPA-SPPP 491
            S PPP+ S PPP    PPP  SPPP
Sbjct: 661 FSPPPPMHSPPPPVYSPPPPVHSPPP 686

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 33/96 (34%), Positives = 43/96 (44%), Gaps = 3/96 (3%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPPVQS--A 380
           Q+PP    +  P PP P  +  P  P Q +P P +S  P      PP Q +P P +S   
Sbjct: 514 QEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQ-----PPKQETPKPEESPKP 568

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
            PP Q++  P  S  P P +   PP    P   SPP
Sbjct: 569 QPPKQETPKPEESPKPQPPKQEQPPKTEAPKMGSPP 604

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 34/96 (35%), Positives = 43/96 (44%), Gaps = 5/96 (5%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP-PPVQASPPPVQS-APP 386
           +PP    +  P PP   T  P  +P+  PP  ++  P     P PP Q +P P +S  P 
Sbjct: 526 EPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQ 585

Query: 387 PVQQSSPPPVSSTPPPVQSSPP---PAPVTPPPASP 485
           P +Q  PP    T  P   SPP   P P  P  ASP
Sbjct: 586 PPKQEQPP---KTEAPKMGSPPLESPVPNDPYDASP 618

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 37/118 (31%), Positives = 47/118 (39%), Gaps = 24/118 (20%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPP-PVQASPP------- 365
            PP  SP      P PP ++PP    + PPP  + S PP   S PP PV   PP       
Sbjct: 776  PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMAN 835

Query: 366  --------------PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                          PVQ+  P  +    P  S+  P  +SSP P+P + P    P  S
Sbjct: 836  APTPSSSESGEISTPVQAPTPDSEDIEAPSDSNHSPVFKSSPAPSPDSEPEVEAPVPS 893

[29][TOP]
>UniRef100_O81765 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=O81765_ARATH
          Length = 699

 Score =  102 bits (254), Expect = 1e-20
 Identities = 55/104 (52%), Positives = 59/104 (56%), Gaps = 11/104 (10%)
 Frame = +3

Query: 216 PPSTSPNASPAP---PTPPTNTPPTTPQASPPP----VQSAPPTAQSSPPPVQASPPPVQ 374
           PP  SP   P P   P PP ++PP  P  SPPP    V S PP   S PPPV + PPPV 
Sbjct: 528 PPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVH 587

Query: 375 SAPPPVQQSSPP-PVSSTPPPVQSSPPPAPVTPPPA---SPPPA 494
           S PPPV    PP PV S PPPV S PPP PV  PP    SPPP+
Sbjct: 588 SPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPS 631

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 53/100 (53%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A    PP   P  SP PP PP ++PP    + PPP   +PP     PPPV + PPPV S 
Sbjct: 521 APVNSPPP--PVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPP---PPPVHSPPPPVFSP 575

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA---SPPP 491
           PPPV  S PPPV S PPPV S PPPAPV  PP    SPPP
Sbjct: 576 PPPVY-SPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPP 614

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 46/93 (49%), Positives = 52/93 (55%), Gaps = 2/93 (2%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP--PVQSAPPPV 392
           P   P  SP PP PP ++PP    + PPPV S PP   S PPPV + PP  PV S PPPV
Sbjct: 550 PPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPV 609

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP   +PPP   SPPP+   P   SPPP
Sbjct: 610 HSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPP 642

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 50/102 (49%), Positives = 56/102 (54%), Gaps = 10/102 (9%)
 Frame = +3

Query: 216 PPSTSPNASP-----APPTPPTNTPPTTP---QASPPPVQSAPPTAQSSPPPVQASPPPV 371
           PP   P  SP     +PP PP  +PP  P    + PPPV S PP   S PPPV + PPPV
Sbjct: 534 PPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPV 593

Query: 372 QSAPPPVQ-QSSPPPVSSTPPPVQ-SSPPPAPVTPPPASPPP 491
            S PPP    S PPPV S PPP    SPPP   +PPP+  PP
Sbjct: 594 HSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPP 635

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 52/106 (49%), Positives = 57/106 (53%), Gaps = 13/106 (12%)
 Frame = +3

Query: 216 PPSTSPNASPAP---PTPPTNTPPTTPQASPPPVQSAPPTAQSSPP--PVQASPPPVQSA 380
           PP  SP   P P   P PP  +PP    + PPPV S PP   S PP  PV + PPPV S 
Sbjct: 553 PPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSP 612

Query: 381 PPPVQQSSPPPVSSTPPPVQS-----SPPPAPV---TPPPASPPPA 494
           PPP    SPPP   +PPP QS     SPPP P    +PP  SPPPA
Sbjct: 613 PPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPA 658

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 41/91 (45%), Positives = 47/91 (51%), Gaps = 1/91 (1%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA-SPPPVQSAPPPVQ 395
           P   P+  P+ P      P  +PQ   P  QS P T + SPPP    SPPP   +PPP  
Sbjct: 479 PVDKPSPVPSRPVQKPQPPKESPQPDDPYDQS-PVTKRRSPPPAPVNSPPPPVYSPPP-- 535

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
              PPPV S PPPV S PPP   +PPP  PP
Sbjct: 536 --PPPPVHSPPPPVHSPPPPPVYSPPPPPPP 564

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 46/100 (46%), Positives = 54/100 (54%), Gaps = 7/100 (7%)
 Frame = +3

Query: 216 PPSTSPNA---SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PP  SP     SP PP P  + PP      PPP   +PP    SPPP Q+  PPV  +PP
Sbjct: 584 PPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQS--PPVVYSPP 641

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPV----TPPPASPPPA 494
           P     PP ++S  PPVQ SPPPAPV    TPP  +P P+
Sbjct: 642 P----RPPKINS--PPVQ-SPPPAPVEKKETPPAHAPAPS 674

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 42/100 (42%), Positives = 50/100 (50%), Gaps = 8/100 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT------PPTNTPPTTPQASPPPVQSAPPTAQSSPP-PVQASPPPVQ 374
           PP  +P  SP PP       PP  +PP  P  SPPP QS PP   S PP P + + PPVQ
Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPPVYSPP-PPVFSPPPSQS-PPVVYSPPPRPPKINSPPVQ 653

Query: 375 SAPP-PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           S PP PV++   PP  +  P       P  +    ASPPP
Sbjct: 654 SPPPAPVEKKETPPAHAPAPSDDEFIIPPFIGHQYASPPP 693

[30][TOP]
>UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1
            Tax=Ostreococcus tauri RepID=Q010M7_OSTTA
          Length = 1449

 Score =  101 bits (251), Expect = 3e-20
 Identities = 53/105 (50%), Positives = 59/105 (56%), Gaps = 3/105 (2%)
 Frame = +3

Query: 189  VFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP 368
            V   A    PPS  P   P+PP PP+  PP  P + PPP    PPT  S PPP   SPPP
Sbjct: 779  VLGQARQSPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPN--PPTPPSPPPP--PSPPP 834

Query: 369  VQSAPPPVQQS---SPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              S+PPP   S   SPPP  S PPP   +PPPAP  PPP SPPP+
Sbjct: 835  PPSSPPPPSPSPPPSPPPAPSPPPP--PNPPPAPTPPPPPSPPPS 877

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 49/96 (51%), Positives = 53/96 (55%), Gaps = 3/96 (3%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP  SP   P PPTPP+  PP     SPPP  S+PP    SPPP   SPPP  S PPP  
Sbjct: 809  PPPPSPPPPPNPPTPPSPPPPP----SPPPPPSSPPPPSPSPPP---SPPPAPSPPPPPN 861

Query: 396  QS---SPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
                 +PPP  S PP    SPPP P  PPP SPPP+
Sbjct: 862  PPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPS 897

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/93 (48%), Positives = 50/93 (53%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP-VQSAPPPV 392
            PP  SP   P PP+PP    P TP + PPP   +PP   SSPPP   SPPP    AP P 
Sbjct: 800  PPPPSPPPPPPPPSPPPPPNPPTPPSPPPP--PSPPPPPSSPPPPSPSPPPSPPPAPSPP 857

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               +PPP  + PPP    P P P  PPP SPPP
Sbjct: 858  PPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPP 890

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 50/102 (49%), Positives = 56/102 (54%), Gaps = 8/102 (7%)
 Frame = +3

Query: 216  PPSTSPNASPAPPT--PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PPS+ P  SP+PP   PP  +PP  P   P P    PP+   SPPP   SPPP  S PPP
Sbjct: 835  PPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPP---SPPPPPSPPPP 891

Query: 390  VQ---QSSPPPVSSTP---PPVQSSPPPAPVTPPPASPPPAS 497
                   SPPP S+ P   PP  SSPPP    PPP+SPPP S
Sbjct: 892  PSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPS 933

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 50/98 (51%), Positives = 58/98 (59%), Gaps = 7/98 (7%)
 Frame = +3

Query: 219  PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP---PVQSAPPP 389
            P   PN  PAP  PP  +PP +P  SPPP  S PP    SPPP  + PP   P  S+PPP
Sbjct: 856  PPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPP--SPPPSPSPPPSSNPPLSSPPP 913

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPP----PASPPP 491
            +  SSPPP+SS PPP  S PPP+P  PP    P +PPP
Sbjct: 914  L--SSPPPLSSPPPP-SSPPPPSPPLPPSPPLPPNPPP 948

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/93 (53%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASP-PPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            PPS  P+  P+PP PP+  PP +P  SP PP  S PP   SSPPP+ +SPPP+ S PPP 
Sbjct: 871  PPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPL--SSPPPL-SSPPPLSSPPPP- 926

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              SSPPP S   PP+  SPP  P  PPP SP P
Sbjct: 927  --SSPPPPS---PPLPPSPPLPPNPPPPPSPSP 954

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/94 (48%), Positives = 54/94 (57%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            P   SP   P+PP PP++ PP +P  SPPP   +PP A S PPP   +PPP  + PPP  
Sbjct: 821  PTPPSPPPPPSPPPPPSSPPPPSP--SPPP---SPPPAPSPPPP--PNPPPAPTPPPPPS 873

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                PP S  PPP   SPPP P  PP  SPPP+S
Sbjct: 874  PPPSPPPSPPPPP---SPPPPPSPPPSPSPPPSS 904

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 49/93 (52%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP+ SP   P PP  PT  PP +P  SPPP   +PP   S PPP   SPPP  S PP   
Sbjct: 851  PPAPSPPPPPNPPPAPTPPPPPSPPPSPPP---SPPPPPSPPPP--PSPPPSPSPPPSSN 905

Query: 396  Q--SSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
               SSPPP+SS PPP+ S PPP+  +PPP SPP
Sbjct: 906  PPLSSPPPLSS-PPPLSSPPPPS--SPPPPSPP 935

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 45/102 (44%), Positives = 56/102 (54%), Gaps = 10/102 (9%)
 Frame = +3

Query: 216  PPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP--P 386
            PPS  P  SP P P+PP ++ P  P +SPPP+ S PP   SSPPP  + PPP    P  P
Sbjct: 885  PPSPPPPPSPPPSPSPPPSSNP--PLSSPPPLSSPPPL--SSPPPPSSPPPPSPPLPPSP 940

Query: 387  PVQQSSPPPVSSTP-------PPVQSSPPPAPVTPPPASPPP 491
            P+  + PPP S +P       PP   +P P P +PP   PPP
Sbjct: 941  PLPPNPPPPPSPSPXXXXXXXPPRLPTPSPPPPSPPLPPPPP 982

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 34/63 (53%), Positives = 38/63 (60%)
 Frame = +3

Query: 309 QSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           QS PP   S PPP+  SPPP  S PPP    SPPP  + P P    PPP+P  PPP+SPP
Sbjct: 785 QSPPP---SPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSP-PPPPSSPP 840

Query: 489 PAS 497
           P S
Sbjct: 841 PPS 843

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 33/76 (43%), Positives = 39/76 (51%)
 Frame = +3

Query: 270 TPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSP 449
           +PP +P   PPP+  +PP   S PPP    PPP    PPP      PP   +PPP  S P
Sbjct: 786 SPPPSP---PPPLPPSPPPPPSPPPP----PPPPSPPPPP-----NPPTPPSPPPPPSPP 833

Query: 450 PPAPVTPPPASPPPAS 497
           PP    PPP+  PP S
Sbjct: 834 PPPSSPPPPSPSPPPS 849

[31][TOP]
>UniRef100_Q41805 Extensin-like protein n=1 Tax=Zea mays RepID=Q41805_MAIZE
          Length = 1188

 Score =  100 bits (250), Expect = 4e-20
 Identities = 52/99 (52%), Positives = 63/99 (63%), Gaps = 8/99 (8%)
 Frame = +3

Query: 219  PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTA--QSSPPPVQASPP--PVQSAPP 386
            P  +P +SP PP   +  PP    + PPPV+S PP A   S PPPV++ PP  PV S PP
Sbjct: 996  PPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPP 1055

Query: 387  PVQQSSPP-PVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
            PV+   PP P+SS PPPV+S PPPAPV+ PP    SPPP
Sbjct: 1056 PVKSPPPPAPISSPPPPVKSPPPPAPVSSPPPPVKSPPP 1094

 Score =  100 bits (249), Expect = 5e-20
 Identities = 53/108 (49%), Positives = 64/108 (59%), Gaps = 18/108 (16%)
 Frame = +3

Query: 222  STSPNASPAPPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPP--VQASPPPVQSAPPP 389
            S  P    +PP  P ++PP TP++SPPP  V   PP  +SSPPP  V + PP  +S+PPP
Sbjct: 939  SPPPTVKSSPPPAPVSSPPATPKSSPPPAPVNLPPPEVKSSPPPTPVSSPPPAPKSSPPP 998

Query: 390  VQQSSPP-----------PVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
               SSPP           PVSS PPPV+S PPPAPV+ PP    SPPP
Sbjct: 999  APMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPP 1046

 Score =  100 bits (249), Expect = 5e-20
 Identities = 58/119 (48%), Positives = 68/119 (57%), Gaps = 20/119 (16%)
 Frame = +3

Query: 195  VSAGAQQPPSTSPNASP--APPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPPVQASP 362
            V +     P +SP A+P  +PP  P N PP   ++SPPP  V S PP  +SSPPP   S 
Sbjct: 944  VKSSPPPAPVSSPPATPKSSPPPAPVNLPPPEVKSSPPPTPVSSPPPAPKSSPPPAPMSS 1003

Query: 363  PP---VQSAPPPVQQSSPP----------PVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
            PP   V+S PPP   SSPP          PVSS PPPV+S PPPAPV+ PP    SPPP
Sbjct: 1004 PPPPEVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPP 1062

 Score =  100 bits (248), Expect = 7e-20
 Identities = 60/118 (50%), Positives = 71/118 (60%), Gaps = 25/118 (21%)
 Frame = +3

Query: 216  PPST-----SPNASPAPPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPPVQ--ASPPP 368
            PPST     S    P+PP  P ++PP TP++SPPP  V S PPT  SSPP +   +SPP 
Sbjct: 704  PPSTPSKPPSSPEKPSPPKEPVSSPPQTPKSSPPPAPVSSPPPTPVSSPPALAPVSSPPS 763

Query: 369  VQSAPPPVQQSSPPP---VSSTPPPVQ---------SSPPPAPVTPPP----ASPPPA 494
            V+S+PPP   SSPPP   V S+PPPVQ         SSPP APV+ PP     SPPPA
Sbjct: 764  VKSSPPPAPLSSPPPAPQVKSSPPPVQVSSPPPAPKSSPPLAPVSSPPQVEKTSPPPA 821

 Score =  100 bits (248), Expect = 7e-20
 Identities = 57/109 (52%), Positives = 70/109 (64%), Gaps = 14/109 (12%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPTA--QSSPPPVQASPPP--V 371
            + PP  +P +SP PP  +PP   P ++P   PPPV+S PP A   S PPPV++ PPP  V
Sbjct: 1026 KSPPPPAPVSSPPPPVKSPPPPAPVSSP---PPPVKSPPPPAPISSPPPPVKSPPPPAPV 1082

Query: 372  QSAPPPVQQSSPP-PVSSTPPPVQSSPPPAPV-TPPPAS------PPPA 494
             S PPPV+   PP PVSS PPP++S PPPAPV +PPPA       PPPA
Sbjct: 1083 SSPPPPVKSPPPPAPVSSPPPPIKSPPPPAPVSSPPPAPVKPPSLPPPA 1131

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 53/100 (53%), Positives = 64/100 (64%), Gaps = 10/100 (10%)
 Frame = +3

Query: 222  STSPNASPAPPTPPTNTPPTTPQASPPP--VQSAPPTA--QSSPPPVQASPP--PVQSAP 383
            S  P    +PP  P ++PP  P +SPPP  V+S PP A   S PPPV++ PP  PV S P
Sbjct: 979  SPPPTPVSSPPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPPAPVSSPP 1038

Query: 384  PPVQQSSPP-PVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
            PPV+   PP PVSS PPPV+S PPPAP++ PP    SPPP
Sbjct: 1039 PPVKSPPPPAPVSSPPPPVKSPPPPAPISSPPPPVKSPPP 1078

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 55/117 (47%), Positives = 68/117 (58%), Gaps = 22/117 (18%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPP--TPPTNTP---PTTPQASPPP---VQSAPPTAQSSPPP--VQAS 359
            + PP  +P +SP PP  +PP   P   P  P  SPPP   V S PP  +S PPP  + + 
Sbjct: 1010 KSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPISSP 1069

Query: 360  PPPVQSAPPPVQQSSPP----------PVSSTPPPVQSSPPPAPVTPPPASP--PPA 494
            PPPV+S PPP   SSPP          PVSS PPP++S PPPAPV+ PP +P  PP+
Sbjct: 1070 PPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPIKSPPPPAPVSSPPPAPVKPPS 1126

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 58/126 (46%), Positives = 67/126 (53%), Gaps = 27/126 (21%)
 Frame = +3

Query: 195  VSAGAQQPPSTSPNA-----------SPAPPTPPTNTPPTTPQASPP-PVQSAPPTAQSS 338
            VS+    P S+ P A           SP PP P ++ PP      PP PV S PP  +S 
Sbjct: 985  VSSPPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSP 1044

Query: 339  PP--PVQASPPPVQSAPPPVQQSSPP----------PVSSTPPPVQSSPPPAPVTPPP-- 476
            PP  PV + PPPV+S PPP   SSPP          PVSS PPPV+S PPPAPV+ PP  
Sbjct: 1045 PPPAPVSSPPPPVKSPPPPAPISSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPP 1104

Query: 477  -ASPPP 491
              SPPP
Sbjct: 1105 IKSPPP 1110

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 61/142 (42%), Positives = 77/142 (54%), Gaps = 41/142 (28%)
 Frame = +3

Query: 195  VSAGAQQPPSTSPNA--SPAPPTPPTNTPPTTPQASPPPVQSAPPTA-----------QS 335
            VS+  Q P S+ P A  S  PPTP ++ P   P +SPP V+S+PP A           +S
Sbjct: 725  VSSPPQTPKSSPPPAPVSSPPPTPVSSPPALAPVSSPPSVKSSPPPAPLSSPPPAPQVKS 784

Query: 336  SPPPVQ-ASPPPVQ---------SAPPPVQQSSPPP------------------VSSTPP 431
            SPPPVQ +SPPP           S+PP V+++SPPP                  VSS PP
Sbjct: 785  SPPPVQVSSPPPAPKSSPPLAPVSSPPQVEKTSPPPAPLSSPPLAPKSSPPHVVVSSPPP 844

Query: 432  PVQSSPPPAPVTPPPASPPPAS 497
             V+SSPPPAPV+ PP +P PAS
Sbjct: 845  VVKSSPPPAPVSSPPLTPKPAS 866

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 53/101 (52%), Positives = 62/101 (61%), Gaps = 9/101 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQ-SSPPPVQASPPP---VQSAP 383
           PP     + PAP   P+  PP +  + PPPV+S PP A   SPPP + SPPP   V S P
Sbjct: 517 PPPVKTTSPPAPIGSPSPPPPVSVVSPPPPVKSPPPPAPVGSPPPPEKSPPPPAPVASPP 576

Query: 384 PPVQQSSPPP--VSSTPPPVQSSPPPAPVTPPP---ASPPP 491
           PPV +S PPP  V+S PPPV+S PPPAPV  PP    SPPP
Sbjct: 577 PPV-KSPPPPTLVASPPPPVKSPPPPAPVASPPPPVKSPPP 616

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 50/104 (48%), Positives = 61/104 (58%), Gaps = 6/104 (5%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT---AQSSPPPVQASPPP-- 368
           G+  PP   P +  +PP P  + PP  P  SPPP + +PP      S PPPV++ PPP  
Sbjct: 530 GSPSPPP--PVSVVSPPPPVKSPPPPAPVGSPPPPEKSPPPPAPVASPPPPVKSPPPPTL 587

Query: 369 VQSAPPPVQQSSPP-PVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           V S PPPV+   PP PV+S PPPV+S PPP PV  PP   P AS
Sbjct: 588 VASPPPPVKSPPPPAPVASPPPPVKSPPPPTPVASPPPPAPVAS 631

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 52/102 (50%), Positives = 64/102 (62%), Gaps = 8/102 (7%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           + PP  +P ASP PP  +PP   PPT   + PPPV+S PP     P PV + PPPV+S P
Sbjct: 564 KSPPPPAPVASPPPPVKSPP---PPTLVASPPPPVKSPPP-----PAPVASPPPPVKSPP 615

Query: 384 PPVQ-QSSPP--PVSSTPPPVQSSPPPAPVT---PPPASPPP 491
           PP    S PP  PV+S+PPP++S PPP PV+   PP  SPPP
Sbjct: 616 PPTPVASPPPPAPVASSPPPMKSPPPPTPVSSPPPPEKSPPP 657

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 53/109 (48%), Positives = 66/109 (60%), Gaps = 17/109 (15%)
 Frame = +3

Query: 219  PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPP-TAQSSPPPVQASPPP--VQSAPPP 389
            P + P +SP PPTP +  PP    + PP + S+PP T +SSPPPV  S PP  V+S+PPP
Sbjct: 892  PPSEPKSSP-PPTPVSLPPPIVKSSPPPAMVSSPPMTPKSSPPPVVVSSPPPTVKSSPPP 950

Query: 390  VQQSSPP----------PVSSTPPPVQSSPPPAPVTPPP----ASPPPA 494
               SSPP          PV+  PP V+SSPPP PV+ PP    +SPPPA
Sbjct: 951  APVSSPPATPKSSPPPAPVNLPPPEVKSSPPPTPVSSPPPAPKSSPPPA 999

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 59/122 (48%), Positives = 71/122 (58%), Gaps = 22/122 (18%)
 Frame = +3

Query: 195  VSAGAQQPPSTSPNASPAPPTPPTNTP-------PTTPQA-----SPP--PVQSAPPTAQ 332
            V +     P +SP  +P P +PP +         P+TP A     SPP  P  S PPT  
Sbjct: 846  VKSSPPPAPVSSPPLTPKPASPPAHVSSPPEVVKPSTPPAPTTVISPPSEPKSSPPPTPV 905

Query: 333  SSPPP-VQASPPPVQ-SAPPPVQQSSPPP--VSSTPPPVQSSPPPAPVTPPPA----SPP 488
            S PPP V++SPPP   S+PP   +SSPPP  VSS PP V+SSPPPAPV+ PPA    SPP
Sbjct: 906  SLPPPIVKSSPPPAMVSSPPMTPKSSPPPVVVSSPPPTVKSSPPPAPVSSPPATPKSSPP 965

Query: 489  PA 494
            PA
Sbjct: 966  PA 967

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 52/107 (48%), Positives = 65/107 (60%), Gaps = 15/107 (14%)
 Frame = +3

Query: 216  PPSTSPNASP-----APPTPPTNTPPTTPQASPPPV--QSAPPTAQSSPPPVQASPPPV- 371
            PP T  +  P     +PP    ++PP TP++SPPPV   S PPT +SSPPP   S PP  
Sbjct: 900  PPPTPVSLPPPIVKSSPPPAMVSSPPMTPKSSPPPVVVSSPPPTVKSSPPPAPVSSPPAT 959

Query: 372  -QSAPPPVQQSSPPP-VSSTPPPVQ-SSPPPAPVTPPP----ASPPP 491
             +S+PPP   + PPP V S+PPP   SSPPPAP + PP    +SPPP
Sbjct: 960  PKSSPPPAPVNLPPPEVKSSPPPTPVSSPPPAPKSSPPPAPMSSPPP 1006

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 59/130 (45%), Positives = 69/130 (53%), Gaps = 33/130 (25%)
 Frame = +3

Query: 201  AGAQQPPSTSPNASPA-----------PPTPPTNT----PPTTPQASPPP--VQSAPPTA 329
            A    PP T   ASP            P TPP  T    PP+ P++SPPP  V   PP  
Sbjct: 853  APVSSPPLTPKPASPPAHVSSPPEVVKPSTPPAPTTVISPPSEPKSSPPPTPVSLPPPIV 912

Query: 330  QSSPPPVQASPPPV--QSAPPPVQQSSPPP-VSSTPPPV---------QSSPPPAPVTPP 473
            +SSPPP   S PP+  +S+PPPV  SSPPP V S+PPP          +SSPPPAPV  P
Sbjct: 913  KSSPPPAMVSSPPMTPKSSPPPVVVSSPPPTVKSSPPPAPVSSPPATPKSSPPPAPVNLP 972

Query: 474  P----ASPPP 491
            P    +SPPP
Sbjct: 973  PPEVKSSPPP 982

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 56/114 (49%), Positives = 66/114 (57%), Gaps = 17/114 (14%)
 Frame = +3

Query: 201  AGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPP-PVQSAPPTAQSSPPP--VQASPPPV 371
            A    PP T P +SP PP   ++ PPT   + PP PV S P T +SSPPP  V   PP V
Sbjct: 919  AMVSSPPMT-PKSSP-PPVVVSSPPPTVKSSPPPAPVSSPPATPKSSPPPAPVNLPPPEV 976

Query: 372  QSAPPPVQQSSPP----------PVSSTPPP-VQSSPPPAPVTPPP---ASPPP 491
            +S+PPP   SSPP          P+SS PPP V+S PPPAPV+ PP    SPPP
Sbjct: 977  KSSPPPTPVSSPPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPP 1030

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/109 (47%), Positives = 62/109 (56%), Gaps = 15/109 (13%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ-SAPP 386
           + PP  +P ASP PP    + PP TP ASPPP    P    SSPPP+++ PPP   S+PP
Sbjct: 596 KSPPPPAPVASPPPPVK--SPPPPTPVASPPP----PAPVASSPPPMKSPPPPTPVSSPP 649

Query: 387 PVQQS--SPPPVSSTPPP---------VQSSPPPAPVTPPPA---SPPP 491
           P ++S   PPP  STPPP         V+SSPPP    PPP    SPPP
Sbjct: 650 PPEKSPPPPPPAKSTPPPEEYPTPPTSVKSSPPPEKSLPPPTLIPSPPP 698

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/105 (49%), Positives = 61/105 (58%), Gaps = 8/105 (7%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQAS-PPPVQSAPP-TAQSSPPPVQASPPP---V 371
           A  PP   P  SP PPTP  + PP  P AS PPP++S PP T  SSPPP + SPPP    
Sbjct: 605 ASPPP---PVKSPPPPTPVASPPPPAPVASSPPPMKSPPPPTPVSSPPPPEKSPPPPPPA 661

Query: 372 QSAPPPVQQSSPP-PVSSTPPPVQSSPPPA--PVTPPPASPPPAS 497
           +S PPP +  +PP  V S+PPP +S PPP   P  PP   P P S
Sbjct: 662 KSTPPPEEYPTPPTSVKSSPPPEKSLPPPTLIPSPPPQEKPTPPS 706

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 46/100 (46%), Positives = 59/100 (59%), Gaps = 6/100 (6%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPTA--QSSPPPVQASPPP--V 371
            + PP  +P +SP PP  +PP   P ++P   PPPV+S PP A   S PPPV++ PPP  V
Sbjct: 1042 KSPPPPAPVSSPPPPVKSPPPPAPISSP---PPPVKSPPPPAPVSSPPPPVKSPPPPAPV 1098

Query: 372  QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             S PPP++   PP   S+PPP    PP  P   P +SPPP
Sbjct: 1099 SSPPPPIKSPPPPAPVSSPPPAPVKPPSLPPPAPVSSPPP 1138

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 52/113 (46%), Positives = 63/113 (55%), Gaps = 24/113 (21%)
 Frame = +3

Query: 219  PSTSPNASPAPPTPPTNTPPTTPQASPP--PVQSAPPTAQSSPPP--VQ----------- 353
            PS  P   P PP+ P+  P +  + SPP  PV S P T +SSPPP  V            
Sbjct: 694  PSPPPQEKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQTPKSSPPPAPVSSPPPTPVSSPP 753

Query: 354  -----ASPPPVQSAPPPVQQSSPPP---VSSTPPPVQ-SSPPPAPVTPPPASP 485
                 +SPP V+S+PPP   SSPPP   V S+PPPVQ SSPPPAP + PP +P
Sbjct: 754  ALAPVSSPPSVKSSPPPAPLSSPPPAPQVKSSPPPVQVSSPPPAPKSSPPLAP 806

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 53/114 (46%), Positives = 63/114 (55%), Gaps = 20/114 (17%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPP---TPPTN----TPPTTPQASPPP-VQSAPPTAQ----SSPPPVQ 353
           + PP+TSP+    PP   TPP +    +PP  P  SPPP V++  P A     S PPPV 
Sbjct: 480 KSPPATSPSPQVQPPAASTPPPSLVKLSPPQAPVGSPPPPVKTTSPPAPIGSPSPPPPVS 539

Query: 354 --ASPPPVQSAPPPVQQSSPPPVSSTPP---PVQSSPPPAPVTPPP---ASPPP 491
             + PPPV+S PPP    SPPP   +PP   PV S PPP    PPP   ASPPP
Sbjct: 540 VVSPPPPVKSPPPPAPVGSPPPPEKSPPPPAPVASPPPPVKSPPPPTLVASPPP 593

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 55/143 (38%), Positives = 70/143 (48%), Gaps = 48/143 (33%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPPTPPTNTPPT-------TPQASPPPVQSAPPT---AQSSPPP---- 347
            + PP  +P ASP PP P  ++PP        TP +SPPP + +PP    A+S+PPP    
Sbjct: 612  KSPPPPTPVASPPPPAPVASSPPPMKSPPPPTPVSSPPPPEKSPPPPPPAKSTPPPEEYP 671

Query: 348  -----VQASPPPVQSAPPPVQQSSPP--------------------------PVSSTPPP 434
                 V++SPPP +S PPP    SPP                          PVSS P  
Sbjct: 672  TPPTSVKSSPPPEKSLPPPTLIPSPPPQEKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQT 731

Query: 435  VQSSPPPAPVTPPPASP---PPA 494
             +SSPPPAPV+ PP +P   PPA
Sbjct: 732  PKSSPPPAPVSSPPPTPVSSPPA 754

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 53/113 (46%), Positives = 65/113 (57%), Gaps = 21/113 (18%)
 Frame = +3

Query: 219 PSTSPNASPA----PPTPPT--NTPPTT---PQASPPPVQSAPPT-AQSSPP--PVQASP 362
           P  +P++ PA    PPTPP    +PP T   PQ  PP   + PP+  + SPP  PV + P
Sbjct: 458 PMPTPHSPPADDYVPPTPPVPGKSPPATSPSPQVQPPAASTPPPSLVKLSPPQAPVGSPP 517

Query: 363 PPVQSAPPPV---QQSSPPPVS--STPPPVQSSPPPAPVTPPP----ASPPPA 494
           PPV++  PP      S PPPVS  S PPPV+S PPPAPV  PP    + PPPA
Sbjct: 518 PPVKTTSPPAPIGSPSPPPPVSVVSPPPPVKSPPPPAPVGSPPPPEKSPPPPA 570

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 55/117 (47%), Positives = 65/117 (55%), Gaps = 26/117 (22%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTN--TPPT--TPQASPPPVQSAP---PTAQSSPPP--VQASPP-- 365
           P+ +P   P P +PP +   PPT   P  SPP    +P   P A S+PPP  V+ SPP  
Sbjct: 452 PAPAPMPMPTPHSPPADDYVPPTPPVPGKSPPATSPSPQVQPPAASTPPPSLVKLSPPQA 511

Query: 366 PVQSAPPPVQQSS----------PPPVS--STPPPVQSSPPPAPV---TPPPASPPP 491
           PV S PPPV+ +S          PPPVS  S PPPV+S PPPAPV    PP  SPPP
Sbjct: 512 PVGSPPPPVKTTSPPAPIGSPSPPPPVSVVSPPPPVKSPPPPAPVGSPPPPEKSPPP 568

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 54/128 (42%), Positives = 62/128 (48%), Gaps = 34/128 (26%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPTAQ-SSPPPVQASPPP---- 368
            + PP  +P +SP PP  +PP   P ++P   PPPV+S PP A  SSPPP   SPPP    
Sbjct: 1058 KSPPPPAPISSPPPPVKSPPPPAPVSSP---PPPVKSPPPPAPVSSPPPPIKSPPPPAPV 1114

Query: 369  ---------VQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP------------ 476
                       S PPP   SSPPPV +  PP    QS PPPA   PPP            
Sbjct: 1115 SSPPPAPVKPPSLPPPAPVSSPPPVVTPAPPKKEEQSLPPPAESQPPPSFNDIILPPIMA 1174

Query: 477  ---ASPPP 491
               ASPPP
Sbjct: 1175 NKYASPPP 1182

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 51/133 (38%), Positives = 63/133 (47%), Gaps = 42/133 (31%)
 Frame = +3

Query: 219  PSTSPNASP------APPTPPTNTPPTTPQASPPPV--QSAPPTAQSSPPPVQASPPPVQ 374
            P  +P +SP      +PP  P ++PP  P++SPP V   S PP  +SSPPP   S PP+ 
Sbjct: 802  PPLAPVSSPPQVEKTSPPPAPLSSPPLAPKSSPPHVVVSSPPPVVKSSPPPAPVSSPPLT 861

Query: 375  SAP--PPVQQSSPP----------------------------PVSSTPPPVQSSPPPAPV 464
              P  PP   SSPP                            PVS  PP V+SSPPPA V
Sbjct: 862  PKPASPPAHVSSPPEVVKPSTPPAPTTVISPPSEPKSSPPPTPVSLPPPIVKSSPPPAMV 921

Query: 465  TPPP----ASPPP 491
            + PP    +SPPP
Sbjct: 922  SSPPMTPKSSPPP 934

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 47/109 (43%), Positives = 64/109 (58%), Gaps = 16/109 (14%)
 Frame = +3

Query: 216  PPSTSPNASP------APPTPPTNTPPTTPQASPPPVQ-SAPPTAQSSPPPV--QASPPP 368
            PP+    +SP      +PP  P ++PP  P +SPP V+ ++PP A  S PP+  ++SPP 
Sbjct: 777  PPAPQVKSSPPPVQVSSPPPAPKSSPPLAPVSSPPQVEKTSPPPAPLSSPPLAPKSSPPH 836

Query: 369  VQ-SAPPPVQQSSPPPVSSTPPPVQSSP--PPAPVTPPP----ASPPPA 494
            V  S+PPPV +SSPPP   + PP+   P  PPA V+ PP     S PPA
Sbjct: 837  VVVSSPPPVVKSSPPPAPVSSPPLTPKPASPPAHVSSPPEVVKPSTPPA 885

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 49/113 (43%), Positives = 59/113 (52%), Gaps = 20/113 (17%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQ-SAPPTAQSSPPP--VQASPPPV-QSA 380
            Q  S  P    +PP  P ++PP   + SPPP   S+PP A  S PP  V +SPPPV +S+
Sbjct: 790  QVSSPPPAPKSSPPLAPVSSPPQVEKTSPPPAPLSSPPLAPKSSPPHVVVSSPPPVVKSS 849

Query: 381  PPPVQQSSPP----------PVSSTPPPVQSSPPPAPVT------PPPASPPP 491
            PPP   SSPP           VSS P  V+ S PPAP T       P +SPPP
Sbjct: 850  PPPAPVSSPPLTPKPASPPAHVSSPPEVVKPSTPPAPTTVISPPSEPKSSPPP 902

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/115 (40%), Positives = 57/115 (49%), Gaps = 15/115 (13%)
 Frame = +3

Query: 198 SAGAQQP-PSTSPNASPAPPTPPTNTPPTTPQASPPP--------VQSAPPTAQSSPPPV 350
           +A A  P P T P+ SP P   P+  P   P   P P        V   PP    SPP  
Sbjct: 426 AASAPMPSPHTPPDVSPEPLPEPSPVPAPAPMPMPTPHSPPADDYVPPTPPVPGKSPPAT 485

Query: 351 QASP---PPVQSAPPP-VQQSSPP--PVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SP   PP  S PPP + + SPP  PV S PPPV+++ PPAP+  P + PPP S
Sbjct: 486 SPSPQVQPPAASTPPPSLVKLSPPQAPVGSPPPPVKTTSPPAPIGSP-SPPPPVS 539

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 51/122 (41%), Positives = 62/122 (50%), Gaps = 30/122 (24%)
 Frame = +3

Query: 219  PSTSPNASP--APPTPPTNTPPTTPQASPP--PVQSAPPTAQSSPPPV-QASPPPV---- 371
            P +SP  +P  +PP     +PP  P +SPP  P  S P    SSPPPV ++SPPP     
Sbjct: 798  PKSSPPLAPVSSPPQVEKTSPPPAPLSSPPLAPKSSPPHVVVSSPPPVVKSSPPPAPVSS 857

Query: 372  -----QSAPPPVQQSSPPPV--SSTPP----------PVQSSPPPAPVTPPP----ASPP 488
                 + A PP   SSPP V   STPP            +SSPPP PV+ PP    +SPP
Sbjct: 858  PPLTPKPASPPAHVSSPPEVVKPSTPPAPTTVISPPSEPKSSPPPTPVSLPPPIVKSSPP 917

Query: 489  PA 494
            PA
Sbjct: 918  PA 919

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 41/116 (35%), Positives = 50/116 (43%), Gaps = 5/116 (4%)
 Frame = +3

Query: 162 VLVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP 341
           VL   + C+  V AG    P   P +SP P  P  + P  +P    PP  S  P  + SP
Sbjct: 394 VLARPVDCSKHVCAG-YPTPGGGPPSSPVPGKPAASAPMPSPHT--PPDVSPEPLPEPSP 450

Query: 342 PPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPP---PAPVTPPPA--SPPPA 494
            P  A  P      PP     PP    TPP    SPP   P+P   PPA  +PPP+
Sbjct: 451 VPAPAPMPMPTPHSPPADDYVPP----TPPVPGKSPPATSPSPQVQPPAASTPPPS 502

[32][TOP]
>UniRef100_Q1EP18 Protein kinase family protein n=1 Tax=Musa balbisiana
           RepID=Q1EP18_MUSBA
          Length = 637

 Score =  100 bits (250), Expect = 4e-20
 Identities = 52/112 (46%), Positives = 64/112 (57%), Gaps = 11/112 (9%)
 Frame = +3

Query: 195 VSAGAQQPPSTSPNASPAPPT-----PPTNTPPTTPQASPPPVQSAPPTAQSSPP----P 347
           +S+    P +T P+ SP PP+     P +N+PP  P A PPP   +PP A S PP    P
Sbjct: 1   MSSPPPSPSATPPSTSPPPPSSLSPPPASNSPPPAPNAPPPPTPPSPPPASSPPPTPPPP 60

Query: 348 VQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP--ASPPPAS 497
               PPPV ++PPP     PPP S +PPP   SPPPA   PPP  ASPPPA+
Sbjct: 61  ADVPPPPVVTSPPP---PDPPPPSVSPPPPALSPPPASTPPPPPSASPPPAA 109

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 47/99 (47%), Positives = 57/99 (57%), Gaps = 2/99 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A   P  +PNA P PPTPP+  P ++P  +PPP    PP    + PP    PPP  S PP
Sbjct: 28  ASNSPPPAPNAPP-PPTPPSPPPASSPPPTPPPPADVPPPPVVTSPPPPDPPPPSVSPPP 86

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPP--ASPPPAS 497
           P    SPPP S+ PPP  +SPPPA   PPP  A+PPP +
Sbjct: 87  PA--LSPPPASTPPPPPSASPPPAAAPPPPPFATPPPTN 123

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 47/99 (47%), Positives = 55/99 (55%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAP-PTPPTNTPP-----TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           PPS  P +SP P P PP + PP     + P   PPP   +PP    SPPP    PPP  +
Sbjct: 44  PPSPPPASSPPPTPPPPADVPPPPVVTSPPPPDPPPPSVSPPPPALSPPPASTPPPPPSA 103

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
           +PPP   + PPP  +TPPP  S PPP   TPPP  SPPP
Sbjct: 104 SPPPA-AAPPPPPFATPPPTNSPPPPPSATPPPTISPPP 141

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 45/99 (45%), Positives = 55/99 (55%), Gaps = 4/99 (4%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTT----PQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           A  PP T P  +  PP P   +PP      P  SPPP   +PP A + PPP  ASPPP  
Sbjct: 50  ASSPPPTPPPPADVPPPPVVTSPPPPDPPPPSVSPPPPALSPPPASTPPPPPSASPPPA- 108

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           +APPP   ++PPP +S PPP  ++PPP    PPP S  P
Sbjct: 109 AAPPPPPFATPPPTNSPPPPPSATPPPTISPPPPGSQSP 147

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 42/93 (45%), Positives = 50/93 (53%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A  PP     + P P  PP +  P  P  SPPP  + PP   +SPPP  A PPP  + PP
Sbjct: 61  ADVPPPPVVTSPPPPDPPPPSVSPPPPALSPPPASTPPPPPSASPPPAAAPPPPPFATPP 120

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
           P   S PPP S+TPPP  S PPP   +PP  +P
Sbjct: 121 PTN-SPPPPPSATPPPTISPPPPGSQSPPARAP 152

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 46/101 (45%), Positives = 56/101 (55%), Gaps = 7/101 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS SP   PA   PP +TPP  P ASPPP  + PP   ++PPP  + PPP  + PPP  
Sbjct: 79  PPSVSP-PPPALSPPPASTPPPPPSASPPPAAAPPPPPFATPPPTNSPPPPPSATPPPT- 136

Query: 396 QSSPPPVSSTPPPVQS------SPPPAPVTPP-PASPPPAS 497
             SPPP  S  PP ++        PPAP  PP P SP P++
Sbjct: 137 -ISPPPPGSQSPPARAPSNSTGGTPPAPPKPPSPPSPSPSA 176

[33][TOP]
>UniRef100_B9HWP9 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9HWP9_POPTR
          Length = 390

 Score =  100 bits (249), Expect = 5e-20
 Identities = 57/127 (44%), Positives = 67/127 (52%), Gaps = 28/127 (22%)
 Frame = +3

Query: 195 VSAGAQQPPSTSPNASPAPP---------------TPPTNTPPTTPQASPPPVQSAPPTA 329
           VS+    PPS  P+ +P PP               TPP N+PP  P ++PPP  S+P   
Sbjct: 117 VSSPPPPPPSNPPSTAPPPPLLNPPTSSSPPSPSTTPPQNSPP--PSSTPPPQSSSPSPP 174

Query: 330 QSSPPPVQASPPPVQSAPPP--VQQSSPPPVSSTPP-----------PVQSSPPPAPVTP 470
           Q S PP  +SPPP  S PPP    QSSPPP S+ PP           P Q+SPPP P TP
Sbjct: 175 QISSPPPPSSPPPQSSPPPPSLPPQSSPPPPSTPPPQSSPPSQPSSRPPQNSPPPPPPTP 234

Query: 471 PPASPPP 491
           PPAS PP
Sbjct: 235 PPASLPP 241

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 48/97 (49%), Positives = 58/97 (59%), Gaps = 6/97 (6%)
 Frame = +3

Query: 219 PSTSPNASPAPP-TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-----PPVQSA 380
           P T PNA+P  P TPP  +PP  PQ  PP V + PP   S+PPP    P     PP+ S+
Sbjct: 42  PPTQPNANPPDPRTPPAPSPP--PQTPPPTVSNPPPATPSTPPPQPPPPMTSRSPPLSSS 99

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PP   +SPPP+S+T PPV S PPP P  PP  +PPP
Sbjct: 100 DPPSNSNSPPPLSAT-PPVSSPPPPPPSNPPSTAPPP 135

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 51/120 (42%), Positives = 65/120 (54%), Gaps = 24/120 (20%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPP-----------PVQSAPPTAQSSPP--- 344
           +  PPS S +  P   TPP ++PP  P ++PP           P  S+PP+  ++PP   
Sbjct: 98  SSDPPSNSNSPPPLSATPPVSSPPPPPPSNPPSTAPPPPLLNPPTSSSPPSPSTTPPQNS 157

Query: 345 -PVQASPPPVQSAPPPVQQSSPPPVSSTPP---------PVQSSPPPAPVTPPPASPPPA 494
            P  ++PPP  S+P P Q SSPPP SS PP         P QSSPPP P TPPP S PP+
Sbjct: 158 PPPSSTPPPQSSSPSPPQISSPPPPSSPPPQSSPPPPSLPPQSSPPP-PSTPPPQSSPPS 216

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 49/104 (47%), Positives = 56/104 (53%), Gaps = 8/104 (7%)
 Frame = +3

Query: 204 GAQQPPSTS--PNASPAPPTPPTNTP------PTTPQASPPPVQSAPPTAQSSPPPVQAS 359
           G   P STS  P AS  PPT P   P      P TP A  PP Q+ PPT  + PP   ++
Sbjct: 21  GTPPPSSTSSPPQASSPPPTSPPTQPNANPPDPRTPPAPSPPPQTPPPTVSNPPPATPST 80

Query: 360 PPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PPP    PPP+   SPP  SS PP   +SPPP   TPP +SPPP
Sbjct: 81  PPP--QPPPPMTSRSPPLSSSDPPSNSNSPPPLSATPPVSSPPP 122

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 49/110 (44%), Positives = 55/110 (50%), Gaps = 17/110 (15%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPP---TNTPPTTPQA----SPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           P T P  SP P TPP   +N PP TP       PPP+ S  P   SS PP  ++ PP  S
Sbjct: 53  PRTPPAPSPPPQTPPPTVSNPPPATPSTPPPQPPPPMTSRSPPLSSSDPPSNSNSPPPLS 112

Query: 378 APPPVQQSSPPPVSSTP----------PPVQSSPPPAPVTPPPASPPPAS 497
           A PPV    PPP S+ P          PP  SSPP    TPP  SPPP+S
Sbjct: 113 ATPPVSSPPPPPPSNPPSTAPPPPLLNPPTSSSPPSPSTTPPQNSPPPSS 162

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 54/127 (42%), Positives = 63/127 (49%), Gaps = 31/127 (24%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPP-TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP------- 365
           Q PP T  N  PA P TPP   PP     SPP   S PP+  +SPPP+ A+PP       
Sbjct: 64  QTPPPTVSNPPPATPSTPPPQPPPPMTSRSPPLSSSDPPSNSNSPPPLSATPPVSSPPPP 123

Query: 366 ----PVQSAPPPV-----------------QQSSPPPVSSTPPPVQSSPPPAPVT--PPP 476
               P  +APPP                   Q+SPPP SSTPPP  SSP P  ++  PPP
Sbjct: 124 PPSNPPSTAPPPPLLNPPTSSSPPSPSTTPPQNSPPP-SSTPPPQSSSPSPPQISSPPPP 182

Query: 477 ASPPPAS 497
           +SPPP S
Sbjct: 183 SSPPPQS 189

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 47/104 (45%), Positives = 62/104 (59%), Gaps = 10/104 (9%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT-PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP-- 386
           P S  P +SP PP+ PP ++PP  P ++PPP QS+PP+  SS PP  + PPP  + PP  
Sbjct: 182 PSSPPPQSSPPPPSLPPQSSPP--PPSTPPP-QSSPPSQPSSRPPQNSPPPPPPTPPPAS 238

Query: 387 -PVQQSSPPPVSSTP------PPVQSSPPPAPVTPPPASPPPAS 497
            P  + SPPP +STP      PP+  +P P+ V PPP   PP S
Sbjct: 239 LPPPRRSPPPPASTPPENSPRPPISIAPRPSNVPPPPRLTPPTS 282

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 41/85 (48%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +3

Query: 240 SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVS 419
           SP+P +PP+ TPP      PP   S+PP A SSPPP      P  + P P    +P P  
Sbjct: 5   SPSPNSPPSATPPPLNGTPPPSSTSSPPQA-SSPPPTSPPTQPNANPPDPRTPPAPSPPP 63

Query: 420 STPPPVQSSPPPA-PVTPPPASPPP 491
            TPPP  S+PPPA P TPPP  PPP
Sbjct: 64  QTPPPTVSNPPPATPSTPPPQPPPP 88

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 44/95 (46%), Positives = 53/95 (55%), Gaps = 2/95 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPST P  S +PP+ P++ P   PQ SPPP    PP A  S PP + SPPP  S PP  +
Sbjct: 204 PPSTPPPQS-SPPSQPSSRP---PQNSPPPPPPTPPPA--SLPPPRRSPPPPASTPP--E 255

Query: 396 QSSPPPVSSTPPPVQSSPPP--APVTPPPASPPPA 494
            S  PP+S  P P    PPP   P T P A+P P+
Sbjct: 256 NSPRPPISIAPRPSNVPPPPRLTPPTSPQATPVPS 290

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 43/98 (43%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           S+   QP S  P  SP PP P   TPP  P + PPP +S PP A  S PP  +  PP+  
Sbjct: 212 SSPPSQPSSRPPQNSPPPPPP---TPP--PASLPPPRRSPPPPA--STPPENSPRPPISI 264

Query: 378 APPPVQQSSPPPVSSTPP-PVQSSPPPAPVTPPPASPP 488
           AP P   + PPP   TPP   Q++P P+   PP  SPP
Sbjct: 265 APRP--SNVPPPPRLTPPTSPQATPVPSDSNPPALSPP 300

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 37/103 (35%), Positives = 51/103 (49%), Gaps = 9/103 (8%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNA-SPAPP----TPPTNTPP----TTPQASPPPVQSAPPTAQSSPPPV 350
           S  + +PP  SP    P PP     PP  +PP    T P+ SP P  S  P   + PPP 
Sbjct: 216 SQPSSRPPQNSPPPPPPTPPPASLPPPRRSPPPPASTPPENSPRPPISIAPRPSNVPPPP 275

Query: 351 QASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA 479
           + +PP    A P    S+PP +S  PP ++ +PPP  +  PP+
Sbjct: 276 RLTPPTSPQATPVPSDSNPPALS--PPKIRLAPPPRALVSPPS 316

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 35/84 (41%), Positives = 41/84 (48%), Gaps = 12/84 (14%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT-----------PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP 362
           P ST P  SP PP            PP  TPPT+PQA+P P  S PP           SP
Sbjct: 249 PASTPPENSPRPPISIAPRPSNVPPPPRLTPPTSPQATPVPSDSNPPA---------LSP 299

Query: 363 PPVQSAPPPVQQSSPP-PVSSTPP 431
           P ++ APPP    SPP P ++T P
Sbjct: 300 PKIRLAPPPRALVSPPSPTNNTAP 323

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 38/109 (34%), Positives = 47/109 (43%), Gaps = 15/109 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT----PPTNTPPTT-----------PQASPPPVQSAPPTAQSSPPPV 350
           PP T P AS  PP     PP +TPP             P   PPP +  PPT+       
Sbjct: 230 PPPTPPPASLPPPRRSPPPPASTPPENSPRPPISIAPRPSNVPPPPRLTPPTSP------ 283

Query: 351 QASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           QA+P P  S PP +   SPP +   PPP     PP+P      + P +S
Sbjct: 284 QATPVPSDSNPPAL---SPPKIRLAPPPRALVSPPSPTNNTAPNSPGSS 329

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 29/62 (46%), Positives = 35/62 (56%), Gaps = 6/62 (9%)
 Frame = +3

Query: 324 TAQSSP-PPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQ-----SSPPPAPVTPPPASP 485
           T   SP  P  A+PPP+   PPP   SSPP  +S+PPP       ++ PP P TPP  SP
Sbjct: 3   TVSPSPNSPPSATPPPLNGTPPPSSTSSPPQ-ASSPPPTSPPTQPNANPPDPRTPPAPSP 61

Query: 486 PP 491
           PP
Sbjct: 62  PP 63

[34][TOP]
>UniRef100_B1Z6K9 Type VI secretion system Vgr family protein n=1 Tax=Burkholderia
           ambifaria MC40-6 RepID=B1Z6K9_BURA4
          Length = 1057

 Score =  100 bits (248), Expect = 7e-20
 Identities = 44/92 (47%), Positives = 50/92 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS+ P  S  PP P +  PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 726 PPSSEPPPSSEPPPPSSEPPP--PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 783

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP S  PPP    PPP+   PPP+S PP
Sbjct: 784 SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 815

 Score =  100 bits (248), Expect = 7e-20
 Identities = 43/95 (45%), Positives = 53/95 (55%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
            ++ PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PP
Sbjct: 729  SEPPPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 787

Query: 387  PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            P     PPP S  PPP    PPP+   PPP+S PP
Sbjct: 788  PPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 822

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 739  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 797

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 798  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 829

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 746  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 804

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 805  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 836

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 753  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 811

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 812  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 843

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 760  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 818

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 819  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 850

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 767  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 825

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 826  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 857

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 774  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 832

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 833  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 864

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 781  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 839

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 840  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 871

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 788  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 846

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 847  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 878

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 795  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 853

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 854  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 885

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 802  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 860

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 861  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 892

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 809  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 867

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 868  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 899

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 816  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 874

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 875  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 906

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 823  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 881

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 882  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 913

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 830  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 888

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 889  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 920

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 837  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 895

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 896  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 927

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 844  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 902

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 903  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 934

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 851  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 909

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 910  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 941

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 858  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 916

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 917  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 948

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 865  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 923

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 924  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 955

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 872  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 930

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 931  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 962

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 879  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 937

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 938  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 969

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 886  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 944

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 945  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 976

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 893  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 951

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 952  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 983

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 900  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 958

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 959  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 990

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 907  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 965

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 966  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 997

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 914  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 972

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 973  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 1004

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 921  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 979

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 980  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 1011

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 928  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 986

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 987  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 1018

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 935  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 993

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 994  SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 1025

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 942  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 1000

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 1001 SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 1032

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 949  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 1007

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 1008 SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 1039

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 43/92 (46%), Positives = 51/92 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 956  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 1014

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP S  PPP    PPP+   PPP+S PP
Sbjct: 1015 SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 1046

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 43/94 (45%), Positives = 51/94 (54%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS+ P    + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 963  PPSSEPPPPSSEPPPPSSEPPP-PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 1021

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PPP S  PPP    PPP+   PPP+  PP S
Sbjct: 1022 SEPPPPSSEPPPPSSEPPPPSSEPPPPSEEPPPS 1055

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 43/96 (44%), Positives = 51/96 (53%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTT----PQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
            PP+  P  S  PP P +  PP++    P + PPP  S PP   S PPP  + PPP  S P
Sbjct: 713  PPALPPAPSSEPPPPSSEPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 772

Query: 384  PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PP     PPP S  PPP    PPP+   PPP+S PP
Sbjct: 773  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 808

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 48/97 (49%), Positives = 54/97 (55%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P A  + P PP++ PP  P + PPP  S PP   S PPP  + PPP  S PPP  
Sbjct: 712 PPPALPPAPSSEPPPPSSEPP--PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPP-P 768

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPAS---PPPAS 497
            S PPP SS PPP  S PPP    PPP S   PPP+S
Sbjct: 769 SSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSS 805

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 43/92 (46%), Positives = 49/92 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   PA P  P++ PP  P +S PP  S PP   S PPP  + PPP  S PPP  
Sbjct: 708 PPLPPP---PALPPAPSSEPP--PPSSEPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS 762

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP S  PPP    PPP+   PPP+S PP
Sbjct: 763 SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPP 794

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/88 (46%), Positives = 45/88 (51%), Gaps = 3/88 (3%)
 Frame = +3

Query: 243 PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSS 422
           P P    + T P  P   PPP  + PP   S PPP  + PPP    PPP   S PPP SS
Sbjct: 694 PVPLFFRSITVPILPPLPPPP--ALPPAPSSEPPPPSSEPPPSSEPPPP--SSEPPPPSS 749

Query: 423 TPPPVQSSPPPAPVTPPPAS---PPPAS 497
            PPP  S PPP    PPP S   PPP+S
Sbjct: 750 EPPPPSSEPPPPSSEPPPPSSEPPPPSS 777

[35][TOP]
>UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q8L685_VOLCA
          Length = 1009

 Score =  100 bits (248), Expect = 7e-20
 Identities = 44/103 (42%), Positives = 49/103 (47%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP 362
           C V    G   PP + P   P PP+PP  +PP  P + PPP+   PP     PPP    P
Sbjct: 199 CPVSTVIGYNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPP 258

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PP    PPP     PPP    PPP    PPP P  PPP  PPP
Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 42/92 (45%), Positives = 43/92 (46%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP+  SPPP P  PPP  PPP
Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 42/92 (45%), Positives = 42/92 (45%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/92 (44%), Positives = 43/92 (46%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP+  +PPP    PPP P  PPP  PPP
Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 42/93 (45%), Positives = 43/93 (46%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 675

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
             SPPP    PPP    PPP P  PPP  PPP+
Sbjct: 676 PPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPS 708

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 41/92 (44%), Positives = 42/92 (45%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P +PPP  PPP
Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 41/92 (44%), Positives = 42/92 (45%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 43/94 (45%), Positives = 44/94 (46%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP+ 
Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            S PPP    PPP    PPP P  PPP  PPP S
Sbjct: 677 PSPPPPPPPPPPP--PPPPPPPPPPPPPHPPPPS 708

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 42/92 (45%), Positives = 44/92 (47%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP+  +PPP  
Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP SPPP
Sbjct: 684 PPPPPPPPPPPPP----PPPPPPHPPPPSPPP 711

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 42/93 (45%), Positives = 44/93 (47%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSP-NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PPS  P +  P PP+PP   PP  P   PPP    PP     PPP    PPP    PPP 
Sbjct: 221 PPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP  PPP
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 43/93 (46%), Positives = 43/93 (46%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNA-SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PPS  P   SP PP PP   PP  P   PPP    PP     PPP    PPP    PPP 
Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP  PPP
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP   P  P PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  P P SPPP
Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 40/92 (43%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P+ P P  PPP
Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              P P S  PPP    PPP P  PPP  PPP
Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 41/94 (43%), Positives = 41/94 (43%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              PPP    PPP    PPP P  PPP  P P S
Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 40/92 (43%), Positives = 40/92 (43%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  P P
Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 40/92 (43%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P   PP+ PPP
Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 40/92 (43%), Positives = 40/92 (43%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PP   PPP
Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 40/92 (43%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP     PP+P  PPP  PPP
Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 40/92 (43%), Positives = 40/92 (43%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PP  P  PPP  PPP
Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 40/92 (43%), Positives = 40/92 (43%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PP  P  PPP  PPP
Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 36/93 (38%), Positives = 38/93 (40%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P + PPP           PPP    PPP    PPP  
Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPP-----------PPPPPPPPPPPPPPPPPPP 701

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              PPP  S PP V + PP   V       PPA
Sbjct: 702 PHPPPP--SPPPLVPALPPSCEVCIVARLLPPA 732

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 29/66 (43%), Positives = 34/66 (51%), Gaps = 3/66 (4%)
 Frame = +3

Query: 303 PVQSAPPTA---QSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPP 473
           P Q  P +     + PPP    PPP+  +PPP    SPPP   +PPP    PPP P  PP
Sbjct: 195 PCQCCPVSTVIGYNPPPPSPPPPPPLPPSPPP---PSPPPPPPSPPPPLPPPPPPPPPPP 251

Query: 474 PASPPP 491
           P  PPP
Sbjct: 252 PPPPPP 257

[36][TOP]
>UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J4Y2_HUMAN
          Length = 253

 Score =  100 bits (248), Expect = 7e-20
 Identities = 48/97 (49%), Positives = 53/97 (54%), Gaps = 4/97 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPV----QSAPPTAQSSPPPVQASPPPVQSAP 383
           PPS  P   P+PP P  + PP  P  SPPP      S PP   S PPP  + PPP  S P
Sbjct: 77  PPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPP 136

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PP   S PPP  S PPP   SPPP P +PPP  PPP+
Sbjct: 137 PPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPS 173

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 47/96 (48%), Positives = 56/96 (58%), Gaps = 4/96 (4%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT----AQSSPPPVQASPPPVQSA 380
           QPP   P +SP PP PP + PP  P + PPP+ S PP     +   PPP+ +SPPP   +
Sbjct: 63  QPPP--PPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPS 120

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           PPP   S PPP  S PPP   SPPP P +PPP  PP
Sbjct: 121 PPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPP 156

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 45/92 (48%), Positives = 53/92 (57%), Gaps = 1/92 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP-PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP   P  SP PP P P++ PP  P   PPP+   PP     PPP+ + PPP  S PPP 
Sbjct: 95  PPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPP 154

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
             S PPP  S PPP+   PPP+P+ PPP SPP
Sbjct: 155 PPSPPPPPPSPPPPL---PPPSPLPPPPPSPP 183

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 45/95 (47%), Positives = 54/95 (56%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P   P+PP PP + PP  P + PPP    PP     PPP  + PPP+ S PPP  
Sbjct: 45  PPSPPPPPPPSPPPPPPSQPPPPPSSPPPP----PPPPSPPPPPPPSPPPPLPSPPPPPP 100

Query: 396 QSS---PPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             S   PPP+ S+PPP   SPPP P++PPP  P P
Sbjct: 101 LPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSP 135

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 48/95 (50%), Positives = 52/95 (54%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP---PVQASPPPVQSAPP 386
           PP  SP   P PP PP++ PP  P + PPP  S PP    SPP   P    PPP  S PP
Sbjct: 2   PPPPSP---PPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPP 58

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           P     PPP SS PPP    PPP+P  PPP SPPP
Sbjct: 59  PPPSQPPPPPSSPPPP---PPPPSPPPPPPPSPPP 90

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 50/99 (50%), Positives = 57/99 (57%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP-PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PPS  P   P+PP+P P + PP  P + PPP  S PP   SSPPP    PPP  S PPP 
Sbjct: 29  PPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPP----PPPPPSPPPPP 84

Query: 393 QQSSPPPVSS--TPPPVQSSPPPAPV----TPPPASPPP 491
             S PPP+ S   PPP+ S PPP P+     PPP SPPP
Sbjct: 85  PPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPP 123

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 42/92 (45%), Positives = 47/92 (51%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P+  P PP+PP   PP+ P   PP     PP +   PPP Q  PPP    PPP  
Sbjct: 18  PPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPP 77

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            S PPP   +PPP   SPPP P  P P  PPP
Sbjct: 78  PSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPP 109

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 44/95 (46%), Positives = 51/95 (53%), Gaps = 3/95 (3%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV-- 392
           PS+ P   P+PP PP + PP  P   PPP+ S PP   S PPP   SPPP   +PPP   
Sbjct: 111 PSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLP 170

Query: 393 -QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
                PPP  S P P+  SPPP P   PP  PPP+
Sbjct: 171 PPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPS 205

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/99 (45%), Positives = 51/99 (51%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAP-PTAQSSPPPVQASPPPVQSAPPPV 392
           PP   P+  P PP+PP   PP +P   PPP    P P +   PPP    PPP  S PPP 
Sbjct: 151 PPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPP 210

Query: 393 QQSSP------PPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             S P      PP+   PPP  S PPP P +PPP SPPP
Sbjct: 211 LPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPPPSPPP 249

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 47/98 (47%), Positives = 51/98 (52%), Gaps = 6/98 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPP---PVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PPS+ P   P  P PP  +PP  P  SPP   P    PP   S PPP  + PPP  S+PP
Sbjct: 13  PPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPP 72

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
           P     PPP S  PPP  S PPP P  PPP    SPPP
Sbjct: 73  P----PPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPP 106

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 47/101 (46%), Positives = 53/101 (52%), Gaps = 9/101 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTP--QASPPPVQSAPPTAQSSPP----PVQASPPPVQS 377
           PPS  P     PP PP++ PP  P     PPP  S PP   S PP    P    PPP+ S
Sbjct: 53  PPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPS 112

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPP---APVTPPPASPPP 491
           +PPP   S PPP  S PPP  S PPP   +P  PPP+ PPP
Sbjct: 113 SPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPP 153

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 42/88 (47%), Positives = 46/88 (52%)
 Frame = +3

Query: 231 PNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPP 410
           P  SP PP PP ++PP  P  SPPP    PP+    PPP   SP P    PPP     PP
Sbjct: 3   PPPSPPPPPPPPSSPPPPPPPSPPP---PPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPP 59

Query: 411 PVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           P S  PPP  S PPP P   PP  PPP+
Sbjct: 60  PPSQPPPPPSSPPPPPPPPSPPPPPPPS 87

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 43/97 (44%), Positives = 47/97 (48%), Gaps = 4/97 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAP----PTAQSSPPPVQASPPPVQSAP 383
           PP   P  S  PP PP + PP  P   PPP  S P    P+    PPP    PPP Q  P
Sbjct: 7   PPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPP 66

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PP     PPP  S PPP   SPPP   +PPP  P P+
Sbjct: 67  PPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPS 103

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/98 (44%), Positives = 52/98 (53%), Gaps = 5/98 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP----PPVQASPPPVQSAP 383
           PP + P   P+PP PP  +PP  P + PPP   +PP    SP    PP    PPP  S P
Sbjct: 124 PPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPP 183

Query: 384 PPVQQS-SPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            P+  S  PPP  S PPP   SPPP P+  PPA  PP+
Sbjct: 184 HPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPS 221

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 45/87 (51%), Positives = 47/87 (54%), Gaps = 4/87 (4%)
 Frame = +3

Query: 249 PPTPPTNTPPTTPQAS--PPPVQSAPPTAQSSPPPVQASPPP--VQSAPPPVQQSSPPPV 416
           PP PP+  PP  P +S  PPP  S PP   S PPP   SPP     S PPP   S PPP 
Sbjct: 1   PPPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPP 60

Query: 417 SSTPPPVQSSPPPAPVTPPPASPPPAS 497
            S PPP  SSPPP P  P P  PPP S
Sbjct: 61  PSQPPPPPSSPPPPPPPPSPPPPPPPS 87

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 48/99 (48%), Positives = 53/99 (53%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQAS-PPPVQSAPPPV 392
           PP   P  S  PP PP+  PP  P + PPP  S PP    SPPP   S PPP   +PPP 
Sbjct: 104 PPPPPPLPSSPPPPPPS--PPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPP 161

Query: 393 QQSSPPPV---SSTPPPVQSSP---PPAPVTPPPASPPP 491
             S PPP+   S  PPP  S P   PP+P  PPP SPPP
Sbjct: 162 PPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPP 200

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 45/100 (45%), Positives = 50/100 (50%), Gaps = 7/100 (7%)
 Frame = +3

Query: 216 PPSTSPNASPA--PPTPPTNTPPTTPQASP--PPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP  SP   P   PP PP + PP  P   P  PP    PP   S P P+  SPPP    P
Sbjct: 138 PPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPP----P 193

Query: 384 PPVQQSSPPPVSSTPPPVQSSP---PPAPVTPPPASPPPA 494
           PP     PPP S  PPP+ S P   PP+P  PPP  PPP+
Sbjct: 194 PPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPS 233

[37][TOP]
>UniRef100_C5Y7E8 Putative uncharacterized protein Sb05g025945 (Fragment) n=1
           Tax=Sorghum bicolor RepID=C5Y7E8_SORBI
          Length = 360

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 8/101 (7%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPTA--QSSPPPVQASPPP--V 371
           + PP  +P +SP PP  +PP   P ++P   PPPV+S PP A   S PPPV++ PPP  V
Sbjct: 200 KSPPPPAPVSSPPPPVKSPPPPAPLSSP---PPPVKSPPPPAPVSSPPPPVKSPPPPAPV 256

Query: 372 QSAPPPVQQSSPPP--VSSTPPPVQSSPPPAPVTPPPASPP 488
            S PPPV+   PPP  VSS PPP +S PPPAPV+ PP  PP
Sbjct: 257 SSPPPPVKSPPPPPAPVSSPPPPEKSPPPPAPVSSPPPKPP 297

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 54/108 (50%), Positives = 61/108 (56%), Gaps = 17/108 (15%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPP--VQASPPPVQSAPP 386
           P T P  +P    PP   PP  P+  PPP  V S PP  +S PPP  V + PPPV+S PP
Sbjct: 161 PKTLPPPAPVSSPPPEVKPPPAPKPLPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPP 220

Query: 387 PVQQSSPP----------PVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
           P   SSPP          PVSS PPPV+S PPPAPV+ PP    SPPP
Sbjct: 221 PAPLSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPP 268

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 62/131 (47%), Positives = 75/131 (57%), Gaps = 31/131 (23%)
 Frame = +3

Query: 195 VSAGAQQPPSTSPNASPAPPTPPT----------NTPPTTPQASPPP-VQSAPP--TAQS 335
           V +     P +SP  +P P  PP            TPP  P +SPPP V+S+PP  T +S
Sbjct: 6   VKSSPPPAPVSSPPPTPKPSPPPAPVKSPPQVEKKTPPPAPVSSPPPAVKSSPPPLTPKS 65

Query: 336 SPPPVQASPPP---VQSAPPPVQQSSPP-----------PVSSTPPPVQSSPPPAPV-TP 470
           S PP Q SPPP    +S+PPPV +SSPP           PVSS PP V+S+PPPAPV +P
Sbjct: 66  SGPPAQVSPPPEDEEESSPPPVVKSSPPPETPKLSPPPAPVSSPPPVVKSTPPPAPVSSP 125

Query: 471 PPA---SPPPA 494
           PPA   SPPPA
Sbjct: 126 PPAPKPSPPPA 136

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 57/106 (53%), Positives = 65/106 (61%), Gaps = 14/106 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAP---PTPPTNTPPTTPQAS--PPPVQSAPPTA--QSSPPPVQASPPP-- 368
           PP+  P   PAP   P PP  +PP     S  PPPV+S PP A   S PPPV++ PPP  
Sbjct: 180 PPAPKPLPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPLSSPPPPVKSPPPPAP 239

Query: 369 VQSAPPPVQQSSPP-PVSSTPPPVQS-SPPPAPVT---PPPASPPP 491
           V S PPPV+   PP PVSS PPPV+S  PPPAPV+   PP  SPPP
Sbjct: 240 VSSPPPPVKSPPPPAPVSSPPPPVKSPPPPPAPVSSPPPPEKSPPP 285

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 52/111 (46%), Positives = 60/111 (54%), Gaps = 19/111 (17%)
 Frame = +3

Query: 216 PPSTSPNASPAP----PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP--VQASPPPVQS 377
           PP    +  PAP    P  P   PP  P +SPPP    PP  +  PPP  V + PPPV+S
Sbjct: 142 PPVVKSSPPPAPVSLPPPAPKTLPPPAPVSSPPPEVKPPPAPKPLPPPAPVSSPPPPVKS 201

Query: 378 APPPVQQSSPP----------PVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
            PPP   SSPP          P+SS PPPV+S PPPAPV+ PP    SPPP
Sbjct: 202 PPPPAPVSSPPPPVKSPPPPAPLSSPPPPVKSPPPPAPVSSPPPPVKSPPP 252

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 47/97 (48%), Positives = 58/97 (59%), Gaps = 7/97 (7%)
 Frame = +3

Query: 222 STSPNASPAPPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           S  P   P+PP  P ++PP   ++SPPP  V   PP  ++ PPP   S PP +  PPP  
Sbjct: 124 SPPPAPKPSPPPAPVSSPPPVVKSSPPPAPVSLPPPAPKTLPPPAPVSSPPPEVKPPPAP 183

Query: 396 QSSPPP--VSSTPPPVQSSPPPAPVTPPP---ASPPP 491
           +  PPP  VSS PPPV+S PPPAPV+ PP    SPPP
Sbjct: 184 KPLPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPP 220

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 54/107 (50%), Positives = 63/107 (58%), Gaps = 10/107 (9%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPP--VQASPPP 368
           A    PP     +SP PP   ++ PP TP+ SPPP  V S PP  +S+PPP  V + PP 
Sbjct: 70  AQVSPPPEDEEESSP-PPVVKSSPPPETPKLSPPPAPVSSPPPVVKSTPPPAPVSSPPPA 128

Query: 369 VQSAPPPVQQSSPPPV--SSTPPPVQSSPPPAPVT-PPPA---SPPP 491
            + +PPP   SSPPPV  SS PP   S PPPAP T PPPA   SPPP
Sbjct: 129 PKPSPPPAPVSSPPPVVKSSPPPAPVSLPPPAPKTLPPPAPVSSPPP 175

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/103 (49%), Positives = 65/103 (63%), Gaps = 8/103 (7%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPTA--QSSPPPVQASPPPVQ- 374
           + PP  +P +SP PP  +PP   P ++P   PPPV+S PP A   S PPPV++ PPP   
Sbjct: 216 KSPPPPAPLSSPPPPVKSPPPPAPVSSP---PPPVKSPPPPAPVSSPPPPVKSPPPPPAP 272

Query: 375 -SAPPPVQQSSPPP--VSSTPPPVQSSPPPAPVTPPPASPPPA 494
            S+PPP ++S PPP  VSS PP   S PPPAPV+ PP +  PA
Sbjct: 273 VSSPPPPEKSPPPPAPVSSPPPKPPSLPPPAPVSSPPPAVTPA 315

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/111 (45%), Positives = 60/111 (54%), Gaps = 19/111 (17%)
 Frame = +3

Query: 216 PPSTSPNASPAP------------PTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPPVQ 353
           PP+  P+  PAP            P  P + PP  P+  PPP  V S PP  +  P P  
Sbjct: 126 PPAPKPSPPPAPVSSPPPVVKSSPPPAPVSLPPPAPKTLPPPAPVSSPPPEVKPPPAPKP 185

Query: 354 ASPP-PVQSAPPPVQQSSPP-PVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
             PP PV S PPPV+   PP PVSS PPPV+S PPPAP++ PP    SPPP
Sbjct: 186 LPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPLSSPPPPVKSPPP 236

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/106 (50%), Positives = 68/106 (64%), Gaps = 12/106 (11%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTA---QSSPPPVQASPPPVQS- 377
           ++ P  +P +SP PP   ++ PP TP++S PP Q +PP     +SSPPPV  S PP ++ 
Sbjct: 39  KKTPPPAPVSSP-PPAVKSSPPPLTPKSSGPPAQVSPPPEDEEESSPPPVVKSSPPPETP 97

Query: 378 --APPPVQQSSPPP-VSSTPPPVQ-SSPPPAP-VTPPPA---SPPP 491
             +PPP   SSPPP V STPPP   SSPPPAP  +PPPA   SPPP
Sbjct: 98  KLSPPPAPVSSPPPVVKSTPPPAPVSSPPPAPKPSPPPAPVSSPPP 143

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 49/100 (49%), Positives = 55/100 (55%), Gaps = 7/100 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPP-PVQSAPPTAQSSPPPVQASPPP--VQSAPP 386
           PP  +P  SP PP P ++ PP      PP PV S PP  + SPPP   S PP  V+S+PP
Sbjct: 92  PPPETPKLSP-PPAPVSSPPPVVKSTPPPAPVSSPPPAPKPSPPPAPVSSPPPVVKSSPP 150

Query: 387 PVQQSSPPPVSST-PPPVQSSPPPAPVTPPPAS---PPPA 494
           P   S PPP   T PPP   S PP  V PPPA    PPPA
Sbjct: 151 PAPVSLPPPAPKTLPPPAPVSSPPPEVKPPPAPKPLPPPA 190

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 41/97 (42%), Positives = 53/97 (54%), Gaps = 2/97 (2%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           + PP  +P +SP PP  +PP   PP  P +SPPP + +PP     P PV + PP   S P
Sbjct: 248 KSPPPPAPVSSPPPPVKSPP---PPPAPVSSPPPPEKSPPP----PAPVSSPPPKPPSLP 300

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PP   SSPPP  +  PP +    PAP  P  + PPP+
Sbjct: 301 PPAPVSSPPPAVTPAPPKKEESTPAP--PAESLPPPS 335

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 41/83 (49%), Positives = 48/83 (57%), Gaps = 10/83 (12%)
 Frame = +3

Query: 273 PPTTPQASPPPVQSAPPTAQSSPPPVQASPPPV--QSAPPPVQQSSPPP-VSSTPPPV-- 437
           PP      P PV S PPT + SPPP     PP   +  PPP   SSPPP V S+PPP+  
Sbjct: 4   PPVKSSPPPAPVSSPPPTPKPSPPPAPVKSPPQVEKKTPPPAPVSSPPPAVKSSPPPLTP 63

Query: 438 QSSPPPAPVTPPP-----ASPPP 491
           +SS PPA V+PPP     +SPPP
Sbjct: 64  KSSGPPAQVSPPPEDEEESSPPP 86

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 32/59 (54%), Positives = 40/59 (67%), Gaps = 7/59 (11%)
 Frame = +3

Query: 336 SPPPVQASPPPVQ-SAPPPVQQSSPP--PVSSTPPPVQSSPPPAPVTPPP----ASPPP 491
           SPPPV++SPPP   S+PPP  + SPP  PV S P   + +PPPAPV+ PP    +SPPP
Sbjct: 2   SPPPVKSSPPPAPVSSPPPTPKPSPPPAPVKSPPQVEKKTPPPAPVSSPPPAVKSSPPP 60

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 34/58 (58%), Positives = 36/58 (62%), Gaps = 12/58 (20%)
 Frame = +3

Query: 357 SPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPV---------TPPPA---SPPPA 494
           SPPPV+S+PPP   SSPPP   TP P   SPPPAPV         TPPPA   SPPPA
Sbjct: 2   SPPPVKSSPPPAPVSSPPP---TPKP---SPPPAPVKSPPQVEKKTPPPAPVSSPPPA 53

[38][TOP]
>UniRef100_C5XS10 Putative uncharacterized protein Sb04g033190 n=1 Tax=Sorghum
           bicolor RepID=C5XS10_SORBI
          Length = 160

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 50/111 (45%), Positives = 61/111 (54%), Gaps = 2/111 (1%)
 Frame = +3

Query: 165 LVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQA-SPPPVQSAPPTAQSSP 341
           LV+ L+ A   S  AQQ P   P   P P  PP+N+PP  P A +PPP   APP     P
Sbjct: 8   LVLALLIA---SCAAQQSPPAQP--PPTPNAPPSNSPPQAPPAGNPPPAPQAPPAGNPPP 62

Query: 342 PPVQASPPPVQSAPPPVQQSSPPPVSSTPPPV-QSSPPPAPVTPPPASPPP 491
            P    PP   S PPP   ++PPP  +TPPP   ++PPPAP TPP + P P
Sbjct: 63  APTATPPPAPTSTPPPAPPTTPPPAPTTPPPAPPTTPPPAPTTPPSSPPSP 113

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/97 (43%), Positives = 52/97 (53%), Gaps = 5/97 (5%)
 Frame = +3

Query: 219 PSTSPNASPA--PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           P  +P A PA  PP  PT TPP  P ++PPP   APPT          +PPP  + PPP 
Sbjct: 48  PPPAPQAPPAGNPPPAPTATPPPAPTSTPPP---APPT----------TPPPAPTTPPPA 94

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPA---SPPPA 494
             ++PPP  +TPP    S PP+P  P PA   SP P+
Sbjct: 95  PPTTPPPAPTTPP----SSPPSPKAPSPAAATSPAPS 127

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 34/88 (38%), Positives = 45/88 (51%), Gaps = 4/88 (4%)
 Frame = +3

Query: 210 QQPPSTSPNASPA--PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           Q PP+ +P  +P   PP  PT+TPP  P  +PPP   AP T   +PP    +PPP  + P
Sbjct: 53  QAPPAGNPPPAPTATPPPAPTSTPPPAPPTTPPP---APTTPPPAPP---TTPPPAPTTP 106

Query: 384 P--PVQQSSPPPVSSTPPPVQSSPPPAP 461
           P  P    +P P ++T P    SP   P
Sbjct: 107 PSSPPSPKAPSPAAATSPAPSLSPTGTP 134

[39][TOP]
>UniRef100_C0Z3D3 AT2G14890 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z3D3_ARATH
          Length = 171

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 56/119 (47%), Positives = 73/119 (61%), Gaps = 10/119 (8%)
 Frame = +3

Query: 171 VGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQ-ASPPPVQSAPPTAQSSPPP 347
           + +IC V ++    Q P++ P A+PAPPTP T  P   P  A+PPP  S+PP A  SPPP
Sbjct: 7   IAVICIVLIAGVTGQAPTSPPTATPAPPTPTTPPPAAAPPPANPPPPVSSPPPA--SPPP 64

Query: 348 VQASPPPVQSAPPPVQQ---SSPPPVSSTPPPVQSSPP-----PAPVTPPPA-SPPPAS 497
             A+PPPV S PPPV     ++PPPV++ PP   +SPP     PAP T P + SP P+S
Sbjct: 65  --ATPPPVASPPPPVASHPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSS 121

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 42/99 (42%), Positives = 49/99 (49%), Gaps = 1/99 (1%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A    P S+ P ASP P TPP    P  P AS PP  + PP   + PP   ASPP    A
Sbjct: 48  ANPPPPVSSPPPASPPPATPPPVASPPPPVASHPP--ATPPPVATPPPAPLASPPAQVPA 105

Query: 381 P-PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           P P  +  SP P  S+ PP+ SS  P P T    SP P+
Sbjct: 106 PAPTTKPDSPSPSPSSSPPLPSSDAPGPST-DSISPAPS 143

[40][TOP]
>UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK2_CHLRE
          Length = 541

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 48/99 (48%), Positives = 53/99 (53%)
 Frame = +3

Query: 195 VSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           V+ GA  PP       P PP+PP   PP+ P  SPPP    PP   S PPP   SPPP  
Sbjct: 169 VTRGASPPP-------PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPS 221

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             PP     SPPP S  PPP  S PPP+P  PPP+ PPP
Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPPPPSP--PPPSPPPP 258

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 38/76 (50%), Positives = 42/76 (55%), Gaps = 2/76 (2%)
 Frame = +3

Query: 276 PTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPP 455
           P T  ASPPP    PP     PPP  + PPP   +PPP     PPP S  PPP  S PPP
Sbjct: 168 PVTRGASPPP----PPPPSPPPPPPPSPPPP---SPPPPSPPPPPPPSPPPPPPPSPPPP 220

Query: 456 A--PVTPPPASPPPAS 497
           +  P +PPP SPPP S
Sbjct: 221 SPPPPSPPPPSPPPPS 236

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 32/65 (49%), Positives = 34/65 (52%), Gaps = 2/65 (3%)
 Frame = +3

Query: 309 QSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAP--VTPPPAS 482
           Q  P T  +SPPP     PP  S PPP   S PPP   +PPP    PPP P    PPP S
Sbjct: 165 QCCPVTRGASPPP-----PPPPSPPPPPPPSPPPP---SPPPPSPPPPPPPSPPPPPPPS 216

Query: 483 PPPAS 497
           PPP S
Sbjct: 217 PPPPS 221

[41][TOP]
>UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO
          Length = 1765

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 46/97 (47%), Positives = 56/97 (57%), Gaps = 4/97 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP  +P+A P  P PP  +PP +P  SPPP  S  P    SPPP +  PPP  S PPPV 
Sbjct: 1138 PPPPTPDAPPPSPPPPPPSPPPSPPPSPPPPPSPMPPPPPSPPPPRPPPPP--SPPPPVH 1195

Query: 396  Q----SSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            +      PPP  S PPP    PPP+P+ PPP+ PPP+
Sbjct: 1196 EPPPSPPPPPNPSPPPPSPMPPPPSPMPPPPSPPPPS 1232

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 10/104 (9%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPPTPPTNTPPTTPQASPP-PVQSAPPTAQSSPPPVQ---ASPPPVQS 377
            ++PP  SP + P+PP+PP   PP+ P   PP P    PP   S PPPV     SPPP  S
Sbjct: 1078 EKPPPPSPPSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPS 1137

Query: 378  APPPVQQ----SSPPPVSSTP--PPVQSSPPPAPVTPPPASPPP 491
             PPP       S PPP  S P  PP    PPP+P+ PPP SPPP
Sbjct: 1138 PPPPTPDAPPPSPPPPPPSPPPSPPPSPPPPPSPMPPPPPSPPP 1181

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 48/94 (51%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQ--ASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PPS  P  SP PP PP+  PP  P   + PPPV   PP   S PPP   SPPP    PPP
Sbjct: 1162 PPSPPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPP---SPPPPPNPSPPPPSPMPPP 1218

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                 PPP  S PPP  S PPP+P+ PPP+ PPP
Sbjct: 1219 PSPMPPPP--SPPPP--SPPPPSPMPPPPSPPPP 1248

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 48/99 (48%), Positives = 58/99 (58%), Gaps = 6/99 (6%)
 Frame = +3

Query: 216  PPSTS----PNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
            PP+ +    P   P PP+PP+  PP+ P   PPP  S PP    SPPP +  PPP  S P
Sbjct: 1067 PPAAAMDNRPCEKPPPPSPPS--PPSPPSPPPPPPPSPPPPPPPSPPPPRPPPPP--SPP 1122

Query: 384  PPVQQS--SPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            PPV +   SPPP  S PPP   +PPP+P  PPP SPPP+
Sbjct: 1123 PPVHEPPPSPPPPPSPPPPTPDAPPPSP-PPPPPSPPPS 1160

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 47/101 (46%), Positives = 52/101 (51%), Gaps = 7/101 (6%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTT----PQASPPPVQSAPPTAQ---SSPPPVQASPPPVQ 374
            PPS  P   P+PP PP  +PP      P + PPPV   PP+     S PPP   +PPP  
Sbjct: 1091 PPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPDAPPPSP 1150

Query: 375  SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              PPP    SPPP  S PPP    PPP P  PPP  PPP S
Sbjct: 1151 PPPPPSPPPSPPP--SPPPPPSPMPPPPPSPPPPRPPPPPS 1189

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 47/92 (51%), Positives = 50/92 (54%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS  P   P PP+PP   P   P  SPPP  S PP    +PPP  + PPP  S PP   
Sbjct: 1107 PPSPPPPRPPPPPSPPP--PVHEPPPSPPPPPSPPPPTPDAPPP--SPPPPPPSPPPSPP 1162

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             S PPP S  PPP  S PPP P  PPP SPPP
Sbjct: 1163 PSPPPPPSPMPPPPPSPPPPRP--PPPPSPPP 1192

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 46/95 (48%), Positives = 52/95 (54%), Gaps = 1/95 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQAS-PPPVQSAPPPV 392
            P    P + P PP+PP  TP   P + PPP  S PP+   SPPP  +  PPP  S PPP 
Sbjct: 1124 PVHEPPPSPPPPPSPPPPTPDAPPPSPPPPPPSPPPSPPPSPPPPPSPMPPPPPSPPPP- 1182

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                PPP  S PPPV   PPP+P  PP  SPPP S
Sbjct: 1183 ---RPPPPPSPPPPVH-EPPPSPPPPPNPSPPPPS 1213

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 46/99 (46%), Positives = 51/99 (51%), Gaps = 8/99 (8%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTN------TPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
            PPS  P   P PP+PP        +PP  P  SPPP    PP     PPP   SPPP   
Sbjct: 1176 PPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPSPMPPP--PSPPP--P 1231

Query: 378  APPPVQQSSPPPVSSTPPPVQSSPPPAPV--TPPPASPP 488
            +PPP     PPP  S PPP+ S PPP P   +PPPA PP
Sbjct: 1232 SPPPPSPMPPPP--SPPPPIPSPPPPPPTPRSPPPAPPP 1268

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 47/103 (45%), Positives = 50/103 (48%), Gaps = 12/103 (11%)
 Frame = +3

Query: 216  PPSTSPNASPAPPT---PPTNTPPTTPQASPPPVQSAPPTAQSSPP-PVQASPPPVQSAP 383
            PP   P  SP PP    PP+  PP  P   PP     PP+    PP P   SPPP    P
Sbjct: 1181 PPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPSPMPPPPSPPPPSPPPPSPMP 1240

Query: 384  PPVQQSSPPPVSS--TPPPVQSSPPPAP------VTPPPASPP 488
            PP   S PPP+ S   PPP   SPPPAP      V P PASPP
Sbjct: 1241 PP--PSPPPPIPSPPPPPPTPRSPPPAPPPLPGDVDPTPASPP 1281

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 41/91 (45%), Positives = 47/91 (51%), Gaps = 8/91 (8%)
 Frame = +3

Query: 243  PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ--SAP---PPVQQSSP 407
            PAPP    +  P   +  PPP   +PP+  S PPP   SPPP    S P   PP   S P
Sbjct: 1065 PAPPAAAMDNRPC--EKPPPPSPPSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPP 1122

Query: 408  PPVSS---TPPPVQSSPPPAPVTPPPASPPP 491
            PPV     +PPP  S PPP P  PPP+ PPP
Sbjct: 1123 PPVHEPPPSPPPPPSPPPPTPDAPPPSPPPP 1153

[42][TOP]
>UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E1896
          Length = 695

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 45/98 (45%), Positives = 53/98 (54%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           S G   PP+ +P  +PAPP P    PP  P   PPP   APP   + PPP   +PPP   
Sbjct: 598 SPGPPPPPAPAPPPAPAPPAPA--PPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPP-PP 654

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           APPP    +PPP    PPP   +PPP P  PPP +PPP
Sbjct: 655 APPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPPP 692

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 43/93 (46%), Positives = 46/93 (49%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           Q P   P  +PAPP  P    P  P A PPP    PP A   PPP  A PPP   APPP 
Sbjct: 597 QSPGPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPA---PPPPPAPPPPPPPAPPPP 653

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP  + PP     PPP P  PPP +PPP
Sbjct: 654 PAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPP 686

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 44/95 (46%), Positives = 48/95 (50%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           Q+  S  P  SP PP PP   PP  P    P    APP     PPP    PPP   APPP
Sbjct: 589 QRAESMMPQ-SPGPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPP---APPP 644

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
               +PPP  + PPP   +PPPAP  PPP  PPPA
Sbjct: 645 PPPPAPPPPPAPPPPPAPAPPPAP--PPPPPPPPA 677

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 33/73 (45%), Positives = 38/73 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   PAPP PP   PP  P  +PPP  + PP    +PPP    PPP   APPP  
Sbjct: 625 PPPPPPPPPPAPPPPPA--PPPPPPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPP-P 681

Query: 396 QSSPPPVSSTPPP 434
            + PPP +  PPP
Sbjct: 682 PAPPPPPAPPPPP 694

[43][TOP]
>UniRef100_Q9XIB6 F13F21.7 protein n=1 Tax=Arabidopsis thaliana RepID=Q9XIB6_ARATH
          Length = 847

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 50/95 (52%), Positives = 54/95 (56%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P  SP+PP+P  + PP      PP   S PP    SPPP  ASPPP  S PPPV 
Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPP-PSPPPPVH 592

Query: 396 QSSPPPVSSTPPPVQSSPPPAPV---TPPPASPPP 491
              PPPV S PPPV S PPP+PV    PP  SPPP
Sbjct: 593 SPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPP 627

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/101 (49%), Positives = 56/101 (55%), Gaps = 7/101 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP-PTNTPPTTPQASPPPVQSAPPTAQSSPPP--VQASPPPVQSAPP 386
           PP       P P  P P+ +PP+   + PPPV S PP   SSPPP  V + PPPV S PP
Sbjct: 525 PPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPP 584

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA----SPPPAS 497
           P   S PPPV S PPP   SPPP   +PPP     SPPP S
Sbjct: 585 P---SPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPS 622

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 49/111 (44%), Positives = 54/111 (48%), Gaps = 14/111 (12%)
 Frame = +3

Query: 207 AQQPPSTSP-NASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP 368
           AQ P    P +ASP     +PP P        P   P P  S P    S PPPV + PPP
Sbjct: 503 AQGPTPDDPYDASPVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPP 562

Query: 369 VQSAPPPVQQSSP------PPVSSTPPPVQSSPPPAPVTPPPA--SPPPAS 497
           V S+PPP    SP      PP  S PPPV S PPP   +PPP   SPPP S
Sbjct: 563 VYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPS 613

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 41/91 (45%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +3

Query: 231 PNASPAPPTPP--TNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSS 404
           P ASP PP+PP   ++PP  P  SPPP   +PP     P PV + PPP  S PPPV  S 
Sbjct: 578 PVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPP----PSPVYSPPPPSHSPPPPV-YSP 632

Query: 405 PPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PPP  S PP   ++ PP     P  +P P+S
Sbjct: 633 PPPTFSPPPTHNTNQPPMGAPTPTQAPTPSS 663

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 43/97 (44%), Positives = 49/97 (50%), Gaps = 6/97 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAP----PTPPTNTPPTTPQASPPPVQSAPPTAQ-SSPPPVQASPPPVQ-S 377
           PP    ++ P P    P PP  +PP  P + PPPV S PP    S PPPV + PPP    
Sbjct: 559 PPPPVYSSPPPPHVYSPPPPVASPP--PPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVY 616

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           +PPP   S PPPV S PPP  S PP      PP   P
Sbjct: 617 SPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMGAP 653

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 41/96 (42%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +3

Query: 219 PSTSPNASPAP-PTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           P + PN +  P P  P +  P   + SPPP  V+         P P  + P P+ S PPP
Sbjct: 496 PVSPPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPP 555

Query: 390 VQQSSPPPVSSTPPP--VQSSPPPAPVTPPPASPPP 491
           V  S PPPV S+PPP  V S PPP    PPP+ PPP
Sbjct: 556 VH-SPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPP 590

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 39/96 (40%), Positives = 52/96 (54%), Gaps = 4/96 (4%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPPVQASPPPVQSA 380
           A  PP + P    +PP PP  +PP    + PPP  V S PP + S PPPV + PPP  S 
Sbjct: 580 ASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFS- 638

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVT--PPPAS 482
           PPP   ++ PP+ + P P Q+  P +  T  P P+S
Sbjct: 639 PPPTHNTNQPPMGA-PTPTQAPTPSSETTQVPTPSS 673

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 46/114 (40%), Positives = 53/114 (46%), Gaps = 19/114 (16%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTP----PTN--TPPTTPQASPP--PVQSAPPTAQSSPPPVQAS--- 359
           +P    P  SP P  P    PT   +PP   Q   P  P  ++P   + SPPP +     
Sbjct: 473 KPEQPKPEESPKPEQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTR 532

Query: 360 ---PPPVQSAPPPVQ--QSSPPPVSSTPPPVQSSPPPAPV---TPPPASPPPAS 497
              P P   +P P     S PPPV S PPPV SSPPP  V    PP ASPPP S
Sbjct: 533 VPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPS 586

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 41/119 (34%), Positives = 51/119 (42%), Gaps = 30/119 (25%)
 Frame = +3

Query: 216 PPSTSPNASP--APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ----- 374
           PP  SP   P  +PP P  + PP +P  SPPP   +PP    SPPP   SPPP       
Sbjct: 589 PPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQP 648

Query: 375 --------SAPPPVQQSSPPPVSST-------------PPPVQSSPPPAPVT--PPPAS 482
                    AP P  +++  P  S+             P PVQSS P +  T  P P+S
Sbjct: 649 PMGAPTPTQAPTPSSETTQVPTPSSESDQSQILSPVQAPTPVQSSTPSSEPTQVPTPSS 707

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 33/95 (34%), Positives = 43/95 (45%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNA---SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PP  SP     SP PP+P  + PP  P  SPPP   +PP    SPPP   +  P   AP 
Sbjct: 597 PPVFSPPPPVFSPPPPSPVYSPPP--PSHSPPPPVYSPPPPTFSPPPTHNTNQPPMGAPT 654

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           P Q  +P   ++  P   S    + +  P  +P P
Sbjct: 655 PTQAPTPSSETTQVPTPSSESDQSQILSPVQAPTP 689

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 37/103 (35%), Positives = 48/103 (46%), Gaps = 10/103 (9%)
 Frame = +3

Query: 213 QPPSTSPNASPAP--PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPPPVQS 377
           +P  + P  SP P  P P  +  P  PQ   P    +PP     P P     ASP   + 
Sbjct: 462 KPQPSKPEDSPKPEQPKPEESPKPEQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNRR 521

Query: 378 APPP--VQQSSPPPVSSTPPPVQSSPPPAP-VTPPPA--SPPP 491
           +PPP  V+ +  PP     PP+ S  PP+P  +PPP   SPPP
Sbjct: 522 SPPPPKVEDTRVPPPQ---PPMPSPSPPSPIYSPPPPVHSPPP 561

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 37/106 (34%), Positives = 49/106 (46%), Gaps = 14/106 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTT------PQASPPPVQSAPPTAQSSPPPVQASP----- 362
           PPS SP      P PPT +PP T      P  +P P Q+  P+++++  P  +S      
Sbjct: 620 PPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMGAPTPTQAPTPSSETTQVPTPSSESDQSQ 679

Query: 363 --PPVQSAPPPVQQSSP-PPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PVQ AP PVQ S+P    +  P P  S    AP   P  +P P
Sbjct: 680 ILSPVQ-APTPVQSSTPSSEPTQVPTPSSSESYQAPNLSPVQAPTP 724

[44][TOP]
>UniRef100_Q9SPM0 Extensin-like protein n=1 Tax=Zea mays RepID=Q9SPM0_MAIZE
          Length = 1016

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 51/97 (52%), Positives = 59/97 (60%), Gaps = 6/97 (6%)
 Frame = +3

Query: 222  STSPNASPAPPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPPVQAS--PPPVQSAPPP 389
            S  P   P PP  P + PP   ++SPPP  + S PP A+S PPP   S  PPPV+S PPP
Sbjct: 864  SPPPTPKPLPPPAPVSLPPPEVKSSPPPAPISSPPPPAKSPPPPAPMSSLPPPVKSPPPP 923

Query: 390  VQQSSPPPVSSTPPPVQ--SSPPPAPVTPPPASPPPA 494
               SSPPP   +PPP    SSPPPAPV  PP+ PPPA
Sbjct: 924  APVSSPPPPMKSPPPPAPISSPPPAPV-KPPSLPPPA 959

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 52/101 (51%), Positives = 67/101 (66%), Gaps = 11/101 (10%)
 Frame = +3

Query: 216  PPSTSPNASPAP------PTPPTNTPPTTPQASPP--PVQSAPPTAQSSPPPVQASPPPV 371
            PPST P+  P P      P P  ++PP  P +SPP  P  S+PP   SSPPP+++SPPPV
Sbjct: 706  PPST-PSKPPPPSPVETLPPPSKSSPPEEPVSSPPQAPKSSSPPAPVSSPPPLKSSPPPV 764

Query: 372  -QSAPPPVQQSSPP--PVSSTPPPVQSSPPPAPVTPPPASP 485
             +S+PPP  +SSPP  PVSS P   ++SPPPAPV+ PP +P
Sbjct: 765  PESSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTP 805

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 53/110 (48%), Positives = 65/110 (59%), Gaps = 19/110 (17%)
 Frame = +3

Query: 219  PSTSPNASP--APPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPPVQAS--PPPVQSA 380
            P +SP  +P  +PP  P ++PP   + SPPP  V S PPT +  PPP   S  PP V+S+
Sbjct: 829  PVSSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKPLPPPAPVSLPPPEVKSS 888

Query: 381  PPPVQQSSPP----------PVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
            PPP   SSPP          P+SS PPPV+S PPPAPV+ PP    SPPP
Sbjct: 889  PPPAPISSPPPPAKSPPPPAPMSSLPPPVKSPPPPAPVSSPPPPMKSPPP 938

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 53/103 (51%), Positives = 69/103 (66%), Gaps = 6/103 (5%)
 Frame = +3

Query: 195  VSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPV-QSAPPTAQ-SSPPPVQ-ASPP 365
            VS+  Q P S+SP A  + P P  ++PP  P++SPPP  +S+PP A  SSPP V+  SPP
Sbjct: 735  VSSPPQAPKSSSPPAPVSSPPPLKSSPPPVPESSPPPTPKSSPPLAPVSSPPQVEKTSPP 794

Query: 366  PVQ-SAPPPVQQSSPP--PVSSTPPPVQSSPPPAPVTPPPASP 485
            P   S+PPP  +SSPP  PVSS P   ++SPPPAPV+ PP +P
Sbjct: 795  PAPVSSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTP 837

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/108 (49%), Positives = 63/108 (58%), Gaps = 16/108 (14%)
 Frame = +3

Query: 219  PSTSPNASP------APPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPP--VQASPPP 368
            P  +P +SP      +PP  P ++PP TP+  PPP  V   PP  +SSPPP  + + PPP
Sbjct: 841  PPLAPVSSPPQVEKTSPPPAPVSSPPPTPKPLPPPAPVSLPPPEVKSSPPPAPISSPPPP 900

Query: 369  VQSAPPPVQQSS-PPPVSSTPP--PVQSSPPPAPVTPPPA---SPPPA 494
             +S PPP   SS PPPV S PP  PV S PPP    PPPA   SPPPA
Sbjct: 901  AKSPPPPAPMSSLPPPVKSPPPPAPVSSPPPPMKSPPPPAPISSPPPA 948

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 51/104 (49%), Positives = 67/104 (64%), Gaps = 11/104 (10%)
 Frame = +3

Query: 216  PPSTSPNASP--APPTPPTNTPPTTPQASPPPVQSAPPTA-QSSPPPVQASPPPVQ--SA 380
            P  +SP   P  +PP  P ++ P  P +SPPP++S+PP   +SSPPP   S PP+   S+
Sbjct: 725  PSKSSPPEEPVSSPPQAPKSSSPPAPVSSPPPLKSSPPPVPESSPPPTPKSSPPLAPVSS 784

Query: 381  PPPVQQSSPP--PVSSTPPPVQSSPPPAPVTPPP----ASPPPA 494
            PP V+++SPP  PVSS PP  +SSPP APV+ PP     SPPPA
Sbjct: 785  PPQVEKTSPPPAPVSSPPPTPKSSPPLAPVSSPPQVEKTSPPPA 828

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/106 (49%), Positives = 66/106 (62%), Gaps = 12/106 (11%)
 Frame = +3

Query: 213  QPPSTSPNASP--APPTPPTNTPPTTPQASPPPVQ--SAPPTAQSSPPPVQASPPPVQ-- 374
            Q   TSP  +P  +PP  P ++PP  P +SPP V+  S PP   SSPPP   S PP+   
Sbjct: 787  QVEKTSPPPAPVSSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKSSPPLAPV 846

Query: 375  SAPPPVQQSSPP--PVSSTPPPVQSSPPPAPVTPPP----ASPPPA 494
            S+PP V+++SPP  PVSS PP  +  PPPAPV+ PP    +SPPPA
Sbjct: 847  SSPPQVEKTSPPPAPVSSPPPTPKPLPPPAPVSLPPPEVKSSPPPA 892

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/109 (46%), Positives = 65/109 (59%), Gaps = 18/109 (16%)
 Frame = +3

Query: 219  PSTSPNASP--APPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPP--PVQASPPPVQSA 380
            P +SP  +P  +PP  P ++PP   + SPPP  V S PPT +SSPP  PV + P   +++
Sbjct: 797  PVSSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKSSPPLAPVSSPPQVEKTS 856

Query: 381  PPPVQQSSPP----------PVSSTPPPVQSSPPPAPVT--PPPASPPP 491
            PPP   SSPP          PVS  PP V+SSPPPAP++  PPPA  PP
Sbjct: 857  PPPAPVSSPPPTPKPLPPPAPVSLPPPEVKSSPPPAPISSPPPPAKSPP 905

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/114 (44%), Positives = 65/114 (57%), Gaps = 23/114 (20%)
 Frame = +3

Query: 219  PSTSPNASP------APPTPPTNTPPTTPQASPP--PVQSAPPTAQSSPPPVQASPPPVQ 374
            P  +P +SP      +PP  P ++PP TP++SPP  PV S P   ++SPPP   S PP  
Sbjct: 809  PPLAPVSSPPQVEKTSPPPAPVSSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPT 868

Query: 375  ----------SAPPPVQQSSPP--PVSSTPPPVQSSPPPAPVT---PPPASPPP 491
                      S PPP  +SSPP  P+SS PPP +S PPPAP++   PP  SPPP
Sbjct: 869  PKPLPPPAPVSLPPPEVKSSPPPAPISSPPPPAKSPPPPAPMSSLPPPVKSPPP 922

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/107 (48%), Positives = 66/107 (61%), Gaps = 16/107 (14%)
 Frame = +3

Query: 219  PSTSPNASP--APPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPP--PVQA-------S 359
            P +SP  +P  +PP  P ++PP   + SPPP  V S PPT +SSPP  PV +       S
Sbjct: 765  PESSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKSSPPLAPVSSPPQVEKTS 824

Query: 360  PPPVQ-SAPPPVQQSSPP--PVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PPP   S+PPP  +SSPP  PVSS P   ++SPPPAPV+ PP +P P
Sbjct: 825  PPPAPVSSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKP 871

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 46/98 (46%), Positives = 61/98 (62%), Gaps = 8/98 (8%)
 Frame = +3

Query: 216 PPSTS---PNASPAPPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPP--PVQASPPPVQ 374
           PP  S   P  + +PP     TPP+TP   PPP  V++ PP ++SSPP  PV + P   +
Sbjct: 684 PPEKSLPPPTLTTSPPPQEKPTPPSTPSKPPPPSPVETLPPPSKSSPPEEPVSSPPQAPK 743

Query: 375 SAPPPVQQSSPPPVSSTPPPV-QSSPPPAPVTPPPASP 485
           S+ PP   SSPPP+ S+PPPV +SSPPP P + PP +P
Sbjct: 744 SSSPPAPVSSPPPLKSSPPPVPESSPPPTPKSSPPLAP 781

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 50/108 (46%), Positives = 60/108 (55%), Gaps = 13/108 (12%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPT----PPTNTP-PTTPQASPPP---VQSAPPTAQSSPPP--VQA 356
           A  PP+T   +SP P      PP  TP P  P ASPPP   V S  P  +S PPP  V +
Sbjct: 510 ASSPPATPVKSSPPPAAVVLPPPAKTPSPPAPVASPPPEAPVSSPQPQVKSPPPPAPVAS 569

Query: 357 SPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
            PPP++S PPP + +SPPP+  +P      PPPAPV  PP    SPPP
Sbjct: 570 PPPPMKSPPPPARVASPPPLMKSP------PPPAPVASPPQPLKSPPP 611

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 55/110 (50%), Positives = 65/110 (59%), Gaps = 15/110 (13%)
 Frame = +3

Query: 207 AQQPPSTSPNAS-PAPP----TPPTNTPPTTP-QASPPP--VQSAPPTAQSSPPPVQASP 362
           A+ PP TSP AS  APP     P  ++PP TP ++SPPP  V   PP    SPP   ASP
Sbjct: 486 AKSPPGTSPPASRGAPPLQAQPPAASSPPATPVKSSPPPAAVVLPPPAKTPSPPAPVASP 545

Query: 363 PPVQ--SAPPPVQQSSPP--PVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
           PP    S+P P  +S PP  PV+S PPP++S PPPA V  PP    SPPP
Sbjct: 546 PPEAPVSSPQPQVKSPPPPAPVASPPPPMKSPPPPARVASPPPLMKSPPP 595

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 46/99 (46%), Positives = 57/99 (57%), Gaps = 6/99 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPP-TAQSSPPPVQA-SPPPVQSAPPP 389
           PP  +P  S  PP     TPPT  ++SPPP +S PP T  +SPPP +  +PP   S PPP
Sbjct: 656 PPLPAPGKSTPPPEEEKPTPPTPVKSSPPPEKSLPPPTLTTSPPPQEKPTPPSTPSKPPP 715

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASP----PPA 494
                P PV + PPP +SSPP  PV+ PP +P    PPA
Sbjct: 716 -----PSPVETLPPPSKSSPPEEPVSSPPQAPKSSSPPA 749

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 49/100 (49%), Positives = 57/100 (57%), Gaps = 8/100 (8%)
 Frame = +3

Query: 216  PPSTSPNASPAP----PTPPTNTPPTTPQAS-PPPVQSAPPTAQSSPPPVQASPPPVQSA 380
            PP    +  PAP    P P  + PP  P +S PPPV+S PP     P PV + PPP++S 
Sbjct: 882  PPEVKSSPPPAPISSPPPPAKSPPPPAPMSSLPPPVKSPPP-----PAPVSSPPPPMKSP 936

Query: 381  PPPVQQSSPPPVSSTPPPVQSSPPPAPV-TPPPA--SPPP 491
            PPP   SSPPP    PP   S PPPAPV +PPPA  S PP
Sbjct: 937  PPPAPISSPPPAPVKPP---SLPPPAPVSSPPPAVTSAPP 973

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 53/117 (45%), Positives = 62/117 (52%), Gaps = 20/117 (17%)
 Frame = +3

Query: 201 AGAQQPPSTSPNAS---PAPPTPPTNTPPTTPQAS--PPPVQSAPPTAQSSPP-PVQASP 362
           A  + P   SP A    P PP P  + P T+P AS   PP+Q+ PP A S P  PV++SP
Sbjct: 463 APMRMPTLRSPPADEYIPTPPVPAKSPPGTSPPASRGAPPLQAQPPAASSPPATPVKSSP 522

Query: 363 PPVQSA-PPPVQQSSPP----------PVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
           PP     PPP +  SPP          PVSS  P V+S PPPAPV  PP    SPPP
Sbjct: 523 PPAAVVLPPPAKTPSPPAPVASPPPEAPVSSPQPQVKSPPPPAPVASPPPPMKSPPP 579

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 51/123 (41%), Positives = 65/123 (52%), Gaps = 19/123 (15%)
 Frame = +3

Query: 186 AVFVSAGAQQPPSTSPNASPAPPTPPTNT-------PPTTPQASPPP-VQSAPPTAQ-SS 338
           AV +   A+ P   +P ASP P  P ++        PP  P ASPPP ++S PP A+ +S
Sbjct: 526 AVVLPPPAKTPSPPAPVASPPPEAPVSSPQPQVKSPPPPAPVASPPPPMKSPPPPARVAS 585

Query: 339 PPPVQASPP----------PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           PPP+  SPP          P++S PPPV   S P V S PPPV  + PP PV  PP   P
Sbjct: 586 PPPLMKSPPPPAPVASPPQPLKSPPPPVLWLSTPSVKSPPPPVPVASPPPPVKSPPPLAP 645

Query: 489 PAS 497
            +S
Sbjct: 646 VSS 648

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 48/112 (42%), Positives = 60/112 (53%), Gaps = 18/112 (16%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT---AQSSPPPVQASPPPV--- 371
           + PP  +P ASP PP    + PP    ASPPP+  +PP      S P P+++ PPPV   
Sbjct: 559 KSPPPPAPVASPPPPMK--SPPPPARVASPPPLMKSPPPPAPVASPPQPLKSPPPPVLWL 616

Query: 372 -----QSAPPPVQQSSPPP-VSSTPP--PVQSSPPPAPVTPPPA----SPPP 491
                +S PPPV  +SPPP V S PP  PV S  PP  + P PA    +PPP
Sbjct: 617 STPSVKSPPPPVPVASPPPPVKSPPPLAPVSSPSPPVKLPPLPAPGKSTPPP 668

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 48/116 (41%), Positives = 60/116 (51%), Gaps = 21/116 (18%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPTAQ-SSPPPVQASPPPVQS 377
            A+ PP  +P +S  PP  +PP   P ++P   PPP++S PP A  SSPPP    PP   S
Sbjct: 901  AKSPPPPAPMSSLPPPVKSPPPPAPVSSP---PPPMKSPPPPAPISSPPPAPVKPP---S 954

Query: 378  APPPVQQSSPPPVSSTPPPVQ---SSPPPAPVTPPP---------------ASPPP 491
             PPP   SSPPP  ++ PP +   S+ PPA   PPP               ASPPP
Sbjct: 955  LPPPAPVSSPPPAVTSAPPKKEEDSTAPPAEALPPPSFNDIILPPIMANKYASPPP 1010

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 50/112 (44%), Positives = 60/112 (53%), Gaps = 18/112 (16%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPP--PVQS 377
           + PP  +P ASP  P P  + PP     S P V+S PP     S PPPV++ PP  PV S
Sbjct: 591 KSPPPPAPVASP--PQPLKSPPPPVLWLSTPSVKSPPPPVPVASPPPPVKSPPPLAPVSS 648

Query: 378 APPPVQ--------QSSPPPVSS--TPP-PVQSSPPPAPVTPPP---ASPPP 491
             PPV+        +S+PPP     TPP PV+SSPPP    PPP    SPPP
Sbjct: 649 PSPPVKLPPLPAPGKSTPPPEEEKPTPPTPVKSSPPPEKSLPPPTLTTSPPP 700

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 41/100 (41%), Positives = 50/100 (50%), Gaps = 7/100 (7%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPT-NTPPTTPQASPPPVQSAPPTAQSSP-----PPVQASPPPVQSA 380
           P  SP  +PAP   PT  +PP       PPV +  P   S P     PP+QA PP   S 
Sbjct: 454 PEPSPVPAPAPMRMPTLRSPPADEYIPTPPVPAKSPPGTSPPASRGAPPLQAQPPAASSP 513

Query: 381 PPPVQQSSPPPVSST-PPPVQSSPPPAPVTPPPASPPPAS 497
           P    +SSPPP +   PPP ++  PPAPV  PP   P +S
Sbjct: 514 PATPVKSSPPPAAVVLPPPAKTPSPPAPVASPPPEAPVSS 553

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 51/132 (38%), Positives = 65/132 (49%), Gaps = 29/132 (21%)
 Frame = +3

Query: 180 ICAVFVSAGAQ-------QPPST-----SPNASPAPPTPPTNTPPTTPQASPPPVQSAP- 320
           +CA + + G         +PPS      +P   P P TPP  +P   P+ SP P  +   
Sbjct: 407 VCAGYPTPGGPPSSSVPGKPPSVPGKPAAPAPMPTPHTPPDVSPEPLPEPSPVPAPAPMR 466

Query: 321 -PTAQSSP-------PPVQASPPPVQSAP-----PPVQQSSPPPVSSTPP--PVQSSPPP 455
            PT +S P       PPV A  PP  S P     PP+Q  + PP +S+PP  PV+SSPPP
Sbjct: 467 MPTLRSPPADEYIPTPPVPAKSPPGTSPPASRGAPPLQ--AQPPAASSPPATPVKSSPPP 524

Query: 456 APVT-PPPASPP 488
           A V  PPPA  P
Sbjct: 525 AAVVLPPPAKTP 536

[45][TOP]
>UniRef100_Q5JN60 Os01g0750600 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5JN60_ORYSJ
          Length = 682

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 48/99 (48%), Positives = 58/99 (58%), Gaps = 6/99 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAP--PTAQSSPPPVQASPPPVQSAP 383
           PP T P  +P P +PP  +PP  T P  SPPPV   P  P    +PPPV  SPPP    P
Sbjct: 36  PPVTPPPVTPPPVSPPPVSPPPVTPPPVSPPPVTPPPVTPPTPVAPPPVPPSPPPPTPTP 95

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPP--APVTPPPASPPPA 494
            PV  S PPPV+ +PPP  +SPPP   P  PPP++ PP+
Sbjct: 96  TPVTPSPPPPVTPSPPPPVASPPPPDVPTAPPPSNNPPS 134

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 52/103 (50%), Positives = 60/103 (58%), Gaps = 11/103 (10%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPP-TNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ-SAPPP 389
           PP + P  SP P TPP  + PP TP    PP   APP    SPPP   +P PV  S PPP
Sbjct: 46  PPVSPPPVSPPPVTPPPVSPPPVTPPPVTPPTPVAPPPVPPSPPPPTPTPTPVTPSPPPP 105

Query: 390 VQQSSPPPVSSTPPP-VQSSPPPA--PVTPP------PASPPP 491
           V  S PPPV+S PPP V ++PPP+  P +PP      PASPPP
Sbjct: 106 VTPSPPPPVASPPPPDVPTAPPPSNNPPSPPPSPSNVPASPPP 148

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 50/100 (50%), Positives = 57/100 (57%), Gaps = 5/100 (5%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTT--PQASPPPVQSAPPTAQS-SPPPVQASPPPVQS 377
           +Q P +    A+P P TPP   PP T  P  SPPPV   P T    SPPPV  SPPPV  
Sbjct: 3   SQAPSAPVTPAAPPPQTPPVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPV--SPPPV-- 58

Query: 378 APPPVQQSSPPPVSSTP--PPVQSSPPPAPVTPPPASPPP 491
            PPPV   SPPPV+  P  PP   +PPP P +PPP +P P
Sbjct: 59  TPPPV---SPPPVTPPPVTPPTPVAPPPVPPSPPPPTPTP 95

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 41/92 (44%), Positives = 48/92 (52%), Gaps = 7/92 (7%)
 Frame = +3

Query: 216 PPSTSPNA---SPAPPTPPTNTPPTTP--QASPPPVQSAPPTAQSSPPP--VQASPPPVQ 374
           PP T P      P PP+PP  TP  TP   + PPPV  +PP   +SPPP  V  +PPP  
Sbjct: 71  PPVTPPTPVAPPPVPPSPPPPTPTPTPVTPSPPPPVTPSPPPPVASPPPPDVPTAPPPSN 130

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTP 470
           + P P    S  P S  PP +  SPPP P TP
Sbjct: 131 NPPSPPPSPSNVPASPPPPRISLSPPPPPSTP 162

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 39/93 (41%), Positives = 48/93 (51%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASP-APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP T P  +P  P       PP  P + PPP  +  P   S PPPV  SPPP  ++PPP 
Sbjct: 66  PPVTPPPVTPPTPV-----APPPVPPSPPPPTPTPTPVTPSPPPPVTPSPPPPVASPPPP 120

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              + PP S+ PP    SPPP+P   P + PPP
Sbjct: 121 DVPTAPPPSNNPP----SPPPSPSNVPASPPPP 149

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 41/87 (47%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +3

Query: 240 SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVS 419
           +P+ P  P   PP TP  +PPPV        ++PPPV  SPPPV          +PPPV 
Sbjct: 5   APSAPVTPAAPPPQTPPVTPPPV--------TAPPPV--SPPPV----------TPPPV- 43

Query: 420 STPPPVQSSP-PPAPVTPPPASPPPAS 497
            TPPPV   P  P PVTPPP SPPP +
Sbjct: 44  -TPPPVSPPPVSPPPVTPPPVSPPPVT 69

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 39/70 (55%), Positives = 44/70 (62%)
 Frame = +3

Query: 288 QASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVT 467
           QA   PV  A P  Q+  PPV  +PPPV +APPPV   SPPPV  TPPPV     P PV+
Sbjct: 4   QAPSAPVTPAAPPPQT--PPV--TPPPV-TAPPPV---SPPPV--TPPPVT----PPPVS 49

Query: 468 PPPASPPPAS 497
           PPP SPPP +
Sbjct: 50  PPPVSPPPVT 59

[46][TOP]
>UniRef100_Q1EPA3 Protein kinase family protein n=1 Tax=Musa acuminata
           RepID=Q1EPA3_MUSAC
          Length = 648

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 51/111 (45%), Positives = 64/111 (57%), Gaps = 10/111 (9%)
 Frame = +3

Query: 195 VSAGAQQPPSTSPNASPAPPT-----PPTNTPPTTPQASPPPVQSAPPTAQ---SSPPPV 350
           +S+    P +T P+ SP PPT     P +N+PP  P A PP   S PP +    + PPP 
Sbjct: 1   MSSPPPSPSATPPSTSPPPPTSLSPPPASNSPPPAPNAPPPTPPSPPPASPPPPTPPPPA 60

Query: 351 QASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPA--PVTPPPASPPPAS 497
              PPPV ++PPP    +PPP S +PPP   SPPPA  P  PP ASPPPA+
Sbjct: 61  DVPPPPVVTSPPP---PAPPPPSVSPPPPALSPPPASTPPRPPSASPPPAA 108

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 50/105 (47%), Positives = 55/105 (52%), Gaps = 13/105 (12%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQS-----APPTAQSSPPPVQASPPPV--- 371
           PP T P+  PA P PPT  PP      PPPV +     APP    SPPP   SPPP    
Sbjct: 39  PPPTPPSPPPASPPPPTPPPPA--DVPPPPVVTSPPPPAPPPPSVSPPPPALSPPPASTP 96

Query: 372 ----QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
                ++PPP     PPP S+TPPP  S PPP   TPPP  SPPP
Sbjct: 97  PRPPSASPPPAAAPPPPPPSATPPPTNSPPPPPSATPPPTISPPP 141

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 46/105 (43%), Positives = 56/105 (53%), Gaps = 14/105 (13%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPP-----------TNTPPTTP---QASPPPVQSAPPTAQSSPPPVQA 356
           P + P ASP PPTPP           T+ PP  P     SPPP   +PP A + P P  A
Sbjct: 43  PPSPPPASPPPPTPPPPADVPPPPVVTSPPPPAPPPPSVSPPPPALSPPPASTPPRPPSA 102

Query: 357 SPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           SPPP  + PPP   ++PPP +S PPP  ++PPP    PPP S  P
Sbjct: 103 SPPPAAAPPPPPPSATPPPTNSPPPPPSATPPPTISPPPPGSQSP 147

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 44/95 (46%), Positives = 51/95 (53%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A    PP  +    PAPP P  + PP  P  SPPP  + P    +SPPP  A PPP  SA
Sbjct: 60  ADVPPPPVVTSPPPPAPPPPSVSPPP--PALSPPPASTPPRPPSASPPPAAAPPPPPPSA 117

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
            PP   S PPP S+TPPP  S PPP   +PP  +P
Sbjct: 118 TPPPTNSPPPPPSATPPPTISPPPPGSQSPPAPAP 152

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 53/115 (46%), Positives = 60/115 (52%), Gaps = 21/115 (18%)
 Frame = +3

Query: 216 PPSTSP------------NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQAS 359
           PPSTSP            N+ P  P  P  TPP+ P ASPPP  + PP A   PPPV  S
Sbjct: 12  PPSTSPPPPTSLSPPPASNSPPPAPNAPPPTPPSPPPASPPP-PTPPPPADVPPPPVVTS 70

Query: 360 PPPVQ------SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP---ASPPPAS 497
           PPP        S PPP    SPPP S+ P P  +SPPPA   PPP   A+PPP +
Sbjct: 71  PPPPAPPPPSVSPPPPA--LSPPPASTPPRPPSASPPPAAAPPPPPPSATPPPTN 123

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 50/101 (49%), Positives = 55/101 (54%), Gaps = 4/101 (3%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A  PPS SP   PA   PP +TPP  P ASPPP  +APP     PPP  A+PPP  S PP
Sbjct: 75  APPPPSVSP-PPPALSPPPASTPPRPPSASPPPA-AAPP-----PPPPSATPPPTNSPPP 127

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVT----PPPASPPPAS 497
           P   + PP +S  PP  QS P PAP       PPA P P S
Sbjct: 128 PPSATPPPTISPPPPGSQSPPAPAPSNSTGGTPPAPPKPPS 168

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 40/94 (42%), Positives = 49/94 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP+ SP  +  PP PP+ +PP      PPP  + PP   S PPP  A+PPP  S PPP  
Sbjct: 85  PPALSPPPASTPPRPPSASPPPAAAPPPPPPSATPPPTNSPPPPPSATPPPTISPPPPGS 144

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           QS P P  S       +PP  P  P P SP P++
Sbjct: 145 QSPPAPAPSN--STGGTPPAPPKPPSPPSPSPSA 176

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 33/88 (37%), Positives = 41/88 (46%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A  PP   P+A+P     PTN+PP  P A+PPP  S PP    SPP    S     + P 
Sbjct: 107 AAAPPPPPPSATPP----PTNSPPPPPSATPPPTISPPPPGSQSPPAPAPSNSTGGTPPA 162

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTP 470
           P +  SPP   S  P      P  P++P
Sbjct: 163 PPKPPSPP---SPSPSASHRAPAYPISP 187

[47][TOP]
>UniRef100_B8A9G0 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8A9G0_ORYSI
          Length = 682

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 48/99 (48%), Positives = 58/99 (58%), Gaps = 6/99 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAP--PTAQSSPPPVQASPPPVQSAP 383
           PP T P  +P P +PP  +PP  T P  SPPPV   P  P    +PPPV  SPPP    P
Sbjct: 36  PPVTPPPVTPPPVSPPPVSPPPVTPPPVSPPPVTPPPVTPPTPVAPPPVPPSPPPPTPTP 95

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPP--APVTPPPASPPPA 494
            PV  S PPPV+ +PPP  +SPPP   P  PPP++ PP+
Sbjct: 96  TPVTPSPPPPVTPSPPPPVASPPPPDVPTAPPPSNNPPS 134

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 52/103 (50%), Positives = 59/103 (57%), Gaps = 11/103 (10%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPP-TNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ-SAPPP 389
           PP + P  SP P TPP  + PP TP    PP   APP    SPPP   +P PV  S PPP
Sbjct: 46  PPVSPPPVSPPPVTPPPVSPPPVTPPPVTPPTPVAPPPVPPSPPPPTPTPTPVTPSPPPP 105

Query: 390 VQQSSPPPVSSTPPP-VQSSPPPA---PVTPP-----PASPPP 491
           V  S PPPV+S PPP V ++PPP+   P  PP     PASPPP
Sbjct: 106 VTPSPPPPVASPPPPDVPTAPPPSNNPPSLPPSPSNVPASPPP 148

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 50/100 (50%), Positives = 57/100 (57%), Gaps = 5/100 (5%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTT--PQASPPPVQSAPPTAQS-SPPPVQASPPPVQS 377
           +Q P +    A+P P TPP   PP T  P  SPPPV   P T    SPPPV  SPPPV  
Sbjct: 3   SQAPSAPVTPAAPPPQTPPVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPV--SPPPV-- 58

Query: 378 APPPVQQSSPPPVSSTP--PPVQSSPPPAPVTPPPASPPP 491
            PPPV   SPPPV+  P  PP   +PPP P +PPP +P P
Sbjct: 59  TPPPV---SPPPVTPPPVTPPTPVAPPPVPPSPPPPTPTP 95

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 40/97 (41%), Positives = 49/97 (50%), Gaps = 5/97 (5%)
 Frame = +3

Query: 216 PPSTSPNASP-APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP T P  +P  P       PP  P + PPP  +  P   S PPPV  SPPP  ++PPP 
Sbjct: 66  PPVTPPPVTPPTPV-----APPPVPPSPPPPTPTPTPVTPSPPPPVTPSPPPPVASPPPP 120

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPP----ASPPP 491
              + PP S+ PP +  SP   P +PPP     SPPP
Sbjct: 121 DVPTAPPPSNNPPSLPPSPSNVPASPPPPRISLSPPP 157

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 45/102 (44%), Positives = 55/102 (53%), Gaps = 8/102 (7%)
 Frame = +3

Query: 216 PPSTSPNA---SPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPP-VQSA 380
           PP T P      P PP+PP  TP  TP   SPP     PP   S PPPV + PPP V +A
Sbjct: 71  PPVTPPTPVAPPPVPPSPPPPTPTPTPVTPSPP-----PPVTPSPPPPVASPPPPDVPTA 125

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVT---PPPASPPPAS 497
           PPP   ++PP +  +P  V +SPPP  ++   PPP S P  S
Sbjct: 126 PPP--SNNPPSLPPSPSNVPASPPPPRISLSPPPPPSTPTQS 165

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 41/87 (47%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +3

Query: 240 SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVS 419
           +P+ P  P   PP TP  +PPPV        ++PPPV  SPPPV          +PPPV 
Sbjct: 5   APSAPVTPAAPPPQTPPVTPPPV--------TAPPPV--SPPPV----------TPPPV- 43

Query: 420 STPPPVQSSP-PPAPVTPPPASPPPAS 497
            TPPPV   P  P PVTPPP SPPP +
Sbjct: 44  -TPPPVSPPPVSPPPVTPPPVSPPPVT 69

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 39/70 (55%), Positives = 44/70 (62%)
 Frame = +3

Query: 288 QASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVT 467
           QA   PV  A P  Q+  PPV  +PPPV +APPPV   SPPPV  TPPPV     P PV+
Sbjct: 4   QAPSAPVTPAAPPPQT--PPV--TPPPV-TAPPPV---SPPPV--TPPPVT----PPPVS 49

Query: 468 PPPASPPPAS 497
           PPP SPPP +
Sbjct: 50  PPPVSPPPVT 59

[48][TOP]
>UniRef100_B3XYC5 Chitin-binding lectin n=1 Tax=Solanum lycopersicum var. cerasiforme
           RepID=B3XYC5_SOLLC
          Length = 365

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 48/93 (51%), Positives = 53/93 (56%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP+  P  P PP+ +PP    + PPP  S PP    SPPP   SPPP   +PPP  
Sbjct: 103 PPPPSPSPPPPSPPPPSPSPPPPTPSPPPPAPSPPPP---SPPPPSPSPPP--PSPPPPS 157

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
            S PPP  S PPP  S PPP P  PPPA SPPP
Sbjct: 158 PSPPPPTPSPPPPSPSPPPPTPSPPPPAPSPPP 190

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 47/87 (54%), Positives = 52/87 (59%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP+PP PPT +PP  P A  PP  S PP + S PPP   SPPP   +PPP  
Sbjct: 111 PPPSPPPPSPSPP-PPTPSPP--PPAPSPPPPSPPPPSPSPPPP---SPPPPSPSPPPPT 164

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPP 476
            S PPP  S PPP  S PPPAP  PPP
Sbjct: 165 PSPPPPSPSPPPPTPSPPPPAPSPPPP 191

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 49/109 (44%), Positives = 60/109 (55%), Gaps = 4/109 (3%)
 Frame = +3

Query: 183 CAVFVSAGAQQP---PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQ 353
           C+++   G  +    P    +  P  P+PP  +PP  P  SPPP  S PP + S PPP  
Sbjct: 70  CSIWSWCGTTESFCAPQNCQSQCPHTPSPPPPSPPP-PSPSPPP-PSPPPPSPSPPPPTP 127

Query: 354 ASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPPAS 497
           + PPP  S PPP    SPPP S +PPP  S PPP+P  PPP  SPPP S
Sbjct: 128 SPPPPAPSPPPP----SPPPPSPSPPP-PSPPPPSPSPPPPTPSPPPPS 171

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 40/82 (48%), Positives = 44/82 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP+  P  P+PP   P   P + PPP  S PP    SPPP   SPPP   +PPP  
Sbjct: 115 PPPPSPSPPPPTPSPPPPAPSPPPPSPPPPSPSPPPP---SPPPPSPSPPPPTPSPPPPS 171

Query: 396 QSSPPPVSSTPPPVQSSPPPAP 461
            S PPP  S PPP  S PPP P
Sbjct: 172 PSPPPPTPSPPPPAPSPPPPYP 193

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 44/131 (33%), Positives = 50/131 (38%), Gaps = 44/131 (33%)
 Frame = +3

Query: 216 PPSTSPNA-SPAPPTP-PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PPS SP   +P+PP P P+  PP+ P  SP P   +PP    SPPP   SPPP   +PPP
Sbjct: 117 PPSPSPPPPTPSPPPPAPSPPPPSPPPPSPSPPPPSPPPPSPSPPPPTPSPPPPSPSPPP 176

Query: 390 VQQSSPPPVSSTPPPVQS------------------------------------------ 443
              S PPP  S PPP                                             
Sbjct: 177 PTPSPPPPAPSPPPPYPRCGMGGGGGKCKSNECCSIWSWCGTTESYCAPQNCQSQCPHTP 236

Query: 444 SPPPAPVTPPP 476
           SP P P  PPP
Sbjct: 237 SPSPPPTPPPP 247

[49][TOP]
>UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S9_EHV86
          Length = 621

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 44/94 (46%), Positives = 49/94 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP +P    PP  S PP +   P P   SPPP    PP   
Sbjct: 245 PPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 304

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP S  PPP    P P P +PPP SPPP S
Sbjct: 305 PPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPS 338

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 45/94 (47%), Positives = 51/94 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P + P PP PP+  PP+ P  SPPP  S PP +   P P   SPPP    PP   
Sbjct: 251 PPSPPPPSPPPPPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPSPP 309

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP   +PPP    P P P +PPP SPPP S
Sbjct: 310 PPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPS 343

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 47/99 (47%), Positives = 54/99 (54%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASP--PPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP + P  SP PP+PP  +PP  P + P  PP  S PP +   P P   SPPP    PP 
Sbjct: 350 PPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 409

Query: 390 VQQSSPPPVSSTP---PPVQSSPPPAPVTPPPASPPPAS 497
               SPPP  S P   PP  S PPP+P +PPP SPPP S
Sbjct: 410 PPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPS 448

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 44/94 (46%), Positives = 51/94 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP  +PP+ P  SPPP    PP+     PP  + PPP  S PPP  
Sbjct: 417 PPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSP 474

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PP  S PPP    P P P +PPP SPPP S
Sbjct: 475 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 508

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 44/94 (46%), Positives = 51/94 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP+  PP+ P  SPPP    PP+     PP  + PPP  S PPP  
Sbjct: 422 PPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSP 479

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PP  S PPP    P P P +PPP SPPP S
Sbjct: 480 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 513

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 44/94 (46%), Positives = 50/94 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P+  P  P PP+  PP+ P  SPPP    PP +   PPP  + PPP    P P  
Sbjct: 117 PPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPP 176

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            S PPP  S PPP    P P P +PPP SPPP S
Sbjct: 177 PSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPS 208

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 44/94 (46%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP  +PP      PPP  S PP +   P P   SPPP    PP   
Sbjct: 235 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 294

Query: 396 QSSPPPVSSTPP-PVQSSPPPAPVTPPPASPPPA 494
             SPPP S  PP P   SPPP P +PPP+ PPP+
Sbjct: 295 PPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPS 328

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 44/94 (46%), Positives = 50/94 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P+  P  P PP+  PP+ P  SPPP    PP+     PP  + PPP    PPP  
Sbjct: 317 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSP 376

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP  S PPP    P P P +PPP SPPP S
Sbjct: 377 PPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPS 409

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 46/94 (48%), Positives = 51/94 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P   P+PP PP + PP+ P  SPPP  S PP +   P P   SPPP    PP   
Sbjct: 305 PPSPPP---PSPPPPPPSPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPSPP 360

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP S  PPP    P P P +PPP SPPP S
Sbjct: 361 PPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPS 394

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 45/94 (47%), Positives = 49/94 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P  SP PP PP + PP +P    PP  S PP +   P P   SPPP    PP   
Sbjct: 146 PPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 205

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP  S PPP    P P P +PPP SPPP S
Sbjct: 206 PPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPS 238

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 46/95 (48%), Positives = 51/95 (53%), Gaps = 1/95 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-PPVQSAPPPV 392
           PP + P  SP PP+PP   PP+ P  SPPP    PP+  S PPP    P PP  S PPP 
Sbjct: 401 PPPSPPPPSPPPPSPPP--PPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPS 458

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                PP  S PPP    P P P +PPP SPPP S
Sbjct: 459 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 493

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 46/97 (47%), Positives = 51/97 (52%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP--PVQSAPP 386
           QPP + P  SP PP+PP  +PP  P + PPP    PP    SPPP    PP  P  S PP
Sbjct: 124 QPPPSPPPPSPPPPSPPPPSPP--PPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPP 181

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           P      PP  S PPP    P P P +PPP SPPP S
Sbjct: 182 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 218

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 46/94 (48%), Positives = 50/94 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP   S PPP    PPP  S PPP  
Sbjct: 220 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP---SPPPPSPPPPPPPPSPPPPSP 273

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PP  S PPP    P P P +PPP SPPP S
Sbjct: 274 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 307

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 45/94 (47%), Positives = 51/94 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+     PP  + PPP    PPP  
Sbjct: 264 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSP 320

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP  S PPP    P P P +PPP SPPP S
Sbjct: 321 PPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPS 353

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 46/96 (47%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP  SP PP+PP   PP+ P  SPPP    PP+     PP  + PPP    PP   
Sbjct: 371 PPPPSPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPP 427

Query: 396 QSSPPPVSSTPPPVQSSPPPA--PVTPPPASPPPAS 497
             SPPP S   PP  S PPP+  P +PPP SPPP S
Sbjct: 428 PPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPS 463

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 48/97 (49%), Positives = 53/97 (54%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP  S PP +   P P   SPPP    PP   
Sbjct: 195 PPPSPPPPSPPPPSPP---PPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPSPP 250

Query: 396 QSSPPPVSSTPPPVQSSPP---PAPVTPPPASPPPAS 497
             SPPP S  PPP   SPP   P P +PPP SPPP S
Sbjct: 251 PPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPS 287

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 43/94 (45%), Positives = 48/94 (51%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP  +PP  P    PP  S PP +   P P   SPPP    PP   
Sbjct: 240 PPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 299

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP S  PP     PP  P +PPP SPPP S
Sbjct: 300 PPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPS 333

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 45/94 (47%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP     P P   SPPP    PP   
Sbjct: 340 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPP 396

Query: 396 QSSPPPVSSTPP-PVQSSPPPAPVTPPPASPPPA 494
             SPPP S  PP P   SPPP P  PPP+ PPP+
Sbjct: 397 PPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPS 430

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 44/94 (46%), Positives = 50/94 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP   +PP +   P P   SPPP    PP   
Sbjct: 345 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 401

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP S  PP     P P P +PPP SPPP S
Sbjct: 402 PPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPS 435

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 48/97 (49%), Positives = 53/97 (54%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQ---SSPPPVQASPPPVQSAPP 386
           PP + P  SP PP+PP   PP+ P  SPPP  S PP +    S PPP   SPPP    PP
Sbjct: 391 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPP 447

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                SPPP  S PPP    P P P +PPP SPPP S
Sbjct: 448 SPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPS 483

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 42/94 (44%), Positives = 47/94 (50%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP  +PP  P   PPP   +PP     PP      PP  S PPP  
Sbjct: 130 PPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 189

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PP  S PPP    P P P +PPP SPPP S
Sbjct: 190 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 223

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 44/94 (46%), Positives = 51/94 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+     PP  + PPP    P P  
Sbjct: 190 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 246

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            S PPP   +PPP    PPP P +PPP SPPP S
Sbjct: 247 PSPPPP---SPPPPSPPPPPPPPSPPPPSPPPPS 277

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 44/94 (46%), Positives = 51/94 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+     PP  + PPP   +PPP  
Sbjct: 205 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPS 258

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              PPP  S PPP    P P P +PPP SPPP S
Sbjct: 259 PPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 292

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 47/94 (50%), Positives = 52/94 (55%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP  S PP +   P P   SPPP    PPP  
Sbjct: 210 PPPSPPPPSPPPPSPP---PPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPPPP 265

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            S PPP  S PPP    P P P +PPP SPPP S
Sbjct: 266 PSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPS 297

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/99 (45%), Positives = 53/99 (53%), Gaps = 6/99 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP   +PP +   P P   SPPP    PP   
Sbjct: 289 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 345

Query: 396 QSSPPPVSSTPP------PVQSSPPPAPVTPPPASPPPA 494
             SPPP S  PP      P   SPPP P +PPP+ PPP+
Sbjct: 346 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPS 384

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 47/94 (50%), Positives = 52/94 (55%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+    P P   SPPP  S PPP  
Sbjct: 381 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPP-PSPPPPSP 436

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            S PPP  S PPP    P P P +PPP SPPP S
Sbjct: 437 PSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPS 468

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 44/94 (46%), Positives = 49/94 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P + P PP+PP   PP +P    PP  S PP +   P P   SPPP    PP   
Sbjct: 141 PPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 200

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP  S PPP    P P P +PPP SPPP S
Sbjct: 201 PPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPS 233

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 46/98 (46%), Positives = 52/98 (53%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+     PP  + PPP  S PP   
Sbjct: 269 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPP 325

Query: 396 QSSPPPVS----STPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP S    S PPP    P P P +PPP SPPP S
Sbjct: 326 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 363

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 45/94 (47%), Positives = 51/94 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+     PP  + PPP  S PP   
Sbjct: 325 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPP 381

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP  S PPP    P P P +PPP SPPP S
Sbjct: 382 PPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPS 414

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 44/94 (46%), Positives = 49/94 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P  SP PP+PP  +PP     SPPP    PP+     PP  + PPP  S PPP  
Sbjct: 412 PPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSP 469

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PP  S PPP    P P P +PPP SPPP S
Sbjct: 470 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 503

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 45/94 (47%), Positives = 50/94 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+    PP    SPPP    PP   
Sbjct: 279 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPP 335

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP  S PPP    P P P +PPP SPPP S
Sbjct: 336 PPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPS 368

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 44/96 (45%), Positives = 50/96 (52%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPP--PVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP + P  SP PP+PP  +PP  P + PP  P  S PP +   P P   SPPP    PP 
Sbjct: 294 PPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 353

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               SPPP S  PP     PP  P +PPP SPPP S
Sbjct: 354 PPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPS 389

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 43/94 (45%), Positives = 49/94 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP+T P + P    PP+  PP+ P  SPPP   +PP     PPP    PPP  S PPP  
Sbjct: 112 PPTTPPPSPPPSQPPPSPPPPSPPPPSPPP--PSPPPPSPPPPPSPPPPPPPPSPPPPSP 169

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PP  S PPP    P P P +PPP SPPP S
Sbjct: 170 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 203

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 44/96 (45%), Positives = 49/96 (51%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT--PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP + P  SP PP+  PP+  PP+ P  SPPP    PP+    PP    SPPP    PP 
Sbjct: 330 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPS 389

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               SPPP S  PP      PP P  PPP SPPP S
Sbjct: 390 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPS 425

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/96 (46%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P   P+PP PP + PP+ P  SPPP    PP+     PP  + PPP    P P  
Sbjct: 361 PPSPPP---PSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 417

Query: 396 QSSPPPVSSTPP--PVQSSPPPAPVTPPPASPPPAS 497
             SPPP S  PP  P  S P P P +PPP SPPP S
Sbjct: 418 PPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPS 453

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 46/94 (48%), Positives = 52/94 (55%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP  S PP +   PPP  + PPP  S PPP  
Sbjct: 225 PPPSPPPPSPPPPSPP---PPSPPPPSPPP-PSPPPPSPPPPPPPPSPPPP--SPPPPSP 278

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PP  S PPP    P P P +PPP SPPP S
Sbjct: 279 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 312

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 43/94 (45%), Positives = 49/94 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP  P PP+  PP+ P  SPPP    PP+     PP  + PPP  S PPP  
Sbjct: 427 PPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSP 484

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PP  S PPP    P P P +PPP SPPP S
Sbjct: 485 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 518

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 45/96 (46%), Positives = 50/96 (52%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTA--QSSPPPVQASPPPVQSAPPP 389
           PP + P  SP PP+PP   PP+ P  SPPP    PP +    SPPP    PP   S PPP
Sbjct: 386 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPP 442

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                 PP  S PPP    P P P +PPP SPPP S
Sbjct: 443 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 478

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 44/94 (46%), Positives = 50/94 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+     PP  + PPP  S PPP  
Sbjct: 160 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSP 214

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PP  S PPP    P P P +PPP SPPP S
Sbjct: 215 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 248

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 44/94 (46%), Positives = 50/94 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+     PP  + PPP    P P  
Sbjct: 165 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 221

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            S PPP  S PPP    P P P +PPP SPPP S
Sbjct: 222 PSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPS 253

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 44/94 (46%), Positives = 50/94 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+     PP  + PPP    P P  
Sbjct: 170 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 226

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            S PPP  S PPP    P P P +PPP SPPP S
Sbjct: 227 PSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPS 258

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 45/95 (47%), Positives = 49/95 (51%), Gaps = 1/95 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-PPVQSAPPPV 392
           PPS  P + P PP+PP   PP+ P  SPPP     P   S PPP    P PP  S PPP 
Sbjct: 407 PPSPPPPSPPPPPSPP---PPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPS 463

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                PP  S PPP    P P P +PPP SPPP S
Sbjct: 464 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 498

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 44/96 (45%), Positives = 50/96 (52%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPT--NTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP + P  SP PP+PP   + PP  P  SPPP    PP+     PP  + PPP  S PPP
Sbjct: 135 PPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPP 192

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                 PP  S PPP    P P P +PPP SPPP S
Sbjct: 193 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 228

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 41/93 (44%), Positives = 49/93 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P+  P  P PP+  PP+ P  SPPP    PP+     PP  + PPP  S PPP  
Sbjct: 432 PPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSP 489

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
               PP  S PPP    P P P +PPP SPPP+
Sbjct: 490 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPS 522

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 43/92 (46%), Positives = 49/92 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+     PP  + PPP    P P  
Sbjct: 175 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 231

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            S PPP  S PPP    P P P +PPP SPPP
Sbjct: 232 PSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP 261

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 43/94 (45%), Positives = 49/94 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+     PP  + PPP    P P  
Sbjct: 185 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 241

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            S PPP   +PPP    PP  P  PPP SPPP S
Sbjct: 242 PSPPPP---SPPPPSPPPPSPPPPPPPPSPPPPS 272

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 40/91 (43%), Positives = 48/91 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP    PP+     PP  + PPP    P P  
Sbjct: 445 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 501

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
            S PPP   +PPP    PP  P +PPP+ PP
Sbjct: 502 PSPPPP---SPPPPSPPPPSPPPSPPPSHPP 529

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 42/91 (46%), Positives = 46/91 (50%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP  S PP +   P P   SPPP    PP   
Sbjct: 455 PPPSPPPPSPPPPSPP---PPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPSPP 510

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
             SPPP S  P P  S PP  P   PP  PP
Sbjct: 511 PPSPPPPSPPPSPPPSHPPSHPPMHPPMHPP 541

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 45/94 (47%), Positives = 49/94 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP   PP+ P  SPPP  S PP +   P P   SPPP  S PPP  
Sbjct: 465 PPPSPPPPSPPPPSPP---PPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPP-SPPPPSP 519

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP  S PP   S PP  P   PP  PP  S
Sbjct: 520 PPSPPP--SHPP---SHPPMHPPMHPPFLPPTTS 548

[50][TOP]
>UniRef100_Q8RWX5 Putative uncharacterized protein At3g19020 (Fragment) n=1
           Tax=Arabidopsis thaliana RepID=Q8RWX5_ARATH
          Length = 712

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 44/86 (51%), Positives = 51/86 (59%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           PST    + +P +PP ++PP      PPPV S PP   S PPP+ + PPPV S PPPV  
Sbjct: 629 PSTEETKTTSPQSPPVHSPPP-----PPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHS 683

Query: 399 SSPPPVSSTPPPVQSSPPPAPVTPPP 476
             PPPV S PPPV S PPP    PPP
Sbjct: 684 PPPPPVHSPPPPVHSPPPPVHSPPPP 709

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 51/97 (52%), Positives = 57/97 (58%), Gaps = 5/97 (5%)
 Frame = +3

Query: 216 PPSTSP--NASPAPPTPPTN-TPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           P   SP     P PP+P T  T  T+PQ+  PPV S PP     PPPV + PPPV S PP
Sbjct: 613 PYDASPIKKCRPQPPSPSTEETKTTSPQS--PPVHSPPP-----PPPVHSPPPPVFSPPP 665

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           P+  S PPPV S PPPV S PPP   +PPP   SPPP
Sbjct: 666 PM-HSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPP 701

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 39/85 (45%), Positives = 49/85 (57%), Gaps = 3/85 (3%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPA---PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP 368
           S   ++  +TSP + P    PP PP ++PP    + PPP+ S PP   S PPPV + PPP
Sbjct: 628 SPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPP 687

Query: 369 VQSAPPPVQQSSPPPVSSTPPPVQS 443
              +PPP   S PPPV S PPPV S
Sbjct: 688 PVHSPPPPVHSPPPPVHSPPPPVHS 712

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 51/109 (46%), Positives = 59/109 (54%), Gaps = 15/109 (13%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTP-PTTP-QASP-------PPVQSAPPTAQSSP--PPVQA 356
           +QPP T    +P   +PP  +P P  P  ASP       PP  S   T  +SP  PPV +
Sbjct: 590 EQPPKTE---APKMGSPPLESPVPNDPYDASPIKKCRPQPPSPSTEETKTTSPQSPPVHS 646

Query: 357 SPPP--VQSAPPPVQQSSPPPVSSTPPPVQSSPPP--APVTPPPASPPP 491
            PPP  V S PPPV  S PPP+ S PPPV S PPP  +P  PP  SPPP
Sbjct: 647 PPPPPPVHSPPPPVF-SPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP 694

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 48/146 (32%), Positives = 55/146 (37%), Gaps = 52/146 (35%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASP---------------PPVQSAPPTAQS--- 335
           Q+ P    +  P PP   T  P  +P+  P               PP Q  PP  ++   
Sbjct: 541 QETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQEQPPKTEAPKM 600

Query: 336 -SPP--------PVQASP-----------------------PPVQSAPPPVQ-QSSPPPV 416
            SPP        P  ASP                       PPV S PPP    S PPPV
Sbjct: 601 GSPPLESPVPNDPYDASPIKKCRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPV 660

Query: 417 SSTPPPVQSSPPPAPVTPPPA-SPPP 491
            S PPP+ S PPP    PPP  SPPP
Sbjct: 661 FSPPPPMHSPPPPVYSPPPPVHSPPP 686

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 33/96 (34%), Positives = 43/96 (44%), Gaps = 3/96 (3%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPPVQS--A 380
           Q+PP    +  P PP P  +  P  P Q +P P +S  P      PP Q +P P +S   
Sbjct: 514 QEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQ-----PPKQETPKPEESPKP 568

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
            PP Q++  P  S  P P +   PP    P   SPP
Sbjct: 569 QPPKQETPKPEESPKPQPPKQEQPPKTEAPKMGSPP 604

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 34/96 (35%), Positives = 43/96 (44%), Gaps = 5/96 (5%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP-PPVQASPPPVQS-APP 386
           +PP    +  P PP   T  P  +P+  PP  ++  P     P PP Q +P P +S  P 
Sbjct: 526 EPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQ 585

Query: 387 PVQQSSPPPVSSTPPPVQSSPP---PAPVTPPPASP 485
           P +Q  PP    T  P   SPP   P P  P  ASP
Sbjct: 586 PPKQEQPP---KTEAPKMGSPPLESPVPNDPYDASP 618

[51][TOP]
>UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2U1_EHV86
          Length = 2873

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 45/92 (48%), Positives = 49/92 (53%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP  SP  SP PP+PP + PP+ P  SPPP    PP   S PPP     PP  S PPP  
Sbjct: 2671 PPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPP---SPPPPSPPPSPPPPSPPPPSP 2727

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                PP  S PPP    P P P +PPP SPPP
Sbjct: 2728 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2759

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 46/95 (48%), Positives = 51/95 (53%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            +PPS  P  SP PP+PP  +PP +P  SPPP    PP   S PPP    P P  S PPP 
Sbjct: 2666 KPPSPPPPPSP-PPSPPPPSPPPSPPPSPPPPSPPPP---SPPPPSPPPPSPPPSPPPPS 2721

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                 PP  S PPP    P P P +PPP SPPP S
Sbjct: 2722 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 2756

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/100 (48%), Positives = 52/100 (52%), Gaps = 6/100 (6%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQ---ASPPPVQSAPP 386
            PP + P  SP P  PP+  PP+ P  SPPP    PP+   SPPP      SPPP    PP
Sbjct: 2676 PPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPP 2735

Query: 387  PVQQSSPPPVSSTP--PPVQSSPPPAPVTP-PPASPPPAS 497
                 SPPP S  P  PP  S PPP P  P PP SPPP S
Sbjct: 2736 SPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPS 2775

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 47/96 (48%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS  P + P P  PP + PP +P  SPPP  S PP +   P P   SPPP    PP   
Sbjct: 2690 PPSPPPPSPPPPSPPPPSPPPPSPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2748

Query: 396  QSSPPPVSSTPP-PVQSSPPPAPVTP-PPASPPPAS 497
              SPPP S  PP P   SPPP+P  P PP SPPP S
Sbjct: 2749 PPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPS 2784

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 41/92 (44%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS  P + P P  PP + PP+ P  SPPP    PP+     PP  + PPP    P P  
Sbjct: 2695 PPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2754

Query: 396  QSSPPPVSSTPPPVQSSPPPA-PVTPPPASPP 488
             S PPP+   P P  S PPP+ P +PPP SPP
Sbjct: 2755 PSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPP 2786

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 43/86 (50%), Positives = 48/86 (55%)
 Frame = +3

Query: 234  NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPP 413
            N+ P  P PP+  PP+ P  SPPP    PPT    PPP   SPPP    PPP    SPPP
Sbjct: 2251 NSPPPSPPPPSPHPPSPPPPSPPPPSPPPPT----PPP---SPPP----PPPTPPPSPPP 2299

Query: 414  VSSTPPPVQSSPPPAPVTPPPASPPP 491
             S  PP   S PPP+P  PPP+ PPP
Sbjct: 2300 PSPPPP---SPPPPSP--PPPSQPPP 2320

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 38/72 (52%), Positives = 40/72 (55%)
 Frame = +3

Query: 282  TPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAP 461
            +P  SPPP    PP    SPPP   SPPP  S PPP    SPPP   TPPP    P P P
Sbjct: 2252 SPPPSPPPPSPHPP----SPPP--PSPPP-PSPPPPTPPPSPPPPPPTPPPSPPPPSPPP 2304

Query: 462  VTPPPASPPPAS 497
             +PPP SPPP S
Sbjct: 2305 PSPPPPSPPPPS 2316

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/72 (52%), Positives = 40/72 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS  P + P P  PP + PP TP  SPPP    PPT   SPPP   SPPP  S PPP  
Sbjct: 2259 PPSPHPPSPPPPSPPPPSPPPPTPPPSPPP---PPPTPPPSPPP--PSPPP-PSPPPP-- 2310

Query: 396  QSSPPPVSSTPP 431
              SPPP S  PP
Sbjct: 2311 --SPPPPSQPPP 2320

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 36/77 (46%), Positives = 43/77 (55%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP + P  SP PP+PP   PP+ P  SPPP    PP   S PPP+  +P P  S PPP  
Sbjct: 2723 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPP---SPPPPLPPAPSPPPSPPPPSP 2776

Query: 396  QSSPPPVSSTPPPVQSS 446
              SPPP S   PP ++S
Sbjct: 2777 PPSPPPPS---PPDRTS 2790

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 30/52 (57%), Positives = 32/52 (61%)
 Frame = +3

Query: 336 SPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           SPPP    PPP+   PPP    SPPP S  PPP  S PPP+P  PPP SPPP
Sbjct: 204 SPPP-PPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPP 254

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/72 (50%), Positives = 41/72 (56%)
 Frame = +3

Query: 246  APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSST 425
            +PP+PP  +PP +P  SPPP    PP    SPPP   SPPP   +PPP    SPPP S  
Sbjct: 2528 SPPSPPPPSPPPSPPPSPPPPLPPPP----SPPP--PSPPP--PSPPP----SPPPPSPP 2575

Query: 426  PPPVQSSPPPAP 461
            P P   SPPP P
Sbjct: 2576 PSPPPPSPPPYP 2587

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 33/66 (50%), Positives = 34/66 (51%)
 Frame = +3

Query: 294 SPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPP 473
           SPPP    PP     PPP   SPPP   +PPP    SPPP S  PPP  S PPP    PP
Sbjct: 204 SPPPPPPPPPLPPPPPPPPPPSPPP--PSPPPPPPPSPPPPSPPPPPPPSPPPP----PP 257

Query: 474 PASPPP 491
           P  P P
Sbjct: 258 PPLPTP 263

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 37/78 (47%), Positives = 39/78 (50%)
 Frame = +3

Query: 240 SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVS 419
           SP PP PP   PP  P   PPP    PP    SPPP    PPP  S PPP   S PPP  
Sbjct: 204 SPPPPPPP---PPLPPPPPPPP----PP----SPPPPSPPPPPPPSPPPP---SPPPPPP 249

Query: 420 STPPPVQSSPPPAPVTPP 473
            +PPP    PPP P+  P
Sbjct: 250 PSPPP----PPPPPLPTP 263

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 31/69 (44%), Positives = 32/69 (46%)
 Frame = +3

Query: 222 STSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQS 401
           S  P+  P PP PP   PP  P    PP  S PP    SPPP    PPP  S PPP    
Sbjct: 200 SDFPSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPP---- 255

Query: 402 SPPPVSSTP 428
            PPP   TP
Sbjct: 256 -PPPPLPTP 263

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 33/73 (45%), Positives = 37/73 (50%)
 Frame = +3

Query: 243 PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSS 422
           P+PP PP   PP  P   PPP   +PP     PPP  + PPP   +PPP     PPP S 
Sbjct: 203 PSPPPPPP--PPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPP---SPPP-----PPPPSP 252

Query: 423 TPPPVQSSPPPAP 461
            PPP    PPP P
Sbjct: 253 PPPP----PPPLP 261

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/73 (47%), Positives = 39/73 (53%)
 Frame = +3

Query: 195  VSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
            +S+    PPS  P  SP P  PP+  PP  P  SPPP    PP+   SPPP   SPPP  
Sbjct: 2522 ISSDPCSPPSPPP-PSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPP--PSPPP-- 2576

Query: 375  SAPPPVQQSSPPP 413
            S PPP    SPPP
Sbjct: 2577 SPPPP----SPPP 2585

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 31/63 (49%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = +3

Query: 312  SAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTP-PPASPP 488
            S+ P +  SPPP    P P  S PPP+     PP  S PPP   SPPP+P  P PP SPP
Sbjct: 2523 SSDPCSPPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPP---SPPPSPPPPSPPPSPP 2579

Query: 489  PAS 497
            P S
Sbjct: 2580 PPS 2582

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 27/57 (47%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +3

Query: 330  QSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPA-PVTPPPASPPPAS 497
            ++SPPP    P P   +PPP     P P   TPPP    PPP  P +PPP SPPP S
Sbjct: 2250 ENSPPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPS 2306

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 26/62 (41%), Positives = 30/62 (48%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP + PP +P   PPP  S PP +   PPP    PPP    P P  
Sbjct: 208 PPPPPPLPPPPPPPPPPSPPPPSPPPPPPP--SPPPPSPPPPPPPSPPPPPPPPLPTPTG 265

Query: 396 QS 401
           +S
Sbjct: 266 RS 267

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 30/53 (56%), Positives = 32/53 (60%)
 Frame = +3

Query: 333  SSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            S  PP   SPPP  S PPP    SPPP  S PPP   SPPP P+ PPP+ PPP
Sbjct: 1169 SCNPP---SPPPPPSPPPP----SPPPPPSPPPP---SPPP-PLPPPPSPPPP 1210

[52][TOP]
>UniRef100_Q41645 Extensin (Fragment) n=1 Tax=Volvox carteri RepID=Q41645_VOLCA
          Length = 464

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 51/107 (47%), Positives = 57/107 (53%), Gaps = 10/107 (9%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTP-----PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP-P 368
           A  PP   P  SP+PP P     P   PP  P  SPPP +S+P     SPPP    PP P
Sbjct: 287 ASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRP 346

Query: 369 VQSAPPPVQQSSPPP--VSSTPPPVQSSPPPAPVT--PPPASPPPAS 497
             S PPP    SPPP  VS  PPP ++SPPP P +  PPP  PPP S
Sbjct: 347 SPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPS 393

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 46/101 (45%), Positives = 55/101 (54%), Gaps = 8/101 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTP--------PTTPQASPPPVQSAPPTAQSSPPPVQASPPPV 371
           PP   P +SP PP PP  +P        P+ P  SPPP    PP    SPPP ++SP P 
Sbjct: 301 PPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSP- 359

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              PPPV    PPP  ++PPP  +S PP P  PPP SPPP+
Sbjct: 360 ---PPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSPPPS 397

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 47/101 (46%), Positives = 56/101 (55%), Gaps = 7/101 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP---PTNTPPTTPQASPPPVQSAP----PTAQSSPPPVQASPPPVQ 374
           PP   P  SP+PP P   P+  PP+ P  SPPP + +P    P +  SPPP   SPPP  
Sbjct: 311 PPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPP-- 368

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             PPP     PPP SS PPP    P P P +PPP+ PPPA+
Sbjct: 369 --PPPRASPPPPPASSPPPP----PRPPPPSPPPSPPPPAT 403

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 47/98 (47%), Positives = 52/98 (53%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216 PPSTSPN-ASPAPPTPPT---NTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PPS  P  ASP PP PP    + PP  P +SPPP    PP    SPPP ++SP P   +P
Sbjct: 279 PPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPP--PPPPRPSPSPPPPRSSPSPPPPSP 336

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PP     P P  S PPP  S  PP PV  PP  PP AS
Sbjct: 337 PPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRAS 374

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 47/94 (50%), Positives = 55/94 (58%), Gaps = 4/94 (4%)
 Frame = +3

Query: 222 STSPNASPAPPTPPTN--TPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ--SAPPP 389
           S SP  + +PP P T+   PP  P + PPPV S PP     PP V  SPPP Q  S+PPP
Sbjct: 256 SPSPVLTASPPLPKTSPPPPPRVPPSPPPPVASPPP---PPPPRVSPSPPPPQPVSSPPP 312

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                PP  S +PPP +SSP P P +PPP SPPP
Sbjct: 313 ---PPPPRPSPSPPPPRSSPSPPPPSPPPPSPPP 343

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 50/117 (42%), Positives = 60/117 (51%), Gaps = 10/117 (8%)
 Frame = +3

Query: 171 VGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPV-QSAPPTAQSSPPP 347
           V L+ A  V       P   P  S +PP      PP    +SPPP  +S PP   +SP P
Sbjct: 206 VALVTAAAVVVQTTPSPPPPPRVSTSPP------PPARVSSSPPPATRSPPPRRITSPSP 259

Query: 348 V-QASPPPVQSAPPP---VQQSSPPPVSSTPPP-----VQSSPPPAPVTPPPASPPP 491
           V  ASPP  +++PPP   V  S PPPV+S PPP       S PPP PV+ PP  PPP
Sbjct: 260 VLTASPPLPKTSPPPPPRVPPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPP 316

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 42/94 (44%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP-PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP + P  SP PP P P+  PP +  + PPPV S PP     PPP  + PPP  S+PPP 
Sbjct: 332 PPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPP-----PPPRASPPPPPASSPPPP 386

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            +  PP    +PPP  S PPPA     P SP P+
Sbjct: 387 PRPPPP----SPPP--SPPPPATAAANPPSPAPS 414

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 43/111 (38%), Positives = 52/111 (46%), Gaps = 19/111 (17%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP-PVQSAPPPV 392
           P    P +SP+PP P  + PP  P+ASPPP     P A S PPP +  PP P  S PPP 
Sbjct: 348 PSPPPPRSSPSPPPPVVSPPPPPPRASPPP-----PPASSPPPPPRPPPPSPPPSPPPPA 402

Query: 393 QQSSPPPVSS----------------TPPPVQSSPPPAPVTPPP--ASPPP 491
             ++ PP  +                 PPP   +PPP    PPP   SPPP
Sbjct: 403 TAAANPPSPAPSRSRAGGPPLGTRPPPPPPEDDAPPPDYYFPPPQDMSPPP 453

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 36/99 (36%), Positives = 46/99 (46%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P+ SP PP    + PP      PPP +++PP     PPP  + PPP +  PP   
Sbjct: 341 PPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPP-----PPPASSPPPPPRPPPPSPP 395

Query: 396 QSSPPPVSSTPPPVQSSP-------PPAPVTPPPASPPP 491
            S PPP ++   P   +P       PP    PPP  PPP
Sbjct: 396 PSPPPPATAAANPPSPAPSRSRAGGPPLGTRPPP--PPP 432

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 3/76 (3%)
 Frame = +3

Query: 279 TTPQASPPPVQSAPPTAQSSPPP---VQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSP 449
           TTP  SPPP    PP   +SPPP   V +SPPP   +PPP + +SP PV +  PP+  + 
Sbjct: 218 TTP--SPPP----PPRVSTSPPPPARVSSSPPPATRSPPPRRITSPSPVLTASPPLPKTS 271

Query: 450 PPAPVTPPPASPPPAS 497
           PP P   PP+ PPP +
Sbjct: 272 PPPPPRVPPSPPPPVA 287

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/90 (40%), Positives = 43/90 (47%), Gaps = 3/90 (3%)
 Frame = +3

Query: 216 PPSTSPNASPA--PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP  SP   PA  PP PP   PP+ P + PPP  +A      +P   +A  PP+ + PPP
Sbjct: 370 PPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPLGTRPPP 429

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAP-VTPPP 476
                PPP    PPP    PPP     PPP
Sbjct: 430 -----PPPEDDAPPPDYYFPPPQDMSPPPP 454

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 33/85 (38%), Positives = 41/85 (48%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A +  PP   P  SP P  P    PP T  A+PP    AP  +++  PP+   PP     
Sbjct: 380 ASSPPPPPRPPPPSPPPSPP----PPATAAANPP--SPAPSRSRAGGPPLGTRPP----- 428

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPP 455
           PPP +  +PPP    PPP   SPPP
Sbjct: 429 PPPPEDDAPPPDYYFPPPQDMSPPP 453

[53][TOP]
>UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2Z7_EHV86
          Length = 516

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 50/109 (45%), Positives = 58/109 (53%), Gaps = 2/109 (1%)
 Frame = +3

Query: 177 LICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA 356
           +I  V +  GA   P + P  SP PP+PP  +PP  P   PPP    P    S PPP+  
Sbjct: 5   MIFVVILCGGAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPL-- 62

Query: 357 SPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPA--PVTPPPASPPPAS 497
            PPP  S P P   S PPP  S PPP   SPPP+  P +PPP SPPP S
Sbjct: 63  -PPPSPSPPSPPPPSPPPP--SPPPPSPPSPPPSPPPPSPPPPSPPPPS 108

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 50/97 (51%), Positives = 56/97 (57%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTN-TPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP  SP  SP PP PP + +PP+ P  SPPP  S PP +  SPPP   SPPP    PP  
Sbjct: 49  PPPPSPPPSPPPPLPPPSPSPPSPPPPSPPP-PSPPPPSPPSPPP---SPPPPSPPPPSP 104

Query: 393 QQSSPPPVSSTPPPVQSSPPPAP--VTPPPASPPPAS 497
              SPPP S  PP    SPPP+P   +PPP SPPP S
Sbjct: 105 PPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPS 141

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 48/114 (42%), Positives = 59/114 (51%), Gaps = 2/114 (1%)
 Frame = +3

Query: 162 VLVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP 341
           ++ V ++C    +     PP + P  SP PP+PP   PP  P + PPP  S PP+     
Sbjct: 5   MIFVVILCGGAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPP--SPPPSPPPPL 62

Query: 342 PPVQASP--PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PP   SP  PP  S PPP   S PPP   +PPP    P P P +PPP SPPP S
Sbjct: 63  PPPSPSPPSPPPPSPPPP---SPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPS 113

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 51/124 (41%), Positives = 62/124 (50%), Gaps = 7/124 (5%)
 Frame = +3

Query: 147 MGTHIVLVVGLICAVFVSAGAQQPPSTSPNASPAP-------PTPPTNTPPTTPQASPPP 305
           M   ++ VV L    + +  +  PPS  P + P P       P PP + PP +P  SPPP
Sbjct: 1   MNIFMIFVVILCGGAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPP 60

Query: 306 VQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
               PP + S P P   SPPP   +PPP    SPPP  S PPP    P P P +PPP SP
Sbjct: 61  --PLPPPSPSPPSPPPPSPPP--PSPPPPSPPSPPP--SPPPPSPPPPSPPPPSPPPPSP 114

Query: 486 PPAS 497
           PP S
Sbjct: 115 PPPS 118

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/92 (50%), Positives = 51/92 (55%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS SP  SP PP+PP  +PP     SPPP  S PP +   P P   SPPP  S PPP  
Sbjct: 64  PPSPSP-PSPPPPSPPPPSPPPPSPPSPPP--SPPPPSPPPPSPPPPSPPP-PSPPPPSP 119

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             SPPP  S P P   SPPP  ++P P  PPP
Sbjct: 120 PPSPPPSPSPPSPPPPSPPPPSISPSPPPPPP 151

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 49/112 (43%), Positives = 57/112 (50%), Gaps = 20/112 (17%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAP------------PTAQSSPPPVQAS 359
           PP + P  SP P  PP+ +PP+ P  SPPP   +P            P+A  SPPP    
Sbjct: 110 PPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPP---P 166

Query: 360 PPPVQSAP-----PPVQQSSPPPVSS---TPPPVQSSPPPAPVTPPPASPPP 491
           PPP   AP     PP    SP P SS   TPPP  +SP P P +PPP SPPP
Sbjct: 167 PPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPP 218

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 44/100 (44%), Positives = 50/100 (50%), Gaps = 8/100 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+PP + PP+ P  SPPP    PP   S PPP    P P  S PP   
Sbjct: 73  PPPSPPPPSPPPPSPP-SPPPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPSPPPSPS 128

Query: 396 QSSPPPVSSTPPPVQSSPPPAP--------VTPPPASPPP 491
             SPPP S  PP +  SPPP P         +P P  PPP
Sbjct: 129 PPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPP 168

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 43/93 (46%), Positives = 50/93 (53%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-PPVQSAPPPV 392
           PP  SP + P  P PP+  PP+ P  SPPP    PP+   SPPP  + P PP  S PPP 
Sbjct: 82  PPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPS 141

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              SPPP    PPP   +P  +P  PPP  PPP
Sbjct: 142 ISPSPPP---PPPPWWQAPSASPSPPPP--PPP 169

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 49/114 (42%), Positives = 54/114 (47%), Gaps = 23/114 (20%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPT---TPQASPPPVQSAP----------------PTAQSS 338
           PPS  P+ SP  P PP+  PP+   +P   PPP   AP                P+A  S
Sbjct: 120 PPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPS 179

Query: 339 PPPVQASPPPVQSA----PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           PPP   SP P  SA    PPP    SPPP S  PPP    PPP P  PPP SPP
Sbjct: 180 PPPPSISPSPPSSASPTPPPPSASPSPPPPS--PPPPSPPPPPPPPPPPPPSPP 231

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 48/120 (40%), Positives = 54/120 (45%), Gaps = 28/120 (23%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPV--------QASPPPV 371
           PP + P  SP PP+PP + PP+    SPPP    PP+   SPPP          ASP P 
Sbjct: 105 PPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPP 164

Query: 372 QSAPP----PVQQSSPPP----------VSSTPPPVQSSP------PPAPVTPPPASPPP 491
              PP    P    SPPP           S TPPP  +SP      PP P  PPP  PPP
Sbjct: 165 PPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPP 224

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 43/108 (39%), Positives = 57/108 (52%), Gaps = 12/108 (11%)
 Frame = +3

Query: 198 SAGAQQPPST-----SPNASPAPPTPPTN-TPPTTPQASPPPVQSAPPTAQSSPPPVQAS 359
           SA    PP       +P+ASP+PP P  + +PP++   +PPP  ++P     SPPP    
Sbjct: 158 SASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPP 217

Query: 360 PPPVQSAPPPVQQSSP-PPVSSTPPP-----VQSSPPPAPVTPPPASP 485
           PPP    PPP    SP PP S++P P     ++S PPP P  PPP  P
Sbjct: 218 PPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPPPPGLP 265

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 44/121 (36%), Positives = 56/121 (46%), Gaps = 22/121 (18%)
 Frame = +3

Query: 195 VSAGAQQPPST---SPNASPAPPTPPT---NTPPTTPQASPPPVQSAPPTAQS-SPPPVQ 353
           +S     PP     +P+ASP+PP PP      P  +P   PP +  +PP++ S +PPP  
Sbjct: 142 ISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPS 201

Query: 354 ASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPP---------------APVTPPPASPP 488
           ASP P   +PPP     PPP    PPP   SP P               +P  PPP  PP
Sbjct: 202 ASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPPP 261

Query: 489 P 491
           P
Sbjct: 262 P 262

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 43/95 (45%), Positives = 51/95 (53%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           Q PS SP  SP PP PP    P+   + PPP  S  P + +SP P    PPP  S  PP 
Sbjct: 155 QAPSASP--SPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTP----PPPSASPSPP- 207

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              SPPP S  PPP    PPP P +PP  +PPP++
Sbjct: 208 -PPSPPPPSPPPPP--PPPPPPPPSPPSPNPPPSA 239

[54][TOP]
>UniRef100_Q01AC1 Meltrins, fertilins and related Zn-dependent metalloproteinases of
           the ADAMs family (ISS) n=1 Tax=Ostreococcus tauri
           RepID=Q01AC1_OSTTA
          Length = 872

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 49/93 (52%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPP-TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP +SP  SP+PP +PP + PP +P  SPPP  S PP +  SPPP   SPPP  S PPP 
Sbjct: 496 PPVSSPPPSPSPPPSPPPSPPPPSPPPSPPP--SPPPPSPPSPPPPSPSPPP--SPPPP- 550

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              SPPP S+  PP    P P P +PPP SPPP
Sbjct: 551 --PSPPPGSAARPPSPPPPSPPPPSPPPPSPPP 581

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 46/96 (47%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP--P 389
           PPS SP  SP P  PP + PP+ P + PPP   +PP    SPPP   SPPP  S PP   
Sbjct: 502 PPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPP---SPPPPPSPPPGSA 558

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            +  SPPP S  PP      PP P +PPP+ PPP S
Sbjct: 559 ARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPS 594

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 48/98 (48%), Positives = 55/98 (56%), Gaps = 7/98 (7%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPT-TPQASPPPVQSAPPTAQSSPP------PVQASPPPVQS 377
           P  SP  SP PP+PP+  PP+ +P  SPPP  S PP + + PP      P   SPPP   
Sbjct: 520 PPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSP 579

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PPP    SPPP  S PPP   SPPP PV   P+SPPP
Sbjct: 580 PPPPSPPPSPPPPPSPPPP---SPPPPPVVVVPSSPPP 614

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 44/94 (46%), Positives = 52/94 (55%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT--AQSSPPPVQASPPPVQSAPPP 389
           PP + P  SP PP+PP + PP +P + PPP  S PP+     SPPP  A+ PP    P P
Sbjct: 511 PPPSPPPPSP-PPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSP 569

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              S PPP    PP    SPPP P  PPP+ PPP
Sbjct: 570 PPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPP 603

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 45/95 (47%), Positives = 51/95 (53%), Gaps = 1/95 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P S  P A P    PP+ +PP +P  SPPP    P    S PPP   SPPP   +PPP  
Sbjct: 488 PSSELPTAPPVSSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPP-- 545

Query: 396 QSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
             SPPP  S PP   + PP P P +PPP SPPP S
Sbjct: 546 --SPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPS 578

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 44/94 (46%), Positives = 50/94 (53%), Gaps = 7/94 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQA-SPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP  SP+  P+PP PP+  P +  +  SPPP    PP+     PP   SPPP  S PPP 
Sbjct: 536 PPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPP--SPPPP- 592

Query: 393 QQSSPPPVSSTPPP---VQSSPPPAPVT---PPP 476
              SPPP S  PPP   V SSPPP  V    PPP
Sbjct: 593 --PSPPPPSPPPPPVVVVPSSPPPVLVNDMYPPP 624

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 40/84 (47%), Positives = 44/84 (52%), Gaps = 4/84 (4%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A +PPS  P  SP PP+PP  +PP  P  SPPP    PP    SPPP    PPPV   P 
Sbjct: 558 AARPPSPPP-PSPPPPSPPPPSPP--PPPSPPPSPPPPP----SPPPPSPPPPPVVVVP- 609

Query: 387 PVQQSSPPPV----SSTPPPVQSS 446
               SSPPPV       PPPV S+
Sbjct: 610 ----SSPPPVLVNDMYPPPPVMSA 629

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 31/62 (50%), Positives = 37/62 (59%)
 Frame = +3

Query: 306 VQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
           + S P +   + PPV +SPPP  S PPP    SPPP S  P P  S PPP+P +PPP SP
Sbjct: 484 LSSVPSSELPTAPPV-SSPPPSPS-PPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSP 541

Query: 486 PP 491
            P
Sbjct: 542 SP 543

[55][TOP]
>UniRef100_UPI0001983015 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983015
          Length = 469

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 44/101 (43%), Positives = 55/101 (54%), Gaps = 8/101 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPT-TPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP  +P  +P P  PP  TPP   P  +PPP ++ PP    +PPP Q  PPP     PP 
Sbjct: 136 PPKETPPPAPVPAPPPKQTPPPPAPVPAPPPKETPPPAPVPAPPPKQTPPPPAPVPAPPP 195

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPV-------TPPPASPPPA 494
           +++ PPP     PP + +PPPAPV       TPPP SP PA
Sbjct: 196 KETPPPPTPVPAPPPKETPPPAPVPAPPPKETPPPPSPVPA 236

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 44/101 (43%), Positives = 55/101 (54%), Gaps = 8/101 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPT-TPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP  +P  +P P  PP  TPP   P  +PPP ++ PP    +PPP Q  PPP     PP 
Sbjct: 107 PPKGTPPPAPVPAPPPKETPPPPAPVPAPPPKETPPPAPVPAPPPKQTPPPPAPVPAPPP 166

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPV-------TPPPASPPPA 494
           +++ PP     PPP Q+ PPPAPV       TPPP +P PA
Sbjct: 167 KETPPPAPVPAPPPKQTPPPPAPVPAPPPKETPPPPTPVPA 207

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 44/99 (44%), Positives = 54/99 (54%), Gaps = 3/99 (3%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A  P  T P  +P P  PP  TPP  P  +PPP Q+ PP A    PP + +PPP     P
Sbjct: 119 APPPKETPPPPAPVPAPPPKETPPPAPVPAPPPKQTPPPPAPVPAPPPKETPPPAPVPAP 178

Query: 387 PVQQSSPPPVS-STPPPVQSSPPPAPV--TPPPASPPPA 494
           P +Q+ PPP     PPP ++ PPP PV   PP  +PPPA
Sbjct: 179 PPKQTPPPPAPVPAPPPKETPPPPTPVPAPPPKETPPPA 217

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 44/107 (41%), Positives = 55/107 (51%), Gaps = 14/107 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP-------PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           PP   P  +P PP P       P  TPP  P  +PPP ++ PP A    PP + +PPP  
Sbjct: 86  PPPPPPKVTPPPPPPVPVPAPPPKGTPPPAPVPAPPPKETPPPPAPVPAPPPKETPPPAP 145

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPV-------TPPPASPPPA 494
              PP +Q+ PPP     PP + +PPPAPV       TPPP +P PA
Sbjct: 146 VPAPPPKQTPPPPAPVPAPPPKETPPPAPVPAPPPKQTPPPPAPVPA 192

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 42/99 (42%), Positives = 53/99 (53%), Gaps = 4/99 (4%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQ-SSPPPVQASPPPVQSAP 383
           A  P  T P  +P P  PP  TPP  P  +PPP Q+ PP A   +PPP +  PPP     
Sbjct: 148 APPPKQTPPPPAPVPAPPPKETPPPAPVPAPPPKQTPPPPAPVPAPPPKETPPPPTPVPA 207

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
           PP +++ PP     PPP ++ PPP+PV  PP     PPP
Sbjct: 208 PPPKETPPPAPVPAPPPKETPPPPSPVPAPPPKETRPPP 246

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 40/89 (44%), Positives = 49/89 (55%), Gaps = 5/89 (5%)
 Frame = +3

Query: 243 PAPPTPPTNTPPTTPQA---SPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPP 413
           P PP PP  TPP  P     +PPP  + PP    +PPP +  PPP     PP +++ PP 
Sbjct: 85  PPPPPPPKVTPPPPPPVPVPAPPPKGTPPPAPVPAPPPKETPPPPAPVPAPPPKETPPPA 144

Query: 414 VSSTPPPVQSSPPPAPV--TPPPASPPPA 494
               PPP Q+ PPPAPV   PP  +PPPA
Sbjct: 145 PVPAPPPKQTPPPPAPVPAPPPKETPPPA 173

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 40/93 (43%), Positives = 50/93 (53%), Gaps = 2/93 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPT-TPQASPPPVQS-APPTAQSSPPPVQASPPPVQSAPPP 389
           PP  +P  +P P  PP  TPP   P  +PPP ++  PPT   +PPP +  PP    APPP
Sbjct: 165 PPKETPPPAPVPAPPPKQTPPPPAPVPAPPPKETPPPPTPVPAPPPKETPPPAPVPAPPP 224

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
            +   PP     PPP ++ PPP   TP PA PP
Sbjct: 225 KETPPPPSPVPAPPPKETRPPPP--TPVPAPPP 255

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/98 (41%), Positives = 51/98 (52%), Gaps = 4/98 (4%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNT-PPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           A  P  T P  +P P  PP  T PP TP  +PPP ++ PP    +PPP +  PPP     
Sbjct: 177 APPPKQTPPPPAPVPAPPPKETPPPPTPVPAPPPKETPPPAPVPAPPPKETPPPPSPVPA 236

Query: 384 PPVQQSSPPPVSSTPPPVQSSPP---PAPVTPPPASPP 488
           PP +++ PPP    P PV + PP   P   TP PA PP
Sbjct: 237 PPPKETRPPP----PTPVPAPPPQEDPECSTPAPAPPP 270

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 37/85 (43%), Positives = 44/85 (51%), Gaps = 1/85 (1%)
 Frame = +3

Query: 243 PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA-SPPPVQSAPPPVQQSSPPPVS 419
           P PP PP   PP      PPPV    P  + +PPP    +PPP ++ PPP    +PPP  
Sbjct: 80  PCPPPPPPPPPPKVTPPPPPPVPVPAPPPKGTPPPAPVPAPPPKETPPPPAPVPAPPP-K 138

Query: 420 STPPPVQSSPPPAPVTPPPASPPPA 494
            TPPP     PP   TPPP +P PA
Sbjct: 139 ETPPPAPVPAPPPKQTPPPPAPVPA 163

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/102 (37%), Positives = 47/102 (46%), Gaps = 10/102 (9%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPV----QSAP 383
           PP   P   PAPP   T  PP+ P   P P+ + PP     PP    +PPP     Q+ P
Sbjct: 349 PPPPPPVPGPAPPPKVTPPPPSPPPPPPAPIPAPPPKETPPPPAPVPAPPPKKTLPQTPP 408

Query: 384 PPVQQSSPPPVSSTP------PPVQSSPPPAPVTPPPASPPP 491
           PP    +PPP  + P      PP + +PPP    P   SPPP
Sbjct: 409 PPAPVPAPPPKETPPLAPVPAPPPKETPPPLAPQPKETSPPP 450

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 39/92 (42%), Positives = 48/92 (52%), Gaps = 2/92 (2%)
 Frame = +3

Query: 222 STSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQ-ASPPPVQSAPPPVQQ 398
           S S    P  P PP   PP  P  +PPP  + PP +   PPP    +PPP ++ PPP   
Sbjct: 338 SLSNCLEPCRPPPP---PPPVPGPAPPPKVTPPPPSPPPPPPAPIPAPPPKETPPPPAPV 394

Query: 399 SSPPPVSSTPPPVQSSPPPAPV-TPPPASPPP 491
            +PPP  + P   Q+ PPPAPV  PPP   PP
Sbjct: 395 PAPPPKKTLP---QTPPPPAPVPAPPPKETPP 423

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 38/93 (40%), Positives = 43/93 (46%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  +    P    P  + PP+TP   PPP  S P   Q  PP V+   PP    P P  
Sbjct: 31  PPCVNGKCPPCIKVP-CSPPPSTP---PPPRNSCP--TQVCPPCVKGICPPCIGKPCPPP 84

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              PPP   TPPP    P PAP  PP  +PPPA
Sbjct: 85  PPPPPPPKVTPPPPPPVPVPAP--PPKGTPPPA 115

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 30/74 (40%), Positives = 38/74 (51%), Gaps = 5/74 (6%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNT-----PPTTPQASPPPVQSAPPTAQSSPPPVQASPPPV 371
           A  P  T P  +P P  PP  T     PP  P  +PPP ++ PP A    PP + +PPP+
Sbjct: 381 APPPKETPPPPAPVPAPPPKKTLPQTPPPPAPVPAPPPKET-PPLAPVPAPPPKETPPPL 439

Query: 372 QSAPPPVQQSSPPP 413
             AP P + S PPP
Sbjct: 440 --APQPKETSPPPP 451

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 32/89 (35%), Positives = 37/89 (41%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP T   A P   TPP    P  P    PP    PP+   +PPP +  PPP    P P  
Sbjct: 200 PPPTPVPAPPPKETPPPAPVPAPPPKETPP----PPSPVPAPPPKETRPPPPTPVPAPPP 255

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPAS 482
           Q  P    STP P   +PPP  +     S
Sbjct: 256 QEDPE--CSTPAP---APPPTNIATAATS 279

[56][TOP]
>UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA
          Length = 599

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 49/121 (40%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +3

Query: 135 PTHKMGTHIVLVVGLICAVFVSAGAQQPPSTSPNA--SPAPPTPPTNTPPTTPQASPPPV 308
           P +  G     +    C     + A   P   PNA  SP PP+PP   PP+ P + PPP 
Sbjct: 183 PGYPSGFCAAAIFDTTCECCPISQASTLPLPLPNAPPSPLPPSPPPPPPPSPPPSPPPPP 242

Query: 309 QSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
              PP+   SPPP    PPP    PPP     PPP S  PPP    PPP P  PPP  PP
Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPP---PPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299

Query: 489 P 491
           P
Sbjct: 300 P 300

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 41/91 (45%), Positives = 46/91 (50%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P   P+PP PP  +PP +P   PPP   +PP +   PPP    PPP    PPP  
Sbjct: 218 PPSPLP---PSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPP 274

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
            S PPP    PPP    PPP P  PPP   P
Sbjct: 275 PSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 45/92 (48%), Positives = 46/92 (50%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP  SP PP PP   PP +P  SPPP    PP     PPP    PPP    PPP  
Sbjct: 229 PPPPSPPPSPPPPPPP---PPPSPPPSPPPPPPPPP-----PPPPPPPPPP----PPP-- 274

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             SPPP    PPP    PPP P  PPP  PPP
Sbjct: 275 -PSPPP----PPPPPPPPPPPPPPPPPPPPPP 301

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 39/89 (43%), Positives = 42/89 (47%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P+  P PP PP + PP+ P   PPP    PP     PPP    PPP    PPP  
Sbjct: 231 PPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP-- 288

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPAS 482
              PPP    PPP    PPP PV P   S
Sbjct: 289 -PPPPP----PPP---PPPPPPVYPDQCS 309

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 42/94 (44%), Positives = 44/94 (46%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P   P PP+PP + PP  P   PPP    PP     PPP   SPPP    PPP  
Sbjct: 235 PPSPPPPPPPPPPSPPPSPPPPPP-PPPPPPPPPPP-----PPPPPPSPPP----PPP-- 282

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              PPP    PPP    PPP P  PPP  P   S
Sbjct: 283 ---PPP----PPPPPPPPPPPPPPPPPVYPDQCS 309

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 35/76 (46%), Positives = 40/76 (52%), Gaps = 2/76 (2%)
 Frame = +3

Query: 273 PPTTPQASPPPVQSAPPTA--QSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSS 446
           P +     P P+ +APP+    S PPP   SPPP    PPP    SPPP  S PPP    
Sbjct: 203 PISQASTLPLPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPP--SPPPPPPPP 260

Query: 447 PPPAPVTPPPASPPPA 494
           PPP P  PPP  PPP+
Sbjct: 261 PPPPPPPPPPPPPPPS 276

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 31/74 (41%), Positives = 32/74 (43%), Gaps = 2/74 (2%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV-- 392
           P  SP   P PP PP   PP  P   PPP    PP     PPP    PPP    PPPV  
Sbjct: 249 PPPSPPPPPPPPPPP---PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305

Query: 393 QQSSPPPVSSTPPP 434
            Q S   V+   PP
Sbjct: 306 DQCSVCIVAKLQPP 319

[57][TOP]
>UniRef100_C0P2F3 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0P2F3_MAIZE
          Length = 326

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 45/97 (46%), Positives = 50/97 (51%), Gaps = 5/97 (5%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPT-----PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           Q P   P  +P PPT     PP   PP    A PPP    PP  ++ PPP Q  PPP + 
Sbjct: 26  QQPFPPPRRAPPPPTLPQPPPPRRAPPPPALAPPPPTMPPPPPRRAPPPPTQPPPPP-RR 84

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           APPP  Q  PPP  + PPP Q  PPP    PPP SPP
Sbjct: 85  APPPPTQPPPPPRRAPPPPTQPPPPPRRAPPPPPSPP 121

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 41/92 (44%), Positives = 49/92 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  +P      P PPT  PP   +A PPP Q  PP  ++ PPP Q  PPP ++ PPP Q
Sbjct: 46  PPRRAPPPPALAPPPPTMPPPPPRRAPPPPTQPPPPPRRAPPPPTQPPPPPRRAPPPPTQ 105

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PP  +  PPP     PP P TP P +PPP
Sbjct: 106 PPPPPRRAPPPPPSPPIRPPPPPTPRPQAPPP 137

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 42/87 (48%), Positives = 46/87 (52%)
 Frame = +3

Query: 231 PNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPP 410
           P   P PP      PPT PQ  PPP + APP    +PPP    PPP + APPP  Q  PP
Sbjct: 24  PPQQPFPPPRRAPPPPTLPQ--PPPPRRAPPPPALAPPPPTMPPPPPRRAPPPPTQPPPP 81

Query: 411 PVSSTPPPVQSSPPPAPVTPPPASPPP 491
           P  + PPP Q  PPP    PPP  PPP
Sbjct: 82  PRRAPPPPTQPPPPPRRAPPPPTQPPP 108

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 45/102 (44%), Positives = 54/102 (52%), Gaps = 7/102 (6%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A  PP+ +P     PP PP   PP   Q  PPP ++ PP  Q  PPP +A PPP Q  PP
Sbjct: 50  APPPPALAPPPPTMPPPPPRRAPPPPTQPPPPPRRAPPPPTQPPPPPRRAPPPPTQPPPP 109

Query: 387 PVQQSSP---PPVSSTPPPV---QSSPPP-APVTPPPASPPP 491
           P +   P   PP+   PPP    Q+ PPP  P+ PPPA  PP
Sbjct: 110 PRRAPPPPPSPPIRPPPPPTPRPQAPPPPHLPMPPPPAPVPP 151

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 44/95 (46%), Positives = 52/95 (54%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASP---APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PP T P   P   APP PP   PP      PPP ++ PP  Q  PPP +A PPP Q  PP
Sbjct: 37  PPPTLPQPPPPRRAPP-PPALAPPPPTMPPPPPRRAPPPPTQPPPPPRRAPPPPTQPPPP 95

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           P  + +PPP +  PPP + +PPP P   PP  PPP
Sbjct: 96  P--RRAPPPPTQPPPPPRRAPPPPP--SPPIRPPP 126

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 40/94 (42%), Positives = 49/94 (52%), Gaps = 4/94 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP----VQSAP 383
           PP  +P     PP PP   PP   Q  PPP ++ PP  Q  PPP +A PPP    ++  P
Sbjct: 67  PPRRAPPPPTQPPPPPRRAPPPPTQPPPPPRRAPPPPTQPPPPPRRAPPPPPSPPIRPPP 126

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
           PP  +   PP    PP +   PPPAPV PPP+ P
Sbjct: 127 PPTPRPQAPP----PPHLPMPPPPAPVPPPPSPP 156

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 37/91 (40%), Positives = 46/91 (50%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           P   PN  P  P PP    P   +A PPP    PP  + +PPP   +PPP    PPP ++
Sbjct: 13  PYLPPN--PYLPRPPQQPFPPPRRAPPPPTLPQPPPPRRAPPPPALAPPPPTMPPPPPRR 70

Query: 399 SSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           + PPP    PPP ++ PPP    PPP   PP
Sbjct: 71  APPPPTQPPPPPRRAPPPPTQPPPPPRRAPP 101

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 36/88 (40%), Positives = 43/88 (48%), Gaps = 4/88 (4%)
 Frame = +3

Query: 240 SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVS 419
           +P PP       P  P    PP Q  PP  ++ PPP    PPP + APPP   + PPP  
Sbjct: 4   NPTPPGLGFPYLPPNPYLPRPPQQPFPPPRRAPPPPTLPQPPPPRRAPPPPALAPPPPTM 63

Query: 420 STPPPVQSSPPPAPVTPPP----ASPPP 491
             PPP ++ PPP    PPP    A PPP
Sbjct: 64  PPPPPRRAPPPP--TQPPPPPRRAPPPP 89

[58][TOP]
>UniRef100_B9S5R2 Actin binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9S5R2_RICCO
          Length = 210

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 51/122 (41%), Positives = 69/122 (56%), Gaps = 6/122 (4%)
 Frame = +3

Query: 144 KMGTHIVLVVGLIC---AVFVSAGAQQPPSTSPNA---SPAPPTPPTNTPPTTPQASPPP 305
           ++ T I +++GL+C   A  V + +Q  P+++       P PP PP+  PP+ P  SPPP
Sbjct: 4   RLSTLIFVILGLVCNFLAFLVESQSQNVPASAAFLIVQPPPPPPPPSPPPPSPPPPSPPP 63

Query: 306 VQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
               PP + S PPP   SPP    +PPP   S PPP SS+ PP    PPP P +PPP+ P
Sbjct: 64  PPPPPPPSPSPPPPT--SPPSSLLSPPP--PSPPPPASSSSPP--PPPPPPPSSPPPSPP 117

Query: 486 PP 491
           PP
Sbjct: 118 PP 119

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 37/89 (41%), Positives = 46/89 (51%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P+P  PP  +PP++   SPPP    PP + SSPPP    PPP  S+PPP  
Sbjct: 61  PPPPPPPPPPSPSPPPPTSPPSS-LLSPPPPSPPPPASSSSPPP---PPPPPPSSPPP-- 114

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPAS 482
             SPPP  +      +SPP  P    P+S
Sbjct: 115 --SPPPPPTPSYTSNTSPPLRPSLRGPSS 141

[59][TOP]
>UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2B5_EHV86
          Length = 2332

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 46/93 (49%), Positives = 50/93 (53%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-PPVQSAPPPV 392
            PP + P  +P PP PP   PP  P  SPPP  S PP+   SPPP    P PP  + PPP 
Sbjct: 737  PPPSPPPPTPPPPAPPPPAPPPAPPPSPPP--SPPPSPPPSPPPSPPPPTPPPPAPPPPT 794

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               SPPP  S PPP    P P P  PPP SPPP
Sbjct: 795  PPPSPPP--SPPPPTPPPPAPPPPNPPPPSPPP 825

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 49/97 (50%), Positives = 53/97 (54%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP  SP  SP PP+PP  +PP +P  SPPP    PP+   SPPP   SP P    PPP  
Sbjct: 1728 PPPPSP-PSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSP----PPPSA 1782

Query: 396  QSSPPPVS---STPPPVQSSPPPAPVTPPPASPPPAS 497
              SPPP S   S PPP  S  PP P T P   PPPAS
Sbjct: 1783 SPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPAS 1819

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 42/94 (44%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPPPVQSAPPP 389
            PP T P  +P PPTPP + PP+ P  +PPP    PP     S PPP+   PPP    P P
Sbjct: 781  PPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLP 840

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                 PPP+   P P  S PP  P +PPP+ PPP
Sbjct: 841  PPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPP 874

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 45/94 (47%), Positives = 54/94 (57%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP + P++SP+PP P    PP+ P   PPPV   PPT   SPPP+   P P  S PP   
Sbjct: 2093 PPPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPP-PPTPPPSPPPLPPPPTPPPSPPPLPP 2151

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              +PPP S   PP+ S PPP+P TPPP  PP  S
Sbjct: 2152 PPTPPPQS---PPLPSPPPPSPPTPPPLPPPSPS 2182

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/106 (50%), Positives = 61/106 (57%), Gaps = 12/106 (11%)
 Frame = +3

Query: 216  PPSTSPN-----ASPAPPTP---PTNTPPTTPQASPPPVQSA---PPTAQSSPPPVQASP 362
            PPSTSP+     ASP+PP P   P+  PP+   + PPP  S    PP A  SPPP  ASP
Sbjct: 1770 PPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASP 1829

Query: 363  PPVQSAPPPVQQSSPPPVSSTP-PPVQSSPPPAPVTPPPASPPPAS 497
             P    PPP    SPPP SS+P PP  S  P  P +PPP+SPPP S
Sbjct: 1830 SP----PPPSSSPSPPPPSSSPSPPPPSLSPSPPPSPPPSSPPPPS 1871

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 43/94 (45%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP + P  +P PP PP  TPP +P  SPPP    PP      PP  + PPP+   PPP  
Sbjct: 776  PPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPP-- 833

Query: 396  QSSPPPVSSTP-PPVQSSPPPAPVTPPPASPPPA 494
             S PPP+   P PP    PPP+P   PP SPPP+
Sbjct: 834  -SPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPS 866

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 40/92 (43%), Positives = 46/92 (50%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP + P  +P PP PP   PP +P  SPPP    PP      PP  + PPP+   PPP  
Sbjct: 867  PPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSP 926

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                PP    PPPV   P P P+ PPP  PPP
Sbjct: 927  PPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPP 958

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 45/98 (45%), Positives = 50/98 (51%), Gaps = 6/98 (6%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP  SP  SP PP+PP + PP+ P  +PPP    PP    SPPP    P P   APPP  
Sbjct: 1119 PPPPSPPPSP-PPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPN 1177

Query: 396  QSSP------PPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               P      PP  S PPP+   P P P  PPP SPPP
Sbjct: 1178 PPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPP 1215

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 44/98 (44%), Positives = 52/98 (53%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPP-TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            PP+  P+  P+PP +PP + PP+ P  +PPP    PPT   SPPP    P P   APPP 
Sbjct: 757  PPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPP 816

Query: 393  QQ---SSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                 S PPP+   PPP    P P P  PPP  PPP S
Sbjct: 817  NPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPS 854

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 49/97 (50%), Positives = 56/97 (57%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP---PPVQSAPP 386
            PPS  P+ SP PP PPT  PP+ P  SPP     PP   S PPP   SP   PP QS PP
Sbjct: 1655 PPSPPPSPSPLPP-PPTPPPPSPPLPSPPLPAPPPP---SPPPPNAPSPSSMPPSQSPPP 1710

Query: 387  PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            P+     PP  + PPP+   PPP+P +PPP SPPP S
Sbjct: 1711 PLPPPPLPPPPNPPPPL--PPPPSPPSPPPPSPPPPS 1745

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 47/100 (47%), Positives = 53/100 (53%), Gaps = 8/100 (8%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP-PVQSAPPPV 392
            PP T P  +P PP PP   PP +P  SPPP  S PP+   SPPP    PP P    PPP 
Sbjct: 742  PPPTPPPPAPPPPAPPP-APPPSPPPSPPP--SPPPSPPPSPPPPTPPPPAPPPPTPPPS 798

Query: 393  QQSSPPPVSSTP-------PPVQSSPPPAPVTPPPASPPP 491
               SPPP +  P       PP  S PPP P+ PPP+ PPP
Sbjct: 799  PPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPP 838

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 45/97 (46%), Positives = 50/97 (51%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP  SP  SP PP+PP + PP+ P  +PPP    PP    SPPP    P P   APPP  
Sbjct: 850  PPPPSPPPSP-PPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPN 908

Query: 396  Q---SSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                S PPP+   PPP    P P P  PPP  PPP S
Sbjct: 909  PPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPS 945

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 45/97 (46%), Positives = 50/97 (51%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP  SP  SP PP+PP + PP+ P  +PPP    PP    SPPP    P P   APPP  
Sbjct: 1028 PPPPSPPPSP-PPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPN 1086

Query: 396  Q---SSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                S PPP+   PPP    P P P  PPP  PPP S
Sbjct: 1087 PPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPS 1123

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 41/94 (43%), Positives = 49/94 (52%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPPPVQSAPPP 389
            PP T P  +P PP PP + PP+ P  +PPP    PP     S PPP+   PPP    P P
Sbjct: 1050 PPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLP 1109

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                 PPP+   P P  S PP  P +PPP+ PPP
Sbjct: 1110 PPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPP 1143

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 49/102 (48%), Positives = 58/102 (56%), Gaps = 9/102 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAP--PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP--VQASPPPVQ--- 374
           PPS SP+  P    P+PP + PP +   SPPP    PP+A  SPPP  +  SPPP     
Sbjct: 282 PPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPP--RPPPSASPSPPPPSLSPSPPPPSLSP 339

Query: 375 SAPPPVQQSSPPP--VSSTPPPVQSSPPPAPVTPPPASPPPA 494
           S PPP    SPPP   S +PPP   SP P P TPPP+ PPP+
Sbjct: 340 SPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPS 381

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 47/111 (42%), Positives = 56/111 (50%), Gaps = 2/111 (1%)
 Frame = +3

Query: 168 VVGLICAVFVSAGAQQPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPP 344
           +VG  CA   S      PS  P + P P P+PP + PP +P  SPPP    PP      P
Sbjct: 661 LVGDSCARVGSVDCAPSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLP 720

Query: 345 PVQASPPPVQSAPPPVQQSSPPPVSSTPP-PVQSSPPPAPVTPPPASPPPA 494
           P    PP    +PPP    SPPP +  PP P   +PPPAP   PP SPPP+
Sbjct: 721 PPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPS 771

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 48/108 (44%), Positives = 53/108 (49%), Gaps = 16/108 (14%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTT---------------PQASPPPVQSAPPTAQSSPPPV 350
            PPS SP  SP PP+PP + PP +               P  SPPP  S PP+   SPPP 
Sbjct: 687  PPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPP--SPPPSPPPSPPPP 744

Query: 351  QASPP-PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PP P   APPP    SPPP     PP    P P P TPPP +PPP
Sbjct: 745  TPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPP 792

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 46/99 (46%), Positives = 52/99 (52%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP  +PP +P  SPPP  S PP+     PP  A PPP   APPP  
Sbjct: 836  PPPLPPPPLPPPPLPPPPSPPPSPPPSPPP--SPPPSPPPPTPPPPAPPPP---APPPSP 890

Query: 396  QSSPPPVSSTP-------PPVQSSPPPAPVTPPPASPPP 491
              SPPP +  P       PP  S PPP P+ PPP+ PPP
Sbjct: 891  PPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPP 929

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 46/99 (46%), Positives = 52/99 (52%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP  +PP +P  SPPP  S PP+     PP  A PPP   APPP  
Sbjct: 1014 PPPLPPPPLPPPPLPPPPSPPPSPPPSPPP--SPPPSPPPPTPPPPAPPPP---APPPSP 1068

Query: 396  QSSPPPVSSTP-------PPVQSSPPPAPVTPPPASPPP 491
              SPPP +  P       PP  S PPP P+ PPP+ PPP
Sbjct: 1069 PPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPP 1107

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 43/97 (44%), Positives = 51/97 (52%), Gaps = 4/97 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPPPVQSAPPP 389
            PP T P  +P PP PP + PP+ P  +PPP    PP     S PPP+   PPP    P P
Sbjct: 872  PPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLP 931

Query: 390  VQQSSPPPVSS--TPPPVQSSPPPAPVTPPPASPPPA 494
                 PPPV    +PPP+   P P P  PPP SPPP+
Sbjct: 932  PPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPS 968

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 41/95 (43%), Positives = 49/95 (51%), Gaps = 2/95 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT--AQSSPPPVQASPPPVQSAPPP 389
            PP T P  +P PP PP + PP+ P  +PPP    PP     S PPP+   P P    PPP
Sbjct: 1141 PPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPP 1200

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
                 P P   +PPP+   P P P  PPP SPPP+
Sbjct: 1201 PLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPS 1235

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 45/98 (45%), Positives = 52/98 (53%), Gaps = 5/98 (5%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP-----PVQASPPPVQSA 380
            PP + P   P PP PP+  PP +P  SPPP  S PP+   SPP     P   SPPP    
Sbjct: 1562 PPPSPPPPLPPPPVPPSPLPPPSPPPSPPP--SPPPSPPPSPPPPLPLPPPPSPPPPLPP 1619

Query: 381  PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            PP     SPPP+   P P   SPPP+P   PP SPPP+
Sbjct: 1620 PPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPS 1657

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 44/97 (45%), Positives = 56/97 (57%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P  +P PP PP  +PP+ P  SPPP  S PP+   SPPP    PP +  +PPP  
Sbjct: 1714 PPPLPPPPNPPPPLPPPPSPPSPPPPSPPP-PSPPPSPPPSPPPPSPPPPSLSPSPPPPS 1772

Query: 396  QS-SPPP--VSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             S SPPP   S +PPP  +SP P P +  P+ PPP++
Sbjct: 1773 TSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPST 1809

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 48/104 (46%), Positives = 59/104 (56%), Gaps = 11/104 (10%)
 Frame = +3

Query: 219  PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSA----PPTAQSSPPPVQASP-PPVQSA- 380
            P + P  SP PP+PP + PP+ P  SPPP   +    PP+   SPPP  ASP PP  SA 
Sbjct: 1733 PPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSAS 1792

Query: 381  ---PPPVQQSSPPP--VSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PPP    SPPP   S +PPP  +SP P P +  P+ PPP+S
Sbjct: 1793 PSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSS 1836

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 42/94 (44%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP + P  +P PP PP   PP +P  SPPP    PP      PP  + PPP+   PPP  
Sbjct: 1045 PPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPP-- 1102

Query: 396  QSSPPPVSSTP-PPVQSSPPPAPVTPPPASPPPA 494
             S PPP+   P PP    PPP+P   PP SPPP+
Sbjct: 1103 -SPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPS 1135

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 40/92 (43%), Positives = 47/92 (51%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP + P  +P PP PP   PP +P  SPPP    PP      PP  + PPP+   P P  
Sbjct: 1136 PPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPP 1195

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP+   PPPV   P P P+ PPP  PPP
Sbjct: 1196 PLPPPPL--PPPPVPPPPSPPPLPPPPLPPPP 1225

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 46/94 (48%), Positives = 52/94 (55%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQAS--PPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PPS SP  SP PP+PP + PP +P     PPPV  +P    S PP    SPPP   +PPP
Sbjct: 1543 PPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPP---SPPP 1599

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               S PPP+   PPP    P P P  PPP SPPP
Sbjct: 1600 ---SPPPPLPLPPPPSPPPPLPPPPVPPPPSPPP 1630

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 41/94 (43%), Positives = 48/94 (51%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS  P+  P+PP  P  +PP +P   PPP    PP+     PP+ A PPP    P    
Sbjct: 1639 PPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPS 1698

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SS PP  S PPP+   P P P  PPP  PPP S
Sbjct: 1699 PSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPS 1732

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 46/105 (43%), Positives = 58/105 (55%), Gaps = 11/105 (10%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAP----PTAQSSPPPVQASPPP----V 371
            PP  SP  SP P  PP + PP +   SPPP  ++P    P+A  SPPP  ASP P    +
Sbjct: 1741 PPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSL 1800

Query: 372  QSAPPPVQQSS---PPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              +PPP   S    PPP S +PPP  +SP P P +  P+ PPP+S
Sbjct: 1801 SPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSS 1845

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 45/93 (48%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS-APPPV 392
           PP + P   P PP PP   PP +P  SPPP  S PP+     PP  A PPP    APPP 
Sbjct: 706 PPPSPPPPLPPPPLPPPPLPPPSPPPSPPP--SPPPSPPPPTPPPPAPPPPAPPPAPPPS 763

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              SPPP   +PPP     PP P  PPPA PPP
Sbjct: 764 PPPSPPP---SPPPSPPPSPPPPTPPPPAPPPP 793

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/94 (48%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQ--SAPPTAQSSPPPVQASPPPVQSAPPP 389
           PPS  P+  P+PP PPT  PP  P  +PPP    S PP+   SPPP   SPPP    P P
Sbjct: 730 PPSPPPSPPPSPP-PPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPP---SPPPSPPPPTP 785

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              + PPP   TPPP     PP P  PPPA PPP
Sbjct: 786 PPPAPPPP---TPPPSPPPSPPPPTPPPPAPPPP 816

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 51/109 (46%), Positives = 59/109 (54%), Gaps = 1/109 (0%)
 Frame = +3

Query: 168  VVGLICAVFVSAGAQQPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPP 344
            +VG  CA   S      PS  P + P P P+PP + PP +P  SPPP    PP     PP
Sbjct: 1517 LVGDSCARVGSVDCVPSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPL---PPP 1573

Query: 345  PVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PV  SP P  S PPP    SPPP   +PPP  S PPP P+ PPP+ PPP
Sbjct: 1574 PVPPSPLPPPS-PPPSPPPSPPP---SPPP--SPPPPLPLPPPPSPPPP 1616

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 42/95 (44%), Positives = 46/95 (48%), Gaps = 2/95 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP--PPVQASPPPVQSAPPP 389
            PP T P + P  P PPT  PP  P  +PPP    PP     P  PP    PPP+   P P
Sbjct: 791  PPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLP 850

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
               S PP    +PPP     PP P  PPPA PPPA
Sbjct: 851  PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPA 885

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 45/94 (47%), Positives = 50/94 (53%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP  +PP +P  SPPP  S PP+     PP  A PPP   APPP  
Sbjct: 1105 PPPLPPPPLPPPPLPPPPSPPPSPPPSPPP--SPPPSPPPPTPPPPAPPPP---APPPSP 1159

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              SPPP  + PPP    P P P +PPP  PPP S
Sbjct: 1160 PPSPPP-PTPPPPAPPPPNPPPPSPPPPLPPPPS 1192

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 46/94 (48%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA-SPPPVQSAPPPV 392
            PP  SP  SP PP+PP   PP     SP P  S PP+   SPPP    SPPP    PPP 
Sbjct: 1552 PPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPP- 1610

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              S PPP+   PPPV   P P P+ PPP  PPP+
Sbjct: 1611 -PSPPPPLP--PPPVPPPPSPPPLPPPPLPPPPS 1641

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 50/103 (48%), Positives = 56/103 (54%), Gaps = 6/103 (5%)
 Frame = +3

Query: 201  AGAQQPPSTSPNASPAPPT--PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-PPV 371
            + +  PP  SP   P+PP   PP   PP TP  SPPP+   PPT   SPPP+   P PP 
Sbjct: 2099 SSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPP-PPTPPPSPPPLPPPPTPPP 2157

Query: 372  QSAPPPVQQSSPPPVSSTPPPV---QSSPPPAPVTPPPASPPP 491
            QS P P   S PPP   TPPP+     SP P P  PPP SPPP
Sbjct: 2158 QSPPLP---SPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPPP 2197

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 46/93 (49%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-PPVQSAPPPV 392
            PP + P   P PP PP   PP  P  SPPP  S PP+   SPPP    P PP  + PPP 
Sbjct: 831  PPPSPPPPLPPPPLPP---PPLPPPPSPPP--SPPPSPPPSPPPSPPPPTPPPPAPPPPA 885

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               SPPP  S PPP    P P P  PPP SPPP
Sbjct: 886  PPPSPPP--SPPPPTPPPPAPPPPNPPPPSPPP 916

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/94 (44%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPT--PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PPS  P+  P+PP   PP+  PPT P  +PPP    PP   S PPP+   PPP    P P
Sbjct: 962  PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPP---SPPPPLPLPPPPSPPPPLP 1018

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                 PPP+   P P  S PP  P +PPP+ PPP
Sbjct: 1019 PPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPP 1052

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 45/94 (47%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-PPVQSAPPPV 392
            PPS  P+  P  P PP   PP  P  SPPP    PP   S PPP+   P PP    PPP 
Sbjct: 974  PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPP-PPSPPPPLPPPPLPPPPLPPPPS 1032

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
               SPPP   +PPP     PP P  PPPA PPPA
Sbjct: 1033 PPPSPPP---SPPPSPPPSPPPPTPPPPAPPPPA 1063

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 46/93 (49%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-PPVQSAPPPV 392
            PP + P   P PP PP   PP  P  SPPP  S PP+   SPPP    P PP  + PPP 
Sbjct: 1009 PPPSPPPPLPPPPLPP---PPLPPPPSPPP--SPPPSPPPSPPPSPPPPTPPPPAPPPPA 1063

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               SPPP  S PPP    P P P  PPP SPPP
Sbjct: 1064 PPPSPPP--SPPPPTPPPPAPPPPNPPPPSPPP 1094

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 45/94 (47%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-PPVQSAPPPV 392
            PPS  P+  P  P PP   PP  P  SPPP    PP   S PPP+   P PP    PPP 
Sbjct: 1065 PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPP-PPSPPPPLPPPPLPPPPLPPPPS 1123

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
               SPPP   +PPP     PP P  PPPA PPPA
Sbjct: 1124 PPPSPPP---SPPPSPPPSPPPPTPPPPAPPPPA 1154

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 46/93 (49%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-PPVQSAPPPV 392
            PP + P   P PP PP   PP  P  SPPP  S PP+   SPPP    P PP  + PPP 
Sbjct: 1100 PPPSPPPPLPPPPLPP---PPLPPPPSPPP--SPPPSPPPSPPPSPPPPTPPPPAPPPPA 1154

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               SPPP  S PPP    P P P  PPP SPPP
Sbjct: 1155 PPPSPPP--SPPPPTPPPPAPPPPNPPPPSPPP 1185

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/93 (45%), Positives = 49/93 (52%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS  P+  P+PP PPT  PP  P  +PPP     P   + PPP    P P   +PPP  
Sbjct: 769  PPSPPPSPPPSPP-PPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPL 827

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
               PPP  S PPP+   P P P  PPP SPPP+
Sbjct: 828  PLPPPP--SPPPPLPPPPLPPPPLPPPPSPPPS 858

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/92 (45%), Positives = 48/92 (52%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS  P+  P+PP PPT  PP  P  +PPP     P   + PPP    P P   +PPP  
Sbjct: 860  PPSPPPSPPPSPP-PPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPL 918

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP  S PPP+   P P P  PPP SPPP
Sbjct: 919  PLPPPP--SPPPPLPPPPLPPPPVPPPPSPPP 948

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 41/93 (44%), Positives = 47/93 (50%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP  +PP +P  SPPP     P   + PPP    P P   +PPP  
Sbjct: 946  PPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPL 1005

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
               PPP  S PPP+   P P P  PPP SPPP+
Sbjct: 1006 PLPPPP--SPPPPLPPPPLPPPPLPPPPSPPPS 1036

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/93 (45%), Positives = 49/93 (52%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS  P+  P+PP PPT  PP  P  +PPP     P   + PPP    P P   +PPP  
Sbjct: 1038 PPSPPPSPPPSPP-PPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPL 1096

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
               PPP  S PPP+   P P P  PPP SPPP+
Sbjct: 1097 PLPPPP--SPPPPLPPPPLPPPPLPPPPSPPPS 1127

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 42/92 (45%), Positives = 51/92 (55%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P  SP PP+PP + PP+ P  +PPP    PP    +PPP  + PP    +PPP  
Sbjct: 720 PPPPLPPPSP-PPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPP--SPPPSPPPSPPPSP 776

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             SPPP   TPPP    PP  P +PPP+ PPP
Sbjct: 777 PPSPPP--PTPPPPAPPPPTPPPSPPPSPPPP 806

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 41/92 (44%), Positives = 46/92 (50%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP+PP   PP  P    PP  S PP+   SPPP     PP  + PPP  
Sbjct: 932  PPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAP 991

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                PP  S PPP+   PPP+P  PPP  PPP
Sbjct: 992  PPPNPPPPSPPPPLPLPPPPSP--PPPLPPPP 1021

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 49/103 (47%), Positives = 56/103 (54%), Gaps = 6/103 (5%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
            A  P S  P+ SP PP PP   PP  P  +PPP    PP+  S PPP   SPPP   +PP
Sbjct: 1696 APSPSSMPPSQSPPPPLPP---PPLPPPPNPPPPLPPPPSPPSPPPP---SPPP--PSPP 1747

Query: 387  PVQQSSPPPVSSTPPPVQSSPPP---APVTPPPA---SPPPAS 497
            P    SPPP S  PP +  SPPP   +P  PPP+   SPPP S
Sbjct: 1748 PSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPS 1790

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 42/94 (44%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP     SPPP    PP+   SPPP   SPPP    PP + 
Sbjct: 1709 PPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPP---SPPPPSPPPPSLS 1765

Query: 396  QSSPPP-VSSTPPPVQSSPPPAPVTPPPASPPPA 494
             S PPP  S +PPP  +SP P P +  P+ PPP+
Sbjct: 1766 PSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPS 1799

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 45/98 (45%), Positives = 50/98 (51%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           S     PP   P+ASP+PP P  +  P  P  SP P    PP+   SPPP   SP P   
Sbjct: 306 STSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSP---PPPSLSPSPPPPSFSPSP--- 359

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PPP    SPPP  +TPPP    P P P  PPP SPPP
Sbjct: 360 -PPPSLSPSPPP--ATPPPSPPPPSPPPPLPPPPSPPP 394

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/93 (46%), Positives = 53/93 (56%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS  P  SP PP+PP + PP+ P + PPP+   PP   S PPP+   P P   +PPP+ 
Sbjct: 1576 PPSPLPPPSP-PPSPPPSPPPSPPPSPPPPLPLPPP--PSPPPPLPPPPVPPPPSPPPL- 1631

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
               PPP    PP    SPPP+P   PP SPPP+
Sbjct: 1632 ---PPPPLPPPPSPPPSPPPSPPPSPPPSPPPS 1661

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 39/92 (42%), Positives = 46/92 (50%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P  SP PP+PP + PP+ P + PPP    P     +PPP     PP  + PPP  
Sbjct: 1115 PPPLPPPPSP-PPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAP 1173

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                PP  S PPP+   P P P  PPP  PPP
Sbjct: 1174 PPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPP 1205

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 41/91 (45%), Positives = 47/91 (51%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP T P + P  P PPT  P + P  SPPP   +PPT    PPP  +  PP    PPP  
Sbjct: 2138 PPPTPPPSPPPLPPPPTPPPQSPPLPSPPP--PSPPTPPPLPPPSPSPLPPPPIPPPPSP 2195

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
               PPP S  PP     PPP P+ PPP+ PP
Sbjct: 2196 PPHPPPQSPLPPSPPPPPPPPPLPPPPSPPP 2226

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 44/94 (46%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP + PP+ P  SPPP    PPT     PP  A PP    +PPP  
Sbjct: 711 PPPLPPPPLPPPPLPPPSPPPSPP-PSPPP-SPPPPTPPPPAPPPPAPPPAPPPSPPPSP 768

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTP-PPASPPPA 494
             SPPP     PP  + PPPAP  P PP SPPP+
Sbjct: 769 PPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPS 802

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 46/97 (47%), Positives = 50/97 (51%), Gaps = 4/97 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP  SP   P PP PP   PP  P  SPPP  S PP+   SPPP    P P   APPP  
Sbjct: 941  PPPPSPPPLPPPPLPP---PPLPPPPSPPP--SPPPSPPPSPPPSPPPPTPPPPAPPPPN 995

Query: 396  ---QSSPPPVSSTPPPVQSSP-PPAPVTPPPASPPPA 494
                S PPP+   PPP    P PP P+ PPP  PPP+
Sbjct: 996  PPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPS 1032

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/94 (45%), Positives = 47/94 (50%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS  P+  P  P PP   PP  P  SPPP    PP+     PP    PPPV   PPP  
Sbjct: 1156 PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVP--PPPSP 1213

Query: 396  QSSPPPVSSTPP-PVQSSPPPAPVTPPPASPPPA 494
               PPP    PP P   SPPP+P   PP SPPP+
Sbjct: 1214 PPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPS 1247

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 42/93 (45%), Positives = 46/93 (49%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-PPVQSAPPPV 392
            PP   P  SP PP PP  +PP  P   PPP+   P     SPPP+   P PP    PPP 
Sbjct: 1174 PPPNPPPPSPPPPLPPPPSPP--PPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPS 1231

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               SPPP     PP    P P P TPPP +PPP
Sbjct: 1232 PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPP 1264

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 45/96 (46%), Positives = 53/96 (55%), Gaps = 5/96 (5%)
 Frame = +3

Query: 216  PPSTSPNA-----SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
            PPS SP+      SP+PP P T+  P  P ASP P    PP+A  SPPP  +SP P    
Sbjct: 1788 PPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSP---PPPSASPSPPPPSSSPSP---- 1840

Query: 381  PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
            PPP    SPPP S +P P  S PP +P  P P +PP
Sbjct: 1841 PPPSSSPSPPPPSLSPSPPPSPPPSSPPPPSPPTPP 1876

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/99 (43%), Positives = 50/99 (50%), Gaps = 7/99 (7%)
 Frame = +3

Query: 219  PSTSPNASPAPPTPPTNTPPTTPQASP----PPVQSAPPTAQSSPPPV---QASPPPVQS 377
            P  SP   P PPTPP + PP  P  +P    PP+ S PP +  +PPP+     SP P   
Sbjct: 2129 PPPSPPPLPPPPTPPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPP 2188

Query: 378  APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
             PPP      PP  S  PP    PPP P  PPP SPPP+
Sbjct: 2189 IPPPPSPPPHPPPQSPLPPSPPPPPPPPPLPPPPSPPPS 2227

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 42/96 (43%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTT----PQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
            PP T P  +P PP PP  +PP      P  SPPP    PP      PP  + PP    +P
Sbjct: 804  PPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSP 863

Query: 384  PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PP    SPPP   TPPP    PP  P +PPP+ PPP
Sbjct: 864  PPSPPPSPPP--PTPPPPAPPPPAPPPSPPPSPPPP 897

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 42/96 (43%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTT----PQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
            PP T P  +P PP PP  +PP      P  SPPP    PP      PP  + PP    +P
Sbjct: 982  PPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSP 1041

Query: 384  PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PP    SPPP   TPPP    PP  P +PPP+ PPP
Sbjct: 1042 PPSPPPSPPP--PTPPPPAPPPPAPPPSPPPSPPPP 1075

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 42/96 (43%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTT----PQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
            PP T P  +P PP PP  +PP      P  SPPP    PP      PP  + PP    +P
Sbjct: 1073 PPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSP 1132

Query: 384  PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PP    SPPP   TPPP    PP  P +PPP+ PPP
Sbjct: 1133 PPSPPPSPPP--PTPPPPAPPPPAPPPSPPPSPPPP 1166

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 45/93 (48%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            PPS  P   P P P PP   PP+ P   PPP+   P     SPPP   SPPP   +PPP 
Sbjct: 1190 PPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPP---SPPP---SPPPS 1243

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               SPPP  S PPP    P P P TPPP+ PPP
Sbjct: 1244 PPPSPPP--SPPPPTPPPPAPPPPTPPPSPPPP 1274

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 41/92 (44%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +3

Query: 216  PPSTSPNASPA-PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            PPS  P+  P+ PP+PP   P   P + PPP+   P     SPPP+   P P   +PPP 
Sbjct: 1586 PPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPS 1645

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
               SPPP     PP   SP P P TPPP SPP
Sbjct: 1646 PPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPP 1677

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 44/98 (44%), Positives = 51/98 (52%), Gaps = 6/98 (6%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTN----TPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
            PP   P   P PPTPP +     PP TP  SPPP+   PPT     PP+ + PPP    P
Sbjct: 2115 PPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPPL-PPPPTPPPQSPPLPSPPPPSPPTP 2173

Query: 384  PPVQQSSPPPVSSTPPPVQSSPP--PAPVTPPPASPPP 491
            PP+   SP P+   P P   SPP  P P +P P SPPP
Sbjct: 2174 PPLPPPSPSPLPPPPIPPPPSPPPHPPPQSPLPPSPPP 2211

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 43/99 (43%), Positives = 51/99 (51%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P  +P PP+PP   PP TP  SPPP+   PPT     PP+ + PPP    PPP+ 
Sbjct: 2120 PPPVPPPPTP-PPSPPPLPPPPTPPPSPPPLPP-PPTPPPQSPPLPSPPPPSPPTPPPLP 2177

Query: 396  QSSPPPVSSTPPPVQSSPPP-------APVTPPPASPPP 491
              SP P+   P P   SPPP        P +PPP  PPP
Sbjct: 2178 PPSPSPLPPPPIPPPPSPPPHPPPQSPLPPSPPPPPPPP 2216

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 41/94 (43%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP-PVQASPPPVQSAPPPV 392
            PPS  P+  P  P PP   PP  P  SPPP    PP     PP P    PPP    PP  
Sbjct: 887  PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSP 946

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
                PPP+   P P   SPPP+P   PP SPPP+
Sbjct: 947  PPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPS 980

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 41/92 (44%), Positives = 46/92 (50%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P P  PP + PP  P   PPP    PP+   SPPP    P P  S PPP  
Sbjct: 928  PPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPP-SPPPSPPPSPPPPTP 986

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                PP  + PPP  S PPP P+ PPP+ PPP
Sbjct: 987  PPPAPPPPNPPPP--SPPPPLPLPPPPSPPPP 1016

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/96 (44%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASP--PPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PP   P   P PP+PP + PP+ P + P  PP  + PP A   P P   SPPP    PPP
Sbjct: 951  PPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP 1010

Query: 390  VQQSSPPPVSSTP-PPVQSSPPPAPVTPPPASPPPA 494
               S PPP+   P PP    PPP+P   PP SPPP+
Sbjct: 1011 --PSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPS 1044

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/94 (45%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTT--PQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PP T P  +P PP PP  +PP    P  SPPP    PP     PPPV   P P    PPP
Sbjct: 1164 PPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLP---PPPVPPPPSPPPLPPPP 1220

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            +     PP  S PP    SPPP+P   PP SPPP
Sbjct: 1221 LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPPP 1254

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/92 (46%), Positives = 48/92 (52%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P P  PP + PP  P   PPP    PP+   SPPP   SPPP   +PPP  
Sbjct: 1195 PPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPP---SPPP---SPPPSP 1248

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              SPPP   TPPP    PP  P +PPP +PPP
Sbjct: 1249 PPSPPP--PTPPPPAPPPPTPPPSPPPPTPPP 1278

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 41/92 (44%), Positives = 47/92 (51%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP + P   P PP PP  +PP  P    PP  S PP+   SPPP   SPPP   +PPP  
Sbjct: 1609 PPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPP---SPPP---SPPPSP 1662

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP +  PP      PP P  PPP+ PPP
Sbjct: 1663 SPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPP 1694

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 42/98 (42%), Positives = 48/98 (48%), Gaps = 3/98 (3%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAP---PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
            A  PP+  P + P P   P PP+  PP  P   PPP    PP+   SPPP     PP   
Sbjct: 812  APPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 871

Query: 378  APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             PP     +PPP +  P P  S PPP P  PPPA PPP
Sbjct: 872  PPPTPPPPAPPPPAPPPSPPPSPPPPTP--PPPAPPPP 907

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 42/98 (42%), Positives = 48/98 (48%), Gaps = 3/98 (3%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAP---PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
            A  PP+  P + P P   P PP+  PP  P   PPP    PP+   SPPP     PP   
Sbjct: 990  APPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 1049

Query: 378  APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             PP     +PPP +  P P  S PPP P  PPPA PPP
Sbjct: 1050 PPPTPPPPAPPPPAPPPSPPPSPPPPTP--PPPAPPPP 1085

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 42/98 (42%), Positives = 48/98 (48%), Gaps = 3/98 (3%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAP---PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
            A  PP+  P + P P   P PP+  PP  P   PPP    PP+   SPPP     PP   
Sbjct: 1081 APPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 1140

Query: 378  APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             PP     +PPP +  P P  S PPP P  PPPA PPP
Sbjct: 1141 PPPTPPPPAPPPPAPPPSPPPSPPPPTP--PPPAPPPP 1176

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 48/104 (46%), Positives = 57/104 (54%), Gaps = 10/104 (9%)
 Frame = +3

Query: 216  PPSTSP---NASPAPPTPPTNTP--PTTPQASPPPVQ----SAPPTAQSSPPPVQASP-P 365
            PPS SP     +P PP+PP  +P  P  P  SPPP      S+ P +QS PPP+   P P
Sbjct: 1659 PPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLP 1718

Query: 366  PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            P  + PPP+    PPP S   PP  S PPP+P   PP SPPP S
Sbjct: 1719 PPPNPPPPL----PPPPSPPSPPPPSPPPPSPPPSPPPSPPPPS 1758

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 46/103 (44%), Positives = 53/103 (51%), Gaps = 11/103 (10%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP--- 386
            PP  SP   P PP PP  +PP +P  SPPP  S PP+   SP P+   P P   +PP   
Sbjct: 1623 PPPPSPPPLPPPPLPPPPSPPPSPPPSPPP--SPPPSPPPSPSPLPPPPTPPPPSPPLPS 1680

Query: 387  -----PVQQSSPPPVSSTP---PPVQSSPPPAPVTPPPASPPP 491
                 P   S PPP + +P   PP QS PPP P  PPP  PPP
Sbjct: 1681 PPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLP--PPPLPPPP 1721

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 43/98 (43%), Positives = 50/98 (51%), Gaps = 2/98 (2%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP-PVQASPPPVQSAP 383
            A  PP+  P+  P+PP PPT  PP  P  +PPP    PP     PP P    PPP    P
Sbjct: 880  APPPPAPPPSPPPSPP-PPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPP 938

Query: 384  PPVQQSSPPPVSSTP-PPVQSSPPPAPVTPPPASPPPA 494
            P     SPPP+   P PP    PPP+P   PP SPPP+
Sbjct: 939  PVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPS 976

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 44/101 (43%), Positives = 50/101 (49%), Gaps = 6/101 (5%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAP---PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP-PVQ 374
            A  PP+  P + P P   P PP+  PP  P   PPP    PP+    PPP    PP P  
Sbjct: 903  APPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPP 962

Query: 375  SAPPPVQQSSPPPVSSTPPPVQSSPPPA--PVTPPPASPPP 491
             +PPP    SPPP     PP  + PPPA  P  PPP SPPP
Sbjct: 963  PSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPP 1003

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 41/94 (43%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP-PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            PPS  P+  P+PP P P   PP+ P   PPP    PP+    PPP    PP    +PPP 
Sbjct: 1590 PPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPS 1649

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
               SPPP   +PPP  S  PP P  PPP+ P P+
Sbjct: 1650 PPPSPPP---SPPPSPSPLPPPPTPPPPSPPLPS 1680

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 48/106 (45%), Positives = 58/106 (54%), Gaps = 12/106 (11%)
 Frame = +3

Query: 216 PPSTSP-NASPAPPTP---PTNTPPTTPQASPPPVQSA---PPTAQSSPPP--VQASPPP 368
           PPS  P +ASP+PP P   P+  PP+   + PPP  S    PP+   SPPP  V  SPPP
Sbjct: 214 PPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPP 273

Query: 369 VQ---SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                S PPP    SPPP S +P P  S PPP+    PP  PPP++
Sbjct: 274 PSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSA 319

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 40/93 (43%), Positives = 46/93 (49%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPP-PVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            PP   P   P PP+PP + PP+ P + PP P    PP     PP    SPPP  S PPP 
Sbjct: 1110 PPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPP--SPPPPT 1167

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                 PP  + PPP    P P P +PPP  PPP
Sbjct: 1168 PPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPP 1200

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 45/99 (45%), Positives = 51/99 (51%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216 PPSTSPNA-----SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           PPS SP+      SP+PP P  +  P  P  SP P    PP+   SPPP   SP P  + 
Sbjct: 316 PPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSP---PPPSFSPSPPPPSLSPSPPPAT 372

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PPP    SPPP  S PPP+   P P P  PPP  PPP S
Sbjct: 373 PPP----SPPP-PSPPPPLPPPPSPPPPLPPPPIPPPPS 406

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 43/97 (44%), Positives = 49/97 (50%), Gaps = 5/97 (5%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTT----PQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
            PP T P  +P PP PP  +PP      P  SPPP    PP     PPPV   P P    P
Sbjct: 895  PPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLP---PPPVPPPPSPPPLPP 951

Query: 384  PPVQQSSPPPVSSTPPPVQSSPPPAP-VTPPPASPPP 491
            PP+     PP  S PP    SPPP+P  +PPP +PPP
Sbjct: 952  PPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPP 988

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/95 (42%), Positives = 47/95 (49%), Gaps = 1/95 (1%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
            A  PP+  P+  P+PP PPT  PP  P  +PPP    PP      PP    PPP+   P 
Sbjct: 1149 APPPPAPPPSPPPSPP-PPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPV 1207

Query: 387  PVQQSSPP-PVSSTPPPVQSSPPPAPVTPPPASPP 488
            P   S PP P    PPP    PP  P +PPP+ PP
Sbjct: 1208 PPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 1242

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 44/103 (42%), Positives = 52/103 (50%), Gaps = 10/103 (9%)
 Frame = +3

Query: 216 PPSTSPNA-----SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           PPS SP+      SP+PP P  +  P  P  SP P    PP+   SPPP   SP P  S 
Sbjct: 246 PPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSP---PPPSLSPSPPPPSLSPSPPPSP 302

Query: 381 PPPVQQSSPPP-----VSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PPP    SPPP      S +PPP   SP P P +  P+ PPP+
Sbjct: 303 PPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPS 345

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 44/99 (44%), Positives = 48/99 (48%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P  P PP   PP  P  SPPP+   P     SPPP   SPPP   +PPP  
Sbjct: 1601 PPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPP---SPPP---SPPPSP 1654

Query: 396  QSSPPPVSSTPPPVQSSPPPAP-------VTPPPASPPP 491
              SPPP  S  PP  + PPP+P         PPP SPPP
Sbjct: 1655 PPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPP 1693

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 45/95 (47%), Positives = 52/95 (54%), Gaps = 2/95 (2%)
 Frame = +3

Query: 216  PPSTSPNA-SPAPPTPPTNTPPTTPQ-ASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PP  SP   +P PP+PP   PP  P  +S PP QS PP     PPP+   P P    PPP
Sbjct: 1676 PPLPSPPLPAPPPPSPP---PPNAPSPSSMPPSQSPPPPL--PPPPLPPPPNPPPPLPPP 1730

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
                SPPP S  PP    SPPP+P  PPP+ PPP+
Sbjct: 1731 PSPPSPPPPSPPPPSPPPSPPPSP--PPPSPPPPS 1763

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 46/97 (47%), Positives = 53/97 (54%), Gaps = 5/97 (5%)
 Frame = +3

Query: 216  PPSTSPN-----ASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
            PPS SP+      SP+PP PP +  P  P ASP P    PP++  SPPP  +SP P    
Sbjct: 1797 PPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSP---PPPSSSPSPPPPSSSPSP---- 1849

Query: 381  PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PPP    SPPP     PP  S PPP+P T PPA P P
Sbjct: 1850 PPPSLSPSPPP----SPPPSSPPPPSPPT-PPAPPRP 1881

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 43/100 (43%), Positives = 52/100 (52%), Gaps = 7/100 (7%)
 Frame = +3

Query: 216 PPSTSPN-----ASPAPPTPPTNTPPTTPQASP-PPVQSAPPTAQSSPPPVQASPPPVQS 377
           PPS SP+      SP+PP P  +  P  P  SP PP  S  P+   SPPP   SP P   
Sbjct: 255 PPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPR 314

Query: 378 APPPVQQSSPPP-VSSTPPPVQSSPPPAPVTPPPASPPPA 494
            PP    S PPP +S +PPP   SP P P +  P+ PPP+
Sbjct: 315 PPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPS 354

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 45/90 (50%), Positives = 48/90 (53%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP  SP   P PP PP   PP  P  SPPP  S PP+   SPPP   SPPP  S PPP  
Sbjct: 1208 PPPPSPPPLPPPPLPP---PPLPPPPSPPP--SPPPSPPPSPPP---SPPP--SPPPP-- 1255

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
             + PPP    P P  S PPP P  PPP +P
Sbjct: 1256 -TPPPPAPPPPTPPPSPPPPTPPPPPPLAP 1284

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 44/97 (45%), Positives = 51/97 (52%), Gaps = 5/97 (5%)
 Frame = +3

Query: 216 PPSTSPNA-----SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           PPS SP+      SP+PP P  +  P  P  SP P    PP+   SPPP  A+PPP  S 
Sbjct: 325 PPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSP---PPPSLSPSPPP--ATPPP--SP 377

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PPP      PP  S PPP+   P P P +PPP  PPP
Sbjct: 378 PPPSPPPPLPPPPSPPPPLPPPPIPPPPSPPPPPPPP 414

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 42/94 (44%), Positives = 48/94 (51%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P P  PP   PP  P  SPPP  S PP+   SPPP   SPPP  S  PP  
Sbjct: 1615 PPLPPPPVPPPPSPPPLPPPPLPPPPSPPP--SPPPSPPPSPPP---SPPPSPSPLPPPP 1669

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PP      PP+ + PPP+P  PPP +P P+S
Sbjct: 1670 TPPPPSPPLPSPPLPAPPPPSP--PPPNAPSPSS 1701

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/103 (44%), Positives = 58/103 (56%), Gaps = 13/103 (12%)
 Frame = +3

Query: 228 SPNASPAPPTPPTNTPPTTPQASPPPVQSA---PPTAQSSPPP--VQASPPPVQ---SAP 383
           SP   P+ P+PP+  PP+   + PPP  S    PP+   SPPP  +  SPPP     S P
Sbjct: 204 SPPYPPSLPSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPP 263

Query: 384 PPVQQSSPPP--VSSTPPP--VQSSPPPAPVTP-PPASPPPAS 497
           PP    SPPP  +S +PPP  +  SPPP  ++P PP SPPP S
Sbjct: 264 PPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPS 306

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 42/92 (45%), Positives = 46/92 (50%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP+PP   PP  P    PP  S PP+   SPPP   SPPP   +PPP  
Sbjct: 1199 PPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP---SPPP---SPPPSP 1252

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                PP  + PPP     PP P TPPP  PPP
Sbjct: 1253 PPPTPPPPAPPPPTPPPSPPPP-TPPP--PPP 1281

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 39/92 (42%), Positives = 44/92 (47%), Gaps = 2/92 (2%)
 Frame = +3

Query: 219  PSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            P  SP   P PPTPP  +PP  + P  SPP     PP + S  PP    PPP     PP 
Sbjct: 2142 PPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPPPHPPP 2201

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
            Q   PP     PPP    PPP   +PPP+ PP
Sbjct: 2202 QSPLPPSPPPPPPPPPLPPPP---SPPPSQPP 2230

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 44/105 (41%), Positives = 51/105 (48%), Gaps = 13/105 (12%)
 Frame = +3

Query: 216  PPSTSPN-----ASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
            PPSTSP+     ASP+PP P  +  P  P +SP P    PP++  SPPP   SP P  S 
Sbjct: 1806 PPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSP---PPPSSSPSPPPPSLSPSPPPSP 1862

Query: 381  PPPVQQSSPPPVSSTPPPVQSSPPPAP--------VTPPPASPPP 491
            PP    S PPP   TPP      PP P         T P +S PP
Sbjct: 1863 PP---SSPPPPSPPTPP-----APPRPFLVSLDIIATQPSSSNPP 1899

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 40/89 (44%), Positives = 47/89 (52%)
 Frame = +3

Query: 228  SPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSP 407
            S +  P+P  PP + PP +P  SPPP          SPPP   SPPP  S PPP   S P
Sbjct: 1527 SVDCVPSPSPPPPSPPPPSP--SPPP----------SPPP--PSPPP--SPPPP---SPP 1567

Query: 408  PPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            PP+   P P    PPP+P   PP SPPP+
Sbjct: 1568 PPLPPPPVPPSPLPPPSPPPSPPPSPPPS 1596

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 37/87 (42%), Positives = 47/87 (54%), Gaps = 3/87 (3%)
 Frame = +3

Query: 243 PAPPTPPT-NTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPP-- 413
           P+PP PP+  +PP+ P          PP+A  SPPP   SP P    PPP    SPPP  
Sbjct: 203 PSPPYPPSLPSPPSLP----------PPSASPSPPPPSLSPSP----PPPSLSPSPPPPS 248

Query: 414 VSSTPPPVQSSPPPAPVTPPPASPPPA 494
           +S +PPP   SP P P +  P+ PPP+
Sbjct: 249 ISPSPPPPSLSPSPPPPSVSPSPPPPS 275

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 44/93 (47%), Positives = 53/93 (56%), Gaps = 3/93 (3%)
 Frame = +3

Query: 216 PPSTSPNASP---APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PPS SP+  P   +P  PP +  P+ P A+PPP  S PP   S PPP+   PPP  S PP
Sbjct: 343 PPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPP--SPPPP--SPPPPLP--PPP--SPPP 394

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
           P+    PPP+   PPP   SPPP P  PPP +P
Sbjct: 395 PL---PPPPI---PPP--PSPPPPP--PPPLAP 417

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 35/75 (46%), Positives = 38/75 (50%), Gaps = 7/75 (9%)
 Frame = +3

Query: 285  PQASPPPVQSAPPTAQSSPPPVQASP------PPVQSAPPPVQQSSPPPVSSTPPPVQSS 446
            P  SPPP  S P ++ S PPP    P      PP    PPP    SPPP+   P P  S 
Sbjct: 2089 PPPSPPP--SLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSP 2146

Query: 447  PP-PAPVTPPPASPP 488
            PP P P TPPP SPP
Sbjct: 2147 PPLPPPPTPPPQSPP 2161

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 33/87 (37%), Positives = 40/87 (45%), Gaps = 4/87 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTP--PTTPQASPPPVQSAPPTAQSSPPPVQASPP--PVQSAP 383
            PP + P  SP PP+PPT  P  P +P   PPP    PP+    PPP    PP  P    P
Sbjct: 2156 PPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPPPHPPPQSPLPPSPPPPPPP 2215

Query: 384  PPVQQSSPPPVSSTPPPVQSSPPPAPV 464
            PP+     PP S  P    +S    P+
Sbjct: 2216 PPLPPPPSPPPSQPPSLENASQSLVPI 2242

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 31/66 (46%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +3

Query: 294  SPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPP-PAPVTP 470
            S PP  S PP+  SS P      PP+  +PPP+    PPPV   P P  S PP P P TP
Sbjct: 2086 SVPPPPSPPPSLPSSSPSPPPPSPPLPPSPPPL---PPPPVPPPPTPPPSPPPLPPPPTP 2142

Query: 471  PPASPP 488
            PP+ PP
Sbjct: 2143 PPSPPP 2148

[60][TOP]
>UniRef100_A4F808 Putative uncharacterized protein n=1 Tax=Saccharopolyspora
           erythraea NRRL 2338 RepID=A4F808_SACEN
          Length = 504

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 46/95 (48%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP+ +P  +P+   P +N P +TP  S PP  S+ P  +SS PP   +PPP  S PPP  
Sbjct: 308 PPNGTPPPAPSSTPPSSNPPGSTPPGSSPPPGSSQPPPESSKPPESTTPPPGSSQPPP-- 365

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPP-ASPPPAS 497
           +SS PP S+TPPP  S+PPP   TPPP +S PP S
Sbjct: 366 ESSTPPESTTPPPDSSTPPPDSTTPPPESSTPPES 400

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 42/92 (45%), Positives = 60/92 (65%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P ST P+++P   TPP ++PP  P +S PP +S+ P   ++PPP  + PPP  S PP  +
Sbjct: 317 PSSTPPSSNPPGSTPPGSSPP--PGSSQPPPESSKPPESTTPPPGSSQPPPESSTPP--E 372

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            ++PPP SSTPPP  ++PPP   TPP ++ PP
Sbjct: 373 STTPPPDSSTPPPDSTTPPPESSTPPESTTPP 404

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 47/104 (45%), Positives = 64/104 (61%), Gaps = 10/104 (9%)
 Frame = +3

Query: 216 PPSTSPNASPAP----PTPPTNTPPTT----PQASPPPVQSAPPTAQSSPPPVQASPPPV 371
           P ST P +SP P    P P ++ PP +    P +S PP +S+ P   ++PPP  ++PPP 
Sbjct: 327 PGSTPPGSSPPPGSSQPPPESSKPPESTTPPPGSSQPPPESSTPPESTTPPPDSSTPPPD 386

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP--ASPPPAS 497
            + PPP  +SS PP S+TPPP  S+PPP   TPPP  ++PPP S
Sbjct: 387 STTPPP--ESSTPPESTTPPPDSSTPPPDSTTPPPDSSTPPPGS 428

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 45/103 (43%), Positives = 57/103 (55%), Gaps = 5/103 (4%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           G+ QPP  S +  P   TPP  +    P++S PP  + PP   S+PPP   +PPP  S P
Sbjct: 339 GSSQPPPES-SKPPESTTPPPGSSQPPPESSTPPESTTPPPDSSTPPPDSTTPPPESSTP 397

Query: 384 P-----PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           P     P   S+PPP S+TPPP  S+PPP   TPP    PP+S
Sbjct: 398 PESTTPPPDSSTPPPDSTTPPPDSSTPPPGSSTPPEEPGPPSS 440

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 41/98 (41%), Positives = 54/98 (55%), Gaps = 4/98 (4%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTT----PQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           ++ P ST+P    + P P ++TPP +    P +S PP  S  P  +SS PP   +PPP  
Sbjct: 348 SKPPESTTPPPGSSQPPPESSTPPESTTPPPDSSTPPPDSTTPPPESSTPPESTTPPPDS 407

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           S PPP   ++PPP SSTPPP  S+PP  P  P     P
Sbjct: 408 STPPP-DSTTPPPDSSTPPPGSSTPPEEPGPPSSCQVP 444

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 48/107 (44%), Positives = 57/107 (53%), Gaps = 8/107 (7%)
 Frame = +3

Query: 195 VSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP--- 365
           V A  Q PP   P  +PAP   P  +P  TP A PP     PP A SS PP  ++PP   
Sbjct: 279 VLAMPQTPP---PAGAPAPAPAPGPSP--TPTAHPP--NGTPPPAPSSTPP-SSNPPGST 330

Query: 366 PVQSAPPPVQ-----QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           P  S+PPP       +SS PP S+TPPP  S PPP   TPP ++ PP
Sbjct: 331 PPGSSPPPGSSQPPPESSKPPESTTPPPGSSQPPPESSTPPESTTPP 377

[61][TOP]
>UniRef100_A4S6G3 Predicted protein (Fragment) n=1 Tax=Ostreococcus lucimarinus CCE9901
            RepID=A4S6G3_OSTLU
          Length = 2146

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 57/124 (45%), Positives = 64/124 (51%), Gaps = 1/124 (0%)
 Frame = +3

Query: 123  QINQPTHKMGTHIVLVVGLICAVFVSAGAQQPPSTSPNASPAPPTP-PTNTPPTTPQASP 299
            QI  PT    + + LV GL C          PP + P  SP PP+P P+  PP+ P  SP
Sbjct: 857  QITAPT-LCDSGLELVSGLSCF-------PSPPPSPPPPSPPPPSPLPSPPPPSPPSPSP 908

Query: 300  PPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA 479
            PP    PP + S PPP   SP P    PPP   S PPP  S PPP   SPPP P  PPP 
Sbjct: 909  PPPSPLPP-SPSPPPPSPPSPSPPSPPPPPPVPSPPPP--SPPPP---SPPPLPPPPPPP 962

Query: 480  SPPP 491
            SPPP
Sbjct: 963  SPPP 966

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 42/120 (35%), Positives = 54/120 (45%), Gaps = 1/120 (0%)
 Frame = +3

Query: 135  PTHKMGTHIVLVVGLICA-VFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQ 311
            P  + G ++    G++ A V + +    PP   P  SP+PP PP   P  +P +  PPV+
Sbjct: 656  PAWERGENVTWTSGVVGAEVMMPSPPPSPPIVQP--SPSPP-PPVEVPSPSPPSPSPPVE 712

Query: 312  SAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               P+    PP    SP P    P  V   SPPP      P  S PP  PV  P  SPPP
Sbjct: 713  VPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPP 772

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 42/103 (40%), Positives = 46/103 (44%), Gaps = 5/103 (4%)
 Frame = +3

Query: 195 VSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP-----PPVQAS 359
           V   +  PPS SP      P+PP   P   P  SPPP    PP    SP     PPV+  
Sbjct: 697 VEVPSPSPPSPSPPVEVPSPSPPPQPPVEVPSPSPPP---QPPVEVPSPSPPPQPPVEV- 752

Query: 360 PPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           P P     PPV+  SP P    P  V S PPP PV  P  SPP
Sbjct: 753 PSPSPPPQPPVEVPSPSPPPQPPVEVPSPPPPPPVAVPSPSPP 795

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/72 (51%), Positives = 43/72 (59%), Gaps = 1/72 (1%)
 Frame = +3

Query: 216  PPST-SPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            PPS   P+ SP PP+PP+ +PP+ P   PPPV S PP    SPPP   SPPP+   PPP 
Sbjct: 910  PPSPLPPSPSPPPPSPPSPSPPSPPP--PPPVPSPPPP---SPPP--PSPPPLPPPPPP- 961

Query: 393  QQSSPPPVSSTP 428
              S PPPV   P
Sbjct: 962  -PSPPPPVDECP 972

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/107 (32%), Positives = 48/107 (44%), Gaps = 13/107 (12%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP-P 386
            + PPS SP  +P+P   PT +P  +P  SP P  +  PT   +P P     PP +S+P P
Sbjct: 1856 RSPPSPSPPPTPSPTPSPTPSPTPSPTPSPTPSPTPTPTPSPTPTPTPTPTPPTESSPTP 1915

Query: 387  PVQQSSP------------PPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            P   S+             P  + T  P    PP AP + P  +P P
Sbjct: 1916 PAPDSATYFTLQPGVPVQIPASTITVIPGAQLPPGAPPSTPTPAPIP 1962

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 38/94 (40%), Positives = 42/94 (44%), Gaps = 8/94 (8%)
 Frame = +3

Query: 213 QPPSTSPNASPAP--------PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP 368
           QPP   P+ SP P        P+PP   P   P  SPPP    PP    SP     SPPP
Sbjct: 721 QPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPP---QPPVEVPSP-----SPPP 772

Query: 369 VQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTP 470
                PPV+  SPPP    PPPV    P  P+ P
Sbjct: 773 ----QPPVEVPSPPP----PPPVAVPSPSPPILP 798

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 34/103 (33%), Positives = 44/103 (42%), Gaps = 12/103 (11%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            P   SP  SP+PP  P+ TP  TP  +P P  S  P+   +P P   +P P  +  PP +
Sbjct: 1853 PTQRSP-PSPSPPPTPSPTPSPTPSPTPSPTPSPTPSPTPTPTP-SPTPTPTPTPTPPTE 1910

Query: 396  QSSPPPVSSTPP--------PVQSSPPPAPVTP----PPASPP 488
             S  PP   +          PVQ       V P    PP +PP
Sbjct: 1911 SSPTPPAPDSATYFTLQPGVPVQIPASTITVIPGAQLPPGAPP 1953

[62][TOP]
>UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1
           Tax=Vitis vinifera RepID=UPI0001982DE4
          Length = 569

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 43/100 (43%), Positives = 47/100 (47%)
 Frame = +3

Query: 189 VFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP 368
           + +  G   PP       P PP P    PP  P + PPP   +PP   S PPP   SPPP
Sbjct: 105 IIIGGGYSPPPEYEEGCPPPPPEP--ECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPP 162

Query: 369 VQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
             S PPP   S PPP    PPP    PPP P  PPP  PP
Sbjct: 163 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 202

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 36/74 (48%), Positives = 38/74 (51%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P   P+PP PP+  PP  P  SPPP  S PP    SPPP    PPP    PPP  
Sbjct: 135 PPSPPPPPPPSPPPPPS--PPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 192

Query: 396 QSSPPPVSSTPPPV 437
              PPP    PPPV
Sbjct: 193 PPPPPP---PPPPV 203

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 34/71 (47%), Positives = 37/71 (52%), Gaps = 3/71 (4%)
 Frame = +3

Query: 294 SPPPV--QSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVT 467
           SPPP   +  PP     PPP    PPP   +PPP    SPPP  S PPP    PPP+P  
Sbjct: 112 SPPPEYEEGCPP-----PPPEPECPPPPPPSPPPPPPPSPPPPPSPPPP----PPPSPPP 162

Query: 468 PP-PASPPPAS 497
           PP P  PPP S
Sbjct: 163 PPSPPPPPPPS 173

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 28/65 (43%), Positives = 33/65 (50%), Gaps = 2/65 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS--APPP 389
           PPS  P  SP PP PP+  PP +P   PPP    PP     PPP    PPP      PPP
Sbjct: 143 PPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 202

Query: 390 VQQSS 404
           V +++
Sbjct: 203 VDRNA 207

[63][TOP]
>UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0K5_ARATH
          Length = 760

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 50/93 (53%), Positives = 53/93 (56%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP P  +TPPT    SPPP    PP    SPPP    PPPV S PPP  
Sbjct: 403 PPPSLP--SPPPPAPIFSTPPTL--TSPPPPSPPPPVY--SPPPPPPPPPPVYSPPPPPP 456

Query: 396 QSSPPPVSSTPPPVQSSPPPAPV-TPPPASPPP 491
              PPPV S PPP    PPP PV +PPP SPPP
Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPP 489

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 47/96 (48%), Positives = 50/96 (52%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP   P PP P  + PP  P   PPPV S PP     PPP    PPPV S PPP  
Sbjct: 433 PPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPP-----PPPPPPPPPPVYSPPPPSP 487

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPP----ASPPP 491
              PPPV S PPP    PPP   +PPP    +SPPP
Sbjct: 488 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPP 523

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 47/105 (44%), Positives = 52/105 (49%), Gaps = 13/105 (12%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA----- 380
           PP   P  SP PP+PP   PP      PPP    PP     PPPV +SPPP  S      
Sbjct: 473 PPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPV 532

Query: 381 ----PPPVQQSSPPPVSSTPPPVQ----SSPPPAPVTPPPASPPP 491
               PPP    SPPP   +PPP +    SSPPP   +PPP SPPP
Sbjct: 533 YCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPP 577

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 50/106 (47%), Positives = 50/106 (47%), Gaps = 14/106 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP-VQSAPPPV 392
           PP   P  SP PP PP   PP      PPP    PP   S PPP    PPP V S PPP 
Sbjct: 442 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPP 501

Query: 393 QQSSPPPV-SSTPPPVQSSPPP------------APVTPPPASPPP 491
               PPPV S  PPPV SSPPP             P  PPP SPPP
Sbjct: 502 PPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPP 547

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 45/96 (46%), Positives = 50/96 (52%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP+ +    P+PP PP  +PP  P   PP     PP     PPPV + PPP    PPP  
Sbjct: 420 PPTLTSPPPPSPP-PPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPP 478

Query: 396 QSSPPPVS--STPPPVQSSPPPAPVTPPPA--SPPP 491
             SPPP S    PPPV S PPP P  PPP   SPPP
Sbjct: 479 VYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPP 514

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 49/109 (44%), Positives = 55/109 (50%), Gaps = 17/109 (15%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPT-------NTPPTTPQASPPPVQSAPPTAQSSPPPVQAS--PPP 368
           PP   P  SP PP PP        + PP +P   PPPV S PP     PPP   S  PPP
Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516

Query: 369 VQSAPPPVQQSSPPPVSST--PPPVQSSPPPAPVTPPP------ASPPP 491
           V S+PPP    +P PV  T  PPP   SPPP   +PPP      +SPPP
Sbjct: 517 VYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPP 565

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 53/105 (50%), Positives = 59/105 (56%), Gaps = 14/105 (13%)
 Frame = +3

Query: 216 PPSTSPNASPA----PPTPPTNTPPTTPQASPPPVQ----SAPPTAQSSPPPVQASPPPV 371
           PP  SP  +P     PP PP ++PP  PQ SPPP +    S+PP   SSPPP   SPPP 
Sbjct: 522 PPPPSPAPTPVYCTRPPPPPPHSPPP-PQFSPPPPEPYYYSSPPPPHSSPPP--HSPPPP 578

Query: 372 QSAPPPVQQ--SSPP---PVSSTPP-PVQSSPPPAPVTPPPASPP 488
            S PPP+    S PP   PVSS PP PV S PPP P   PP  PP
Sbjct: 579 HSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPP 623

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 53/121 (43%), Positives = 59/121 (48%), Gaps = 16/121 (13%)
 Frame = +3

Query: 183 CAVFVSAGAQQPP------STSPNASPAPPTPPTNTPPTTPQASPP-PVQSAPPTAQSSP 341
           C  F+S    +PP      S   + SP PP      PP+ P   PP P+ S PPT  S P
Sbjct: 372 CKAFLS----RPPVNCGSFSCGRSVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPP 427

Query: 342 PPVQASPPPVQS------APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA---SPPPA 494
           PP  + PPPV S       PPPV    PPP    PPPV S PPP P  PPP    SPPP 
Sbjct: 428 PP--SPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPP 485

Query: 495 S 497
           S
Sbjct: 486 S 486

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 49/98 (50%), Positives = 54/98 (55%), Gaps = 6/98 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS-SPPPVQAS--PPPVQSAPP 386
           PP   P  SP PP PP   PP      PPPV S+PP   S +P PV  +  PPP   +PP
Sbjct: 488 PPPPPPVYSPPPPPPPPPPPPVY-SPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP 546

Query: 387 PVQQSSPPP---VSSTPPPVQSSPPPAPVTPPPASPPP 491
           P Q S PPP     S+PPP  SSPPP    PPP SPPP
Sbjct: 547 PPQFSPPPPEPYYYSSPPPPHSSPPPHS-PPPPHSPPP 583

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 49/113 (43%), Positives = 55/113 (48%), Gaps = 22/113 (19%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSA--PPTAQSSPPPVQASPPPVQ----S 377
           PP   P  SP PP P  ++PP  P  +P PV     PP    SPPP Q SPPP +    S
Sbjct: 503 PPPPPPVYSPPPP-PVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYS 561

Query: 378 APPPVQQS----SPPPVSSTPPPVQ------------SSPPPAPVTPPPASPP 488
           +PPP   S    SPPP  S PPP+             SSPPP PV  PP  PP
Sbjct: 562 SPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPP 614

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 54/126 (42%), Positives = 60/126 (47%), Gaps = 33/126 (26%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSA------PPTAQSSPPPVQ-----ASP 362
           PP   P  SP PP  P ++PP TP  SPPP          PP  + SPPP       +SP
Sbjct: 582 PPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSP 641

Query: 363 PPV-----QSAPPPVQQSSPPP-----VSSTPPPV--QSSPPPAPV---TPPP------- 476
           PP         PPPV  SSPPP      SS PPP     SPPP+PV   +PPP       
Sbjct: 642 PPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCE 701

Query: 477 ASPPPA 494
            SPPPA
Sbjct: 702 ESPPPA 707

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 52/115 (45%), Positives = 60/115 (52%), Gaps = 23/115 (20%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPP----PVQSAPPTAQSSPPP----VQASPPP- 368
           P S+ P  SP PP  P   PP  P  SPP    PV S PPT   SPPP    ++  PPP 
Sbjct: 566 PHSSPPPHSPPPPHSPP--PPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPP 623

Query: 369 -VQSAPPP----VQQSSPPPVSSTPPPVQSSPPPAPV---TPPP------ASPPP 491
            ++ +PPP    V  SSPPP    PP   SSPPP PV   +PPP      +SPPP
Sbjct: 624 CIEYSPPPPPPVVHYSSPPP----PPVYYSSPPPPPVYYSSPPPPPPVHYSSPPP 674

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 47/104 (45%), Positives = 54/104 (51%), Gaps = 12/104 (11%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTP--QASPPPVQSAPPTAQSSPPPVQA---SPPPVQSA 380
           PP     +SP PP    ++PP  P   +SPPP    PP   SSPPP +    SPP     
Sbjct: 632 PPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPP---PPPVHYSSPPPPEVHYHSPP----- 683

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPV---TPPPA----SPPP 491
           P PV  SSPPP  S   P + SPPPAPV   +PPP     SPPP
Sbjct: 684 PSPVHYSSPPPPPSA--PCEESPPPAPVVHHSPPPPMVHHSPPP 725

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 43/100 (43%), Positives = 50/100 (50%), Gaps = 8/100 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTP--QASPPPVQSAPPTAQSSPPP---VQASPPPV--- 371
           PP     +SP PP    ++PP +P   +SPPP  SAP   + SPPP   V  SPPP    
Sbjct: 663 PPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAP--CEESPPPAPVVHHSPPPPMVH 720

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            S PPPV   SPPP    P P    P P  +    ASPPP
Sbjct: 721 HSPPPPVIHQSPPP----PSPEYEGPLPPVIGVSYASPPP 756

[64][TOP]
>UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f.
           nagariensis RepID=Q9SBM1_VOLCA
          Length = 409

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 45/94 (47%), Positives = 49/94 (52%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           QPP   P+ SP PP PP   PP  P   PPP  S PP     PPP  + PPP    PPP 
Sbjct: 78  QPP-LPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPP 136

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
               PPP    PPP   SPPP+P   PP SPPP+
Sbjct: 137 PNPPPPP---PPPPPSPSPPPSPPPSPPPSPPPS 167

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 44/93 (47%), Positives = 48/93 (51%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP+ +PP  P   PPPV   PP     PPP   SPPP    PPP  
Sbjct: 68  PPPPPPPPPPQPPLPPSPSPPPPP---PPPVPPPPPPPPPPPPP--PSPPPPPPPPPPPP 122

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            S PPP    PPP  + PPP P  PP  SPPP+
Sbjct: 123 PSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPS 155

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 47/95 (49%), Positives = 50/95 (52%), Gaps = 2/95 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQA--SPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PPS SP   P PP PP   PP  P    SPPP    PP    SPPP    PPP    PPP
Sbjct: 82  PPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPP 141

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
                PPP S +PPP   SPPP+P   PP SPPP+
Sbjct: 142 --PPPPPPPSPSPPP---SPPPSPPPSPPPSPPPS 171

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 47/110 (42%), Positives = 50/110 (45%), Gaps = 2/110 (1%)
 Frame = +3

Query: 168 VVGLICAVFVSAGAQQPPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPTAQSSP 341
           VV L+           PP T P   P PPTP  P + PP  P   PPP    PP+    P
Sbjct: 31  VVALVETPAAPPPGSPPPGTPPPGVP-PPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPP 89

Query: 342 PPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PP    PPP    PPP    SPPP    PPP   SPPP P  PPP  P P
Sbjct: 90  PPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNP 139

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 41/93 (44%), Positives = 45/93 (48%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP+P    PP  P   PPP    PP   S PPP    PPP  S PPP  
Sbjct: 71  PPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPP 130

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              PPP +  PPP    P P+P   PP SPPP+
Sbjct: 131 PPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPS 163

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 44/94 (46%), Positives = 47/94 (50%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P  SP PP PP   PP +P   PPP    PP     PPP   SP P  S PP   
Sbjct: 102 PPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPP 161

Query: 396 QSSPP-PVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            S PP P  S PP    SPPP+P   PP SPPP+
Sbjct: 162 PSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPS 195

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 44/93 (47%), Positives = 47/93 (50%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP  +PP  P   PPP  S PP     PPP    PPP    PPP  
Sbjct: 92  PPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPP---PPPPPP 148

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
             SPPP  S PP    SPPP+P   PP SPPP+
Sbjct: 149 SPSPPP--SPPPSPPPSPPPSPPPSPPPSPPPS 179

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/99 (44%), Positives = 47/99 (47%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           +G + PP       P PP PP   PP  P  SPPP    PP     PPP    PPP   +
Sbjct: 61  SGPEHPPP------PPPPPPPPPQPPLPPSPSPPP----PPPPPVPPPPPPPPPPPPPPS 110

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PPP     PPP  S PPP    PPP P  PPP  PPP S
Sbjct: 111 PPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPS 149

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 42/93 (45%), Positives = 45/93 (48%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP + PP  P   PPP    PP     PPP    PPP    P P  
Sbjct: 93  PPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSP 152

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
             SPPP  S PP    SPPP+P   PP SPPP+
Sbjct: 153 PPSPPP--SPPPSPPPSPPPSPPPSPPPSPPPS 183

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 43/92 (46%), Positives = 46/92 (50%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P+PP PP   PP  P   PPP    PP     PPP    PPP   +PPP  
Sbjct: 100 PPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPP---PPPPPSPSPPPSP 156

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             SPPP  S PP    SPPP+P   PP SPPP
Sbjct: 157 PPSPPP--SPPPSPPPSPPPSPPPSPPPSPPP 186

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 45/92 (48%), Positives = 50/92 (54%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P   P PP PP N PP  P   PPP  S PP+   SPPP  + PP    +PPP  
Sbjct: 121 PPPSPPPPPPPPPPPPPNPPPPPPP--PPPSPSPPPSPPPSPPP--SPPPSPPPSPPPSP 176

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             SPPP  S PP    SPPP+P   PP SPPP
Sbjct: 177 PPSPPP--SPPPRPPPSPPPSPPPSPPPSPPP 206

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 44/93 (47%), Positives = 49/93 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P+PP PP   PP  P  +PPP    PP + S PP    SPPP   +PPP  
Sbjct: 114 PPPPPPPPPPSPPPPP--PPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPP---SPPPSP 168

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
             SPPP  S PP    SPPP P   PP SPPP+
Sbjct: 169 PPSPPP--SPPPSPPPSPPPRPPPSPPPSPPPS 199

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/95 (45%), Positives = 50/95 (52%), Gaps = 2/95 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PPS  P+  P+PP  P  +PP +P  SPPP    S PP+   SPPP     PP    PP 
Sbjct: 157 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPS 216

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            +  SP P S  PPP +  P P P  PPP  PPPA
Sbjct: 217 PRPPSPSPPSPRPPP-RRPPFPPPSPPPPRPPPPA 250

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 47/95 (49%), Positives = 53/95 (55%), Gaps = 1/95 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTN-TPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP   PN  P PP PP + +PP +P  SPPP  S PP+   SPPP   SPPP   +PPP 
Sbjct: 132 PPPPPPNPPPPPPPPPPSPSPPPSPPPSPPP--SPPPSPPPSPPP---SPPP---SPPPS 183

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PPP  S PP    SPPP+P   PP SP P S
Sbjct: 184 PPPRPPP--SPPPSPPPSPPPSPPPRPPPSPNPPS 216

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 44/94 (46%), Positives = 50/94 (53%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P  SP+PP  P  +PP +P  SPPP  S PP+   SPPP   SPPP    PPP  
Sbjct: 141 PPPPPPPPSPSPPPSPPPSPPPSPPPSPPP--SPPPSPPPSPPP---SPPP---RPPPSP 192

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP     PP +  P P P +P P SP P S
Sbjct: 193 PPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPS 226

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 44/93 (47%), Positives = 52/93 (55%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPPPV 392
           PP  SP+  P+PP  P  +PP +P  SPPP  S PP+   SPPP    SPPP   +PPP 
Sbjct: 145 PPPPSPSPPPSPPPSPPPSPPPSPPPSPPP--SPPPSPPPSPPPRPPPSPPP---SPPPS 199

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              SPPP    PPP  + P P P +P P SP P
Sbjct: 200 PPPSPPP---RPPPSPNPPSPRPPSPSPPSPRP 229

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 45/103 (43%), Positives = 50/103 (48%), Gaps = 11/103 (10%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP-----------PVQASP 362
           PPS  P+  P+PP  P  +PP  P  SPPP  S PP+   SPP           P   SP
Sbjct: 165 PPSPPPSPPPSPPPSPPPSPPPRPPPSPPP--SPPPSPPPSPPPRPPPSPNPPSPRPPSP 222

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            P    PPP +   PPP  S PPP    P P P  PPP SPPP
Sbjct: 223 SPPSPRPPPRRPPFPPP--SPPPPRPPPPAPPPPRPPPPSPPP 263

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 41/105 (39%), Positives = 47/105 (44%), Gaps = 11/105 (10%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ------- 374
           PPS  P   P+PP  P  +PP +P   PPP  + P     SP P    PPP +       
Sbjct: 181 PPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPS 240

Query: 375 ----SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                 PPP      PP  S PPP+   P P P  PPP SPPP S
Sbjct: 241 PPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPS 285

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/92 (43%), Positives = 48/92 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P+  P PP  P  +PP +P  SPPP    PP + + P P   SP P    PPP +
Sbjct: 177 PPSPPPSPPPRPPPSPPPSPPPSPPPSPPP---RPPPSPNPPSPRPPSPSPPSPRPPPRR 233

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    P P   +PPP P  PPP+ PPP
Sbjct: 234 PPFPPPSPPPPRPPPPAPPP-PRPPPPSPPPP 264

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 43/96 (44%), Positives = 50/96 (52%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P+  P+PP  P  +PP +P  SPPP  S PP    SPPP  + PP    +PPP  
Sbjct: 153 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPP--SPPPRPPPSPPP--SPPPSPPPSPPPRP 208

Query: 396 QSSPPPVSSTPP----PVQSSPPPAPVTPPPASPPP 491
             SP P S  PP    P    PP  P  PPP+ PPP
Sbjct: 209 PPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPP 244

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 43/98 (43%), Positives = 49/98 (50%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT--PPTNTPPTTPQASP-PPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PPS  P+  P+PP   PP+  PP+    SP PP    PP     PPP    P P   APP
Sbjct: 193 PPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPP 252

Query: 387 PVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
           P +   P P    PPP    PP P P +PPP SPPP S
Sbjct: 253 PPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPS 290

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 40/96 (41%), Positives = 46/96 (47%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP--PVQSAPPP 389
           PP + P   P  P PP+  PP+    SP P    PP    SPPP +  PP  P    PPP
Sbjct: 200 PPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPP 259

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                 PP  S PPP+   P P P +PPP SP P S
Sbjct: 260 SPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPS 295

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 44/109 (40%), Positives = 54/109 (49%), Gaps = 14/109 (12%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPT------PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           +PPS SP  SP PP       PP+  PP  P  +PPP +  PP+     PP  + PPP+ 
Sbjct: 218 RPPSPSP-PSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLP 276

Query: 375 SAPPPVQQSSPPP--VSSTPPPVQSSPP------PAPVTPPPASPPPAS 497
             P P   S PPP  +  +P P + SPP      P P  PPP  PPP S
Sbjct: 277 PPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPS 325

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 42/100 (42%), Positives = 48/100 (48%), Gaps = 8/100 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAP--PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP   P  +P P  P PP+  PP  P  SPPP    PP   S PPP    P P+  +P P
Sbjct: 242 PPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPP---SPPPPSPPPPSPLPPSPRP 298

Query: 390 VQQSSP------PPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            + S P      PP  + PPP    P P P  PPP SPPP
Sbjct: 299 PKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPP 338

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 43/106 (40%), Positives = 49/106 (46%), Gaps = 12/106 (11%)
 Frame = +3

Query: 216 PPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP   P A P P P PP+  PP  P  SPPP    PP   S PPP    P P+  +P P 
Sbjct: 243 PPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPP---SPPPPSPPPPSPLPPSPRPP 299

Query: 393 QQSSP-----------PPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           + S P           PP    PPP  + P P P +PPP  PPP S
Sbjct: 300 KPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPS 345

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 42/95 (44%), Positives = 48/95 (50%), Gaps = 2/95 (2%)
 Frame = +3

Query: 216 PPSTSP-NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PPS  P + SP  P PP   PP  P + PPP    PP A   P P   SPPP    PP  
Sbjct: 214 PPSPRPPSPSPPSPRPPPRRPPFPPPSPPPP--RPPPPAPPPPRPPPPSPPPPLPPPP-- 269

Query: 393 QQSSPPPVSSTP-PPVQSSPPPAPVTPPPASPPPA 494
             S PPP+   P PP  S PPP+P+ P P  P P+
Sbjct: 270 --SPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPS 302

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 42/96 (43%), Positives = 46/96 (47%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP--PVQSAP 383
           PP + P  SP PP+P  P  +PP  P   PPP    PP     PPP   +PP  P  S P
Sbjct: 282 PPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPR----PPPPSPNPPRPPPPSPP 337

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PP     PPP S  PP      P  P  PPP SPPP
Sbjct: 338 PP----RPPPPSPNPPRPPPPSPSPPKPPPPPSPPP 369

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/108 (37%), Positives = 48/108 (44%), Gaps = 14/108 (12%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           ++PP   P+  P  P PP   PP  P  SPPP    PP+     PP  + PPP    P P
Sbjct: 232 RRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSP 291

Query: 390 VQQSSPPPVSSTP------PPVQSSPPPAPVTP--------PPASPPP 491
           +  S  PP  S P      PP  + PPP P  P        PP+ PPP
Sbjct: 292 LPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPP 339

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 39/93 (41%), Positives = 43/93 (46%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PPS  P   P P P PP+  PP+    SP P + +PP      PP    PPP    PPP 
Sbjct: 268 PPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPP--RPPPPS 325

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                PP  S PPP    P P P  PPP SP P
Sbjct: 326 PNPPRPPPPSPPPPRPPPPSPNPPRPPPPSPSP 358

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 38/106 (35%), Positives = 44/106 (41%)
 Frame = +3

Query: 171 VGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPV 350
           V L+  +  S  A   P+  P    +P      TP   P  SPPP    P     +P   
Sbjct: 4   VALLLLLASSPHALGAPARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGP 63

Query: 351 QASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           +  PPP    PPP Q   PP  S  PPP    PPP P  PPP  PP
Sbjct: 64  EHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPP 109

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 42/97 (43%), Positives = 44/97 (45%), Gaps = 5/97 (5%)
 Frame = +3

Query: 216 PPSTSPNAS----PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP  SP  +    PA P P +  P T P   PPP  S P      PPP    PPP    P
Sbjct: 25  PPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGP----EHPPPPPPPPPPPPQPP 80

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAP-VTPPPASPPP 491
            P   S PPP    PPP    PPP P   PPP SPPP
Sbjct: 81  LPPSPSPPPP----PPPPVPPPPPPPPPPPPPPSPPP 113

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 39/93 (41%), Positives = 45/93 (48%), Gaps = 2/93 (2%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP-PVQSAPPP 389
           +PP  SP  +P P  PP N PP  P   PPP  + P     SPPP +  PP P    PPP
Sbjct: 297 RPPKPSPPNNPFPRPPPPNPPPPRP---PPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPP 353

Query: 390 VQQSSP-PPVSSTPPPVQSSPPPAPVTPPPASP 485
              S P PP   +PPP     PP P   PP +P
Sbjct: 354 PSPSPPKPPPPPSPPPRPPRRPPRPPRRPPTAP 386

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 41/98 (41%), Positives = 47/98 (47%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P   P+PP  P   PP  P   PPP    PP + + P P   SPPP +  PP   
Sbjct: 293 PPSPRP-PKPSPPNNPFPRPP--PPNPPPP--RPPPPSPNPPRPPPPSPPPPRPPPPSPN 347

Query: 396 QSSPPPVSSTP--PPVQSSPPPAPVTPPPASP--PPAS 497
              PPP S +P  PP   SPPP P   PP  P  PP +
Sbjct: 348 PPRPPPPSPSPPKPPPPPSPPPRPPRRPPRPPRRPPTA 385

[65][TOP]
>UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum
           bicolor RepID=C5XPK9_SORBI
          Length = 613

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 46/105 (43%), Positives = 52/105 (49%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP 362
           C  FV      PP + P  SP PP+P    P   P + PPP  S PP +   P P   SP
Sbjct: 399 CKKFVLPSPPLPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP 458

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PP   +PPP   S PPP    P P   SP P P +PPP SPPP S
Sbjct: 459 PP--PSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPS 501

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 47/108 (43%), Positives = 55/108 (50%), Gaps = 4/108 (3%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP 362
           C  F       P    P  SP PP+PP  +P   P + PPP  S PP + S PPP   SP
Sbjct: 394 CDAFKCKKFVLPSPPLPPPSPPPPSPPPPSPSPPPPSPPPP--SPPPPSPSPPPP---SP 448

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQ----SSPPPAPVTPPPASPPPA 494
           PP    PP     SPPP S +PPP      S PPP+P  PPP+ PPP+
Sbjct: 449 PPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPS 496

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 47/93 (50%), Positives = 53/93 (56%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNA-SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PPS SP   SP PP+PP  +P   P + PPP    P     SPPP   SPPP  S PPP 
Sbjct: 421 PPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPP-PSPPPP- 478

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              SPPP S +PPP  S PPP+P  P P+ PPP
Sbjct: 479 ---SPPPPSPSPPP-PSPPPPSPPPPSPSPPPP 507

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 45/101 (44%), Positives = 54/101 (53%), Gaps = 9/101 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQ---SSPPPVQASPPPVQSAPP 386
           PP  SP+  P  P PP+  PP+ P  SPPP   +PP       SPPP   SPPP  S PP
Sbjct: 436 PPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPP-PSPPP 494

Query: 387 PVQQSSPPPVSSTPPP--VQSSPPPAPVTPPPAS----PPP 491
           P    SPPP S +PPP   + SP    ++PPP +    PPP
Sbjct: 495 P----SPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPP 531

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 46/128 (35%), Positives = 55/128 (42%), Gaps = 38/128 (29%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTP----PTTPQASPPPVQSAPPTAQ----SSPPPVQASPPPV 371
           PP + P  SP PP+PP  +P    P+ P  SPPP   +PP       S PPP  + PPP 
Sbjct: 449 PPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPY 508

Query: 372 Q---------SAPPPVQQSSPPP-----------VSSTPPPVQSSPPPAP---------- 461
                     S PPP     PPP           +S  PPPV   PPP P          
Sbjct: 509 YEVSPEERYLSPPPPAYTEVPPPPYYEVSPEDRYLSPPPPPVHHDPPPPPYYEVSPEDRY 568

Query: 462 VTPPPASP 485
           ++PPP SP
Sbjct: 569 LSPPPPSP 576

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 40/133 (30%), Positives = 51/133 (38%), Gaps = 39/133 (29%)
 Frame = +3

Query: 216 PPSTSP-NASPAPPTPPTNTPPTTPQASPPPVQ---------SAPPTAQSS--------- 338
           PPS  P + SP PP+PP  +PP    + PPP           S PP A +          
Sbjct: 477 PPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPPPYYEV 536

Query: 339 ----------PPPVQASPPPVQS----------APPPVQQSSPPPVSSTPPPVQSSPPPA 458
                     PPPV   PPP             +PPP   +S P    + PP   + P  
Sbjct: 537 SPEDRYLSPPPPPVHHDPPPPPYYEVSPEDRYLSPPPPSPASLPKYDYSSPPPPRALPKL 596

Query: 459 PVTPPPASPPPAS 497
           PV    + PPPA+
Sbjct: 597 PVYDYSSPPPPAA 609

[66][TOP]
>UniRef100_UPI00017390C7 AGP19 (ARABINOGALACTAN-PROTEIN 19) n=1 Tax=Arabidopsis thaliana
           RepID=UPI00017390C7
          Length = 248

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS-SPPPVQASPPPVQSAPPPV 392
           PP+ +P + PAP   P  +P T P   P P QS P +A + SPPPV  SPPP  ++PPP 
Sbjct: 74  PPAVTPTSPPAPKVAPVISPATPP---PQPPQSPPASAPTVSPPPV--SPPPAPTSPPPT 128

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
             +SPPP  ++PPP  +SPPPAPV+PPP   P
Sbjct: 129 P-ASPPPAPASPPPAPASPPPAPVSPPPVQAP 159

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = +3

Query: 219 PSTSPNASPA--PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           P  +P  SPA  PP PP + P + P  SPPPV  +PP A +SPPP  ASPPP  ++PPP 
Sbjct: 85  PKVAPVISPATPPPQPPQSPPASAPTVSPPPV--SPPPAPTSPPPTPASPPPAPASPPPA 142

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
             +SPPP   +PPPVQ+   P+P++ PPA  P
Sbjct: 143 -PASPPPAPVSPPPVQA---PSPISLPPAPAP 170

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 47/105 (44%), Positives = 60/105 (57%), Gaps = 6/105 (5%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPA-PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           +  A  P +T+P  S A PP  P   PP     SPP  + AP  + ++PPP     PP  
Sbjct: 48  TTAAPPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPAS 107

Query: 375 S---APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPP--PASPPPA 494
           +   +PPPV   SPPP  ++PPP  +SPPPAP +PP  PASPPPA
Sbjct: 108 APTVSPPPV---SPPPAPTSPPPTPASPPPAPASPPPAPASPPPA 149

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/105 (40%), Positives = 55/105 (52%), Gaps = 13/105 (12%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           QPP + P ++P    PP + PP     SPPP  ++PP A +SPPP  ASPPP   +PPPV
Sbjct: 99  QPPQSPPASAPTVSPPPVSPPPAP--TSPPPTPASPPPAPASPPPAPASPPPAPVSPPPV 156

Query: 393 QQSSPPPVSSTPPPVQS-------------SPPPAPVTPPPASPP 488
           Q  SP  +   P P  +             +P PAP+ P P SPP
Sbjct: 157 QAPSPISLPPAPAPAPTKHKRKHKHKRHHHAPAPAPIPPSPPSPP 201

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 57/135 (42%), Positives = 65/135 (48%), Gaps = 23/135 (17%)
 Frame = +3

Query: 159 IVLVVGLICAVFVSA-GAQQPPSTSPNASP-----APPT----PPTNTPPTTPQASPP-- 302
           ++L   LI +  V+A G    P TS   +P     APPT    PPT T P    A PP  
Sbjct: 10  LLLASALISSFSVNAQGPAASPVTSTTTAPPPTTAAPPTTAAPPPTTTTPPVSAAQPPAS 69

Query: 303 PVQSAPPTAQSSPP---------PVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPP 455
           PV   P    +SPP         P    P P QS P      SPPPVS  PPP  +SPPP
Sbjct: 70  PVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVS--PPPAPTSPPP 127

Query: 456 APVTPP--PASPPPA 494
            P +PP  PASPPPA
Sbjct: 128 TPASPPPAPASPPPA 142

[67][TOP]
>UniRef100_Q6ZD62 Os08g0108300 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q6ZD62_ORYSJ
          Length = 342

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 42/96 (43%), Positives = 53/96 (55%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPP----TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP   P   P+PP     PP   PP   QA PPP ++ PP A   PPP +A PPP    P
Sbjct: 52  PPPAPPIRPPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPP 111

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PP +++ PPP +  PPP ++ PPP+P   PP  P P
Sbjct: 112 PPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTP 147

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 45/99 (45%), Positives = 56/99 (56%), Gaps = 4/99 (4%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           Q PP   P   P PP PP   PP+ P  +PPP   APP    +PPP + +PPP    PPP
Sbjct: 42  QAPPP--PQRFPPPPAPPIR-PPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPPPALPPPP 98

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPP----ASPPPA 494
            +++ PPP    PPP + +PPP P TPPP    A PPP+
Sbjct: 99  PRRAPPPPSMPPPPPPRRAPPP-PATPPPPPRRAPPPPS 136

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 43/98 (43%), Positives = 51/98 (52%), Gaps = 3/98 (3%)
 Frame = +3

Query: 213 QPPSTSPNASPAP---PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           +PPS    A P P   P PP+  PP   +A PPP    PP  ++ PPP    PPP + AP
Sbjct: 59  RPPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAP 118

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PP     PPP  + PPP     PP P TP P +PPP S
Sbjct: 119 PPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPS 156

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 41/92 (44%), Positives = 52/92 (56%), Gaps = 1/92 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  +P   P  P+PP   PP   +A PPP Q+ PP  ++ PPP    PPP ++ PPP  
Sbjct: 51  PPPPAPPIRP--PSPPGRAPPPPGRAPPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSM 108

Query: 396 QSSPPPVSSTPPPVQSSPPPAP-VTPPPASPP 488
              PPP  + PPP  ++PPP P   PPP SPP
Sbjct: 109 PPPPPPRRAPPPP--ATPPPPPRRAPPPPSPP 138

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 41/94 (43%), Positives = 48/94 (51%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS--SPPPVQASPPPVQSAPPP 389
           PP+ +P A   P  P     P  PQA PPP +  PP A     P P   +PPP   APPP
Sbjct: 18  PPNPNPYAPLNPNAPKPPVMPPRPQAPPPPQRFPPPPAPPIRPPSPPGRAPPPPGRAPPP 77

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             Q+ PPP  + PPP    PPP    PPP+ PPP
Sbjct: 78  PSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPP 111

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/100 (41%), Positives = 50/100 (50%), Gaps = 6/100 (6%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP----PPVQ 374
           A  PP  +P     PP PP   PP      PPP + APP   + PPP + +P    PP++
Sbjct: 81  APPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAPPPPATPPPPPRRAPPPPSPPIR 140

Query: 375 SAPPPVQQSSPPPVSSTP--PPVQSSPPPAPVTPPPASPP 488
             PPP  +   PP  S P  PP     PPAPV PPP+ PP
Sbjct: 141 PPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPPSPPP 180

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 44/102 (43%), Positives = 55/102 (53%), Gaps = 3/102 (2%)
 Frame = +3

Query: 195 VSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPP--PVQSAPPTAQSSPPPVQASPPP 368
           ++  A +PP   P    APP P    PP  P   PP  P ++ PP  ++ PPP QA PPP
Sbjct: 27  LNPNAPKPPVMPPRPQ-APPPPQRFPPPPAPPIRPPSPPGRAPPPPGRAPPPPSQAPPPP 85

Query: 369 VQSAPPPVQQSSPPPVSSTPPP-VQSSPPPAPVTPPPASPPP 491
            + APPP     PPP  + PPP +   PPP    PPPA+PPP
Sbjct: 86  -RRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAPPPPATPPP 126

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 39/87 (44%), Positives = 45/87 (51%), Gaps = 4/87 (4%)
 Frame = +3

Query: 243 PAPPTPPTNTP--PTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ--QSSPP 410
           P P  PP   P  P  P A  PPV   PP  Q+ PPP +  PPP     PP    ++ PP
Sbjct: 13  PFPFYPPNPNPYAPLNPNAPKPPVM--PPRPQAPPPPQRFPPPPAPPIRPPSPPGRAPPP 70

Query: 411 PVSSTPPPVQSSPPPAPVTPPPASPPP 491
           P  + PPP Q+ PPP    PPPA PPP
Sbjct: 71  PGRAPPPPSQAPPPPRRAPPPPALPPP 97

[68][TOP]
>UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO
          Length = 2618

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 46/98 (46%), Positives = 51/98 (52%), Gaps = 5/98 (5%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP-PPV 392
            PP   P  +P PP PP   PP    + PPP    PP     PPP  A PP    AP PP 
Sbjct: 2052 PPPPPPPPAPLPPPPPPLPPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPP 2111

Query: 393  QQSSPPPVS----STPPPVQSSPPPAPVTPPPASPPPA 494
               SPPP S     +PPP   SPPPAP+ PPP SPPP+
Sbjct: 2112 PSPSPPPPSPPPPPSPPPPPPSPPPAPLPPPPPSPPPS 2149

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 46/96 (47%), Positives = 50/96 (52%), Gaps = 3/96 (3%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP-PPVQASPPPVQSAPPP- 389
            PPS  P + P PP PP    P  P   PPP  S  P     P PP  + PPP   APPP 
Sbjct: 2043 PPSPPPLSPPPPPPPPPAPLPPPPPPLPPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPG 2102

Query: 390  -VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              Q   PPP S +PPP    PPP+P  PPP SPPPA
Sbjct: 2103 AAQAPWPPPPSPSPPPPSPPPPPSPP-PPPPSPPPA 2137

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 47/95 (49%), Positives = 52/95 (54%), Gaps = 2/95 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPT--PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PP+ SP+  P PP   PP + PP  P A PP    AP     SP P   SPPP  S PPP
Sbjct: 2071 PPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSPPPP 2130

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
                SPPP    PPP   SPPP+P  PPP SPPP+
Sbjct: 2131 --PPSPPPAPLPPPP--PSPPPSP--PPPPSPPPS 2159

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 40/91 (43%), Positives = 43/91 (47%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P  SP PP PP   P       PPP   +PP     PPP   SPPP   +PPP  
Sbjct: 2082 PPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPP---SPPPPPPSPPPAP 2138

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
               PPP     PP   SPPP+P  PPP  PP
Sbjct: 2139 LPPPPPSPPPSPPPPPSPPPSPPAPPPHPPP 2169

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 45/112 (40%), Positives = 51/112 (45%), Gaps = 13/112 (11%)
 Frame = +3

Query: 201  AGAQQPPSTSPNASP----APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP 368
            A A +PP   P  SP    +PP  P+  PP+ P  SPPP    PP     PPP    P P
Sbjct: 2015 ADAPRPPPNHPPPSPPPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPPPPLPPPAP 2074

Query: 369  VQSAPPPVQQSSPPPVSSTPPP---------VQSSPPPAPVTPPPASPPPAS 497
              S PPP     PPP    PPP             PPP+P  PPP+ PPP S
Sbjct: 2075 SPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPS 2126

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 42/92 (45%), Positives = 47/92 (51%), Gaps = 2/92 (2%)
 Frame = +3

Query: 222  STSPNASPAPPTPPTNTPPTTPQA--SPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            + +P      P PP N PP +P    SPPP+ S PP    SPPP+   PPP    PPP  
Sbjct: 2008 AAAPKQYADAPRPPPNHPPPSPPPLPSPPPLPSPPPP---SPPPLSPPPPP---PPPPAP 2061

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    P P  S PPP P  PPP SPPP
Sbjct: 2062 LPPPPPPLPPPAPSPSPPPPPPPWPPPPSPPP 2093

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/87 (42%), Positives = 42/87 (48%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP+  P A+ AP  PP +  P  P   PPP   +PP    SPPP    PPP    P P  
Sbjct: 2096 PPAPPPGAAQAPWPPPPSPSPPPPSPPPPP---SPPPPPPSPPPAPLPPPPPSPPPSPPP 2152

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPP 476
              SPPP    PPP     PPAP + PP
Sbjct: 2153 PPSPPPSPPAPPPHPPPEPPAPPSFPP 2179

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 35/86 (40%), Positives = 40/86 (46%)
 Frame = +3

Query: 198  SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
            +A A  PP  SP+  P  P PP + PP  P   P P+   PP+   SPPP   SPPP   
Sbjct: 2103 AAQAPWPPPPSPSPPPPSPPPPPSPPPPPPSPPPAPLPPPPPSPPPSPPP-PPSPPPSPP 2161

Query: 378  APPPVQQSSPPPVSSTPPPVQSSPPP 455
            APPP     PP   S PP       P
Sbjct: 2162 APPPHPPPEPPAPPSFPPQFDFGDEP 2187

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 38/75 (50%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +3

Query: 273  PPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPP 452
            P     A  PP    PP    SPPP+  SPPP+ S PPP    SPPP+S  PPP    PP
Sbjct: 2011 PKQYADAPRPPPNHPPP----SPPPLP-SPPPLPSPPPP----SPPPLSPPPPP---PPP 2058

Query: 453  PAPVTPPPAS-PPPA 494
            PAP+ PPP   PPPA
Sbjct: 2059 PAPLPPPPPPLPPPA 2073

[69][TOP]
>UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO
          Length = 538

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 51/94 (54%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 PPSTSPNA-SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PPS  P   SP PP PP  +PP      PPPV S PP   S PPP    PPPV S PPP 
Sbjct: 271 PPSPPPPVYSPPPPPPPVYSPPP-----PPPVYSPPPPPPSPPPP----PPPVYSPPPP- 320

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              SPPP  S PPPV S PPP P  PPP+ PPP+
Sbjct: 321 --PSPPP-PSPPPPVYSPPPPPPSPPPPSPPPPS 351

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 51/113 (45%), Positives = 54/113 (47%), Gaps = 21/113 (18%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQ----------SSPPPVQASPP 365
           PP   P  SP PP  P  +PP  P  SPPP  S PP  +          S PPP  + PP
Sbjct: 421 PPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPP 480

Query: 366 PVQSAPPPVQQSSPPPVS--STPPPVQSSPPPAPVTPPP---------ASPPP 491
           P Q  PPP     PPPV   S PPP QS PPPAPV   P         ASPPP
Sbjct: 481 PTQYKPPPSPSPPPPPVHYYSPPPPSQSPPPPAPVYEGPLPPITGVSYASPPP 533

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 53/127 (41%), Positives = 59/127 (46%), Gaps = 22/127 (17%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPAPPT------------PPTNTPPTTPQASPPPVQSAPPT 326
           C  FV      PP + P   P+PP             PP  +PP  P + PPPV S PP 
Sbjct: 225 CKPFVPTLPAPPPPSPPMPVPSPPVYLPPPVYSPPPPPPVYSPPPPPPSPPPPVYSPPPP 284

Query: 327 -----AQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPP--PAPV---TPPP 476
                +   PPPV + PPP  S PPP     PPPV S PPP    PP  P PV    PPP
Sbjct: 285 PPPVYSPPPPPPVYSPPPPPPSPPPP-----PPPVYSPPPPPSPPPPSPPPPVYSPPPPP 339

Query: 477 ASPPPAS 497
            SPPP S
Sbjct: 340 PSPPPPS 346

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 49/102 (48%), Positives = 53/102 (51%), Gaps = 10/102 (9%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQ--ASPPPVQSAPPTAQ----SSPPPVQASPPPVQS 377
           PP   P  SP PP P  + PP  P     PPPV S PP       S PPPV + PPP  S
Sbjct: 282 PPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPS 341

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA----SPPP 491
            PPP    SPPP S  PP V+  PPP P +PPP     SPPP
Sbjct: 342 PPPP----SPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPP 379

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 48/100 (48%), Positives = 54/100 (54%), Gaps = 9/100 (9%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQ----ASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP   P  SP PP PP  +PP  P     + PPPV S PP   S PPP   SPPP    P
Sbjct: 300 PPPPPP--SPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPP---SPPPPSPLP 354

Query: 384 PPVQQSSPPPVSS--TPPPVQSSPPPAPV---TPPPASPP 488
           P V+   PPP +S   PPP+ S PPP P    +PPP SPP
Sbjct: 355 PCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPP 394

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 52/108 (48%), Positives = 57/108 (52%), Gaps = 14/108 (12%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P  SP PP PP+  PP  P  SPPP  S PP   S PPPV + PPP  S PPP  
Sbjct: 291 PPPPPPVYSPPPP-PPSPPPPPPPVYSPPPPPSPPPP--SPPPPVYSPPPPPPSPPPP-- 345

Query: 396 QSSPPP------VSSTPPPVQSSPPPAP--VTPPP------ASPPPAS 497
            S PPP      V   PPP  +SPPP P   +PPP      +SPPP S
Sbjct: 346 -SPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPS 392

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 49/120 (40%), Positives = 57/120 (47%), Gaps = 26/120 (21%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTA--------------QSSPPPVQ 353
           PP  SP  SP PP P +  PP+ P + PPP  S PP                   PPPV 
Sbjct: 388 PPPPSPPHSPPPP-PHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVY 446

Query: 354 ASPPP------VQSAPPP--VQQSSPPPVSSTPPPVQSSPPPAPVTPPPA----SPPPAS 497
           + PPP      ++  PPP   + S PPP  S PPP Q  PPP+P  PPP     SPPP S
Sbjct: 447 SPPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPPPPS 506

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 52/111 (46%), Positives = 58/111 (52%), Gaps = 18/111 (16%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPP----VQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP  SP  SP PP P +  PP  P  SPPP    V S PP    SPPP  + PP ++  P
Sbjct: 404 PPPPSPPHSPPPP-PHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPP 462

Query: 384 PP--VQQSSPPPVSSTPPPVQ------SSPPPAPV---TPPPAS---PPPA 494
           PP   + S PPP  S PPP Q       SPPP PV   +PPP S   PPPA
Sbjct: 463 PPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPPPPSQSPPPPA 513

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 46/100 (46%), Positives = 52/100 (52%), Gaps = 8/100 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP---PTNTPPTTPQASPPPVQSAPPTA--QSSPPPVQASPPPVQ-- 374
           PP   P  SP PPTP    +  PP+ P + PPP  S PP +   S PPP  + PPP+   
Sbjct: 368 PPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPY 427

Query: 375 -SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            S PPP     P PV S PPP   SPPP P  PP   PPP
Sbjct: 428 LSPPPP-----PHPVYSPPPPPVYSPPPPPSPPPCIEPPP 462

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 51/111 (45%), Positives = 57/111 (51%), Gaps = 19/111 (17%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP----PTNTPPTTPQA----SPPPVQSAPPTAQSSPPPVQAS---P 362
           PP  SP   P+PP P    P  +PP  P +    SPPP    PP  +  PPP   S   P
Sbjct: 312 PPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPP 371

Query: 363 PPVQSAPPPV--QQSSPPPVS---STPPPVQSSPPPAP---VTPPPASPPP 491
           PP+ S PPP     SSPPP S   S PPP  S PPP+P     PPP SPPP
Sbjct: 372 PPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPP 422

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 50/108 (46%), Positives = 54/108 (50%), Gaps = 16/108 (14%)
 Frame = +3

Query: 216 PPSTSPNA-SPAPPTPPTNTPPTTPQASPPPV------QSAPPTAQSSPPPVQASPPPVQ 374
           PPS  P    P PP PP + PP  P  SPPP          PP+   SPPP   SPPP  
Sbjct: 349 PPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPS 408

Query: 375 S--APPPVQQSSPPPVS---STPPPVQS--SPPPAPV--TPPPASPPP 491
              +PPP   S PPP+    S PPP     SPPP PV   PPP SPPP
Sbjct: 409 PPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPP 456

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/108 (43%), Positives = 52/108 (48%), Gaps = 16/108 (14%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT--PPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQ---ASPPPVQ 374
           PP + P  SP PP   PP   PP +P   PP     PPT    SSPPP     + PPP  
Sbjct: 343 PPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPH 402

Query: 375 SAPPPVQQSSPPPVSSTPPP-----VQSSPPPAPVTPPP----ASPPP 491
           S PPP    SPPP   +PPP     +   PPP PV  PP     SPPP
Sbjct: 403 SPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPP 450

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/95 (48%), Positives = 48/95 (50%), Gaps = 6/95 (6%)
 Frame = +3

Query: 225 TSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSS 404
           +S    P  PT P   PP+ P   P P    PP   S PPP     PPV S PPP   S 
Sbjct: 221 SSFRCKPFVPTLPAPPPPSPPMPVPSPPVYLPPPVYSPPPP-----PPVYSPPPP-PPSP 274

Query: 405 PPPVSS---TPPPVQSSPPPAPV---TPPPASPPP 491
           PPPV S    PPPV S PPP PV    PPP SPPP
Sbjct: 275 PPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPP 309

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 39/90 (43%), Positives = 43/90 (47%), Gaps = 8/90 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPP-VQSAPPTAQSSPPPV--QASPPPVQSAPP 386
           PPS  P   P PP P     P  P  SPPP  Q  PP + S PPP     SPPP   +PP
Sbjct: 451 PPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPPPPSQSPP 510

Query: 387 PVQQSSPPPVSSTP-PPV----QSSPPPAP 461
           P     P PV   P PP+     +SPPP P
Sbjct: 511 P-----PAPVYEGPLPPITGVSYASPPPPP 535

[70][TOP]
>UniRef100_Q9S740 Lysine-rich arabinogalactan protein 19 n=1 Tax=Arabidopsis thaliana
           RepID=AGP19_ARATH
          Length = 222

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS-SPPPVQASPPPVQSAPPPV 392
           PP+ +P + PAP   P  +P T P   P P QS P +A + SPPPV  SPPP  ++PPP 
Sbjct: 74  PPAVTPTSPPAPKVAPVISPATPP---PQPPQSPPASAPTVSPPPV--SPPPAPTSPPPT 128

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
             +SPPP  ++PPP  +SPPPAPV+PPP   P
Sbjct: 129 P-ASPPPAPASPPPAPASPPPAPVSPPPVQAP 159

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = +3

Query: 219 PSTSPNASPA--PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           P  +P  SPA  PP PP + P + P  SPPPV  +PP A +SPPP  ASPPP  ++PPP 
Sbjct: 85  PKVAPVISPATPPPQPPQSPPASAPTVSPPPV--SPPPAPTSPPPTPASPPPAPASPPPA 142

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
             +SPPP   +PPPVQ+   P+P++ PPA  P
Sbjct: 143 -PASPPPAPVSPPPVQA---PSPISLPPAPAP 170

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 47/105 (44%), Positives = 60/105 (57%), Gaps = 6/105 (5%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPA-PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           +  A  P +T+P  S A PP  P   PP     SPP  + AP  + ++PPP     PP  
Sbjct: 48  TTAAPPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPAS 107

Query: 375 S---APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPP--PASPPPA 494
           +   +PPPV   SPPP  ++PPP  +SPPPAP +PP  PASPPPA
Sbjct: 108 APTVSPPPV---SPPPAPTSPPPTPASPPPAPASPPPAPASPPPA 149

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/105 (40%), Positives = 55/105 (52%), Gaps = 13/105 (12%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           QPP + P ++P    PP + PP     SPPP  ++PP A +SPPP  ASPPP   +PPPV
Sbjct: 99  QPPQSPPASAPTVSPPPVSPPPAP--TSPPPTPASPPPAPASPPPAPASPPPAPVSPPPV 156

Query: 393 QQSSPPPVSSTPPPVQS-------------SPPPAPVTPPPASPP 488
           Q  SP  +   P P  +             +P PAP+ P P SPP
Sbjct: 157 QAPSPISLPPAPAPAPTKHKRKHKHKRHHHAPAPAPIPPSPPSPP 201

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 57/135 (42%), Positives = 65/135 (48%), Gaps = 23/135 (17%)
 Frame = +3

Query: 159 IVLVVGLICAVFVSA-GAQQPPSTSPNASP-----APPT----PPTNTPPTTPQASPP-- 302
           ++L   LI +  V+A G    P TS   +P     APPT    PPT T P    A PP  
Sbjct: 10  LLLASALISSFSVNAQGPAASPVTSTTTAPPPTTAAPPTTAAPPPTTTTPPVSAAQPPAS 69

Query: 303 PVQSAPPTAQSSPP---------PVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPP 455
           PV   P    +SPP         P    P P QS P      SPPPVS  PPP  +SPPP
Sbjct: 70  PVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVS--PPPAPTSPPP 127

Query: 456 APVTPP--PASPPPA 494
            P +PP  PASPPPA
Sbjct: 128 TPASPPPAPASPPPA 142

[71][TOP]
>UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae
            RepID=UPI000186983E
          Length = 1411

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 41/92 (44%), Positives = 42/92 (45%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 876  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP +PPP
Sbjct: 936  PPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPP 967

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 42/105 (40%), Positives = 45/105 (42%)
 Frame = +3

Query: 177  LICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA 356
            ++C    +     PP   P   P PP PP   PP  P   PPP    PP     PPP   
Sbjct: 846  MVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905

Query: 357  SPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             PPP    PPP     PPP    PPP    PPP P  PPP  PPP
Sbjct: 906  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 41/94 (43%), Positives = 42/94 (44%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 871  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PPP    PPP    PPP P  PPP  PPP +
Sbjct: 931  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGA 964

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 860  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP  PPP
Sbjct: 920  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 861  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP  PPP
Sbjct: 921  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 862  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP  PPP
Sbjct: 922  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 863  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP  PPP
Sbjct: 923  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 864  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP  PPP
Sbjct: 924  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 865  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP  PPP
Sbjct: 925  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 866  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP  PPP
Sbjct: 926  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 867  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP  PPP
Sbjct: 927  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 868  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP  PPP
Sbjct: 928  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 869  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP  PPP
Sbjct: 929  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 870  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP  PPP
Sbjct: 930  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 42/92 (45%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 889  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP  + PPP P  PP A PPP
Sbjct: 949  PPPPPPPPPPPPPPGAPPPPPPALPPGAPPPP 980

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 40/92 (43%), Positives = 42/92 (45%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 888  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP   +PPP P   PP +PPP
Sbjct: 948  PPPPPPPPPPPPPPPGAPPPPPPALPPGAPPP 979

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 877  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PP A PPP
Sbjct: 937  PPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPP 968

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 42/93 (45%), Positives = 42/93 (45%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 884  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
               PPP    PPP    PP AP  PPPA PP A
Sbjct: 944  PPPPPPPPPPPPPPPPPPPGAPPPPPPALPPGA 976

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/123 (35%), Positives = 50/123 (40%)
 Frame = +3

Query: 123  QINQPTHKMGTHIVLVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPP 302
            + N   +K G   +   G+ C    S   +  P      +  PP PP   PP  P   PP
Sbjct: 813  EYNGQYYKDGEGFIRSDGVSCYCVGSDNYEPAPMVCEEPTTPPPPPPPPPPPPPPPPPPP 872

Query: 303  PVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPAS 482
            P    PP     PPP    PPP    PPP     PPP    PPP    PPP P  PPP  
Sbjct: 873  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932

Query: 483  PPP 491
            PPP
Sbjct: 933  PPP 935

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 40/92 (43%), Positives = 40/92 (43%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 875  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP    PPP    PPP P  PPP   PP
Sbjct: 935  PPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPP 966

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 42/93 (45%), Positives = 42/93 (45%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 881  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
               PPP    PPP    PPP P  PPP  PPPA
Sbjct: 941  PPPPPPPPPPPPPPPPPPPPPPGAPPP--PPPA 971

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 38/90 (42%), Positives = 39/90 (43%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 895  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
               PPP    PPP   + PP    PPPA P
Sbjct: 955  PPPPPPPPGAPPPPPPALPPGAPPPPPALP 984

[72][TOP]
>UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B541C
          Length = 661

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/94 (47%), Positives = 56/94 (59%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS++P+ SP+ P+PP + PP+TP   P    S PP++ S PPP    PPP +  PPP  
Sbjct: 451 PPSSTPSPSPSTPSPPPSRPPSTPSLPP----SRPPSSPSPPPPPPPPPPP-RPPPPPPP 505

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            S PPP S TPP   S P P P  PPP  PPP +
Sbjct: 506 PSQPPPTSLTPPVTYSYPSPPP--PPPPPPPPVT 537

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 42/101 (41%), Positives = 48/101 (47%), Gaps = 5/101 (4%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           ++ P S SP   P PP PP   PP  P + PPP    PP   S P P    PPP    PP
Sbjct: 479 SRPPSSPSPPPPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSP----PPPPPPPPP 534

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVT-----PPPASPPPA 494
           PV  + P     +PPP    PP  PVT     PPP  PPP+
Sbjct: 535 PVTYNYP-----SPPP----PPSLPVTYNYPSPPPPPPPPS 566

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 40/100 (40%), Positives = 50/100 (50%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           ++ +Q  PS + N  P+P TP      +TP   P P  S P  + S+P P  + PP   S
Sbjct: 417 TSSSQPIPSVTYNY-PSPSTPLPLPSTSTPSPPPSPPSSTPSPSPSTPSPPPSRPPSTPS 475

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            PP    SSP P    PPP    PPP P  PPP+ PPP S
Sbjct: 476 LPPSRPPSSPSPPPPPPPPPPPRPPPPP--PPPSQPPPTS 513

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 41/102 (40%), Positives = 52/102 (50%), Gaps = 9/102 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAP--------PTPPTNTP-PTTPQASPPPVQSAPPTAQSSPPPVQASPPP 368
           P  ++P +S  P        P+P T  P P+T   SPPP   +PP++  SP P   SPPP
Sbjct: 411 PDYSTPTSSSQPIPSVTYNYPSPSTPLPLPSTSTPSPPP---SPPSSTPSPSPSTPSPPP 467

Query: 369 VQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            +    P    S PP S +PPP    PPP P  PPP  PPP+
Sbjct: 468 SRPPSTPSLPPSRPPSSPSPPP--PPPPPPPPRPPPPPPPPS 507

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 35/94 (37%), Positives = 37/94 (39%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP T    SP PP PP   P T    SPPP  S P T     PP    PP      P   
Sbjct: 516 PPVTYSYPSPPPPPPPPPPPVTYNYPSPPPPPSLPVTYNYPSPPPPPPPPSYNYPAPTYY 575

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SP P    PPP      P P+  P   PP A+
Sbjct: 576 YPSPSPRPPPPPPRPRPSRPRPIITPKPIPPRAT 609

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 41/104 (39%), Positives = 45/104 (43%), Gaps = 12/104 (11%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPT--TPQAS------PPPVQSAPPTAQSSPPPVQASPPPV 371
           PP   P   P PP PP+  PPT  TP  +      PPP    PP    + P    SPPP 
Sbjct: 491 PPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPPVTYNYP----SPPPP 546

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPV----TPPPASPPP 491
            S P      SPPP    PPP  S   PAP     +P P  PPP
Sbjct: 547 PSLPVTYNYPSPPP----PPPPPSYNYPAPTYYYPSPSPRPPPP 586

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 34/102 (33%), Positives = 44/102 (43%), Gaps = 11/102 (10%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ-------- 374
           PSTS +   + PT  +   P+     P P    P  + S+P     SPPP          
Sbjct: 405 PSTSISPDYSTPTSSSQPIPSVTYNYPSPSTPLPLPSTSTP-----SPPPSPPSSTPSPS 459

Query: 375 ---SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               +PPP +  S P +  + PP   SPPP P  PPP  PPP
Sbjct: 460 PSTPSPPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPP 501

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 34/98 (34%), Positives = 41/98 (41%), Gaps = 7/98 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT--PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPV----QS 377
           PP T    SP PP   P T   P+ P   PPP  + P      P P    PPP      S
Sbjct: 534 PPVTYNYPSPPPPPSLPVTYNYPSPPPPPPPPSYNYPAPTYYYPSPSPRPPPPPPRPRPS 593

Query: 378 APPPVQQSSP-PPVSSTPPPVQSSPPPAPVTPPPASPP 488
            P P+    P PP ++  PP + +P P    PPP   P
Sbjct: 594 RPRPIITPKPIPPRATYLPPPRLTPQPRTYLPPPTPTP 631

[73][TOP]
>UniRef100_A1KR25 Cell wall glycoprotein GP2 (Fragment) n=2 Tax=Chlamydomonas
            reinhardtii RepID=A1KR25_CHLRE
          Length = 1226

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 42/86 (48%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = +3

Query: 243  PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVS- 419
            P PP+PP  TPP+ P  SPPP   +PP +   P P   +PPP    PP     SPPP S 
Sbjct: 949  PLPPSPPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSP 1008

Query: 420  --STPPPVQSSPPPAPVTPPPASPPP 491
               +PPP  +SPPP+P  PPP SPPP
Sbjct: 1009 PPPSPPPAAASPPPSPPPPPPPSPPP 1034

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 44/92 (47%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PP  SP  SP PP+PP   PP  P + PPPV   P     SPPP   SPPP  ++PPP  
Sbjct: 969  PPVLSPPPSPPPPSPPPPAPP--PPSPPPPVPPPPSPPPPSPPP--PSPPPAAASPPP-- 1022

Query: 396  QSSPPPVSSTPPPVQSSP--PPAPVTPPPASP 485
               PPP  S PPPV   P  PP PV   P +P
Sbjct: 1023 SPPPPPPPSPPPPVARLPPWPPLPVNNVPPAP 1054

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 38/83 (45%), Positives = 42/83 (50%), Gaps = 4/83 (4%)
 Frame = +3

Query: 261  PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVS----STP 428
            PTN          P   S PP    SPPP  + PPPV S PP     SPPP +    S P
Sbjct: 936  PTNPAVAVLDLCCPLPPSPPPPTPPSPPP-PSPPPPVLSPPPSPPPPSPPPPAPPPPSPP 994

Query: 429  PPVQSSPPPAPVTPPPASPPPAS 497
            PPV   P P P +PPP SPPPA+
Sbjct: 995  PPVPPPPSPPPPSPPPPSPPPAA 1017

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 40/95 (42%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PP   P  SP PP PP  +PP  + P  SPPP  ++PP    SPPP    PP   S PPP
Sbjct: 984  PPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPP---SPPPPP--PP---SPPPP 1035

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            V +  P P    P PV ++ PPAP         PA
Sbjct: 1036 VARLPPWP----PLPV-NNVPPAPTARNTTWTAPA 1065

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 35/81 (43%), Positives = 40/81 (49%), Gaps = 1/81 (1%)
 Frame = +3

Query: 255 TPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPP 431
           TPP    P+T    SPPP  S PP+     PP   SPPPV  +PP     SPPP      
Sbjct: 564 TPPDLMQPSTSCPLSPPPSPSPPPS-----PPQPPSPPPVPPSPP-----SPPP------ 607

Query: 432 PVQSSPPPAPVTPPPASPPPA 494
              S P PA  +PPP +PP A
Sbjct: 608 ---SPPSPANPSPPPPAPPAA 625

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 31/69 (44%), Positives = 36/69 (52%), Gaps = 1/69 (1%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP-PVQAS 359
           CA  ++      PSTS   SP P   P  +PP  P  SPPPV  +PP+   SPP P   S
Sbjct: 559 CATILTPPDLMQPSTSCPLSPPPSPSPPPSPPQPP--SPPPVPPSPPSPPPSPPSPANPS 616

Query: 360 PPPVQSAPP 386
           PPP   APP
Sbjct: 617 PPP--PAPP 623

[74][TOP]
>UniRef100_UPI0001982E1E PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982E1E
          Length = 664

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 51/106 (48%), Positives = 60/106 (56%), Gaps = 13/106 (12%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPP---TNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           P  SP+ASP PP  P   ++  P  P + PPP  S PP + SSPPP  ASPPP  S PPP
Sbjct: 9   PPDSPSASPPPPPSPDSSSSASPPPPSSPPPPDSSPPPPSSSSPPPPLASPPP--SPPPP 66

Query: 390 VQQSSPPPVSSTPPPVQSS-----PPPA-----PVTPPPASPPPAS 497
              + PP  SS PPP Q+S     PPP+     P T PP  PPP+S
Sbjct: 67  PPGAPPPKNSSPPPPPQNSKSPPPPPPSKNTSGPATSPPPPPPPSS 112

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 47/110 (42%), Positives = 60/110 (54%), Gaps = 10/110 (9%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQ-----ASP 362
           S  A  PP  SP++S +   PP ++PP    + PPP  S+PP   +SPPP        +P
Sbjct: 12  SPSASPPPPPSPDSSSSASPPPPSSPPPPDSSPPPPSSSSPPPPLASPPPSPPPPPPGAP 71

Query: 363 PPVQSAPPPVQQSS-----PPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PP  S+PPP  Q+S     PPP  +T  P  S PPP    PPP+SPPP S
Sbjct: 72  PPKNSSPPPPPQNSKSPPPPPPSKNTSGPATSPPPP----PPPSSPPPPS 117

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 42/79 (53%), Positives = 51/79 (64%), Gaps = 2/79 (2%)
 Frame = +3

Query: 261 PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQ 440
           P   PP +P ASPPP  S   ++ +SPPP  +SPPP  S+PPP   SSPPP  ++PPP  
Sbjct: 5   PVGAPPDSPSASPPPPPSPDSSSSASPPP-PSSPPPPDSSPPPPSSSSPPPPLASPPP-- 61

Query: 441 SSPPPAPVTPPP--ASPPP 491
           S PPP P  PPP  +SPPP
Sbjct: 62  SPPPPPPGAPPPKNSSPPP 80

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/90 (47%), Positives = 48/90 (53%), Gaps = 6/90 (6%)
 Frame = +3

Query: 246 APPTPPTNTPPTTP------QASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSP 407
           APP  P+ +PP  P       ASPPP  S PP   S PPP  +SPPP  ++PPP   S P
Sbjct: 8   APPDSPSASPPPPPSPDSSSSASPPPPSSPPPPDSSPPPPSSSSPPPPLASPPP---SPP 64

Query: 408 PPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PP    PPP  SSPPP P       PPP S
Sbjct: 65  PPPPGAPPPKNSSPPPPPQNSKSPPPPPPS 94

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 42/102 (41%), Positives = 52/102 (50%), Gaps = 4/102 (3%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQS--APPTAQSSPPPVQASPPPV 371
           S+ +  PP  SP   P+PP PP   PP    + PPP Q+  +PP     PPP + +  P 
Sbjct: 48  SSSSPPPPLASP--PPSPPPPPPGAPPPKNSSPPPPPQNSKSPP----PPPPSKNTSGPA 101

Query: 372 QSAPPPVQQSSPPPVSS--TPPPVQSSPPPAPVTPPPASPPP 491
            S PPP   SSPPP SS   PPP +SS  P       + PPP
Sbjct: 102 TSPPPPPPPSSPPPPSSNFVPPPPRSSLSPPHAATRKSPPPP 143

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 49/142 (34%), Positives = 59/142 (41%), Gaps = 42/142 (29%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP--- 368
           S+ A  PP +SP    + P PP+++ P  P ASPPP  S PP    +PPP  +SPPP   
Sbjct: 26  SSSASPPPPSSPPPPDSSPPPPSSSSPPPPLASPPP--SPPPPPPGAPPPKNSSPPPPPQ 83

Query: 369 -----------------VQSAPPPVQQSSPPPVSS--------------------TPPPV 437
                              S PPP   SSPPP SS                    +PPP 
Sbjct: 84  NSKSPPPPPPSKNTSGPATSPPPPPPPSSPPPPSSNFVPPPPRSSLSPPHAATRKSPPPP 143

Query: 438 QSSPPP--APVTPPPASPPPAS 497
             S P      TPP   PPP+S
Sbjct: 144 HKSWPSNHGKSTPP---PPPSS 162

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 38/106 (35%), Positives = 51/106 (48%), Gaps = 8/106 (7%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPA---PPTPP-----TNTPPTTPQASPPPVQSAPPTAQSSPPPVQAS 359
           GA  P ++SP   P     P PP     T+ P T+P   PPP    PP++   PPP ++S
Sbjct: 69  GAPPPKNSSPPPPPQNSKSPPPPPPSKNTSGPATSPPPPPPPSSPPPPSSNFVPPPPRSS 128

Query: 360 PPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             P  +A    ++S PPP  S P     S PP    PPP+S   +S
Sbjct: 129 LSPPHAA---TRKSPPPPHKSWPSNHGKSTPP----PPPSSSSSSS 167

[75][TOP]
>UniRef100_C4IYP5 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C4IYP5_MAIZE
          Length = 441

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 50/103 (48%), Positives = 57/103 (55%), Gaps = 10/103 (9%)
 Frame = +3

Query: 216 PPSTSPNA-SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP------VQASPPPVQ 374
           PPS  P   SP PP+PP  +PP  P   PPP   +PP   SSPPP        + PPP+ 
Sbjct: 266 PPSPPPPLMSPPPPSPPPPSPPPPPLLPPPPQPHSPPPPLSSPPPPPPLPQPHSPPPPLS 325

Query: 375 SAPPP---VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           S PPP    Q  SPPP  S+PPP    PPP P +PPP SP PA
Sbjct: 326 SPPPPPPLPQPHSPPPPLSSPPP----PPPLPHSPPPPSPAPA 364

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 45/99 (45%), Positives = 52/99 (52%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTA---QSSPPPVQASPPPVQSAPP 386
           PP   P     PP+PP  +PP  P + PPP+ S PP +    S PPP    PPP   +PP
Sbjct: 245 PPMPPPRLPSPPPSPPPPSPP--PPSPPPPLMSPPPPSPPPPSPPPPPLLPPPPQPHSPP 302

Query: 387 PVQQSSPP----PVSSTPPPVQSSPPPAPVTPPPASPPP 491
           P   S PP    P   +PPP  SSPPP P  P P SPPP
Sbjct: 303 PPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPQPHSPPP 341

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 43/87 (49%), Positives = 47/87 (54%)
 Frame = +3

Query: 231 PNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPP 410
           P   P PP    + PP+ P  SPPP  S PP   S PPP   SPPP    PPP+    PP
Sbjct: 242 PFVPPMPPPRLPSPPPSPPPPSPPP-PSPPPPLMSPPPP---SPPPPSPPPPPLLP--PP 295

Query: 411 PVSSTPPPVQSSPPPAPVTPPPASPPP 491
           P   +PPP  SSPPP P  P P SPPP
Sbjct: 296 PQPHSPPPPLSSPPPPPPLPQPHSPPP 322

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 44/110 (40%), Positives = 49/110 (44%), Gaps = 18/110 (16%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTA-----QSSPPPVQASPPPV--- 371
           PPS  P   P+PP PP   PP  P + PPP+ S PP        S PPP+ + PPP    
Sbjct: 278 PPSPPP---PSPPPPPLLPPPPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLP 334

Query: 372 ----------QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                        PPP    SPPP S  P PV   PPP    P P  PPP
Sbjct: 335 QPHSPPPPLSSPPPPPPLPHSPPPPSPAPAPVYHPPPPPQCPPCPVLPPP 384

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 42/96 (43%), Positives = 46/96 (47%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQA----SPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP   P   P  P PP ++PP  P      SPPP  S+PP     PPP+  SPPP   AP
Sbjct: 308 PPPPPPLPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPP----PPPLPHSPPPPSPAP 363

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PV    PPP     PP    PPP P TP    PPP
Sbjct: 364 APVYHPPPPPQC---PPCPVLPPPLPCTPTHPWPPP 396

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 41/99 (41%), Positives = 48/99 (48%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP +SP   P  P P +  PP +    PPP+  +PP    +P PV   PPP Q  P PV 
Sbjct: 322 PPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPHSPPPPSPAPAPVYHPPPPPQCPPCPV- 380

Query: 396 QSSPPPVSST-----PPPVQSSPPPAPVTPPP--ASPPP 491
              PPP+  T     PPP    P P P T P   ASPPP
Sbjct: 381 --LPPPLPCTPTHPWPPPPPYYPGPFPPTDPVRYASPPP 417

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 38/85 (44%), Positives = 45/85 (52%), Gaps = 7/85 (8%)
 Frame = +3

Query: 258 PPTNTP-----PTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSS 422
           PP N       P  P   PP + S PP+     PP  + PPP+ S PPP    SPPP S 
Sbjct: 231 PPVNCAAFHCKPFVPPMPPPRLPSPPPSPPPPSPPPPSPPPPLMSPPPP----SPPPPSP 286

Query: 423 TPPPVQSSPPPAPVTPPP--ASPPP 491
            PPP+   PPP P +PPP  +SPPP
Sbjct: 287 PPPPLLP-PPPQPHSPPPPLSSPPP 310

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 40/102 (39%), Positives = 46/102 (45%), Gaps = 5/102 (4%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTPPTNTPPTTPQA-SPPPVQSAP----PTAQSSPPPVQASPP 365
           A A+  P  S  ++  P  P   TP       + PPV  A     P     PPP   SPP
Sbjct: 197 ACARVVPRDSDRSNCLPNRPAQRTPQQCAAFYARPPVNCAAFHCKPFVPPMPPPRLPSPP 256

Query: 366 PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           P    P P   S PPP+ S PPP  S PPP+P  PP   PPP
Sbjct: 257 PSPPPPSPPPPSPPPPLMSPPPP--SPPPPSPPPPPLLPPPP 296

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 38/103 (36%), Positives = 43/103 (41%), Gaps = 10/103 (9%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSS-----PPPVQASPPPVQS 377
           QP S  P  S  PP PP    P  P  +P PV   PP  Q       PPP+  +P     
Sbjct: 335 QPHSPPPPLSSPPPPPPLPHSPPPPSPAPAPVYHPPPPPQCPPCPVLPPPLPCTPTHPWP 394

Query: 378 APPPVQQSSPPPVS----STPPPVQSSPPPAPVTPPP-ASPPP 491
            PPP      PP      ++PPP Q   P  PV P    SPPP
Sbjct: 395 PPPPYYPGPFPPTDPVRYASPPPPQQHHPWPPVYPVQYGSPPP 437

[76][TOP]
>UniRef100_UPI00019841A9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019841A9
          Length = 525

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 49/88 (55%), Positives = 53/88 (60%), Gaps = 4/88 (4%)
 Frame = +3

Query: 240 SPAPPTPPT-NTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPV 416
           +P PP+PP   +PP TP  SPPPV S PP   SSPPP   SPPP   +PPP    SPPP 
Sbjct: 409 TPPPPSPPVFPSPPPTPVYSPPPVFSPPPPVLSSPPP--PSPPPPSPSPPPPPVYSPPP- 465

Query: 417 SSTPPPVQSSPPPAPVTPPP---ASPPP 491
              PPPV S PPP P  PPP    SPPP
Sbjct: 466 ---PPPVYSPPPPPPPPPPPPPVXSPPP 490

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 48/91 (52%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = +3

Query: 225 TSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSS 404
           +S   SP  P+ PT  PP     SPP   S PPT   SPPPV + PPPV S+PPP    S
Sbjct: 396 SSFRCSPFVPSLPTPPPP-----SPPVFPSPPPTPVYSPPPVFSPPPPVLSSPPP---PS 447

Query: 405 PPPVSST--PPPVQSSPPPAPVTPPPASPPP 491
           PPP S +  PPPV S PPP PV  PP  PPP
Sbjct: 448 PPPPSPSPPPPPVYSPPPPPPVYSPPPPPPP 478

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 48/108 (44%), Positives = 54/108 (50%), Gaps = 5/108 (4%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP 362
           C+ FV +    PP  SP   P+PP  P  +PP    + PPPV S+PP     PP     P
Sbjct: 400 CSPFVPS-LPTPPPPSPPVFPSPPPTPVYSPPPV-FSPPPPVLSSPPPPSPPPPSPSPPP 457

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP-----ASPPP 491
           PPV S PP      PPPV S PPP    PPP PV  PP      SPPP
Sbjct: 458 PPVYSPPP------PPPVYSPPPPPPPPPPPPPVXSPPPPIIYESPPP 499

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 47/109 (43%), Positives = 50/109 (45%), Gaps = 8/109 (7%)
 Frame = +3

Query: 189 VFVSAGAQQPPSTSPNASPAPPT----PPTNTPPTTPQASPPPVQSAPPT--AQSSPPPV 350
           VF S       S  P  SP PP     PP + PP +P   PPPV S PP     S PPP 
Sbjct: 417 VFPSPPPTPVYSPPPVFSPPPPVLSSPPPPSPPPPSPSPPPPPVYSPPPPPPVYSPPPPP 476

Query: 351 Q--ASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                PPPV S PPP+   SPPP    P PV   P P       ASPPP
Sbjct: 477 PPPPPPPPVXSPPPPIIYESPPP----PTPVYEGPLPPIFGVSYASPPP 521

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 29/58 (50%), Positives = 34/58 (58%)
 Frame = +3

Query: 321 PTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           P+  + PPP     PPV  +PPP    SPPPV S PPPV SSPPP      P+ PPP+
Sbjct: 405 PSLPTPPPP----SPPVFPSPPPTPVYSPPPVFSPPPPVLSSPPP------PSPPPPS 452

[77][TOP]
>UniRef100_B9SMV7 Vegetative cell wall protein gp1, putative n=1 Tax=Ricinus communis
           RepID=B9SMV7_RICCO
          Length = 479

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 49/102 (48%), Positives = 58/102 (56%), Gaps = 8/102 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAP-PTPPTNTPPTTPQASPPPV----QSAPPTAQSSPPPVQASPPPVQSA 380
           P + +P  SP P   PP + PP  P  SPPP+       PP  Q SPPP+  SPPP+ ++
Sbjct: 121 PFNPTPRPSPPPRRRPPPSPPPIVP--SPPPIPLVPSPPPPIVQPSPPPIIPSPPPLVTS 178

Query: 381 PPPVQQSSPPP---VSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PPPV   SPPP   V S PPP    P P P +PPP SPPP S
Sbjct: 179 PPPVTVPSPPPPVIVPSPPPPSPPPPCPPPPSPPPPSPPPPS 220

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 47/94 (50%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP--VQSAPPP 389
           PP   P  SP P  P     P  P   PP VQ +PP    SPPP+  SPPP  V S PPP
Sbjct: 131 PPRRRPPPSPPPIVPSPPPIPLVPSPPPPIVQPSPPPIIPSPPPLVTSPPPVTVPSPPPP 190

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           V   SPPP  S PPP    P P P +PPP SPPP
Sbjct: 191 VIVPSPPP-PSPPPPCPPPPSPPPPSPPPPSPPP 223

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 46/97 (47%), Positives = 55/97 (56%), Gaps = 14/97 (14%)
 Frame = +3

Query: 243 PAPPTP-PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP---VQSAPPPVQQSSPP 410
           P P  P P N    TP+ SPPP +  PP    SPPP+  SPPP   V S PPP+ Q SPP
Sbjct: 111 PFPTYPSPDNPFNPTPRPSPPPRRRPPP----SPPPIVPSPPPIPLVPSPPPPIVQPSPP 166

Query: 411 PVSSTPPPVQSSPPPAPV----------TPPPASPPP 491
           P+  +PPP+ +SPPP  V          +PPP SPPP
Sbjct: 167 PIIPSPPPLVTSPPPVTVPSPPPPVIVPSPPPPSPPP 203

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 43/111 (38%), Positives = 52/111 (46%), Gaps = 17/111 (15%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPT--NTPPTTPQASPPPVQSAPPTAQSSPPPVQA--------- 356
           ++PP + P   P+PP  P   + PP   Q SPPP+  +PP   +SPPPV           
Sbjct: 134 RRPPPSPPPIVPSPPPIPLVPSPPPPIVQPSPPPIIPSPPPLVTSPPPVTVPSPPPPVIV 193

Query: 357 ------SPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                 SPPP    PP     SPPP S  PPP+  SPPP      P  PPP
Sbjct: 194 PSPPPPSPPPPCPPPPSPPPPSPPPPSPPPPPLVPSPPPPLFPSTPEIPPP 244

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 43/100 (43%), Positives = 50/100 (50%), Gaps = 7/100 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT-PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP T P  SP PP   P+  PP+ P   PPP    PP   S PPP    PP V S PPP+
Sbjct: 180 PPVTVP--SPPPPVIVPSPPPPSPPPPCPPPPSPPPP---SPPPPSPPPPPLVPSPPPPL 234

Query: 393 QQSS---PPPVSSTPPPVQSSPPPAPVTP---PPASPPPA 494
             S+   PPP+    PP+  SPPP  + P   PP    PA
Sbjct: 235 FPSTPEIPPPIIFPAPPLVPSPPPPEIIPWLSPPDGYLPA 274

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 41/105 (39%), Positives = 48/105 (45%), Gaps = 7/105 (6%)
 Frame = +3

Query: 195 VSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           V+  +  PP   P+  P  P PP   PP+ P  SPPP    PP    SPPP     P   
Sbjct: 182 VTVPSPPPPVIVPSPPPPSPPPPCPPPPSPPPPSPPPPSPPPPPLVPSPPPPLF--PSTP 239

Query: 375 SAPPPVQQSSPPPVSSTPPP---VQSSPP----PAPVTPPPASPP 488
             PPP+   +PP V S PPP      SPP    PAP   P  +PP
Sbjct: 240 EIPPPIIFPAPPLVPSPPPPEIIPWLSPPDGYLPAPTLVPIFTPP 284

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 43/117 (36%), Positives = 51/117 (43%), Gaps = 24/117 (20%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQAS----------------PPPVQSAPPTAQSSPP 344
           QP        PAPP  P   PPT P  +                PPP Q  PP  + +P 
Sbjct: 286 QPDDPPDQFIPAPPFVPIFFPPTEPDPAPGDQFTPAPPLVPIFYPPPQQDLPPADEFTPA 345

Query: 345 P--VQASPPPVQSAPPPVQQSSP----PPVSSTPPPVQSSPP--PAPVTPPPASPPP 491
           P  V    PP Q   PP  + +P    PPV S+PPPVQ  PP  P  ++PPP   PP
Sbjct: 346 PPLVPIFDPPPQQDLPPADEFTPTPFLPPVVSSPPPVQDLPPLFPINLSPPPDDQPP 402

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 40/112 (35%), Positives = 48/112 (42%), Gaps = 19/112 (16%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP-- 389
           PP   P  SP PP+PP  +PP  P    PP    P T +  PP +  +PP V S PPP  
Sbjct: 202 PPPCPPPPSPPPPSPPPPSPPPPPLVPSPPPPLFPSTPEIPPPIIFPAPPLVPSPPPPEI 261

Query: 390 VQQSSP---------------PPVSSTPPPVQ--SSPPPAPVTPPPASPPPA 494
           +   SP               PP     PP Q   +PP  P+  PP  P PA
Sbjct: 262 IPWLSPPDGYLPAPTLVPIFTPPTQPDDPPDQFIPAPPFVPIFFPPTEPDPA 313

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 40/113 (35%), Positives = 46/113 (40%), Gaps = 23/113 (20%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPP----------------TNTPPTTPQASPPPVQSAPPTAQSSP--- 341
           P+     +PAPP  P                T  PP  P   PPP Q  PP  + +P   
Sbjct: 312 PAPGDQFTPAPPLVPIFYPPPQQDLPPADEFTPAPPLVPIFDPPPQQDLPPADEFTPTPF 371

Query: 342 -PPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAP---VTPPPASPP 488
            PPV +SPPPVQ  PP    +  PP    PP     PP  P    TPP  S P
Sbjct: 372 LPPVVSSPPPVQDLPPLFPINLSPPPDDQPPQFPFLPPEQPPFTFTPPVVSTP 424

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 40/107 (37%), Positives = 46/107 (42%), Gaps = 15/107 (14%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT-----AQSSPPPVQASPP--P 368
           QQ    +   +PAPP  P   PP  PQ   PP     PT       SSPPPVQ  PP  P
Sbjct: 333 QQDLPPADEFTPAPPLVPIFDPP--PQQDLPPADEFTPTPFLPPVVSSPPPVQDLPPLFP 390

Query: 369 VQSAPPPVQQ--------SSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
           +  +PPP  Q           PP + TPP V +   P    PPP  P
Sbjct: 391 INLSPPPDDQPPQFPFLPPEQPPFTFTPPVVSTPTVPDLFLPPPLVP 437

[78][TOP]
>UniRef100_A8MQW1 Uncharacterized protein At1g44191.1 n=1 Tax=Arabidopsis thaliana
           RepID=A8MQW1_ARATH
          Length = 359

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 47/100 (47%), Positives = 59/100 (59%), Gaps = 4/100 (4%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPP-PVQSAPPTAQSSPPPV--QASPPPVQSA 380
           + PPS  P  SP P TP  + PP  P + PP P +S PP   SSPPP   ++ PPP  S+
Sbjct: 99  KSPPSPKP--SPPPRTPKKSPPPPKPSSPPPIPKKSPPPPKPSSPPPTPKKSPPPPKPSS 156

Query: 381 PPPVQQSSPPPVSSTP-PPVQSSPPPAPVTPPPASPPPAS 497
           PPP  + SPPP   +P PP  S+PPP P   PP+ P P+S
Sbjct: 157 PPPSPKKSPPPPKPSPSPPKPSTPPPTPKKSPPSPPKPSS 196

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 46/97 (47%), Positives = 59/97 (60%), Gaps = 4/97 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQ--SAPPTAQSSPPPVQAS--PPPVQSAP 383
           PP  +P  SP PP P  ++PP  P+ SPPP +  S PPT + SPPP + S  PP  + +P
Sbjct: 108 PPPRTPKKSPPPPKP--SSPPPIPKKSPPPPKPSSPPPTPKKSPPPPKPSSPPPSPKKSP 165

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PP + S  PP  STPPP     PP+P  P P+SPPP+
Sbjct: 166 PPPKPSPSPPKPSTPPPTPKKSPPSP--PKPSSPPPS 200

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 50/116 (43%), Positives = 62/116 (53%), Gaps = 22/116 (18%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQ--SAPPTAQSSPPPVQASP-P 365
           + PP   P++ P     +PP P  ++PP TP+ SPPP +  S PP+ + SPPP + SP P
Sbjct: 115 KSPPPPKPSSPPPIPKKSPPPPKPSSPPPTPKKSPPPPKPSSPPPSPKKSPPPPKPSPSP 174

Query: 366 PVQSAPPPVQQSSPP-----------PVSSTPPPVQSSPPPAPVTPPPA---SPPP 491
           P  S PPP  + SPP           P  S PPP  S  PP P TPPP    SPPP
Sbjct: 175 PKPSTPPPTPKKSPPSPPKPSSPPPSPKKSPPPPKPSPSPPKPSTPPPTPKKSPPP 230

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 45/106 (42%), Positives = 60/106 (56%), Gaps = 7/106 (6%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPV---QSAPPTAQSSPPPVQASP-P 365
           S+    P  + P   P+P  P  +TPP TP+ SPP      S PP+ + SPPP + SP P
Sbjct: 155 SSPPPSPKKSPPPPKPSPSPPKPSTPPPTPKKSPPSPPKPSSPPPSPKKSPPPPKPSPSP 214

Query: 366 PVQSAPPPVQQSSPPPVSSTPPPVQSSPP---PAPVTPPPASPPPA 494
           P  S PPP  + SPPP   + PP + SPP   P+P TP P++ PP+
Sbjct: 215 PKPSTPPPTPKKSPPPPKPSQPPPKPSPPRRKPSPPTPKPSTTPPS 260

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 47/100 (47%), Positives = 61/100 (61%), Gaps = 8/100 (8%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTP-PTTPQASPPPVQSAPPTA---QSSPPPVQASPPPV-QSAP 383
           PS     SP PPTP +  P P +P+ SPP  + +PP     +S PPP  +SPPP+ + +P
Sbjct: 74  PSPPHPPSPKPPTPSSRPPSPLSPKKSPPSPKPSPPPRTPKKSPPPPKPSSPPPIPKKSP 133

Query: 384 PPVQQSSPPPV--SSTPPPVQSSPPPAP-VTPPPASPPPA 494
           PP + SSPPP    S PPP  SSPPP+P  +PPP  P P+
Sbjct: 134 PPPKPSSPPPTPKKSPPPPKPSSPPPSPKKSPPPPKPSPS 173

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 45/99 (45%), Positives = 55/99 (55%), Gaps = 5/99 (5%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP--PVQASPPP-VQSA 380
           + PP   P  S  PP+P  + PP  P  SPP   + PPT + SPP  P  +SPPP  + +
Sbjct: 147 KSPPPPKP--SSPPPSPKKSPPPPKPSPSPPKPSTPPPTPKKSPPSPPKPSSPPPSPKKS 204

Query: 381 PPPVQQSSPPPVSSTPPPV--QSSPPPAPVTPPPASPPP 491
           PPP + S  PP  STPPP   +S PPP P  PPP   PP
Sbjct: 205 PPPPKPSPSPPKPSTPPPTPKKSPPPPKPSQPPPKPSPP 243

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 39/99 (39%), Positives = 52/99 (52%), Gaps = 4/99 (4%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           ++ P + P  S  PP+P  + PP  P  SPP   + PPT + SPPP + S PP + +PP 
Sbjct: 185 KKSPPSPPKPSSPPPSPKKSPPPPKPSPSPPKPSTPPPTPKKSPPPPKPSQPPPKPSPPR 244

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPV----TPPPASPPPA 494
            + S P P  ST PP     PP P      PPP +P P+
Sbjct: 245 RKPSPPTPKPSTTPPSPKPSPPRPTPKKSPPPPTTPSPS 283

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 39/99 (39%), Positives = 49/99 (49%), Gaps = 1/99 (1%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP-PVQ 374
           S+    P  + P   P+P  P  +TPP TP+ SPPP + + P  + SPP  + SPP P  
Sbjct: 195 SSPPPSPKKSPPPPKPSPSPPKPSTPPPTPKKSPPPPKPSQPPPKPSPPRRKPSPPTPKP 254

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           S  PP    SP P  S P P     PP P TP P+   P
Sbjct: 255 STTPP----SPKP--SPPRPTPKKSPPPPTTPSPSYQDP 287

[79][TOP]
>UniRef100_A4S1Y9 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901
           RepID=A4S1Y9_OSTLU
          Length = 1065

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/104 (46%), Positives = 60/104 (57%), Gaps = 1/104 (0%)
 Frame = +3

Query: 186 AVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPP-PVQSAPPTAQSSPPPVQASP 362
           A  ++A     P+ +P  SP PP+PP + PP+ P + PP P  S PP+   SPPP   SP
Sbjct: 462 AAALAAAPTPTPTPTPTPSP-PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP---SP 517

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PP   +PPP    SPPP  S PP    SPPP+P   PP SPPP+
Sbjct: 518 PPSPPSPPPSPPPSPPP--SPPPSPPPSPPPSPPPSPPPSPPPS 559

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 46/92 (50%), Positives = 54/92 (58%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           PS  P+  P+PP  P  +PP +P  SPPP  S PP+   SPPP   SPPP   +PPP   
Sbjct: 479 PSPPPSPPPSPPPSPPPSPPPSPPPSPPP--SPPPSPPPSPPPSPPSPPP---SPPPSPP 533

Query: 399 SSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            SPPP  S PP    SPPP+P   PP SPPP+
Sbjct: 534 PSPPP--SPPPSPPPSPPPSPPPSPPPSPPPS 563

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 46/93 (49%), Positives = 54/93 (58%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P+  P+PP  P  +PP +P  SPPP  S PP+   SPP    SPPP   +PPP  
Sbjct: 482 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPP--SPPPSPPPSPPSPPPSPPP---SPPPSP 536

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
             SPPP  S PP    SPPP+P   PP SPPP+
Sbjct: 537 PPSPPP--SPPPSPPPSPPPSPPPSPPPSPPPS 567

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 46/93 (49%), Positives = 54/93 (58%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P+  P+PP  P  +PP +P  SPPP  S PP+  S PP    SPPP   +PPP  
Sbjct: 486 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPP--SPPPSPPSPPPSPPPSPPP---SPPPSP 540

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
             SPPP  S PP    SPPP+P   PP SPPP+
Sbjct: 541 PPSPPP--SPPPSPPPSPPPSPPPSPPPSPPPS 571

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 47/93 (50%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PPS  P+  P+PP  P  +PP +P  SPPP   S PP+   SPPP   SPPP   +PPP 
Sbjct: 490 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPP---SPPP---SPPPS 543

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              SPPP  S PP    SPPP+P   PP SPPP
Sbjct: 544 PPPSPPP--SPPPSPPPSPPPSPPPSPPPSPPP 574

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 44/89 (49%), Positives = 52/89 (58%)
 Frame = +3

Query: 228 SPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSP 407
           +PNA+ A    PT TP  TP  SPPP  S PP+   SPPP  + PP    +PPP    SP
Sbjct: 458 APNAAAALAAAPTPTPTPTPTPSPPP--SPPPSPPPSPPP--SPPPSPPPSPPPSPPPSP 513

Query: 408 PPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PP   +PPP   SPPP+P   PP SPPP+
Sbjct: 514 PP---SPPPSPPSPPPSPPPSPPPSPPPS 539

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 44/90 (48%), Positives = 53/90 (58%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P+  P+PP+PP + PP     SPPP  S PP+   SPPP   SPPP   +PPP  
Sbjct: 510 PPSPPPSPPPSPPSPPPSPPP-----SPPP--SPPPSPPPSPPP---SPPP---SPPPSP 556

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
             SPPP   +PPP   SPPP+P  PP  +P
Sbjct: 557 PPSPPP---SPPP---SPPPSPPPPPHFAP 580

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 30/66 (45%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQ-ASPPPVQSAPPPV 392
           PPS  P+  P+PP  P  +PP +P  SPPP  S PP+   SPPP    SPPP     P V
Sbjct: 525 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPP--SPPPSPPPSPPPSPPPSPPPPPHFAPFV 582

Query: 393 QQSSPP 410
             +S P
Sbjct: 583 PLASVP 588

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 30/71 (42%), Positives = 37/71 (52%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P+  P+PP  P  +PP +P  SPPP          SPPP   SPPP  S PPP  
Sbjct: 533 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPP----------SPPP---SPPP--SPPPPPH 577

Query: 396 QSSPPPVSSTP 428
            +   P++S P
Sbjct: 578 FAPFVPLASVP 588

[80][TOP]
>UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q0P2_IXOSC
          Length = 170

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 61  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 62  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 63  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 64  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 5   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 65  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 6   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 66  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 7   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 67  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 31/87 (35%), Positives = 32/87 (36%), Gaps = 2/87 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP--VQSAPPP 389
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP  V S P  
Sbjct: 48  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSRPLS 107

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTP 470
              + P P             PAP  P
Sbjct: 108 ALFARPVPRDLREMVWSGGDSPAPEPP 134

[81][TOP]
>UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PKI2_IXOSC
          Length = 154

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 61  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 62  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 63  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 64  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 5   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 65  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 6   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 66  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 7   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 67  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 8   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 68  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 9   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 69  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 10  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 70  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 11  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 71  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 12  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 72  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 13  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 73  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 14  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 74  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 15  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP    PPP P  PPP  PPP
Sbjct: 75  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 29/70 (41%), Positives = 32/70 (45%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP +
Sbjct: 51  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--PPPPPPPPPPPPPPPPPPPPPPPPPPQR 108

Query: 396 QSSPPPVSST 425
           +  P P S+T
Sbjct: 109 EHLPVPSSAT 118

[82][TOP]
>UniRef100_Q0CQD0 Predicted protein n=1 Tax=Aspergillus terreus NIH2624
           RepID=Q0CQD0_ASPTN
          Length = 313

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 42/94 (44%), Positives = 46/94 (48%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P     PP PP + PP  P   PPP    PP    +PPPV+  PPP    PPP  
Sbjct: 174 PPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPP----APPPVEGPPPPKGPPPPPHS 229

Query: 396 QSSPPPVSSTPPPVQSSPPPAPV--TPPPASPPP 491
              PPP    PPP +  PP  PV   PPP SPPP
Sbjct: 230 PPGPPPAEGPPPPAKVPPPAPPVEGPPPPHSPPP 263

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 46/105 (43%), Positives = 49/105 (46%), Gaps = 6/105 (5%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTPPT--NTPPTTPQASPPPVQSAPPTAQS--SPPPVQASPPP 368
           AG   PP   P A PAPP PP     P   P   PPP +  PP   S   PPP +  PPP
Sbjct: 183 AGPPVPPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPP 242

Query: 369 VQSAPPPVQQSSPPPVSSTPP--PVQSSPPPAPVTPPPASPPPAS 497
            +  PP      PPP  S PP  P    PPPA   PPP  PPP S
Sbjct: 243 AKVPPPAPPVEGPPPPHSPPPHGPPPHFPPPAEGPPPPHGPPPHS 287

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 45/106 (42%), Positives = 49/106 (46%), Gaps = 13/106 (12%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT---AQSSPPPVQASP------PP 368
           PP   P   P PP PP   PP  P A PPP    PP      + PPPV   P      PP
Sbjct: 135 PPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPP 194

Query: 369 VQSAPPPVQQS----SPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            + APPP        +PPPV   PPP    PPP P +PP   PPPA
Sbjct: 195 AEPAPPPPPAPQGPPAPPPVEGPPPP--KGPPPPPHSPP--GPPPA 236

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 43/104 (41%), Positives = 47/104 (45%), Gaps = 6/104 (5%)
 Frame = +3

Query: 195 VSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP--PPVQASPPP 368
           V  G    P   P   P PP PP   PP  P A PPP    PP     P  PP  A PP 
Sbjct: 131 VLPGPPVGPPPPPPPPPPPPPPP---PPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPV 187

Query: 369 VQSAPPPVQQSSPPPVS----STPPPVQSSPPPAPVTPPPASPP 488
               PPP + + PPP +      PPPV+  PPP    PPP SPP
Sbjct: 188 PPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPP 231

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 45/100 (45%), Positives = 50/100 (50%), Gaps = 7/100 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT---PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP--PPVQSA 380
           PP  +P   PAPP    PP    P  P  SPP     PP A+  PPP +  P  PPV+  
Sbjct: 200 PPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPP----GPPPAEGPPPPAKVPPPAPPVEGP 255

Query: 381 PPPVQQSSPPPVSSTP--PPVQSSPPPAPVTPPPASPPPA 494
           PPP    SPPP    P  PP    PPP P  PPP SPPP+
Sbjct: 256 PPP---HSPPPHGPPPHFPPPAEGPPP-PHGPPPHSPPPS 291

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 35/86 (40%), Positives = 41/86 (47%), Gaps = 3/86 (3%)
 Frame = +3

Query: 243 PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP---PPVQSAPPPVQQSSPPP 413
           P  P PP   PP  P   PPP    PP   + PPP    P   PP  + PPPV  + PP 
Sbjct: 130 PVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPV--AGPPV 187

Query: 414 VSSTPPPVQSSPPPAPVTPPPASPPP 491
               PPP + +PPP P    P +PPP
Sbjct: 188 PPPHPPPAEPAPPPPPAPQGPPAPPP 213

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 37/86 (43%), Positives = 40/86 (46%), Gaps = 4/86 (4%)
 Frame = +3

Query: 249 PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP--PVQQSSPPPVSS 422
           PP P    PP  P   PPP    PP     PPP  A PPP    PP  P   + PPPV+ 
Sbjct: 127 PPPPVLPGPPVGPPPPPPP--PPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAG 184

Query: 423 TPPPVQSSPPPAPVTPPPASP--PPA 494
            P P    PP  P  PPP +P  PPA
Sbjct: 185 PPVPPPHPPPAEPAPPPPPAPQGPPA 210

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 32/67 (47%), Positives = 34/67 (50%)
 Frame = +3

Query: 297 PPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP 476
           PPPV   PP     PPP    PPP    PPP     PPP  + PPP    PPP P  PPP
Sbjct: 128 PPPVLPGPPVGPPPPPPPPPPPPP----PPP-----PPPPMAGPPPPPGPPPPHP--PPP 176

Query: 477 ASPPPAS 497
           A PPP +
Sbjct: 177 AGPPPVA 183

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 37/86 (43%), Positives = 40/86 (46%), Gaps = 2/86 (2%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPA--PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           G   PP + P   PA  PP P    PP  P   PPP  S PP     PPP    PPP + 
Sbjct: 222 GPPPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPPHSPPP---HGPPP--HFPPPAEG 276

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPP 455
            PPP     PPP S  PPP +  PPP
Sbjct: 277 PPPP---HGPPPHS--PPPSEGPPPP 297

[83][TOP]
>UniRef100_Q6GUG3 Serine/proline-rich repeat protein n=2 Tax=Lupinus angustifolius
           RepID=Q6GUG3_LUPAN
          Length = 198

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 48/104 (46%), Positives = 57/104 (54%), Gaps = 10/104 (9%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPPP 368
           + PP  SP+  P     +PP P  + PP     SPPP  S+PP      SPPP   SPPP
Sbjct: 80  KSPPPPSPSPPPPYLYKSPPPPSPSPPPPYVNKSPPPPSSSPPPPYIYKSPPPPSPSPPP 139

Query: 369 VQSAPPPVQQSSPPPVSSTPPP--VQSSPPPAPVTPPPA-SPPP 491
              +PPP   S PPP  S PPP   +S PPP+P  PPP+ SPPP
Sbjct: 140 PSPSPPPPSPSPPPPSPSPPPPYVYKSPPPPSPSPPPPSPSPPP 183

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 48/108 (44%), Positives = 57/108 (52%), Gaps = 12/108 (11%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPT--AQSSPPPVQASPPP 368
           + PP  SP+  P     +PP P  + PP     SPPP   +PP      SPPP  +SPPP
Sbjct: 64  KSPPPPSPSPPPPYAYKSPPPPSPSPPPPYLYKSPPPPSPSPPPPYVNKSPPPPSSSPPP 123

Query: 369 --VQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP---ASPPPAS 497
             +  +PPP   S PPP  S PPP  S PPP+P  PPP    SPPP S
Sbjct: 124 PYIYKSPPPPSPSPPPPSPSPPPPSPSPPPPSPSPPPPYVYKSPPPPS 171

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 51/110 (46%), Positives = 59/110 (53%), Gaps = 14/110 (12%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPP-----TPPTNTPPTTPQA--SPPPVQSAPPTA---QSSPPPVQAS 359
           Q PP  SP+ SP PP      PP +  P  P A  SPPP   +PP     +S PPP  + 
Sbjct: 46  QSPPPPSPSPSPPPPYVYKSPPPPSPSPPPPYAYKSPPPPSPSPPPPYLYKSPPPPSPSP 105

Query: 360 PPPVQSAPPPVQQSSPPP---VSSTPPPVQSSPPPAPVTPPPA-SPPPAS 497
           PPP  +  PP   SSPPP     S PPP  S PPP+P  PPP+ SPPP S
Sbjct: 106 PPPYVNKSPPPPSSSPPPPYIYKSPPPPSPSPPPPSPSPPPPSPSPPPPS 155

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 50/110 (45%), Positives = 58/110 (52%), Gaps = 15/110 (13%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQAS---------- 359
           QPPS    + P P   P+  PP   ++ PPP  S PP  A  SPPP   S          
Sbjct: 39  QPPSYYYQSPPPPSPSPSPPPPYVYKSPPPPSPSPPPPYAYKSPPPPSPSPPPPYLYKSP 98

Query: 360 PPPVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPPA-SPPPAS 497
           PPP  S PPP    SPPP SS+PPP    +S PPP+P  PPP+ SPPP S
Sbjct: 99  PPPSPSPPPPYVNKSPPPPSSSPPPPYIYKSPPPPSPSPPPPSPSPPPPS 148

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/100 (44%), Positives = 52/100 (52%), Gaps = 6/100 (6%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           + PP  SP+  P     +PP P ++ PP     SPPP   +PP    SPPP   SPPP  
Sbjct: 96  KSPPPPSPSPPPPYVNKSPPPPSSSPPPPYIYKSPPPPSPSPPPPSPSPPPPSPSPPPPS 155

Query: 375 -SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            S PPP    SPPP S +PPP   SPPP       +SPPP
Sbjct: 156 PSPPPPYVYKSPPPPSPSPPPPSPSPPPPYHPYLYSSPPP 195

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 34/77 (44%), Positives = 39/77 (50%), Gaps = 1/77 (1%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTP-PTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           + PP  SP+  P  P+PP  +P P  P  SPP     PP    SPPP   SPPP   +PP
Sbjct: 128 KSPPPPSPSPPPPSPSPPPPSPSPPPPSPSPP-----PPYVYKSPPPPSPSPPPPSPSPP 182

Query: 387 PVQQSSPPPVSSTPPPV 437
           P     P   SS PPPV
Sbjct: 183 PPYH--PYLYSSPPPPV 197

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 34/76 (44%), Positives = 37/76 (48%), Gaps = 7/76 (9%)
 Frame = +3

Query: 291 ASPPPVQSAPPTAQ-SSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPP--VQSSPPPAP 461
           A  P     PP+    SPPP   SP P    PPP    SPPP S +PPP     SPPP  
Sbjct: 31  AGQPYYYYQPPSYYYQSPPPPSPSPSP----PPPYVYKSPPPPSPSPPPPYAYKSPPPPS 86

Query: 462 VTPPP----ASPPPAS 497
            +PPP     SPPP S
Sbjct: 87  PSPPPPYLYKSPPPPS 102

[84][TOP]
>UniRef100_Q58NA5 Plus agglutinin (Fragment) n=1 Tax=Chlamydomonas incerta
            RepID=Q58NA5_CHLIN
          Length = 2371

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 45/97 (46%), Positives = 54/97 (55%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P + P+P P PP+  PP+ P  SP P   APP   S PPP    P P   +PPP
Sbjct: 861  EPPSPAPPSPPSPSPEPPSPAPPSPPPPSPAPPSPAPP---SPPPPSPEPPSPAPPSPPP 917

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 P P S +PPP    PP PAP +PPP SP P S
Sbjct: 918  PSPEPPSPASPSPPPPSPEPPSPAPPSPPPPSPEPPS 954

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 45/97 (46%), Positives = 52/97 (53%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            QPPS +P + P P P PP+  PP+ P  SP P   APP   S PPP    P P   +PPP
Sbjct: 726  QPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP---SPPPPSPEPPSPAPPSPPP 782

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 P P   +PPP    PP PAP +PPP SP P S
Sbjct: 783  PSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 819

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 49/106 (46%), Positives = 56/106 (52%), Gaps = 6/106 (5%)
 Frame = +3

Query: 198  SAGAQQPPSTSPNA-SPAPPTPP--TNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPP 365
            S     PPS SP   SPAPP+PP  +  PP+    SPPP    PP+ A  SPPP    PP
Sbjct: 864  SPAPPSPPSPSPEPPSPAPPSPPPPSPAPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPP 923

Query: 366  -PVQSAPPPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
             P   +PPP     P P   +PPP    PP PAP +PPP SP P S
Sbjct: 924  SPASPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 969

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 44/97 (45%), Positives = 52/97 (53%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P + P P P PP+  PP+ P  SP P   APP   S PPP    P P   +PPP
Sbjct: 741  EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP---SPPPPSPEPPSPAPPSPPP 797

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 P P   +PPP    PP PAP +PPP SP P S
Sbjct: 798  PSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 834

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 44/97 (45%), Positives = 52/97 (53%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P + P P P PP+  PP+ P  SP P   APP   S PPP    P P   +PPP
Sbjct: 756  EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP---SPPPPSPEPPSPAPPSPPP 812

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 P P   +PPP    PP PAP +PPP SP P S
Sbjct: 813  PSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 849

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 44/97 (45%), Positives = 52/97 (53%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P + P P P PP+  PP+ P  SP P   APP   S PPP    P P   +PPP
Sbjct: 771  EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP---SPPPPSPEPPSPAPPSPPP 827

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 P P   +PPP    PP PAP +PPP SP P S
Sbjct: 828  PSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 864

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 48/99 (48%), Positives = 55/99 (55%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216  PPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPP-PVQSAP 383
            PPS  P  SPAPP  TPP+  PP+    SPPP    PP+ A  SPPP    PP P   +P
Sbjct: 992  PPSPEP-PSPAPPSPTPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSP 1050

Query: 384  PPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
            PP     P P   +PPP    PP PAP +PPP SP P+S
Sbjct: 1051 PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPSS 1089

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 45/99 (45%), Positives = 53/99 (53%), Gaps = 4/99 (4%)
 Frame = +3

Query: 213  QPPSTSP-NASPAPPTPPTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPP-PVQSAP 383
            +PPS  P +  P  PTPP+  PP+    SPPP    PP+ A  SPPP    PP P   +P
Sbjct: 706  EPPSPKPPSPEPPSPTPPSPQPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSP 765

Query: 384  PPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
            PP     P P   +PPP    PP PAP +PPP SP P S
Sbjct: 766  PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 804

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 46/100 (46%), Positives = 53/100 (53%), Gaps = 7/100 (7%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPP----PVQASPPPVQS 377
            +PPS +P + P P P PP+  PP+ P  SP P   APP+  S  P    P   SPPP   
Sbjct: 831  EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPSPSPEPPSPAPPSPPPPSP 890

Query: 378  APPPVQQSSPPPVSSTP--PPVQSSPPPAPVTPPPASPPP 491
            APP     SPPP S  P  P   S PPP+P  P PASP P
Sbjct: 891  APPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPASPSP 930

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 46/109 (42%), Positives = 54/109 (49%), Gaps = 14/109 (12%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPT----AQSSPPPVQASPPPVQS 377
            +PPS +P + P P P PP+  PP+ P  SP P   APP+    +   P P   SPPP   
Sbjct: 876  EPPSPAPPSPPPPSPAPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPASPSPPPPSP 935

Query: 378  APPPVQQSSPPPVS---------STPPPVQSSPPPAPVTPPPASPPPAS 497
             PP     SPPP S         S PPP    P PAP +PPP SP P S
Sbjct: 936  EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 984

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 46/109 (42%), Positives = 55/109 (50%), Gaps = 14/109 (12%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPT-----------AQSSPPPVQA 356
            +PPS +P + P P P PP+  PP+ P  SP P   APP+           A  SPPP   
Sbjct: 966  EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPTPPSPEPPSPAPPSPPPPSP 1025

Query: 357  SPP-PVQSAPPPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
             PP P   +PPP     P P   +PPP    PP PAP +PPP SP P S
Sbjct: 1026 EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 1074

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 43/97 (44%), Positives = 52/97 (53%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P + P P P PP+  PP+ P  SP P   APP   S PPP    P P   +PP 
Sbjct: 816  EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP---SPPPPSPEPPSPAPPSPPS 872

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 P P   +PPP   +PP PAP +PPP SP P S
Sbjct: 873  PSPEPPSPAPPSPPPPSPAPPSPAPPSPPPPSPEPPS 909

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/97 (44%), Positives = 51/97 (52%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P + P P P PP+  PP+ P  SP P   APP   S PPP    P P   +PPP
Sbjct: 786  EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP---SPPPPSPEPPSPAPPSPPP 842

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 P P   +PPP    PP PAP +PP  SP P S
Sbjct: 843  PSPEPPSPAPPSPPPPSPEPPSPAPPSPPSPSPEPPS 879

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/97 (44%), Positives = 51/97 (52%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P + P P P PP+  PP+ P  SP P   APP   S PPP    P P   +PPP
Sbjct: 801  EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP---SPPPPSPEPPSPAPPSPPP 857

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 P P   +PP     PP PAP +PPP SP P S
Sbjct: 858  PSPEPPSPAPPSPPSPSPEPPSPAPPSPPPPSPAPPS 894

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/97 (44%), Positives = 51/97 (52%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P + P P P PP+   P+ P  SP P   APP   S PPP    P P   +PPP
Sbjct: 906  EPPSPAPPSPPPPSPEPPSPASPSPPPPSPEPPSPAPP---SPPPPSPEPPSPAPPSPPP 962

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 P P   +PPP    PP PAP +PPP SP P S
Sbjct: 963  PSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 999

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/97 (44%), Positives = 51/97 (52%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P + P P P PP+  PP+ P  SP P   APP   S PPP    P P   +P P
Sbjct: 951  EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP---SPPPPSPEPPSPAPPSPTP 1007

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 P P   +PPP    PP PAP +PPP SP P S
Sbjct: 1008 PSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 1044

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/97 (44%), Positives = 51/97 (52%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P + P P P PP+  PP+ P  SP P   APP   S PPP    P P   +PPP
Sbjct: 1011 EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP---SPPPPSPEPPSPAPPSPPP 1067

Query: 390  VQQSSPPPVSSTPPPVQSSP-PPAPVTPPPASPPPAS 497
                 P P   +PPP    P  PAP +PPP SP P S
Sbjct: 1068 PSPEPPSPAPPSPPPPSPEPSSPAPPSPPPPSPAPPS 1104

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 43/97 (44%), Positives = 50/97 (51%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPS-TSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS  SP+  P  P PP+  PP+ P  SP P   APP   S PPP    P P   +PPP
Sbjct: 921  EPPSPASPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP---SPPPPSPEPPSPAPPSPPP 977

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 P P   +PPP    PP PAP +P P SP P S
Sbjct: 978  PSPEPPSPAPPSPPPPSPEPPSPAPPSPTPPSPEPPS 1014

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 47/106 (44%), Positives = 55/106 (51%), Gaps = 6/106 (5%)
 Frame = +3

Query: 198  SAGAQQPPSTSPNA-SPAPPTPPTNTP--PTTPQASPPPVQSAPPT-AQSSPPPVQASPP 365
            S  +  PP  SP   SPAPP+PP  +P  P+    SPPP    PP+ A  SPPP    PP
Sbjct: 924  SPASPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPP 983

Query: 366  -PVQSAPPPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
             P   +PPP     P P   +P P    PP PAP +PPP SP P S
Sbjct: 984  SPAPPSPPPPSPEPPSPAPPSPTPPSPEPPSPAPPSPPPPSPEPPS 1029

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 46/99 (46%), Positives = 54/99 (54%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPP-PVQSAP 383
            PPS  P  SPAPP+P  P+  PP+    SPPP    PP+ A  SPP     PP P   +P
Sbjct: 827  PPSPEP-PSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPSPSPEPPSPAPPSP 885

Query: 384  PPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
            PP   + P P   +PPP    PP PAP +PPP SP P S
Sbjct: 886  PPPSPAPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 924

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 46/99 (46%), Positives = 53/99 (53%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPP-PVQSAP 383
            PPS  P  SPAPP+P  P+  PP+    SPPP    PP+ A  SP P    PP P   +P
Sbjct: 962  PPSPEP-PSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPTPPSPEPPSPAPPSP 1020

Query: 384  PPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
            PP     P P   +PPP    PP PAP +PPP SP P S
Sbjct: 1021 PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 1059

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/100 (47%), Positives = 54/100 (54%), Gaps = 6/100 (6%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPP----PVQASPPPVQS 377
            +PPS +P + P P P PP+  PP+ P  SP P   APP+     P    P   SPPP   
Sbjct: 1041 EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPSSPAPPSPPPPSP 1100

Query: 378  APP-PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            APP P  QSS PP     P  QSS PP+PV P PA P PA
Sbjct: 1101 APPSPEPQSSAPP----SPEPQSSAPPSPVPPSPAPPSPA 1136

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 46/104 (44%), Positives = 53/104 (50%), Gaps = 10/104 (9%)
 Frame = +3

Query: 213  QPPSTSPNA--SPAPPTPPTNTPPTT-------PQASPPPVQSAPPTAQSSPPPVQASPP 365
            QPPS SP    SPAPP+P    PP+        P  +PPP   APP+ +  PP    SPP
Sbjct: 1258 QPPSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPPSPPAPPSPEPIPPAPPPSPP 1317

Query: 366  PVQSAPPPVQQSSPPPVSSTPPPVQSSP-PPAPVTPPPASPPPA 494
               S  PP  Q   PP  S P P   SP PP+P+ P PA P PA
Sbjct: 1318 EPPSPAPPSPQPPQPPSPSPPSPAPPSPEPPSPIPPSPAPPSPA 1361

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 47/102 (46%), Positives = 53/102 (51%), Gaps = 8/102 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPP----TPPTNTPPTTPQASPPPVQSAPPT----AQSSPPPVQASPPPV 371
           PPS +P  SPAPP     PP+ TPP+    SPPP   APP+    +   P P   SP P 
Sbjct: 660 PPSPAP-PSPAPPQPPPAPPSPTPPSPAPPSPPPPSPAPPSPRPPSPEPPSPKPPSPEPP 718

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              PP  Q  SP P  S PPP    P PAP +PPP SP P S
Sbjct: 719 SPTPPSPQPPSPAP-PSPPPPSPEPPSPAPPSPPPPSPEPPS 759

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 44/99 (44%), Positives = 51/99 (51%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP-PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP-P 389
            PPS +P  SP PP+P P + PP +P+   P   S PP +   P P   SPPP    PP P
Sbjct: 1002 PPSPTP-PSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSP 1060

Query: 390  VQQSSPPPVSSTPPPVQSSPP---PAPVTPPPASPPPAS 497
               S PPP    P P   SPP   P P +P P SPPP S
Sbjct: 1061 APPSPPPPSPEPPSPAPPSPPPPSPEPSSPAPPSPPPPS 1099

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 45/99 (45%), Positives = 53/99 (53%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPP-PVQSAP 383
           PPS +P  SP PP+P  P+  PP+    SP P    PP+ A  SPPP    PP P   +P
Sbjct: 692 PPSPAP-PSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPSPAPPSPPPPSPEPPSPAPPSP 750

Query: 384 PPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
           PP     P P   +PPP    PP PAP +PPP SP P S
Sbjct: 751 PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 789

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 48/98 (48%), Positives = 56/98 (57%), Gaps = 4/98 (4%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA--SPPPVQSAP 383
            +PPS +P + P P P PP+  PP+ P  SP P   APP   S PPP  A  SP P  SAP
Sbjct: 1056 EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPSSPAPP---SPPPPSPAPPSPEPQSSAP 1112

Query: 384  P-PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            P P  QSS PP  S  PP  + P PAP +P P SP P+
Sbjct: 1113 PSPEPQSSAPP--SPVPPSPAPPSPAPPSPEPPSPSPS 1148

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 43/93 (46%), Positives = 48/93 (51%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS +P  SP PP PP+  PP+    SP P   APP+ Q  P P   SP P   APP   
Sbjct: 1387 PPSPAP-PSPIPPAPPSPEPPSPAPPSPAPPSPAPPSPQP-PSPAPPSPRPPSPAPPSPA 1444

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              SP P S  PP   S  PP+P  P PA P PA
Sbjct: 1445 PPSPVPPSPQPPAPPSPAPPSPAPPSPAPPSPA 1477

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 42/99 (42%), Positives = 49/99 (49%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTP----PTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PPS +P  SPAPP+PP  +P    P  P   PP  +   P   S  PP    P P   +P
Sbjct: 677 PPSPTP-PSPAPPSPPPPSPAPPSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPSPAPPSP 735

Query: 384 PPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
           PP     P P   +PPP    PP PAP +PPP SP P S
Sbjct: 736 PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 774

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 45/110 (40%), Positives = 54/110 (49%), Gaps = 13/110 (11%)
 Frame = +3

Query: 207 AQQPPST-SPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQ------SSPPPVQASP- 362
           A +PP   SP A PAPP PPT  P   P +  PP Q +PP+         SPP +  SP 
Sbjct: 580 APRPPRPPSPPAPPAPPDPPTAPPSPDPPSPEPPSQPSPPSPDPPSPDPPSPPALPPSPK 639

Query: 363 -----PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                PP  + P P+  S  PP  + P P    PPPAP +P P SP P S
Sbjct: 640 PPSPKPPTPAPPSPLPPSPLPPSPAPPSPAPPQPPPAPPSPTPPSPAPPS 689

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 51/101 (50%), Positives = 56/101 (55%), Gaps = 7/101 (6%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTP-PTTPQA-SPPPVQSAPPT--AQSSPPPVQASPPPVQSAP 383
            PPS  P  SPAPP+PP  +P P++P   SPPP   APP+   QSS PP   SP P  SAP
Sbjct: 1067 PPSPEP-PSPAPPSPPPPSPEPSSPAPPSPPPPSPAPPSPEPQSSAPP---SPEPQSSAP 1122

Query: 384  PPVQQSSPPPVSSTPP---PVQSSPPPAPVTPPPASPPPAS 497
            P     SP P S  PP   P   SP PAP  P P SP P S
Sbjct: 1123 PSPVPPSPAPPSPAPPSPEPPSPSPSPAPPIPAPPSPQPPS 1163

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 44/99 (44%), Positives = 52/99 (52%), Gaps = 4/99 (4%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTPPTNTPPT----TPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
            +PPS SP+ +P  P PP+  PP+    TPQ   P   S  P + + P PV  SP P   A
Sbjct: 1141 EPPSPSPSPAPPIPAPPSPQPPSPAPQTPQPPSPDPPSPAPPSPAPPSPVPPSPIPPTPA 1200

Query: 381  PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            PP  +  SP P S TPP  Q  P PAP  P P SP P S
Sbjct: 1201 PPSPEPPSPVPPSPTPPAPQ-PPSPAPPAPQPPSPAPPS 1238

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 45/98 (45%), Positives = 50/98 (51%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS  P  SPAPP+PP  +P   P  +PP   S PP +   P P   SPPP    PP   
Sbjct: 797  PPSPEP-PSPAPPSPPPPSPEP-PSPAPP---SPPPPSPEPPSPAPPSPPPPSPEPPSPA 851

Query: 396  QSSPPPVSSTP----PPVQSSPPPAPVTPPPASPPPAS 497
              SPPP S  P    PP   SP P P +P P SPPP S
Sbjct: 852  PPSPPPPSPEPPSPAPPSPPSPSPEPPSPAPPSPPPPS 889

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 42/96 (43%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTA--QSSPPPVQASPPPVQSAPPP 389
            PPS  P+ SPAPP+PP   PP+    SP P  SAPP+   QSS PP    P P   +P P
Sbjct: 1082 PPSPEPS-SPAPPSPP---PPSPAPPSPEPQSSAPPSPEPQSSAPPSPVPPSPAPPSPAP 1137

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                 P P  S  PP+ + P P P +P P +P P S
Sbjct: 1138 PSPEPPSPSPSPAPPIPAPPSPQPPSPAPQTPQPPS 1173

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 49/107 (45%), Positives = 55/107 (51%), Gaps = 10/107 (9%)
 Frame = +3

Query: 207  AQQPPSTSPNA----SPAPPTP-PTNTPPTTPQA----SPPPVQSAPPTAQSSPPPVQAS 359
            A QPPS +P A    SPAPP+P P +  PTTP +    SP P   +PP   S  PP  A 
Sbjct: 1218 APQPPSPAPPAPQPPSPAPPSPNPPSPAPTTPASPEPPSPQPPSPSPPVPPSPAPPSPAP 1277

Query: 360  -PPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             PPP    P PV  S  PP S   PP   SP P P  PPP+ P P S
Sbjct: 1278 LPPPSPDPPSPVPPSPAPPPS---PPAPPSPEPIPPAPPPSPPEPPS 1321

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 39/103 (37%), Positives = 47/103 (45%), Gaps = 3/103 (2%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           S    QPP   P+ +P  P PP+  PP+    SP P    PP+ +   P   +  PP   
Sbjct: 667 SPAPPQPPPAPPSPTPPSPAPPSPPPPSPAPPSPRPPSPEPPSPKPPSPEPPSPTPPSPQ 726

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPP---PAPVTPPPASPPPAS 497
            P P   S PPP    P P   SPP   P P +P P SPPP S
Sbjct: 727 PPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 769

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 44/101 (43%), Positives = 51/101 (50%), Gaps = 8/101 (7%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTP--PTTPQASPPPVQSAPPT-AQSSPPPVQASPP-PVQSAP 383
            PPS  P  SPAPP+PP  +P  P+    SPPP    PP+ A  SPPP    PP P   +P
Sbjct: 902  PPSPEP-PSPAPPSPPPPSPEPPSPASPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSP 960

Query: 384  PPVQQSSPPPVSSTPPPVQSSPP----PAPVTPPPASPPPA 494
            PP     P P   +PPP    PP    P+P  P P  P PA
Sbjct: 961  PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 1001

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 43/99 (43%), Positives = 51/99 (51%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216  PPSTSPN--ASPAPPTP--PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
            PPS +P   ASP PP+P  P+ +PP  P  +PP     PP +   P PV  SP P  S P
Sbjct: 1241 PPSPAPTTPASPEPPSPQPPSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPPSPP 1300

Query: 384  PPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
             P    SP P+   PPP    PP PAP +P P  PP  S
Sbjct: 1301 AP---PSPEPIPPAPPPSPPEPPSPAPPSPQPPQPPSPS 1336

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 47/99 (47%), Positives = 53/99 (53%), Gaps = 5/99 (5%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            QPPS  P  SPAPP+P   +P     A P P+  APP+ +  P P   SP P   APP  
Sbjct: 1366 QPPSPEP-PSPAPPSPAPLSPAPPSPAPPSPIPPAPPSPE-PPSPAPPSPAPPSPAPPSP 1423

Query: 393  QQSSPPPVSSTPP-PVQSSP-PPAPVTP---PPASPPPA 494
            Q  SP P S  PP P   SP PP+PV P   PPA P PA
Sbjct: 1424 QPPSPAPPSPRPPSPAPPSPAPPSPVPPSPQPPAPPSPA 1462

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 42/99 (42%), Positives = 47/99 (47%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPPPVQSAPPPV 392
           PP+  P+  P  P PPT  PP+    SP P   APP+ A   PPP   SP P   APP  
Sbjct: 631 PPALPPSPKPPSPKPPTPAPPSPLPPSPLPPSPAPPSPAPPQPPPAPPSPTPPSPAPPSP 690

Query: 393 QQSSPPPVSSTP----PPVQSSPPPAPVTPPPASPPPAS 497
              SP P S  P    PP    P P P +P P SP P S
Sbjct: 691 PPPSPAPPSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPS 729

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 47/111 (42%), Positives = 52/111 (46%), Gaps = 17/111 (15%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPTAQSSPP------PVQASPPPV 371
           PPS  P  SP PPTP  P+  PP+    SP P   APP    +PP      P   SPPP 
Sbjct: 635 PPSPKP-PSPKPPTPAPPSPLPPSPLPPSPAPPSPAPPQPPPAPPSPTPPSPAPPSPPPP 693

Query: 372 QSAPPPVQQSSPPPVSSTPP---------PVQSSPPPAPVTPPPASPPPAS 497
             APP  +  SP P S  PP         P    P PAP +PPP SP P S
Sbjct: 694 SPAPPSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPSPAPPSPPPPSPEPPS 744

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 43/97 (44%), Positives = 52/97 (53%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            +PPS +P  SP PP PP+ +PP+    SP P    PP+  + P P   SP P    PP  
Sbjct: 1318 EPPSPAP-PSPQPPQPPSPSPPSPAPPSPEPPSPIPPSP-APPSPAPPSPQPPSPEPPSP 1375

Query: 393  QQSSPPPVSSTPP-PVQSSP-PPAPVTPPPASPPPAS 497
               SP P+S  PP P   SP PPAP +P P SP P S
Sbjct: 1376 APPSPAPLSPAPPSPAPPSPIPPAPPSPEPPSPAPPS 1412

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 46/107 (42%), Positives = 56/107 (52%), Gaps = 13/107 (12%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPV----- 371
            +PPS +P  SPAPP+P  P+  PP  P  +PP      P   S  PP  ASP PV     
Sbjct: 1434 RPPSPAP-PSPAPPSPVPPSPQPPAPPSPAPPSPAPPSPAPPSPAPPSPASPSPVPPLPT 1492

Query: 372  QSAPPPVQQSSPPPVSSTP----PPVQSSPPPAPVTP--PPASPPPA 494
              +P P   +SP P S TP    PP   +PPP P  P  PPA+PPP+
Sbjct: 1493 PPSPAPAPTTSPLPPSPTPALPAPPASPAPPPNPPRPPQPPAAPPPS 1539

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 43/95 (45%), Positives = 48/95 (50%), Gaps = 2/95 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS +P  SP  P  P   PP  P + P P   APP+ Q   PP   SP P   APP  +
Sbjct: 1290 PPSPAPPPSPPAPPSPEPIPPAPPPSPPEPPSPAPPSPQPPQPP---SPSPPSPAPPSPE 1346

Query: 396  QSSPPPVSSTPP-PVQSSP-PPAPVTPPPASPPPA 494
              SP P S  PP P   SP PP+P  P PA P PA
Sbjct: 1347 PPSPIPPSPAPPSPAPPSPQPPSPEPPSPAPPSPA 1381

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/98 (46%), Positives = 53/98 (54%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PPS +P  SPAPP+P  P+  PP  P   PP   S  P + + P P   SP P   APP 
Sbjct: 1377 PPSPAP-LSPAPPSPAPPSPIPPAPPSPEPP---SPAPPSPAPPSPAPPSPQPPSPAPPS 1432

Query: 390  VQQSSPPPVSSTPP-PVQSSP-PPAPVTPPPASPPPAS 497
             +  SP P S  PP PV  SP PPAP +P P SP P S
Sbjct: 1433 PRPPSPAPPSPAPPSPVPPSPQPPAPPSPAPPSPAPPS 1470

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 44/104 (42%), Positives = 50/104 (48%), Gaps = 11/104 (10%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS  P  SP PP PP+  PP+    SP P   APP+  +SP PV   P P   AP P  
Sbjct: 1445 PPSPVP-PSPQPPAPPSPAPPSPAPPSPAPPSPAPPSP-ASPSPVPPLPTPPSPAPAPTT 1502

Query: 396  QSSPP---------PVSSTPPPVQSSPPPAPVTPP--PASPPPA 494
               PP         P S  PPP    PP  P  PP  PA+PPP+
Sbjct: 1503 SPLPPSPTPALPAPPASPAPPPNPPRPPQPPAAPPPSPAAPPPS 1546

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 41/98 (41%), Positives = 50/98 (51%), Gaps = 6/98 (6%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP----PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
            PPS +P  SPAPP+P    P +  P  P  +PP    AP T+   P P  A P P  S  
Sbjct: 1463 PPSPAP-PSPAPPSPAPPSPASPSPVPPLPTPPSPAPAPTTSPLPPSPTPALPAPPASPA 1521

Query: 384  PPVQQSSPPPVSSTPPPVQSSPP--PAPVTPPPASPPP 491
            PP     PP   + PPP  ++PP  PAP+ PPP  P P
Sbjct: 1522 PPPNPPRPPQPPAAPPPSPAAPPPSPAPLAPPPPQPQP 1559

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 45/99 (45%), Positives = 54/99 (54%), Gaps = 4/99 (4%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
            QPPS SP  SPAPP+P  P+  PP+    SP P    PP+ +  P P   SP P+  APP
Sbjct: 1331 QPPSPSP-PSPAPPSPEPPSPIPPSPAPPSPAPPSPQPPSPEP-PSPAPPSPAPLSPAPP 1388

Query: 387  PVQQSSP-PPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 SP PP   +P P   +PP PAP +P P SP P S
Sbjct: 1389 SPAPPSPIPPAPPSPEPPSPAPPSPAPPSPAPPSPQPPS 1427

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 47/102 (46%), Positives = 54/102 (52%), Gaps = 8/102 (7%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPT-AQSSP-PPVQASPPPVQSAP 383
            PPS +P  SPAPP+P  P+  PP+    SP P+  APP+ A  SP PP   SP P   AP
Sbjct: 1352 PPSPAP-PSPAPPSPQPPSPEPPSPAPPSPAPLSPAPPSPAPPSPIPPAPPSPEPPSPAP 1410

Query: 384  PPVQQSSPPPVSSTPP----PVQSSPPPAPVTPPPASPPPAS 497
            P     SP P S  PP    P    P PAP +P P SP P S
Sbjct: 1411 PSPAPPSPAPPSPQPPSPAPPSPRPPSPAPPSPAPPSPVPPS 1452

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 46/108 (42%), Positives = 56/108 (51%), Gaps = 13/108 (12%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQ-----ASPPPVQSAPPTAQ---SSPP-PVQASP 362
            +PPS +P + P P P P +  PP+ P       SP P  SAPP+ +   S+PP PV  SP
Sbjct: 1071 EPPSPAPPSPPPPSPEPSSPAPPSPPPPSPAPPSPEPQSSAPPSPEPQSSAPPSPVPPSP 1130

Query: 363  PPVQSAPPPVQQSSPPPVSSTP---PPVQSSPPPAPVTPPPASPPPAS 497
             P   APP  +  SP P  + P   PP    P PAP TP P SP P S
Sbjct: 1131 APPSPAPPSPEPPSPSPSPAPPIPAPPSPQPPSPAPQTPQPPSPDPPS 1178

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/103 (38%), Positives = 51/103 (49%), Gaps = 9/103 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAP-PTAQSSPPPVQASPPPVQSAPP 386
           PPS  P + P+PP+P  P+  PP+ P   P P   +P P   + P P+  SP P   APP
Sbjct: 607 PPSPEPPSQPSPPSPDPPSPDPPSPPALPPSPKPPSPKPPTPAPPSPLPPSPLPPSPAPP 666

Query: 387 PVQQSSPPPVSSTPPPVQSSPP------PAPVTPPPASPPPAS 497
                 PPP   +P P   +PP      PAP +P P SP P S
Sbjct: 667 SPAPPQPPPAPPSPTPPSPAPPSPPPPSPAPPSPRPPSPEPPS 709

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 39/95 (41%), Positives = 47/95 (49%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           +PPS     SP PP+P   +PP  P +  PP  S  P   + P P+  SP P   APP  
Sbjct: 611 EPPSQPSPPSPDPPSPDPPSPPALPPSPKPP--SPKPPTPAPPSPLPPSPLPPSPAPPSP 668

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PPP   +P P    P PAP +PPP SP P S
Sbjct: 669 APPQPPPAPPSPTP----PSPAPPSPPPPSPAPPS 699

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 39/97 (40%), Positives = 46/97 (47%), Gaps = 4/97 (4%)
 Frame = +3

Query: 219  PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
            P   P+  P PP PP  +PP  P  +PP  Q   P + S P P   SP P    PP    
Sbjct: 1299 PPAPPSPEPIPPAPPP-SPPEPPSPAPPSPQPPQPPSPSPPSPAPPSPEPPSPIPPSPAP 1357

Query: 399  SSPPPVSSTP----PPVQSSPPPAPVTPPPASPPPAS 497
             SP P S  P    PP  + P PAP++P P SP P S
Sbjct: 1358 PSPAPPSPQPPSPEPPSPAPPSPAPLSPAPPSPAPPS 1394

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 43/104 (41%), Positives = 50/104 (48%), Gaps = 10/104 (9%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAP---PTAQSSPPPVQASPPPVQSAPP 386
            P    P   P+PP PP+  PP+ PQ   PP  S P   P +   P P+  SP P   APP
Sbjct: 1305 PEPIPPAPPPSPPEPPSPAPPS-PQPPQPPSPSPPSPAPPSPEPPSPIPPSPAPPSPAPP 1363

Query: 387  PVQQSSPPPVSSTPP------PVQSSP-PPAPVTPPPASPPPAS 497
              Q  SP P S  PP      P   SP PP+P+ P P SP P S
Sbjct: 1364 SPQPPSPEPPSPAPPSPAPLSPAPPSPAPPSPIPPAPPSPEPPS 1407

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 15/108 (13%)
 Frame = +3

Query: 216  PPSTSPNASPAP----PTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPPPVQS 377
            PPS  P A P+P    P PP+  PP+    SP P   APP+ +  S  PP  A P PV  
Sbjct: 1392 PPSPIPPAPPSPEPPSPAPPSPAPPSPAPPSPQPPSPAPPSPRPPSPAPPSPAPPSPVPP 1451

Query: 378  APPPVQQSSPPPVSSTPP---------PVQSSPPPAPVTPPPASPPPA 494
            +P P    SP P S  PP         P  +SP P P  P P SP PA
Sbjct: 1452 SPQPPAPPSPAPPSPAPPSPAPPSPAPPSPASPSPVPPLPTPPSPAPA 1499

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 38/98 (38%), Positives = 51/98 (52%), Gaps = 6/98 (6%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PPS +P  SPAPP+P  P+  PP+    SP P    PP+   +P      P P  + P P
Sbjct: 1458 PPSPAP-PSPAPPSPAPPSPAPPSPASPSPVPPLPTPPSPAPAPTTSPLPPSPTPALPAP 1516

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPA----SPPP 491
                +PPP    PP   ++PPP+P  PPP+    +PPP
Sbjct: 1517 PASPAPPPNPPRPPQPPAAPPPSPAAPPPSPAPLAPPP 1554

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/123 (38%), Positives = 55/123 (44%), Gaps = 23/123 (18%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNA-----------SPAPPT--PPTNTPPTTPQASPPPVQSAPPTAQSS 338
           S  +  PPS  P +           SP PPT  PP+  PP+    SP P   APP    +
Sbjct: 617 SPPSPDPPSPDPPSPPALPPSPKPPSPKPPTPAPPSPLPPSPLPPSPAPPSPAPPQPPPA 676

Query: 339 PP------PVQASPPPVQSAPPPVQQSSPPPVSSTP----PPVQSSPPPAPVTPPPASPP 488
           PP      P   SPPP   APP  +  SP P S  P    PP  + P P P +P P SPP
Sbjct: 677 PPSPTPPSPAPPSPPPPSPAPPSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPSPAPPSPP 736

Query: 489 PAS 497
           P S
Sbjct: 737 PPS 739

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 41/110 (37%), Positives = 45/110 (40%), Gaps = 2/110 (1%)
 Frame = +3

Query: 174 GLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTP--PTTPQASPPPVQSAPPTAQSSPPP 347
           G++CA+         P   P+  P  P PP   P  P  P    PP    PPTA  SP P
Sbjct: 548 GVLCAMPSPVPPLPSPPRPPSPQPPVPRPPPRAPRPPRPPSPPAPPAPPDPPTAPPSPDP 607

Query: 348 VQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PP   S P P   S  PP     PP    P P P TP P SP P S
Sbjct: 608 PSPEPPSQPSPPSPDPPSPDPPSPPALPPSPKPPSPKPPTPAPPSPLPPS 657

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 40/98 (40%), Positives = 49/98 (50%), Gaps = 5/98 (5%)
 Frame = +3

Query: 216  PPSTSP-NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            PPS +P +  P  P PP+  PP+    SP P    PP+ Q   PP  A P P   +P P 
Sbjct: 1415 PPSPAPPSPQPPSPAPPSPRPPSPAPPSPAPPSPVPPSPQPPAPPSPAPPSPAPPSPAPP 1474

Query: 393  QQSSPPPVSSTPPPVQSSPP---PAPVTPP-PASPPPA 494
              + P P S +P P   +PP   PAP T P P SP PA
Sbjct: 1475 SPAPPSPASPSPVPPLPTPPSPAPAPTTSPLPPSPTPA 1512

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 39/91 (42%), Positives = 45/91 (49%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            P  T P+ +PAP T P   P  TP    PP   APP     PP   A+PPP  +APPP  
Sbjct: 1489 PLPTPPSPAPAPTTSPL-PPSPTPALPAPPASPAPPPNPPRPPQPPAAPPPSPAAPPP-- 1545

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
              SP P++  PP  Q  P PA   P P  PP
Sbjct: 1546 --SPAPLAPPPPQPQPQPTPAAAAPSPPLPP 1574

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 40/99 (40%), Positives = 48/99 (48%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216  PPSTSPNASPAP----PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
            PPS +P   P+P    P PP+  PP +P A P P +  PP    SPP   +  PP    P
Sbjct: 1272 PPSPAPLPPPSPDPPSPVPPSPAPPPSPPAPPSP-EPIPPAPPPSPPEPPSPAPPSPQPP 1330

Query: 384  PPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
             P   S P P   +P P    PP PAP +P P SP P S
Sbjct: 1331 QPPSPSPPSPAPPSPEPPSPIPPSPAPPSPAPPSPQPPS 1369

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 45/121 (37%), Positives = 50/121 (41%), Gaps = 30/121 (24%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS SP     PP PP+  PP  P+   PPV  +PP    SPPP   +PPPV   PP   
Sbjct: 472 PPSPSPAPPRPPPFPPS--PPPNPRPPSPPVPPSPPPTPPSPPPTPPAPPPVPPLPPAPP 529

Query: 396 QSSP------------------------PPVSSTP------PPVQSSPPPAPVTPPPASP 485
            S P                        PP+ S P      PPV   PP AP  P P SP
Sbjct: 530 PSPPLPPEPPFIALCIRAGVLCAMPSPVPPLPSPPRPPSPQPPVPRPPPRAPRPPRPPSP 589

Query: 486 P 488
           P
Sbjct: 590 P 590

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 41/96 (42%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216  PPS-TSPNASPAPPTPPTNTP-PTTPQASPPPVQSAP-PTAQSSPPPVQASPPPVQSAPP 386
            PPS  SP+  P  PTPP+  P PTT    P P  + P P A  +PPP    PP   +APP
Sbjct: 1478 PPSPASPSPVPPLPTPPSPAPAPTTSPLPPSPTPALPAPPASPAPPPNPPRPPQPPAAPP 1537

Query: 387  PVQQSSPP-PVSSTPPPVQSSPPPAPVTPPPASPPP 491
            P   + PP P    PPP Q  P P P    P+ P P
Sbjct: 1538 PSPAAPPPSPAPLAPPPPQPQPQPTPAAAAPSPPLP 1573

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 42/105 (40%), Positives = 49/105 (46%), Gaps = 10/105 (9%)
 Frame = +3

Query: 213  QPPSTSPNA----SPAPPTP--PTNTPPTTPQASPPPVQSAPPT----AQSSPPPVQASP 362
            QPPS  P +    SPAPP+P  P+  PPT    SP P    PP+    A   P P   +P
Sbjct: 1170 QPPSPDPPSPAPPSPAPPSPVPPSPIPPTPAPPSPEPPSPVPPSPTPPAPQPPSPAPPAP 1229

Query: 363  PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             P   APP     SP P +   P   S  PP+P  P P SP P S
Sbjct: 1230 QPPSPAPPSPNPPSPAPTTPASPEPPSPQPPSPSPPVPPSPAPPS 1274

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 42/98 (42%), Positives = 47/98 (47%), Gaps = 3/98 (3%)
 Frame = +3

Query: 213  QPPSTSPNA-SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            QPPS +P    P  P PP+  PP+    SP P    PPT  + P P   SP P    PP 
Sbjct: 1160 QPPSPAPQTPQPPSPDPPSPAPPSPAPPSPVPPSPIPPT-PAPPSPEPPSPVPPSPTPPA 1218

Query: 390  VQQSSP-PPVSSTPPPVQSSP-PPAPVTPPPASPPPAS 497
             Q  SP PP    P P   SP PP+P    PASP P S
Sbjct: 1219 PQPPSPAPPAPQPPSPAPPSPNPPSPAPTTPASPEPPS 1256

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 42/95 (44%), Positives = 47/95 (49%), Gaps = 1/95 (1%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP-PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            PPS  P  SPAPP+P P +  P +P  SP P   APP+ Q   P  Q   PP    P P 
Sbjct: 1122 PPSPVP-PSPAPPSPAPPSPEPPSPSPSPAPPIPAPPSPQPPSPAPQTPQPPSPDPPSPA 1180

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              S  PP  S  PP    P PAP +P P SP P S
Sbjct: 1181 PPSPAPP--SPVPPSPIPPTPAPPSPEPPSPVPPS 1213

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 41/100 (41%), Positives = 49/100 (49%), Gaps = 5/100 (5%)
 Frame = +3

Query: 213  QPPST-SPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS   P+ +P  P PP+  PP+    SP P   AP    S  PP  A P P+  APP 
Sbjct: 1346 EPPSPIPPSPAPPSPAPPSPQPPSPEPPSPAPPSPAP---LSPAPPSPAPPSPIPPAPPS 1402

Query: 390  VQQSSPPPVSSTP----PPVQSSPPPAPVTPPPASPPPAS 497
             +  SP P S  P    PP    P PAP +P P SP P S
Sbjct: 1403 PEPPSPAPPSPAPPSPAPPSPQPPSPAPPSPRPPSPAPPS 1442

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 42/102 (41%), Positives = 50/102 (49%), Gaps = 9/102 (8%)
 Frame = +3

Query: 219  PSTSPNASPAPPTP-PTNTPPTTPQ------ASPPPVQSAPPT-AQSSPPPVQASPPPVQ 374
            P + P  SPAPP+P P ++ P +P+       SP P   APP+ A  SP P   SP P  
Sbjct: 1092 PPSPPPPSPAPPSPEPQSSAPPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPAP 1151

Query: 375  SAPPPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
              P P     P P   TP P    PP PAP +P P SP P S
Sbjct: 1152 PIPAPPSPQPPSPAPQTPQPPSPDPPSPAPPSPAPPSPVPPS 1193

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 41/99 (41%), Positives = 49/99 (49%), Gaps = 6/99 (6%)
 Frame = +3

Query: 216  PPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQS-SPPPVQASP---PPVQSA 380
            PPS  P +S  P P P ++ PP+    SP P   APP+ +  SP P  A P   PP    
Sbjct: 1102 PPSPEPQSSAPPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPAPPIPAPPSPQP 1161

Query: 381  PPPVQQSSPPPVSSTPPPVQSSP-PPAPVTPPPASPPPA 494
            P P  Q+  PP    P P   SP PP+PV P P  P PA
Sbjct: 1162 PSPAPQTPQPPSPDPPSPAPPSPAPPSPVPPSPIPPTPA 1200

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/96 (41%), Positives = 48/96 (50%), Gaps = 2/96 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PPS  P  +PAPP+P  P+  PP+    +P P   APP  Q   PP  A P P   +P P
Sbjct: 1191 PPSPIP-PTPAPPSPEPPSPVPPSPTPPAPQPPSPAPPAPQ---PPSPAPPSPNPPSPAP 1246

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               +SP P S  PP      PP+P  P PA  PP S
Sbjct: 1247 TTPASPEPPSPQPPSPSPPVPPSPAPPSPAPLPPPS 1282

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 43/106 (40%), Positives = 48/106 (45%), Gaps = 17/106 (16%)
 Frame = +3

Query: 231 PNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPP 410
           P+ SPAPP PP   PP+ P    PP    PP    SPPP   SPPP   APPPV     P
Sbjct: 473 PSPSPAPPRPPP-FPPSPPPNPRPPSPPVPP----SPPPTPPSPPPTPPAPPPV-----P 522

Query: 411 PVSSTPPPVQSSPP-----------------PAPVTPPPASPPPAS 497
           P+   PPP    PP                 P+PV P P+ P P S
Sbjct: 523 PLPPAPPPSPPLPPEPPFIALCIRAGVLCAMPSPVPPLPSPPRPPS 568

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 41/100 (41%), Positives = 48/100 (48%), Gaps = 7/100 (7%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP------PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
            PPS +P  SPAPP+P      P+  PP     SP P   AP T Q   P   +  PP  +
Sbjct: 1127 PPSPAP-PSPAPPSPEPPSPSPSPAPPIPAPPSPQPPSPAPQTPQPPSPDPPSPAPPSPA 1185

Query: 378  APPPVQQSSPPPVSSTPPPVQSSP-PPAPVTPPPASPPPA 494
             P PV  S  PP  + P P   SP PP+P  P P  P PA
Sbjct: 1186 PPSPVPPSPIPPTPAPPSPEPPSPVPPSPTPPAPQPPSPA 1225

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 40/102 (39%), Positives = 46/102 (45%), Gaps = 7/102 (6%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP------PV 371
           Q P    P  +P PP PP  +PP  P    PP     P   S  PP Q SPP      P 
Sbjct: 570 QPPVPRPPPRAPRPPRPP--SPPAPPAPPDPPTAPPSPDPPSPEPPSQPSPPSPDPPSPD 627

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSP-PPAPVTPPPASPPPA 494
             +PP +  S  PP    P P   SP PP+P+ P PA P PA
Sbjct: 628 PPSPPALPPSPKPPSPKPPTPAPPSPLPPSPLPPSPAPPSPA 669

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216  PPSTSPNAS-PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            PPS  P +S P  P PP+  PP+    SP P   +P  A   P P   SP P   AP   
Sbjct: 1112 PPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPA--PPIPAPPSPQPPSPAPQTP 1169

Query: 393  QQSSPPPVSSTPP-PVQSSP-PPAPVTPPPASPPP 491
            Q  SP P S  PP P   SP PP+P+ P PA P P
Sbjct: 1170 QPPSPDPPSPAPPSPAPPSPVPPSPIPPTPAPPSP 1204

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 44/99 (44%), Positives = 49/99 (49%), Gaps = 7/99 (7%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP-PTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASP---PPVQS 377
            PPS +P  SP PP+P P+  PP     SP P   AP T Q  S  PP  A P   PP   
Sbjct: 1132 PPSPAP-PSPEPPSPSPSPAPPIPAPPSPQPPSPAPQTPQPPSPDPPSPAPPSPAPPSPV 1190

Query: 378  APPPVQQSSPPPVSSTPPPVQSSP-PPAPVTPPPASPPP 491
             P P+  +  PP    P PV  SP PPAP  P PA P P
Sbjct: 1191 PPSPIPPTPAPPSPEPPSPVPPSPTPPAPQPPSPAPPAP 1229

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 43/104 (41%), Positives = 45/104 (43%), Gaps = 11/104 (10%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTP-------PTNTPPTTPQASPPPVQSAPPTAQS----SPPPVQAS 359
            +PPS  P  SP PP P       P   PP+    SP P   AP T  S    SP P   S
Sbjct: 1205 EPPSPVP-PSPTPPAPQPPSPAPPAPQPPSPAPPSPNPPSPAPTTPASPEPPSPQPPSPS 1263

Query: 360  PPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PP   S  PP     PPP    P PV  SP P P  P P SP P
Sbjct: 1264 PPVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPPSPPAPPSPEP 1307

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 41/101 (40%), Positives = 46/101 (45%), Gaps = 10/101 (9%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASP-PPVQSAPPTAQSSP-PPVQASPPPVQSAPPP 389
            P    P+  P  P PP+ TPP     SP PP    P  A  SP PP  A   P    PP 
Sbjct: 1197 PTPAPPSPEPPSPVPPSPTPPAPQPPSPAPPAPQPPSPAPPSPNPPSPAPTTPASPEPPS 1256

Query: 390  VQQSSP-PPVSSTPPPVQSSP-------PPAPVTPPPASPP 488
             Q  SP PPV  +P P   +P       PP+PV P PA PP
Sbjct: 1257 PQPPSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPP 1297

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 43/107 (40%), Positives = 48/107 (44%), Gaps = 15/107 (14%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP---------------P 347
           +PPS     SP PPTPP  +PP TP A PPPV   PP    SPP                
Sbjct: 494 RPPSPPVPPSP-PPTPP--SPPPTPPA-PPPVPPLPPAPPPSPPLPPEPPFIALCIRAGV 549

Query: 348 VQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           + A P PV   P P +  SP P    PPP    PP  P  P P +PP
Sbjct: 550 LCAMPSPVPPLPSPPRPPSPQPPVPRPPPRAPRPPRPPSPPAPPAPP 596

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 45/107 (42%), Positives = 48/107 (44%), Gaps = 15/107 (14%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTP-PTTPQASP--PPVQSAPP-----------TAQSSPPPVQ 353
           PPS  P     PPTPP   P P  P A P  PP+   PP            A  SP P  
Sbjct: 501 PPSPPPTPPSPPPTPPAPPPVPPLPPAPPPSPPLPPEPPFIALCIRAGVLCAMPSPVPPL 560

Query: 354 ASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSP-PPAPVTPPPASPPP 491
            SPP   S  PPV +  PPP +  PP   S P PPAP  PP A P P
Sbjct: 561 PSPPRPPSPQPPVPR--PPPRAPRPPRPPSPPAPPAPPDPPTAPPSP 605

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 45/126 (35%), Positives = 53/126 (42%), Gaps = 32/126 (25%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTN--TPPTTPQASPPPVQSAPPTAQSSPP--------------- 344
           PP+  P + P PP+PP    +PP TP A PPPV   PP    SPP               
Sbjct: 490 PPNPRPPSPPVPPSPPPTPPSPPPTPPA-PPPVPPLPPAPPPSPPLPPEPPFIALCIRAG 548

Query: 345 ---------PVQASPPPVQSAPPPVQQSSP----PPVSSTPPPVQS--SPPPAPVTPPPA 479
                    P   SPP   S  PPV +  P    PP   +PP   +   PP AP +P P 
Sbjct: 549 VLCAMPSPVPPLPSPPRPPSPQPPVPRPPPRAPRPPRPPSPPAPPAPPDPPTAPPSPDPP 608

Query: 480 SPPPAS 497
           SP P S
Sbjct: 609 SPEPPS 614

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 36/82 (43%), Positives = 39/82 (47%), Gaps = 1/82 (1%)
 Frame = +3

Query: 246 APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSST 425
           APP  P+  PP  P   P P    PP  +   PPV  SPPP     PP    SPPP    
Sbjct: 470 APPPSPSPAPPRPPPFPPSP----PPNPRPPSPPVPPSPPPT----PP----SPPPTPPA 517

Query: 426 PPPVQSSPPPAPVTPP-PASPP 488
           PPPV   PP  P +PP P  PP
Sbjct: 518 PPPVPPLPPAPPPSPPLPPEPP 539

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 30/61 (49%), Positives = 34/61 (55%), Gaps = 1/61 (1%)
 Frame = +3

Query: 315 APPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASP-PP 491
           APP + S  PP    PPP   +PPP  +   PPV  +PPP   SPPP P  PPP  P PP
Sbjct: 470 APPPSPSPAPP---RPPPFPPSPPPNPRPPSPPVPPSPPPTPPSPPPTPPAPPPVPPLPP 526

Query: 492 A 494
           A
Sbjct: 527 A 527

[85][TOP]
>UniRef100_C5X8F7 Putative uncharacterized protein Sb02g032910 n=1 Tax=Sorghum
           bicolor RepID=C5X8F7_SORBI
          Length = 493

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 60/109 (55%), Gaps = 12/109 (11%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASP--APPTPPTNTPP----TTPQASPPPVQSAPPTAQSSPP---PV 350
           +A   +PPST P ASP   P TPP  +PP    T P+ASPP   S PP A    P   P 
Sbjct: 295 AASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPP 354

Query: 351 QASPPPVQSAPP---PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           +ASPP   S PP   P +  S PP +S P P  +SPP  P TPP ASPP
Sbjct: 355 EASPPEPPSTPPASSPPEPPSTPPATSPPEPPAASPPEPPSTPPAASPP 403

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 54/116 (46%), Positives = 64/116 (55%), Gaps = 17/116 (14%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPP--TPPTNTPP----TTPQASPP-PVQSAPPTAQSSPPPVQAS 359
           A   +PPST P ASP  P  TPP ++PP    T P  SPP P  ++PP   S+PP   AS
Sbjct: 344 ASPPEPPSTPPEASPPEPPSTPPASSPPEPPSTPPATSPPEPPAASPPEPPSTPPA--AS 401

Query: 360 PPPVQSAPPPVQQSSPPPV---------SSTPPPVQ-SSPPPAPVTPPPASPPPAS 497
           PP   S PPP  QS+PPP           STPPP   S+PP  P   PP++PPP S
Sbjct: 402 PPESPSVPPPESQSTPPPTPAMAPPESPPSTPPPESPSTPPRTPPESPPSTPPPES 457

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 51/102 (50%), Positives = 57/102 (55%), Gaps = 6/102 (5%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPP--TPPTNTPP---TTPQASPPPVQSAPPTAQSSPPPVQASPP 365
           A   +PPST P ASP  P  TPP  +PP   +TP AS PP   + P A S P P  ASPP
Sbjct: 332 ASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPASSPPEPPSTPPATSPPEPPAASPP 391

Query: 366 PVQSAPPPVQQSSPPPVSSTPPP-VQSSPPPAPVTPPPASPP 488
              S PP    +SPP   S PPP  QS+PPP P   PP SPP
Sbjct: 392 EPPSTPP---AASPPESPSVPPPESQSTPPPTPAMAPPESPP 430

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 51/105 (48%), Positives = 58/105 (55%), Gaps = 9/105 (8%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPP--TPPTNTPP---TTPQASPPPVQSAPPTAQSSPP----PVQ 353
           A   +PPST P ASP  P  TPP  +PP   T P+ASPP   S PP      P    P  
Sbjct: 176 ASPPEPPSTPPEASPPEPPSTPPEASPPEPLTPPEASPPEPPSTPPPVPEPTPSPSTPPA 235

Query: 354 ASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           ASPP   S PP   ++SPP   STPP    +PPP P+TPP ASPP
Sbjct: 236 ASPPEPPSTPP---EASPPEPPSTPP---EAPPPEPLTPPEASPP 274

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 50/100 (50%), Positives = 58/100 (58%), Gaps = 9/100 (9%)
 Frame = +3

Query: 216 PPSTSP---NASPAPPTPPTNTPP----TTPQASPPPVQSAPPTAQSSPP--PVQASPPP 368
           PPST P     +P+P TPP  +PP    T P+ASPP   S PP A    P  P +ASPP 
Sbjct: 156 PPSTPPPVPEPTPSPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPLTPPEASPPE 215

Query: 369 VQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
             S PPPV + +P P  STPP   +SPP  P TPP ASPP
Sbjct: 216 PPSTPPPVPEPTPSP--STPP--AASPPEPPSTPPEASPP 251

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 51/106 (48%), Positives = 59/106 (55%), Gaps = 9/106 (8%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPP--TPPTNTPP---TTPQASPPPVQSAPPTAQSSPP----PV 350
           +A   +PPST P ASP  P  TPP   PP   T P+ASPP   S PP+     P    P 
Sbjct: 235 AASPPEPPSTPPEASPPEPPSTPPEAPPPEPLTPPEASPPEPPSTPPSVPEPTPSPSTPP 294

Query: 351 QASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
            ASPP   S PP   ++SPP   STPP  ++SPP  P TPP ASPP
Sbjct: 295 AASPPEPPSTPP---EASPPEPPSTPP--EASPPEPPSTPPEASPP 335

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/106 (46%), Positives = 61/106 (57%), Gaps = 10/106 (9%)
 Frame = +3

Query: 201 AGAQQPPSTSPNA---SPAPPTPPTNTPP----TTPQASPPPVQSAPPTAQSSPP---PV 350
           A   +PPST P+    +P+P TPP  +PP    T P+ASPP   S PP A    P   P 
Sbjct: 271 ASPPEPPSTPPSVPEPTPSPSTPPAASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPP 330

Query: 351 QASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           +ASPP   S PP   ++SPP   STPP  ++SPP  P TPP +SPP
Sbjct: 331 EASPPEPPSTPP---EASPPEPPSTPP--EASPPEPPSTPPASSPP 371

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 50/105 (47%), Positives = 59/105 (56%), Gaps = 9/105 (8%)
 Frame = +3

Query: 201 AGAQQPPSTSP---NASPAPPTPPTNTPP----TTPQASPPPVQSAPPTAQSSPP--PVQ 353
           A   +PPST P     +P+P TPP  +PP    T P+ASPP   S PP A    P  P +
Sbjct: 211 ASPPEPPSTPPPVPEPTPSPSTPPAASPPEPPSTPPEASPPEPPSTPPEAPPPEPLTPPE 270

Query: 354 ASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           ASPP   S PP V + +P P  STPP   +SPP  P TPP ASPP
Sbjct: 271 ASPPEPPSTPPSVPEPTPSP--STPP--AASPPEPPSTPPEASPP 311

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 45/93 (48%), Positives = 53/93 (56%), Gaps = 2/93 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV- 392
           PP   P ++P P   PT +P T P+ASPP   S PP A    PP   S PP  S P P+ 
Sbjct: 151 PPMNPPPSTPPPVPEPTPSPSTPPEASPPEPPSTPPEASPPEPP---STPPEASPPEPLT 207

Query: 393 -QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
             ++SPP   STPPPV   P P+P TPP ASPP
Sbjct: 208 PPEASPPEPPSTPPPV-PEPTPSPSTPPAASPP 239

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 49/108 (45%), Positives = 60/108 (55%), Gaps = 12/108 (11%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASP---------APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP--- 344
           A   +PPST P A P         +PP PP+ TPP+ P+ +P P  S PP A    P   
Sbjct: 248 ASPPEPPSTPPEAPPPEPLTPPEASPPEPPS-TPPSVPEPTPSP--STPPAASPPEPPST 304

Query: 345 PVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           P +ASPP   S PP   ++SPP   STPP  ++SPP  P TPP ASPP
Sbjct: 305 PPEASPPEPPSTPP---EASPPEPPSTPP--EASPPEPPSTPPEASPP 347

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/105 (44%), Positives = 56/105 (53%), Gaps = 10/105 (9%)
 Frame = +3

Query: 213 QPPSTSPNASPA-PPTPPTNTPPTTPQASPPPVQSA--PPTAQSSPPPVQASPPPVQ--S 377
           +PPST P  SP  PP      PP+TP A+ PP   +  PP +QS+PPP  A  PP    S
Sbjct: 372 EPPSTPPATSPPEPPAASPPEPPSTPPAASPPESPSVPPPESQSTPPPTPAMAPPESPPS 431

Query: 378 APPPVQQSSP---PPVS--STPPPVQSSPPPAPVTPPPASPPPAS 497
            PPP   S+P   PP S  STPPP   S  P P +P    P PA+
Sbjct: 432 TPPPESPSTPPRTPPESPPSTPPPESPSTTPPPESPSDPPPTPAA 476

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 49/114 (42%), Positives = 57/114 (50%), Gaps = 20/114 (17%)
 Frame = +3

Query: 216 PPSTSPNASPA------PPTPPTNTPPTTPQASPPPVQSAPP---------TAQSSPPPV 350
           PP+TSP   PA      P TPP  +PP +P   PP  QS PP         +  S+PPP 
Sbjct: 377 PPATSPPEPPAASPPEPPSTPPAASPPESPSVPPPESQSTPPPTPAMAPPESPPSTPPPE 436

Query: 351 QASPPPVQSAPPPVQQSSPPP--VSSTPPPVQ-SSPPPAPVTPPPASP--PPAS 497
             S PP    PP    S+PPP   S+TPPP   S PPP P    P SP  PPA+
Sbjct: 437 SPSTPP--RTPPESPPSTPPPESPSTTPPPESPSDPPPTPAATSPESPSDPPAT 488

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/109 (42%), Positives = 59/109 (54%), Gaps = 9/109 (8%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASP-----APPTPPTNTPPTTPQASPP--PVQSAPPTAQSSPPPVQA 356
           +A   +PPST P ASP      PP    +TPP TP  +PP  P  + PP + S+PP    
Sbjct: 387 AASPPEPPSTPPAASPPESPSVPPPESQSTPPPTPAMAPPESPPSTPPPESPSTPPRTPP 446

Query: 357 SPPPVQSAPPPVQQS-SPPPVS-STPPPVQSSPPPAPVTPPPASPPPAS 497
             PP  S PPP   S +PPP S S PPP  ++  P   + PPA+P P+S
Sbjct: 447 ESPP--STPPPESPSTTPPPESPSDPPPTPAATSPESPSDPPATPSPSS 493

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 50/122 (40%), Positives = 58/122 (47%), Gaps = 23/122 (18%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPP-TPPTNTPPTTPQASPP-----PVQSAPPTAQSSPPPV---Q 353
           A   +PPST P ASP  P TPP  +PP  P   PP     P  S PP A    PP    +
Sbjct: 188 ASPPEPPSTPPEASPPEPLTPPEASPPEPPSTPPPVPEPTPSPSTPPAASPPEPPSTPPE 247

Query: 354 ASPPPVQSAPPPVQ--------QSSPPPVSSTPP------PVQSSPPPAPVTPPPASPPP 491
           ASPP   S PP           ++SPP   STPP      P  S+PP A    PP++PP 
Sbjct: 248 ASPPEPPSTPPEAPPPEPLTPPEASPPEPPSTPPSVPEPTPSPSTPPAASPPEPPSTPPE 307

Query: 492 AS 497
           AS
Sbjct: 308 AS 309

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 34/79 (43%), Positives = 39/79 (49%)
 Frame = +3

Query: 252 PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPP 431
           P PP N PP+TP                  PPV   P P  S PP   ++SPP   STPP
Sbjct: 149 PVPPMNPPPSTP------------------PPV-PEPTPSPSTPP---EASPPEPPSTPP 186

Query: 432 PVQSSPPPAPVTPPPASPP 488
             ++SPP  P TPP ASPP
Sbjct: 187 --EASPPEPPSTPPEASPP 203

[86][TOP]
>UniRef100_B9HIU4 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9HIU4_POPTR
          Length = 685

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 48/109 (44%), Positives = 57/109 (52%), Gaps = 18/109 (16%)
 Frame = +3

Query: 219 PSTSPNASP-------APPTPP-------TNTPPTTPQASPPPVQSAPPTAQSSP----P 344
           PS+ PNA+P        PP PP       +N PP TP   PP    +PP + S+P    P
Sbjct: 40  PSSQPNANPPNPRNPSTPPPPPQPAPPALSNPPPATPLTPPPTTSQSPPLSGSAPNSNSP 99

Query: 345 PVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           P  ++ PPV S PPP   SS PP  S PPP+ S PPP    PP  SPPP
Sbjct: 100 PPPSATPPVSSPPPPPPPSSNPPSISPPPPLSSPPPPPSSRPPQNSPPP 148

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 48/108 (44%), Positives = 57/108 (52%), Gaps = 16/108 (14%)
 Frame = +3

Query: 216 PPSTS----PNASPAPPTPPTNTP------PTTPQASPPPVQSAPPTAQSSPPPVQASPP 365
           PPST+    P +SP PPT P++ P      P  P   PPP Q APP   + PP    +PP
Sbjct: 21  PPSTTSSSPPASSPPPPTSPSSQPNANPPNPRNPSTPPPPPQPAPPALSNPPPATPLTPP 80

Query: 366 PVQSAPPPVQQSSP----PPVSSTPPPVQSSPPPAPVT--PPPASPPP 491
           P  S  PP+  S+P    PP  S  PPV S PPP P +  PP  SPPP
Sbjct: 81  PTTSQSPPLSGSAPNSNSPPPPSATPPVSSPPPPPPPSSNPPSISPPP 128

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 45/94 (47%), Positives = 56/94 (59%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P +T P +SP PP PP++ PP+    SPPP  S+PP   SS PP Q SPPP    P  + 
Sbjct: 102 PSATPPVSSPPPPPPPSSNPPSI---SPPPPLSSPPPPPSSRPP-QNSPPPPPPTPSQLP 157

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            + PPP +S  PP +S PPPA   P  + PPPAS
Sbjct: 158 TNPPPPPASVSPPRRSHPPPASTPPENSPPPPAS 191

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 44/101 (43%), Positives = 53/101 (52%), Gaps = 7/101 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP T+  + P   + P +  P  P A+PP     PP   SS PP  + PPP+ S PPP  
Sbjct: 79  PPPTTSQSPPLSGSAPNSNSPPPPSATPPVSSPPPPPPPSSNPPSISPPPPLSSPPPPPS 138

Query: 396 ----QSSPPPVSSTPP--PVQSSPPPAPVTPPPAS-PPPAS 497
               Q+SPPP   TP   P    PPPA V+PP  S PPPAS
Sbjct: 139 SRPPQNSPPPPPPTPSQLPTNPPPPPASVSPPRRSHPPPAS 179

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 44/113 (38%), Positives = 56/113 (49%), Gaps = 23/113 (20%)
 Frame = +3

Query: 222 STSPNASPAPPTPPTNT---PPTTPQASPPPVQSAPPTAQSS--------------PPPV 350
           S SPN+ P   + P+N+   PP+T  +SPP     PPT+ SS              PPP 
Sbjct: 1   SPSPNSPPLAVSSPSNSTPPPPSTTSSSPPASSPPPPTSPSSQPNANPPNPRNPSTPPPP 60

Query: 351 QASPPPVQSAPPPVQQSSPPPVSSTPPPV------QSSPPPAPVTPPPASPPP 491
               PP  S PPP    +PPP +S  PP+       +SPPP   TPP +SPPP
Sbjct: 61  PQPAPPALSNPPPATPLTPPPTTSQSPPLSGSAPNSNSPPPPSATPPVSSPPP 113

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 41/98 (41%), Positives = 53/98 (54%), Gaps = 1/98 (1%)
 Frame = +3

Query: 207 AQQPPSTSPNAS-PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           +  PPS SP     +PP PP++ PP      PPP  S  PT  + PPP  +  PP +S P
Sbjct: 118 SSNPPSISPPPPLSSPPPPPSSRPPQNSPPPPPPTPSQLPT--NPPPPPASVSPPRRSHP 175

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PP   +S PP +S PPP   +P P+ V PPP   PP +
Sbjct: 176 PP---ASTPPENSPPPPASIAPLPSNVPPPPMLTPPTA 210

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 44/99 (44%), Positives = 50/99 (50%), Gaps = 8/99 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP--- 386
           PPS+ P  +  PP PPT  P   P   PPP  S  P  +S PPP  AS PP  S PP   
Sbjct: 136 PPSSRPPQNSPPPPPPT--PSQLPTNPPPPPASVSPPRRSHPPP--ASTPPENSPPPPAS 191

Query: 387 --PVQQSSPPPVSSTPPPVQSS-PPPAP--VTPPPASPP 488
             P+  + PPP   TPP   +  PPP P   TPP  SPP
Sbjct: 192 IAPLPSNVPPPPMLTPPTATAPLPPPVPSYSTPPALSPP 230

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 42/106 (39%), Positives = 52/106 (49%), Gaps = 9/106 (8%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTP---PTNTPPTTPQASPP----PVQSAPPTAQSSPPPVQASPP 365
           + +PP  SP   P PPTP   PTN PP     SPP    P  ++ P   S PPP   +P 
Sbjct: 138 SSRPPQNSP--PPPPPTPSQLPTNPPPPPASVSPPRRSHPPPASTPPENSPPPPASIAPL 195

Query: 366 PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP--ASPPPAS 497
           P  + PPP   + P   +  PPPV S   P  ++PP    SPPP S
Sbjct: 196 P-SNVPPPPMLTPPTATAPLPPPVPSYSTPPALSPPTIRLSPPPPS 240

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 36/91 (39%), Positives = 43/91 (47%), Gaps = 3/91 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPP---TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           P S SP     PP   TPP N+P       PPP   AP  +   PPP+   P      PP
Sbjct: 164 PASVSPPRRSHPPPASTPPENSP-------PPPASIAPLPSNVPPPPMLTPPTATAPLPP 216

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA 479
           PV   S PP  S PP ++ SPPP  +  PP+
Sbjct: 217 PVPSYSTPPALS-PPTIRLSPPPPSLVSPPS 246

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 34/84 (40%), Positives = 41/84 (48%), Gaps = 12/84 (14%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT-----------PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP 362
           P ST P  SP PP            PP  TPPT     PPPV S      S+PP +  SP
Sbjct: 177 PASTPPENSPPPPASIAPLPSNVPPPPMLTPPTATAPLPPPVPS-----YSTPPAL--SP 229

Query: 363 PPVQSAPPPVQQSSPP-PVSSTPP 431
           P ++ +PPP    SPP P ++T P
Sbjct: 230 PTIRLSPPPPSLVSPPSPTNNTAP 253

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 29/88 (32%), Positives = 42/88 (47%), Gaps = 6/88 (6%)
 Frame = +3

Query: 216 PPSTS---PNASPA--PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           PP  S   P ++P    P PP +  P      PPP+ + P      PPPV +   P   +
Sbjct: 169 PPRRSHPPPASTPPENSPPPPASIAPLPSNVPPPPMLTPPTATAPLPPPVPSYSTPPALS 228

Query: 381 PPPVQQSSPPPVSSTPP-PVQSSPPPAP 461
           PP ++ S PPP   +PP P  ++ P +P
Sbjct: 229 PPTIRLSPPPPSLVSPPSPTNNTAPNSP 256

[87][TOP]
>UniRef100_UPI0000DD9D0C Os11g0657400 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD9D0C
          Length = 1399

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/101 (50%), Positives = 63/101 (62%), Gaps = 9/101 (8%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSA--PPTAQSSPPP-VQASPPPVQ-SAP 383
            PP T P  S  P TP  ++PP+ P+AS PP + +  PP   S PPP V+  PPPV  S+P
Sbjct: 1087 PPET-PEKSYPPSTPEESSPPSVPKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSP 1145

Query: 384  PPVQQSSPP--PVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
            PP ++S PP  PV   PPP++S PPPAPV  PP    SPPP
Sbjct: 1146 PPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPP 1186

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 57/114 (50%), Positives = 65/114 (57%), Gaps = 13/114 (11%)
 Frame = +3

Query: 195  VSAGAQQPPSTSPNASPAP----PTPPTNTPPTTPQASPPP-VQSAPPTAQS--SPPPVQ 353
            V   +  PP  SP   PAP    P P  + PP  P  SPPP V+S PP A     PPPV+
Sbjct: 1140 VPVSSPPPPEKSP-PPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVK 1198

Query: 354  ASPP--PVQSAPPPVQQSSPP-PVSSTPPPVQSSPPPAPV---TPPPASPPPAS 497
            + PP  PV S PPPV+   PP PV   PPPV+S PPPAPV    PP  SPPPA+
Sbjct: 1199 SPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPEKSPPPAA 1252

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/107 (48%), Positives = 60/107 (56%), Gaps = 15/107 (14%)
 Frame = +3

Query: 216  PPSTSPNASP-------APPTPPTNTPPTTPQASPPPVQSAPPTAQ-SSPPPVQASPP-- 365
            PPST   +SP       +PPT  +  PP T    PP V+  PP    SSPPP + SPP  
Sbjct: 1096 PPSTPEESSPPSVPKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPP 1155

Query: 366  -PVQSAPPPVQQSSPP-PVSSTPPPVQSSPPPAPV---TPPPASPPP 491
             PV   PPP++   PP PV S PPPV+S PPPAPV    PP  SPPP
Sbjct: 1156 APVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPP 1202

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 51/105 (48%), Positives = 59/105 (56%), Gaps = 13/105 (12%)
 Frame = +3

Query: 216  PPSTSPNASPAP---PTPPTNTPPTTPQA--SPPPVQSAPPTAQ--SSPPPVQASPPPVQ 374
            PP+  P   P P   P PP  +PP        PPP++S PP A   S PPPV++ PPP  
Sbjct: 1130 PPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAP 1189

Query: 375  SA-PPPVQQSSPP--PVSSTPPPVQSSPPPAPV---TPPPASPPP 491
               PPP  +S PP  PV S PPPV+S PPPAPV    PP  SPPP
Sbjct: 1190 VILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPP 1234

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 54/119 (45%), Positives = 63/119 (52%), Gaps = 24/119 (20%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPP--TPPTNTP---PTTPQASPPP---VQSAPPTAQSSPPP--VQAS 359
            + PP  +P  SP PP  +PP   P   P  P  SPPP   V S PP  +S PPP  V   
Sbjct: 1166 KSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILP 1225

Query: 360  PPPVQSAPPPVQQSSPPPVSSTPPP----------VQSSPPPAPVTPPP----ASPPPA 494
            PPPV+S PPP    SPPP   +PPP          V+S PPPAPV+ PP    + PPPA
Sbjct: 1226 PPPVKSPPPPAPVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPPVKSLPPPA 1284

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 58/119 (48%), Positives = 65/119 (54%), Gaps = 24/119 (20%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPP--TPPTNTP---PTTPQASPPP---VQSAPPTAQSSPP--PVQAS 359
            + PP  +P  SP PP  +PP   P   P  P  SPPP   V S PP  +S PP  PV  S
Sbjct: 1198 KSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPEKSPPPAAPVILS 1257

Query: 360  PPPVQSAPPPVQQS-SPPPVSSTPPP---------VQSSPPPAPVT-PPPA---SPPPA 494
            PP V+S PPP   S  PPPV S PPP         V+S PPPAPV+ PPPA    PPPA
Sbjct: 1258 PPAVKSLPPPAPVSLPPPPVKSLPPPAPVSLPPPVVKSLPPPAPVSLPPPAVKPLPPPA 1316

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/98 (53%), Positives = 62/98 (63%), Gaps = 9/98 (9%)
 Frame = +3

Query: 222  STSPNASPAPPTPPT--NTPPTTPQASPP-PVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            ST P   P PP  PT  ++PP+  +  PP PV+S+PP A+ S PP    P PV+S  PPV
Sbjct: 989  STPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPP----PSPVESVLPPV 1044

Query: 393  QQSSPP--PVSSTPPPVQSSPPPAPVT--PPPA--SPP 488
            + SSPP  PV S PPP +SSPP  PVT  PPPA  SPP
Sbjct: 1045 K-SSPPHAPVISEPPPTKSSPPQVPVTSEPPPAKSSPP 1081

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 48/108 (44%), Positives = 64/108 (59%), Gaps = 10/108 (9%)
 Frame = +3

Query: 198  SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPP---TAQSSPPPVQA--SP 362
            S  ++ PPS +P +SP  P+     PP+  +++PPP +  PP   T  SSPP  +    P
Sbjct: 960  SEESEPPPSPTPKSSP--PSHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPP 1017

Query: 363  PPVQSAPPPVQQSSPPP--VSSTPPPVQSSPPPAPV---TPPPASPPP 491
             PV+S+PPP ++S PPP  V S  PPV+SSPP APV    PP  S PP
Sbjct: 1018 SPVKSSPPPAEKSQPPPSPVESVLPPVKSSPPHAPVISEPPPTKSSPP 1065

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/106 (48%), Positives = 58/106 (54%), Gaps = 19/106 (17%)
 Frame = +3

Query: 231  PNASPAPPTPPTNTPPTTPQASPPP---VQSAPPTAQSSPPPVQAS--PPPVQSAPPPVQ 395
            P  SP PP P  + PP  P+ SPPP   V  +PP  +S PPP   S  PPPV+S PPP  
Sbjct: 1228 PVKSPPPPAPVISPPP--PEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPPVKSLPPPAP 1285

Query: 396  QSSPP----------PVSSTPPPVQSSPPPAPVT-PPPA---SPPP 491
             S PP          PVS  PP V+  PPPAPV+ PPPA    PPP
Sbjct: 1286 VSLPPPVVKSLPPPAPVSLPPPAVKPLPPPAPVSLPPPAVKPLPPP 1331

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 47/115 (40%), Positives = 59/115 (51%), Gaps = 21/115 (18%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-----------VQA 356
            + PP  SP  SP     PT+ PP+      P  +S+PPT + SP P           V++
Sbjct: 779  KSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKS 838

Query: 357  SPPPVQ---SAPPPVQQSSPPP---VSSTPPPVQSSPPP----APVTPPPASPPP 491
            S PP +   S+PPP + SSPPP   VSS PPP +S PPP     P   P  SPPP
Sbjct: 839  SSPPPEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPP 893

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 51/124 (41%), Positives = 65/124 (52%), Gaps = 27/124 (21%)
 Frame = +3

Query: 204 GAQQPPST-----SPNASPAPPT---PPTN-TPPTTPQASPPPVQSAP--PTAQSSPPPV 350
           GA  PPS+     SP    APP    PPT  +PP TP++SPPP   +P  PTA  SPPPV
Sbjct: 509 GAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPV 568

Query: 351 ---------QASPPPVQSAPPPVQQSSPPPVSS--TPPPVQSSP-----PPAPVTPPPAS 482
                    ++ PP  +S P P  ++SPPP     TP P +S+P     PP P +   + 
Sbjct: 569 PEGHTPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSP 628

Query: 483 PPPA 494
           PPPA
Sbjct: 629 PPPA 632

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 45/109 (41%), Positives = 60/109 (55%), Gaps = 17/109 (15%)
 Frame = +3

Query: 222  STSPNASPAPPTPPTNTPPT-TPQASPPPVQSAPPT---AQSSPPPVQASPPPV---QSA 380
            S+ P    +PP P T +PPT TP+ SPPP   +PP+     SSPP  ++ PPP    +S+
Sbjct: 865  SSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSS 924

Query: 381  PPPVQQSSPP-PVSSTPPPVQSSP---------PPAPVTPPPASPPPAS 497
            PP  ++  PP P  STPPP + SP         PP+  + PP SP P S
Sbjct: 925  PPSHEEYVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKS 973

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/121 (38%), Positives = 61/121 (50%), Gaps = 25/121 (20%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPP----VQSAPPTAQSSPPPVQ--ASPPP 368
            A++    +P  SP+PP+    TPP+  ++S PP    V S PP   SSPPP    +SPPP
Sbjct: 810  AEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSSPPP 869

Query: 369  VQSAPPPVQQSSPP-------------------PVSSTPPPVQSSPPPAPVTPPPASPPP 491
             + +PPP +  SPP                   P SS+PP  +S PPP   TP P S PP
Sbjct: 870  PEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPP---TPTPKSSPP 926

Query: 492  A 494
            +
Sbjct: 927  S 927

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 22/114 (19%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTN--TPPTTPQASPPPVQSAPPTAQSSPP-------PVQA---S 359
            PP +SP    +PP PPT+  +PPT  + +P P +S+PP  +S PP       P +A   S
Sbjct: 739  PPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTS 798

Query: 360  PPPVQSAPP-PVQQSSP--PPVSSTPPPVQSSPPPAPV---TPPP----ASPPP 491
            PPP + +PP P ++SSP  P  S +PP      PP+PV   +PPP    +SPPP
Sbjct: 799  PPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPP 852

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 43/119 (36%), Positives = 64/119 (53%), Gaps = 19/119 (15%)
 Frame = +3

Query: 198  SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQ-------------SAPPTAQ-S 335
            S  ++  P++ P +  +PPTP   + P TP+ SP P               S PP A  S
Sbjct: 789  SPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVS 848

Query: 336  SPPPVQASPPPVQ---SAPPPVQQSSPPPVSSTPPPV--QSSPPPAPVTPPPASPPPAS 497
            SPPP ++S PP +   S+PPP ++S PPP + +PP +  + SPPP   +PP  +P  +S
Sbjct: 849  SPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSS 907

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/112 (41%), Positives = 60/112 (53%), Gaps = 20/112 (17%)
 Frame = +3

Query: 216  PPSTSPNASP--APPTPPTNTPPTTPQAS-PPPVQSAPPTAQSSPP-----------PVQ 353
            P  +SP  +P  + P P  ++PP  P  S PPP +S+PP    SPP           P +
Sbjct: 1043 PVKSSPPHAPVISEPPPTKSSPPQVPVTSEPPPAKSSPPHEPISPPETPEKSYPPSTPEE 1102

Query: 354  ASPPPVQSAP-PPVQQSSPPP--VSSTPPPVQSSPPPAPVT---PPPASPPP 491
            +SPP V  A  PP ++S PPP  VS  PP V+  PPP PV+   PP  SPPP
Sbjct: 1103 SSPPSVPKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPP 1154

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 54/110 (49%), Positives = 61/110 (55%), Gaps = 17/110 (15%)
 Frame = +3

Query: 213  QPPSTS--PNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPV-QASPPPVQ-SA 380
            Q P TS  P A  +PP  P + PP TP+ S PP  S P   +SSPP V +AS PP + S 
Sbjct: 1066 QVPVTSEPPPAKSSPPHEPIS-PPETPEKSYPP--STPE--ESSPPSVPKASSPPTEKSL 1120

Query: 381  PPPVQQSSPP----------PVSSTPPPVQSSPPPAPV---TPPPASPPP 491
            PPP   S PP          PVSS PPP +S PPPAPV    PP  SPPP
Sbjct: 1121 PPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPP 1170

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 43/104 (41%), Positives = 62/104 (59%), Gaps = 10/104 (9%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPPTPPTNTPPT-TPQASPPPVQS--APPTAQSSPPPVQASPPP--VQ 374
            + PPS +P +S +PP+  +  PPT TP++SPP  +    P  A+S+PPP + SPP    +
Sbjct: 896  KSPPSHTPESS-SPPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPSHTPE 954

Query: 375  SAPPPVQQSSPPP---VSSTPPPVQSSPPPAPV--TPPPASPPP 491
            S+ PP ++S PPP     S+PP  +   PP+P   TPPP  P P
Sbjct: 955  SSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLP 998

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 44/105 (41%), Positives = 64/105 (60%), Gaps = 11/105 (10%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPPTPPTNTPPT-TPQASPPPVQS--APPTAQSSPPPVQASPP---PV 371
            + PPS +P +S +PP+  +  PP+ TP++SPP  +    P  A+S+PPP +  PP    +
Sbjct: 946  KSPPSHTPESS-SPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLPPHTPTI 1004

Query: 372  QSAPPPVQQSSPP-PVSSTPPPVQ-SSPPPAP---VTPPPASPPP 491
             S+PP  ++  PP PV S+PPP + S PPP+P   V PP  S PP
Sbjct: 1005 NSSPPSEEEYMPPSPVKSSPPPAEKSQPPPSPVESVLPPVKSSPP 1049

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 45/106 (42%), Positives = 58/106 (54%), Gaps = 12/106 (11%)
 Frame = +3

Query: 216  PPSTSP-NASPA------PPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPP--PVQASP 362
            PP T   N+SP       PP+P  ++PP   ++ PPP  V+S  P  +SSPP  PV + P
Sbjct: 998  PPHTPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPPPSPVESVLPPVKSSPPHAPVISEP 1057

Query: 363  PPVQSAPPPVQQSS-PPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            PP +S+PP V  +S PPP  S+PP    SPP  P    P S P  S
Sbjct: 1058 PPTKSSPPQVPVTSEPPPAKSSPPHEPISPPETPEKSYPPSTPEES 1103

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 42/103 (40%), Positives = 60/103 (58%), Gaps = 10/103 (9%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPP--TPPTNTP----PTTPQASPPPVQSAPPTAQSSPPPVQ--ASPP 365
            + PP+ +P  SP P   +PP++TP    P + ++ PPP     PT +SSPP  +    P 
Sbjct: 880  KSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPT----PTPKSSPPSHEEYVPPS 935

Query: 366  PVQSAPPPVQQSSP--PPVSSTPPPVQSSPPPAPVTPPPASPP 488
            P +S PPP ++S P   P SS+PP  +S PPP+P   P +SPP
Sbjct: 936  PAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPT--PKSSPP 976

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 42/106 (39%), Positives = 55/106 (51%), Gaps = 15/106 (14%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNT---PPTTPQA-SPPPVQSAPPTAQSSPPPVQAS---PPPVQ 374
           PP ++P +  +PPTP +     PP TP+  +P P +S PPT +S P P   S   PPP  
Sbjct: 640 PPESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAP 699

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSS----PPPAP----VTPPPASPP 488
               P    S PPV  +PP  +S     PPPAP     +PP +SPP
Sbjct: 700 EGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGHTPSPPKSSPP 745

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 47/106 (44%), Positives = 55/106 (51%), Gaps = 13/106 (12%)
 Frame = +3

Query: 216  PPSTSPNASP---APPTPPTNTPPTTPQASPPPVQSAPPTAQ-SSPPPVQAS--PPPVQS 377
            P  + P A+P   +PP   +  PP      PPPV+S PP A  S PPPV  S  PP   S
Sbjct: 1244 PEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPPVKSLPPPAPVSLPPPVVKSLPPPAPVS 1303

Query: 378  APPPVQQSSPP--PVSSTPPPVQSSPPPAPVT--PPP---ASPPPA 494
             PPP  +  PP  PVS  PP V+  PPP P    PPP   + PPPA
Sbjct: 1304 LPPPAVKPLPPPAPVSLPPPAVKPLPPPVPQVSLPPPKQESLPPPA 1349

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 43/112 (38%), Positives = 60/112 (53%), Gaps = 16/112 (14%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAP--PTAQSSPP--------PVQAS 359
            + PP+    AS  PP  P    P+ P++SPP  +S P  PT+ +SPP        P ++S
Sbjct: 715  KSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSS 774

Query: 360  PPPVQSAPPPVQQSSPPPVS--STPPPVQSSPP-PAPVTPPPA---SPPPAS 497
            PP  +S PP   + SPP  +  ++PPP + SPP PA  + PP    SP P S
Sbjct: 775  PPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSPPS 826

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 48/147 (32%), Positives = 66/147 (44%), Gaps = 48/147 (32%)
 Frame = +3

Query: 198  SAGAQQPPSTSPNASPAPP--TPPTNTPPTTPQA-------------------SPPPVQS 314
            S  +  PP T    +P+PP  TPPT   P TP++                   S PPV+ 
Sbjct: 656  SKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEK 715

Query: 315  APPTAQS-------------SPPPVQASPPPVQSAP-PPVQQSSPP--------PVSSTP 428
            +PPT +S             +P P ++SPP  +S P PP   +SPP        P  S+P
Sbjct: 716  SPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSP 775

Query: 429  PPVQSSPPPAPVTPPPA-----SPPPA 494
            P  +S PP +P   PP+     SPPP+
Sbjct: 776  PEEKSPPPHSPEKSPPSEAHPTSPPPS 802

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 41/97 (42%), Positives = 50/97 (51%), Gaps = 8/97 (8%)
 Frame = +3

Query: 225 TSPNASPAPPTPPTN--TPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP-PVQ 395
           TSP A    P PP++   P +  +   PP Q+ PPT  S P   ++SPPP   +PP P  
Sbjct: 502 TSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTA 561

Query: 396 QSSPPPV--SSTPPPVQSSPPPAPVTPPP---ASPPP 491
             SPPPV    TP P +S PP     P P   ASPPP
Sbjct: 562 SHSPPPVPEGHTPSPPKSGPPAGESPPTPESKASPPP 598

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 42/103 (40%), Positives = 55/103 (53%), Gaps = 10/103 (9%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPP-TNTPPTTPQA-SPPPVQSAPPTAQSSP-PPVQASPPPVQSAPP 386
           P S+ P    +PPTP  +++PP  P+  +P P +S PP  +S P P  +ASPPP      
Sbjct: 545 PESSPPPEGKSPPTPTASHSPPPVPEGHTPSPPKSGPPAGESPPTPESKASPPPTPEEYT 604

Query: 387 PVQQSSPPPVSSTPPPVQSS----PPPAPV--TP-PPASPPPA 494
           P    S PP   +PP  +S     PPPAP   TP PP S PP+
Sbjct: 605 PSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPS 647

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 39/106 (36%), Positives = 53/106 (50%), Gaps = 14/106 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP---PTNTPPTTPQA-SPPPVQSAPPTAQSSPPP---VQASPPPVQ 374
           PP ++P A  +PPTP    ++ PP  P+  +P P +S PP+ +S P P     + PPP  
Sbjct: 607 PPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTP 666

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSS----PPPAP---VTPPPASPPP 491
               P    S PP   +PP  +S     PPPAP   +  PP S PP
Sbjct: 667 EGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPP 712

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 48/126 (38%), Positives = 66/126 (52%), Gaps = 34/126 (26%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTA---------QSSPP--PVQASP 362
            PPS  P  S  PP   +  PP+  ++  PPV+S+PP A         +SSPP  PV + P
Sbjct: 1016 PPS--PVKSSPPPAEKSQPPPSPVESVLPPVKSSPPHAPVISEPPPTKSSPPQVPVTSEP 1073

Query: 363  PPVQSAPP--PV---------------QQSSPP--PVSSTPPPVQSSPPPAPVTPPPAS- 482
            PP +S+PP  P+               ++SSPP  P +S+PP  +S PPPA V+ PP + 
Sbjct: 1074 PPAKSSPPHEPISPPETPEKSYPPSTPEESSPPSVPKASSPPTEKSLPPPATVSLPPPTV 1133

Query: 483  ---PPP 491
               PPP
Sbjct: 1134 KPLPPP 1139

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 47/120 (39%), Positives = 57/120 (47%), Gaps = 26/120 (21%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPP---VQSAPPTAQSSPPPV---------QAS 359
            PPS   ++SP PP    ++PP    +SPPP   V S PP  +S PPP          + S
Sbjct: 832  PPSPVKSSSP-PPEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEIS 890

Query: 360  PPPVQSAPP--PVQQSSPPPVSSTPPPV---QSSPP---------PAPVTPPPASPPPAS 497
            PPP   +PP    + SSPP   S PPP    +SSPP         PA  TPPP    P S
Sbjct: 891  PPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPS 950

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/95 (40%), Positives = 51/95 (53%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNT--PPTTPQASPPPVQSAPPTAQSSPPPV-QASPPPVQSAPP 386
           PP + P A  +PPTP +    PPT  + +P P +S PP  +S P P  +AS PP    PP
Sbjct: 576 PPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPP----PP 631

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             +  +P P  STPP  +S  PP P +   + PPP
Sbjct: 632 APEGHTPSPPESTPPSEKS--PPTPESKASSPPPP 664

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 43/117 (36%), Positives = 60/117 (51%), Gaps = 22/117 (18%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS-------------SPPPV 350
           + PP+    ASP PPTP   TP  +P  S PP + +PPT +S             +P P 
Sbjct: 585 ESPPTPESKASP-PPTPEEYTP--SPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPP 641

Query: 351 QASPPPVQSAPPPVQQ-SSPPPVS---STPPPVQSSP-----PPAPVTPPPASPPPA 494
           +++PP  +S P P  + SSPPP +    TP P +S+P     PP P +   + PPPA
Sbjct: 642 ESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPA 698

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 47/127 (37%), Positives = 60/127 (47%), Gaps = 28/127 (22%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTP-PTNTPPTTP-QASPPPVQS-----APPTAQSSPPPVQA 356
           S G   P   SP   P  PTP PT + P +P + +PPP  +     +PP    +PPP  +
Sbjct: 457 SHGPPPPEEESPEEPPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSS 516

Query: 357 ----------------SPPPVQSAPPPVQQSSPPPVSSTPP-PVQS-SPPPAPV--TP-P 473
                           + PP + +PP   +SSPPP   +PP P  S SPPP P   TP P
Sbjct: 517 GWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPVPEGHTPSP 576

Query: 474 PASPPPA 494
           P S PPA
Sbjct: 577 PKSGPPA 583

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 49/108 (45%), Positives = 55/108 (50%), Gaps = 15/108 (13%)
 Frame = +3

Query: 216  PPSTSPNASPAP----PTPPTNTPPTTPQASPPPV-QSAPPTAQSS--PPPVQASPPP-- 368
            PP+      PAP    P P  + PP  P + PPPV +S PP A  S  PP V+  PPP  
Sbjct: 1258 PPAVKSLPPPAPVSLPPPPVKSLPPPAPVSLPPPVVKSLPPPAPVSLPPPAVKPLPPPAP 1317

Query: 369  VQSAPPPVQQSSPP-PVSSTPPPVQSS-PPPA-PVTPPPA---SPPPA 494
            V   PP V+   PP P  S PPP Q S PPPA     PPA    PPPA
Sbjct: 1318 VSLPPPAVKPLPPPVPQVSLPPPKQESLPPPAKEAEAPPAKESKPPPA 1365

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 38/102 (37%), Positives = 52/102 (50%), Gaps = 11/102 (10%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNT---PPTTPQA-SPPPVQSAPPTAQSSP--PPVQASPPPVQS 377
            PP ++P    +PPTP +     PP  P+  +P P +S+PP  +S P  P    SPP  + 
Sbjct: 706  PPKSTPPVEKSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEE 765

Query: 378  APPPVQQSSPPPVSSTPPPVQSSPPPA---PVTPPPA--SPP 488
              P   +SSPP   S PP      PP+   P +PPP+  SPP
Sbjct: 766  YTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPP 807

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 44/112 (39%), Positives = 60/112 (53%), Gaps = 16/112 (14%)
 Frame = +3

Query: 207 AQQPPSTSPNA-SPAPP--TPPTNTPPTTPQ--ASPPPVQSAPPTAQS-SPPPVQASPPP 368
           A  PP  +P   +P+PP  TPP+   P TP+  AS PP    PPT +  +P P +++PP 
Sbjct: 625 ASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPP----PPTPEGHTPSPPKSTPPT 680

Query: 369 VQSAPPPVQQSSPPP-------VSSTP---PPVQSSPPPAPVTPPPASPPPA 494
            +S P P  +SS PP       + S P   PPV+ S PP P +   + PPPA
Sbjct: 681 EKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKS-PPTPESEASSPPPPA 731

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 42/98 (42%), Positives = 51/98 (52%), Gaps = 10/98 (10%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPT--NTPPTTPQASPPP-VQSAPPTAQSS--PPPVQASPPPVQ-- 374
            P  + P  +P    PP   + PP  P + PPP V+  PP A  S  PP V+  PPPV   
Sbjct: 1276 PVKSLPPPAPVSLPPPVVKSLPPPAPVSLPPPAVKPLPPPAPVSLPPPAVKPLPPPVPQV 1335

Query: 375  SAPPPVQQSSPPPV--SSTPPPVQSSPPPA-PVTPPPA 479
            S PPP Q+S PPP   +  PP  +S PPPA     PPA
Sbjct: 1336 SLPPPKQESLPPPAKEAEAPPAKESKPPPAMEAEAPPA 1373

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 43/121 (35%), Positives = 54/121 (44%), Gaps = 9/121 (7%)
 Frame = +3

Query: 162 VLVVGLICAVFVSAGAQQP--PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS 335
           VL   + C+  V  G   P  PS  P   P  P P    P  +P    PP   + PT+  
Sbjct: 401 VLARPVDCSKHVCPGHPTPGKPSEPPEKPPLIPVP-VGPPEKSPAYEEPPAAPSTPTSHG 459

Query: 336 SPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAP----VTPPPA---SPPPA 494
            PPP + SP       PP + +  P  SS   P + +PPPAP    VT PPA   +PPP 
Sbjct: 460 PPPPEEESPEE-----PPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPP 514

Query: 495 S 497
           S
Sbjct: 515 S 515

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 40/103 (38%), Positives = 50/103 (48%), Gaps = 16/103 (15%)
 Frame = +3

Query: 231  PNASPAPPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPPVQ--ASPPPVQ-SAPPPVQ 395
            P     PP  P + PP   +  PPP  V   PP  +  PPPV   + PPP Q S PPP +
Sbjct: 1291 PVVKSLPPPAPVSLPPPAVKPLPPPAPVSLPPPAVKPLPPPVPQVSLPPPKQESLPPPAK 1350

Query: 396  QSSPPPV--SSTPPPVQSSPPPA---PVTPPP------ASPPP 491
            ++  PP   S  PP +++  PPA    V  PP      ASPPP
Sbjct: 1351 EAEAPPAKESKPPPAMEAEAPPAFDTTVLLPPVMAHQYASPPP 1393

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 40/114 (35%), Positives = 52/114 (45%), Gaps = 22/114 (19%)
 Frame = +3

Query: 216 PPSTSP---NASPAPPTPPTNTPPTTPQASP--PPVQSAP-PTAQSSPPPVQASPPPVQS 377
           PP  SP       AP TP ++ PP   + SP  PP +  P PT  S   P + +PPP  +
Sbjct: 438 PPEKSPAYEEPPAAPSTPTSHGPPPPEEESPEEPPEEPTPSPTPSSPESPAKMAPPPAPA 497

Query: 378 ----APPPVQQSSPPPVSS----------TPPPVQSSPPP--APVTPPPASPPP 491
                 PP +  +PPP SS            PP Q+ PP   +P   P +SPPP
Sbjct: 498 IKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPP 551

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 37/125 (29%), Positives = 51/125 (40%), Gaps = 21/125 (16%)
 Frame = +3

Query: 180 ICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPP-TTPQASP--PPVQSAPPTAQSSP--P 344
           +C    + G    P   P   P P  PP  +P    P A+P  P     PP  + SP  P
Sbjct: 412 VCPGHPTPGKPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHGPPPPEEESPEEP 471

Query: 345 PVQASPPPVQSAPPPVQQSSPPPVSS----TPPPVQSSPPPAPVT------------PPP 476
           P + +P P  S+P    + +PPP  +    T PP +   PP P +            PPP
Sbjct: 472 PEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPP 531

Query: 477 ASPPP 491
            + PP
Sbjct: 532 QAEPP 536

[88][TOP]
>UniRef100_B9G8N7 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=B9G8N7_ORYSJ
          Length = 1360

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/101 (50%), Positives = 63/101 (62%), Gaps = 9/101 (8%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSA--PPTAQSSPPP-VQASPPPVQ-SAP 383
            PP T P  S  P TP  ++PP+ P+AS PP + +  PP   S PPP V+  PPPV  S+P
Sbjct: 1087 PPET-PEKSYPPSTPEESSPPSVPKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSP 1145

Query: 384  PPVQQSSPP--PVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
            PP ++S PP  PV   PPP++S PPPAPV  PP    SPPP
Sbjct: 1146 PPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPP 1186

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 57/114 (50%), Positives = 65/114 (57%), Gaps = 13/114 (11%)
 Frame = +3

Query: 195  VSAGAQQPPSTSPNASPAP----PTPPTNTPPTTPQASPPP-VQSAPPTAQS--SPPPVQ 353
            V   +  PP  SP   PAP    P P  + PP  P  SPPP V+S PP A     PPPV+
Sbjct: 1140 VPVSSPPPPEKSP-PPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVK 1198

Query: 354  ASPP--PVQSAPPPVQQSSPP-PVSSTPPPVQSSPPPAPV---TPPPASPPPAS 497
            + PP  PV S PPPV+   PP PV   PPPV+S PPPAPV    PP  SPPPA+
Sbjct: 1199 SPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPEKSPPPAA 1252

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/107 (48%), Positives = 60/107 (56%), Gaps = 15/107 (14%)
 Frame = +3

Query: 216  PPSTSPNASP-------APPTPPTNTPPTTPQASPPPVQSAPPTAQ-SSPPPVQASPP-- 365
            PPST   +SP       +PPT  +  PP T    PP V+  PP    SSPPP + SPP  
Sbjct: 1096 PPSTPEESSPPSVPKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPP 1155

Query: 366  -PVQSAPPPVQQSSPP-PVSSTPPPVQSSPPPAPV---TPPPASPPP 491
             PV   PPP++   PP PV S PPPV+S PPPAPV    PP  SPPP
Sbjct: 1156 APVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPP 1202

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 51/105 (48%), Positives = 59/105 (56%), Gaps = 13/105 (12%)
 Frame = +3

Query: 216  PPSTSPNASPAP---PTPPTNTPPTTPQA--SPPPVQSAPPTAQ--SSPPPVQASPPPVQ 374
            PP+  P   P P   P PP  +PP        PPP++S PP A   S PPPV++ PPP  
Sbjct: 1130 PPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAP 1189

Query: 375  SA-PPPVQQSSPP--PVSSTPPPVQSSPPPAPV---TPPPASPPP 491
               PPP  +S PP  PV S PPPV+S PPPAPV    PP  SPPP
Sbjct: 1190 VILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPP 1234

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/98 (53%), Positives = 62/98 (63%), Gaps = 9/98 (9%)
 Frame = +3

Query: 222  STSPNASPAPPTPPT--NTPPTTPQASPP-PVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            ST P   P PP  PT  ++PP+  +  PP PV+S+PP A+ S PP    P PV+S  PPV
Sbjct: 989  STPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPP----PSPVESVLPPV 1044

Query: 393  QQSSPP--PVSSTPPPVQSSPPPAPVT--PPPA--SPP 488
            + SSPP  PV S PPP +SSPP  PVT  PPPA  SPP
Sbjct: 1045 K-SSPPHAPVISEPPPTKSSPPQVPVTSEPPPAKSSPP 1081

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 48/108 (44%), Positives = 64/108 (59%), Gaps = 10/108 (9%)
 Frame = +3

Query: 198  SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPP---TAQSSPPPVQA--SP 362
            S  ++ PPS +P +SP  P+     PP+  +++PPP +  PP   T  SSPP  +    P
Sbjct: 960  SEESEPPPSPTPKSSP--PSHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPP 1017

Query: 363  PPVQSAPPPVQQSSPPP--VSSTPPPVQSSPPPAPV---TPPPASPPP 491
             PV+S+PPP ++S PPP  V S  PPV+SSPP APV    PP  S PP
Sbjct: 1018 SPVKSSPPPAEKSQPPPSPVESVLPPVKSSPPHAPVISEPPPTKSSPP 1065

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 47/115 (40%), Positives = 59/115 (51%), Gaps = 21/115 (18%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-----------VQA 356
            + PP  SP  SP     PT+ PP+      P  +S+PPT + SP P           V++
Sbjct: 779  KSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKS 838

Query: 357  SPPPVQ---SAPPPVQQSSPPP---VSSTPPPVQSSPPP----APVTPPPASPPP 491
            S PP +   S+PPP + SSPPP   VSS PPP +S PPP     P   P  SPPP
Sbjct: 839  SSPPPEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPP 893

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 51/124 (41%), Positives = 65/124 (52%), Gaps = 27/124 (21%)
 Frame = +3

Query: 204 GAQQPPST-----SPNASPAPPT---PPTN-TPPTTPQASPPPVQSAP--PTAQSSPPPV 350
           GA  PPS+     SP    APP    PPT  +PP TP++SPPP   +P  PTA  SPPPV
Sbjct: 509 GAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPV 568

Query: 351 ---------QASPPPVQSAPPPVQQSSPPPVSS--TPPPVQSSP-----PPAPVTPPPAS 482
                    ++ PP  +S P P  ++SPPP     TP P +S+P     PP P +   + 
Sbjct: 569 PEGHTPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSP 628

Query: 483 PPPA 494
           PPPA
Sbjct: 629 PPPA 632

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 45/109 (41%), Positives = 60/109 (55%), Gaps = 17/109 (15%)
 Frame = +3

Query: 222  STSPNASPAPPTPPTNTPPT-TPQASPPPVQSAPPT---AQSSPPPVQASPPPV---QSA 380
            S+ P    +PP P T +PPT TP+ SPPP   +PP+     SSPP  ++ PPP    +S+
Sbjct: 865  SSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSS 924

Query: 381  PPPVQQSSPP-PVSSTPPPVQSSP---------PPAPVTPPPASPPPAS 497
            PP  ++  PP P  STPPP + SP         PP+  + PP SP P S
Sbjct: 925  PPSHEEYVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKS 973

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/121 (38%), Positives = 61/121 (50%), Gaps = 25/121 (20%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPP----VQSAPPTAQSSPPPVQ--ASPPP 368
            A++    +P  SP+PP+    TPP+  ++S PP    V S PP   SSPPP    +SPPP
Sbjct: 810  AEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSSPPP 869

Query: 369  VQSAPPPVQQSSPP-------------------PVSSTPPPVQSSPPPAPVTPPPASPPP 491
             + +PPP +  SPP                   P SS+PP  +S PPP   TP P S PP
Sbjct: 870  PEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPP---TPTPKSSPP 926

Query: 492  A 494
            +
Sbjct: 927  S 927

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 22/114 (19%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTN--TPPTTPQASPPPVQSAPPTAQSSPP-------PVQA---S 359
            PP +SP    +PP PPT+  +PPT  + +P P +S+PP  +S PP       P +A   S
Sbjct: 739  PPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTS 798

Query: 360  PPPVQSAPP-PVQQSSP--PPVSSTPPPVQSSPPPAPV---TPPP----ASPPP 491
            PPP + +PP P ++SSP  P  S +PP      PP+PV   +PPP    +SPPP
Sbjct: 799  PPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPP 852

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 43/119 (36%), Positives = 64/119 (53%), Gaps = 19/119 (15%)
 Frame = +3

Query: 198  SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQ-------------SAPPTAQ-S 335
            S  ++  P++ P +  +PPTP   + P TP+ SP P               S PP A  S
Sbjct: 789  SPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVS 848

Query: 336  SPPPVQASPPPVQ---SAPPPVQQSSPPPVSSTPPPV--QSSPPPAPVTPPPASPPPAS 497
            SPPP ++S PP +   S+PPP ++S PPP + +PP +  + SPPP   +PP  +P  +S
Sbjct: 849  SPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSS 907

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/112 (41%), Positives = 60/112 (53%), Gaps = 20/112 (17%)
 Frame = +3

Query: 216  PPSTSPNASP--APPTPPTNTPPTTPQAS-PPPVQSAPPTAQSSPP-----------PVQ 353
            P  +SP  +P  + P P  ++PP  P  S PPP +S+PP    SPP           P +
Sbjct: 1043 PVKSSPPHAPVISEPPPTKSSPPQVPVTSEPPPAKSSPPHEPISPPETPEKSYPPSTPEE 1102

Query: 354  ASPPPVQSAP-PPVQQSSPPP--VSSTPPPVQSSPPPAPVT---PPPASPPP 491
            +SPP V  A  PP ++S PPP  VS  PP V+  PPP PV+   PP  SPPP
Sbjct: 1103 SSPPSVPKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPP 1154

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 54/110 (49%), Positives = 61/110 (55%), Gaps = 17/110 (15%)
 Frame = +3

Query: 213  QPPSTS--PNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPV-QASPPPVQ-SA 380
            Q P TS  P A  +PP  P + PP TP+ S PP  S P   +SSPP V +AS PP + S 
Sbjct: 1066 QVPVTSEPPPAKSSPPHEPIS-PPETPEKSYPP--STPE--ESSPPSVPKASSPPTEKSL 1120

Query: 381  PPPVQQSSPP----------PVSSTPPPVQSSPPPAPV---TPPPASPPP 491
            PPP   S PP          PVSS PPP +S PPPAPV    PP  SPPP
Sbjct: 1121 PPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPP 1170

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 43/104 (41%), Positives = 62/104 (59%), Gaps = 10/104 (9%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPPTPPTNTPPT-TPQASPPPVQS--APPTAQSSPPPVQASPPP--VQ 374
            + PPS +P +S +PP+  +  PPT TP++SPP  +    P  A+S+PPP + SPP    +
Sbjct: 896  KSPPSHTPESS-SPPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPSHTPE 954

Query: 375  SAPPPVQQSSPPP---VSSTPPPVQSSPPPAPV--TPPPASPPP 491
            S+ PP ++S PPP     S+PP  +   PP+P   TPPP  P P
Sbjct: 955  SSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLP 998

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 44/105 (41%), Positives = 64/105 (60%), Gaps = 11/105 (10%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPPTPPTNTPPT-TPQASPPPVQS--APPTAQSSPPPVQASPP---PV 371
            + PPS +P +S +PP+  +  PP+ TP++SPP  +    P  A+S+PPP +  PP    +
Sbjct: 946  KSPPSHTPESS-SPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLPPHTPTI 1004

Query: 372  QSAPPPVQQSSPP-PVSSTPPPVQ-SSPPPAP---VTPPPASPPP 491
             S+PP  ++  PP PV S+PPP + S PPP+P   V PP  S PP
Sbjct: 1005 NSSPPSEEEYMPPSPVKSSPPPAEKSQPPPSPVESVLPPVKSSPP 1049

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 45/106 (42%), Positives = 58/106 (54%), Gaps = 12/106 (11%)
 Frame = +3

Query: 216  PPSTSP-NASPA------PPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPP--PVQASP 362
            PP T   N+SP       PP+P  ++PP   ++ PPP  V+S  P  +SSPP  PV + P
Sbjct: 998  PPHTPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPPPSPVESVLPPVKSSPPHAPVISEP 1057

Query: 363  PPVQSAPPPVQQSS-PPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            PP +S+PP V  +S PPP  S+PP    SPP  P    P S P  S
Sbjct: 1058 PPTKSSPPQVPVTSEPPPAKSSPPHEPISPPETPEKSYPPSTPEES 1103

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 42/103 (40%), Positives = 60/103 (58%), Gaps = 10/103 (9%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPP--TPPTNTP----PTTPQASPPPVQSAPPTAQSSPPPVQ--ASPP 365
            + PP+ +P  SP P   +PP++TP    P + ++ PPP     PT +SSPP  +    P 
Sbjct: 880  KSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPT----PTPKSSPPSHEEYVPPS 935

Query: 366  PVQSAPPPVQQSSP--PPVSSTPPPVQSSPPPAPVTPPPASPP 488
            P +S PPP ++S P   P SS+PP  +S PPP+P   P +SPP
Sbjct: 936  PAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPT--PKSSPP 976

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 42/106 (39%), Positives = 55/106 (51%), Gaps = 15/106 (14%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNT---PPTTPQA-SPPPVQSAPPTAQSSPPPVQAS---PPPVQ 374
           PP ++P +  +PPTP +     PP TP+  +P P +S PPT +S P P   S   PPP  
Sbjct: 640 PPESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAP 699

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSS----PPPAP----VTPPPASPP 488
               P    S PPV  +PP  +S     PPPAP     +PP +SPP
Sbjct: 700 EGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGHTPSPPKSSPP 745

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 51/130 (39%), Positives = 61/130 (46%), Gaps = 35/130 (26%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPTAQS-SPPPVQASPPP---V 371
            + PP  +P  SP PP  +PP   P   P   PPPV+S PP A   SPPP + SPPP   V
Sbjct: 1198 KSPPPPAPVISPPPPVKSPPPPAPVILP---PPPVKSPPPPAPVISPPPPEKSPPPAAPV 1254

Query: 372  QSAPPPVQQSSPP-PVSSTPPPVQSSPPPAPVTPPP------------------------ 476
              +PP V+   PP PVS  P PV+S PP APV+ PP                        
Sbjct: 1255 ILSPPAVKSLPPPAPVSLPPSPVKSLPPRAPVSLPPRVVKSLPPRAPVSLPQPAVKPFPQ 1314

Query: 477  ----ASPPPA 494
                + PPPA
Sbjct: 1315 RAPVSLPPPA 1324

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 43/112 (38%), Positives = 60/112 (53%), Gaps = 16/112 (14%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAP--PTAQSSPP--------PVQAS 359
            + PP+    AS  PP  P    P+ P++SPP  +S P  PT+ +SPP        P ++S
Sbjct: 715  KSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSS 774

Query: 360  PPPVQSAPPPVQQSSPPPVS--STPPPVQSSPP-PAPVTPPPA---SPPPAS 497
            PP  +S PP   + SPP  +  ++PPP + SPP PA  + PP    SP P S
Sbjct: 775  PPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSPPS 826

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 48/147 (32%), Positives = 66/147 (44%), Gaps = 48/147 (32%)
 Frame = +3

Query: 198  SAGAQQPPSTSPNASPAPP--TPPTNTPPTTPQA-------------------SPPPVQS 314
            S  +  PP T    +P+PP  TPPT   P TP++                   S PPV+ 
Sbjct: 656  SKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEK 715

Query: 315  APPTAQS-------------SPPPVQASPPPVQSAP-PPVQQSSPP--------PVSSTP 428
            +PPT +S             +P P ++SPP  +S P PP   +SPP        P  S+P
Sbjct: 716  SPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSP 775

Query: 429  PPVQSSPPPAPVTPPPA-----SPPPA 494
            P  +S PP +P   PP+     SPPP+
Sbjct: 776  PEEKSPPPHSPEKSPPSEAHPTSPPPS 802

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 41/97 (42%), Positives = 50/97 (51%), Gaps = 8/97 (8%)
 Frame = +3

Query: 225 TSPNASPAPPTPPTN--TPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP-PVQ 395
           TSP A    P PP++   P +  +   PP Q+ PPT  S P   ++SPPP   +PP P  
Sbjct: 502 TSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTA 561

Query: 396 QSSPPPV--SSTPPPVQSSPPPAPVTPPP---ASPPP 491
             SPPPV    TP P +S PP     P P   ASPPP
Sbjct: 562 SHSPPPVPEGHTPSPPKSGPPAGESPPTPESKASPPP 598

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 42/103 (40%), Positives = 55/103 (53%), Gaps = 10/103 (9%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPP-TNTPPTTPQA-SPPPVQSAPPTAQSSP-PPVQASPPPVQSAPP 386
           P S+ P    +PPTP  +++PP  P+  +P P +S PP  +S P P  +ASPPP      
Sbjct: 545 PESSPPPEGKSPPTPTASHSPPPVPEGHTPSPPKSGPPAGESPPTPESKASPPPTPEEYT 604

Query: 387 PVQQSSPPPVSSTPPPVQSS----PPPAPV--TP-PPASPPPA 494
           P    S PP   +PP  +S     PPPAP   TP PP S PP+
Sbjct: 605 PSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPS 647

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 39/106 (36%), Positives = 53/106 (50%), Gaps = 14/106 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP---PTNTPPTTPQA-SPPPVQSAPPTAQSSPPP---VQASPPPVQ 374
           PP ++P A  +PPTP    ++ PP  P+  +P P +S PP+ +S P P     + PPP  
Sbjct: 607 PPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTP 666

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSS----PPPAP---VTPPPASPPP 491
               P    S PP   +PP  +S     PPPAP   +  PP S PP
Sbjct: 667 EGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPP 712

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 48/126 (38%), Positives = 66/126 (52%), Gaps = 34/126 (26%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTA---------QSSPP--PVQASP 362
            PPS  P  S  PP   +  PP+  ++  PPV+S+PP A         +SSPP  PV + P
Sbjct: 1016 PPS--PVKSSPPPAEKSQPPPSPVESVLPPVKSSPPHAPVISEPPPTKSSPPQVPVTSEP 1073

Query: 363  PPVQSAPP--PV---------------QQSSPP--PVSSTPPPVQSSPPPAPVTPPPAS- 482
            PP +S+PP  P+               ++SSPP  P +S+PP  +S PPPA V+ PP + 
Sbjct: 1074 PPAKSSPPHEPISPPETPEKSYPPSTPEESSPPSVPKASSPPTEKSLPPPATVSLPPPTV 1133

Query: 483  ---PPP 491
               PPP
Sbjct: 1134 KPLPPP 1139

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 47/120 (39%), Positives = 57/120 (47%), Gaps = 26/120 (21%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPP---VQSAPPTAQSSPPPV---------QAS 359
            PPS   ++SP PP    ++PP    +SPPP   V S PP  +S PPP          + S
Sbjct: 832  PPSPVKSSSP-PPEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEIS 890

Query: 360  PPPVQSAPP--PVQQSSPPPVSSTPPPV---QSSPP---------PAPVTPPPASPPPAS 497
            PPP   +PP    + SSPP   S PPP    +SSPP         PA  TPPP    P S
Sbjct: 891  PPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPS 950

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/95 (40%), Positives = 51/95 (53%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNT--PPTTPQASPPPVQSAPPTAQSSPPPV-QASPPPVQSAPP 386
           PP + P A  +PPTP +    PPT  + +P P +S PP  +S P P  +AS PP    PP
Sbjct: 576 PPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPP----PP 631

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             +  +P P  STPP  +S  PP P +   + PPP
Sbjct: 632 APEGHTPSPPESTPPSEKS--PPTPESKASSPPPP 664

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 43/117 (36%), Positives = 60/117 (51%), Gaps = 22/117 (18%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS-------------SPPPV 350
           + PP+    ASP PPTP   TP  +P  S PP + +PPT +S             +P P 
Sbjct: 585 ESPPTPESKASP-PPTPEEYTP--SPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPP 641

Query: 351 QASPPPVQSAPPPVQQ-SSPPPVS---STPPPVQSSP-----PPAPVTPPPASPPPA 494
           +++PP  +S P P  + SSPPP +    TP P +S+P     PP P +   + PPPA
Sbjct: 642 ESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPA 698

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 47/127 (37%), Positives = 60/127 (47%), Gaps = 28/127 (22%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTP-PTNTPPTTP-QASPPPVQS-----APPTAQSSPPPVQA 356
           S G   P   SP   P  PTP PT + P +P + +PPP  +     +PP    +PPP  +
Sbjct: 457 SHGPPPPEEESPEEPPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSS 516

Query: 357 ----------------SPPPVQSAPPPVQQSSPPPVSSTPP-PVQS-SPPPAPV--TP-P 473
                           + PP + +PP   +SSPPP   +PP P  S SPPP P   TP P
Sbjct: 517 GWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPVPEGHTPSP 576

Query: 474 PASPPPA 494
           P S PPA
Sbjct: 577 PKSGPPA 583

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 44/102 (43%), Positives = 51/102 (50%), Gaps = 16/102 (15%)
 Frame = +3

Query: 231  PNASPAPPTPPTNTPPTTPQASPPP---VQSAPPTAQSSPPPVQAS--PPPVQSAPPPVQ 395
            P  SP PP P  + PP  P+ SPPP   V  +PP  +S PPP   S  P PV+S PP   
Sbjct: 1228 PVKSPPPPAPVISPPP--PEKSPPPAAPVILSPPAVKSLPPPAPVSLPPSPVKSLPPRAP 1285

Query: 396  QSSPP----------PVSSTPPPVQSSPPPAPVT-PPPASPP 488
             S PP          PVS   P V+  P  APV+ PPPA  P
Sbjct: 1286 VSLPPRVVKSLPPRAPVSLPQPAVKPFPQRAPVSLPPPAVKP 1327

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 38/102 (37%), Positives = 52/102 (50%), Gaps = 11/102 (10%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNT---PPTTPQA-SPPPVQSAPPTAQSSP--PPVQASPPPVQS 377
            PP ++P    +PPTP +     PP  P+  +P P +S+PP  +S P  P    SPP  + 
Sbjct: 706  PPKSTPPVEKSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEE 765

Query: 378  APPPVQQSSPPPVSSTPPPVQSSPPPA---PVTPPPA--SPP 488
              P   +SSPP   S PP      PP+   P +PPP+  SPP
Sbjct: 766  YTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPP 807

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 44/112 (39%), Positives = 60/112 (53%), Gaps = 16/112 (14%)
 Frame = +3

Query: 207 AQQPPSTSPNA-SPAPP--TPPTNTPPTTPQ--ASPPPVQSAPPTAQS-SPPPVQASPPP 368
           A  PP  +P   +P+PP  TPP+   P TP+  AS PP    PPT +  +P P +++PP 
Sbjct: 625 ASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPP----PPTPEGHTPSPPKSTPPT 680

Query: 369 VQSAPPPVQQSSPPP-------VSSTP---PPVQSSPPPAPVTPPPASPPPA 494
            +S P P  +SS PP       + S P   PPV+ S PP P +   + PPPA
Sbjct: 681 EKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKS-PPTPESEASSPPPPA 731

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 43/121 (35%), Positives = 54/121 (44%), Gaps = 9/121 (7%)
 Frame = +3

Query: 162 VLVVGLICAVFVSAGAQQP--PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS 335
           VL   + C+  V  G   P  PS  P   P  P P    P  +P    PP   + PT+  
Sbjct: 401 VLARPVDCSKHVCPGHPTPGKPSEPPEKPPLIPVP-VGPPEKSPAYEEPPAAPSTPTSHG 459

Query: 336 SPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAP----VTPPPA---SPPPA 494
            PPP + SP       PP + +  P  SS   P + +PPPAP    VT PPA   +PPP 
Sbjct: 460 PPPPEEESPEE-----PPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPP 514

Query: 495 S 497
           S
Sbjct: 515 S 515

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 40/114 (35%), Positives = 52/114 (45%), Gaps = 22/114 (19%)
 Frame = +3

Query: 216 PPSTSP---NASPAPPTPPTNTPPTTPQASP--PPVQSAP-PTAQSSPPPVQASPPPVQS 377
           PP  SP       AP TP ++ PP   + SP  PP +  P PT  S   P + +PPP  +
Sbjct: 438 PPEKSPAYEEPPAAPSTPTSHGPPPPEEESPEEPPEEPTPSPTPSSPESPAKMAPPPAPA 497

Query: 378 ----APPPVQQSSPPPVSS----------TPPPVQSSPPP--APVTPPPASPPP 491
                 PP +  +PPP SS            PP Q+ PP   +P   P +SPPP
Sbjct: 498 IKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPP 551

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 37/125 (29%), Positives = 51/125 (40%), Gaps = 21/125 (16%)
 Frame = +3

Query: 180 ICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPP-TTPQASP--PPVQSAPPTAQSSP--P 344
           +C    + G    P   P   P P  PP  +P    P A+P  P     PP  + SP  P
Sbjct: 412 VCPGHPTPGKPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHGPPPPEEESPEEP 471

Query: 345 PVQASPPPVQSAPPPVQQSSPPPVSS----TPPPVQSSPPPAPVT------------PPP 476
           P + +P P  S+P    + +PPP  +    T PP +   PP P +            PPP
Sbjct: 472 PEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPP 531

Query: 477 ASPPP 491
            + PP
Sbjct: 532 QAEPP 536

[89][TOP]
>UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata
           RepID=UPI000192638B
          Length = 557

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 43/98 (43%), Positives = 44/98 (44%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           SA    PP+  P   P PP PP   PP  P   PPP    PP     PPP    PPP   
Sbjct: 234 SAAPCHPPAPPPCPPPPPPCPPPCPPPCPPPPPPPP----PPPPPPPPPPPPPCPPPCPP 289

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PPP     PPP    PPP    PPP P  PPP  PPP
Sbjct: 290 PPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPP 327

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 40/92 (43%), Positives = 40/92 (43%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPP--PPPCPPPPPPPPPPPPPCP 319

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PP     PPP P  PPP  PPP
Sbjct: 320 PPPPPPPPCPPPCPPPCPPPCPPPPPPCPPPP 351

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 40/93 (43%), Positives = 40/93 (43%), Gaps = 1/93 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP  P   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 243 PPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPP 302

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTP-PPASPPP 491
              PPP    PPP    PPP P  P PP  PPP
Sbjct: 303 PCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPP 335

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 41/94 (43%), Positives = 41/94 (43%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP-PVQASPPPVQSAPPPV 392
           PP   P   P PP PP   PP  P   PPP    PP     PP P    PPP    PPP 
Sbjct: 251 PPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPP 310

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVT-PPPASPPP 491
               PPP    PPP    PPP P   PPP  PPP
Sbjct: 311 PPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPP 344

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 40/92 (43%), Positives = 40/92 (43%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 277 PPPPPPCPPPCPPPPPPCPPPPPP---PPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCP 333

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PPP    PPP     PP P  PPP  PPP
Sbjct: 334 PPCPPPCPPPPPPC----PPPPCPPPPCPPPP 361

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 40/92 (43%), Positives = 40/92 (43%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP    PPP    PPP  
Sbjct: 270 PPPPPPPPPPPPPCPPPCPPPPPPCPPPPP---PPPPCPPPPPPPPPPPPPCPPPPPPPP 326

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              PP     PPP    PPP P  PPP  PPP
Sbjct: 327 PCPPPCPPPCPPPCPPPPPPCP--PPPCPPPP 356

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 43/99 (43%), Positives = 45/99 (45%), Gaps = 1/99 (1%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPA-PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           SA      S  P+A+P  PP PP   PP  P   PPP    PP     PPP    PPP  
Sbjct: 222 SAEVNLGDSCCPSAAPCHPPAPPPCPPPPPP--CPPPCP--PPCPPPPPPPPPPPPPPPP 277

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             PPP     PPP    PPP    PPP P  PPP  PPP
Sbjct: 278 PPPPPCPPPCPPPPPPCPPP---PPPPPPCPPPPPPPPP 313

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 35/87 (40%), Positives = 36/87 (41%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP  P   PPP    PP     PPP     PP    PPP  
Sbjct: 288 PPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPPC 347

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPP 476
              P P    PPP    PP  P+ PPP
Sbjct: 348 PPPPCPPPPCPPPPPPCPPACPIPPPP 374

[90][TOP]
>UniRef100_B8GAZ4 Putative uncharacterized protein n=1 Tax=Chloroflexus aggregans DSM
           9485 RepID=B8GAZ4_CHLAD
          Length = 381

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 45/100 (45%), Positives = 54/100 (54%), Gaps = 7/100 (7%)
 Frame = +3

Query: 219 PSTSPNASPAPPT-----PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA- 380
           P  +P A+P PPT     PPT TPP  P A+PPP     PTA  SP P    PPP  +  
Sbjct: 268 PMVTPTATPPPPTATPPPPPTATPPPPPTATPPP-----PTATPSPLPTATPPPPPTATP 322

Query: 381 -PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            PPP    SPPP ++ PPP  ++PPP   TP P  P P +
Sbjct: 323 PPPPTATPSPPPTATPPPPPTATPPPPTATPSPPPPSPTA 362

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 47/97 (48%), Positives = 54/97 (55%), Gaps = 7/97 (7%)
 Frame = +3

Query: 228 SPNASP-APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSS 404
           SP  +P A P PPT TPP  P A+PPP    PPTA   PP    SP P  + PPP   + 
Sbjct: 267 SPMVTPTATPPPPTATPPPPPTATPPP----PPTATPPPPTATPSPLPTATPPPPPTATP 322

Query: 405 PPPVSST--PPPVQSSPPPAPVTPPP----ASPPPAS 497
           PPP ++T  PPP  + PPP   TPPP     SPPP S
Sbjct: 323 PPPPTATPSPPPTATPPPPPTATPPPPTATPSPPPPS 359

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 45/103 (43%), Positives = 53/103 (51%), Gaps = 10/103 (9%)
 Frame = +3

Query: 213 QPPSTSPNA-----SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           QP  T  N      +P+P   PT TPP  P A+PPP    PPTA   PPP    PPP  +
Sbjct: 251 QPTPTRTNTPTATVTPSPMVTPTATPPP-PTATPPP----PPTATPPPPPTATPPPPTAT 305

Query: 378 APPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP--ASPPP 491
             P    + PPP ++TPPP      SPPP    PPP  A+PPP
Sbjct: 306 PSPLPTATPPPPPTATPPPPPTATPSPPPTATPPPPPTATPPP 348

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 40/91 (43%), Positives = 48/91 (52%), Gaps = 5/91 (5%)
 Frame = +3

Query: 219 PSTSPNASPAPPTP-----PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           P   P A+P PPT      PT TPP  P A+PPP    PPTA  SPPP         + P
Sbjct: 291 PPPPPTATPPPPTATPSPLPTATPPPPPTATPPP----PPTATPSPPPT--------ATP 338

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP 476
           PP   ++PPP ++TP P    PPP+P   PP
Sbjct: 339 PPPPTATPPPPTATPSP----PPPSPTATPP 365

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 43/109 (39%), Positives = 55/109 (50%), Gaps = 16/109 (14%)
 Frame = +3

Query: 219 PSTSPNASPAPPTP---------PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPV 371
           P  SP  + A  TP         PT T   TP A+  P     PTA + PPP    PPP 
Sbjct: 229 PQPSPTTALATNTPAPSHTATLQPTPTRTNTPTATVTPSPMVTPTA-TPPPPTATPPPPP 287

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSS-PPPAP-VTPPP-----ASPPPAS 497
            + PPP   ++PPP ++TP P+ ++ PPP P  TPPP      SPPP +
Sbjct: 288 TATPPPPPTATPPPPTATPSPLPTATPPPPPTATPPPPPTATPSPPPTA 336

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 42/112 (37%), Positives = 58/112 (51%), Gaps = 11/112 (9%)
 Frame = +3

Query: 189 VFVSAGAQQPPSTSPNASPAPPTP-PTNTPPTTPQAS--PPPVQSAPPTAQSSPPPV--- 350
           + V A      S+S    P+P T   TNTP  +  A+  P P ++  PTA  +P P+   
Sbjct: 213 ITVVAEEDDQGSSSTTPQPSPTTALATNTPAPSHTATLQPTPTRTNTPTATVTPSPMVTP 272

Query: 351 -QASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAP--VTPPP--ASPPP 491
               PPP  + PPP   + PPP ++TPPP  ++P P P    PPP  A+PPP
Sbjct: 273 TATPPPPTATPPPPPTATPPPPPTATPPPPTATPSPLPTATPPPPPTATPPP 324

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 33/74 (44%), Positives = 40/74 (54%), Gaps = 2/74 (2%)
 Frame = +3

Query: 216 PPSTSPNASPA--PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP+ +P+  P   PP PPT TPP  P A+P P    PPTA   PPP    PPP  +  PP
Sbjct: 301 PPTATPSPLPTATPPPPPTATPPPPPTATPSP----PPTATPPPPPTATPPPPTATPSPP 356

Query: 390 VQQSSPPPVSSTPP 431
                PP  ++TPP
Sbjct: 357 -----PPSPTATPP 365

[91][TOP]
>UniRef100_A7PAK3 Chromosome chr14 scaffold_9, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PAK3_VITVI
          Length = 717

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 49/109 (44%), Positives = 64/109 (58%), Gaps = 17/109 (15%)
 Frame = +3

Query: 216 PPSTSPNASPA--PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS--AP 383
           PP++ P + PA  PP+PPT+ PP    ++PPPV S PP ++ SP P  +  PPV +  +P
Sbjct: 98  PPASPPPSPPASPPPSPPTSAPPPAVNSTPPPVLSPPPPSEGSPSPRVSPAPPVGTPPSP 157

Query: 384 PPVQQSSPPP--------VSSTPPPVQSSPPPAPVTPPPA-----SPPP 491
           P V  S+PPP         SS PPPV SSP  +P  PPP+     SPPP
Sbjct: 158 PAVSPSTPPPDNVPSPTSSSSPPPPVASSPQNSPSPPPPSGSEPLSPPP 206

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 46/101 (45%), Positives = 54/101 (53%), Gaps = 6/101 (5%)
 Frame = +3

Query: 210 QQPP---STSPNASPAPPT---PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPV 371
           Q PP   + SP  SP PP    PP  +PP +P ASPPP   +PP +    PP    P P 
Sbjct: 59  QSPPPSVTASPPESPPPPPASIPPPTSPPPSPPASPPP---SPPASPPPSPPASPPPSPP 115

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            SAPPP   S+PPPV S PPP + SP P     PP   PP+
Sbjct: 116 TSAPPPAVNSTPPPVLSPPPPSEGSPSPRVSPAPPVGTPPS 156

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 46/106 (43%), Positives = 59/106 (55%), Gaps = 14/106 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPP-PVQSAPPTAQSS--PPPVQASPPPVQSAPP 386
           PP++ P  +  PP+PP + PP+ P + PP P  S PP+  +S  PP V ++PPPV S PP
Sbjct: 76  PPASIPPPTSPPPSPPASPPPSPPASPPPSPPASPPPSPPTSAPPPAVNSTPPPVLSPPP 135

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPA--PVTPPP---------ASPPP 491
           P + S  P VS  PP      PPA  P TPPP         +SPPP
Sbjct: 136 PSEGSPSPRVSPAPPVGTPPSPPAVSPSTPPPDNVPSPTSSSSPPP 181

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 44/106 (41%), Positives = 56/106 (52%), Gaps = 12/106 (11%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPP-TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           Q  PST  N SP P  +PP +   + P++ PPP  S PP     P P  + PP   ++PP
Sbjct: 44  QVAPSTPSNPSPPPTQSPPPSVTASPPESPPPPPASIPPPTSPPPSPPASPPPSPPASPP 103

Query: 387 PVQQSSPPP----------VSSTPPPVQSSPPPAPVTPPP-ASPPP 491
           P   +SPPP          V+STPPPV S PPP+  +P P  SP P
Sbjct: 104 PSPPASPPPSPPTSAPPPAVNSTPPPVLSPPPPSEGSPSPRVSPAP 149

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 42/103 (40%), Positives = 54/103 (52%), Gaps = 4/103 (3%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           S+ +Q P  + PN +     P T + P     SPPP QS PP+  +SPP  ++ PPP  S
Sbjct: 27  SSNSQPPAGSDPNQTSDQVAPSTPSNP-----SPPPTQSPPPSVTASPP--ESPPPPPAS 79

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP----ASPPPA 494
            PPP      PP S  P P  S PP  P +PPP    ++PPPA
Sbjct: 80  IPPPTSPPPSPPASPPPSPPASPPPSPPASPPPSPPTSAPPPA 122

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 45/102 (44%), Positives = 55/102 (53%), Gaps = 6/102 (5%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPP--TTPQASPP-PVQSAPPTAQSSPPPVQASPPPVQS 377
           A  P S+S + S +   PP  + P  T+ Q +P  P   +PP  QS PP V ASPP    
Sbjct: 15  ATSPSSSSSSNSSSNSQPPAGSDPNQTSDQVAPSTPSNPSPPPTQSPPPSVTASPP---E 71

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTP---PPASPPPA 494
           +PPP   S PPP S  P P  S PP  P +P   PPASPPP+
Sbjct: 72  SPPPPPASIPPPTSPPPSPPASPPPSPPASPPPSPPASPPPS 113

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 43/104 (41%), Positives = 57/104 (54%), Gaps = 5/104 (4%)
 Frame = +3

Query: 198 SAGAQQPPST--SPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS-SPPPVQASPPP 368
           S     PPST  SP++S +  +   + PP     +    Q AP T  + SPPP Q+ PP 
Sbjct: 5   SPSPNSPPSTATSPSSSSSSNSSSNSQPPAGSDPNQTSDQVAPSTPSNPSPPPTQSPPPS 64

Query: 369 VQSAPPPVQQSSPPPVSSTPPPVQS--SPPPAPVTPPPASPPPA 494
           V ++PP   +S PPP +S PPP     SPP +P   PPASPPP+
Sbjct: 65  VTASPP---ESPPPPPASIPPPTSPPPSPPASPPPSPPASPPPS 105

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 38/91 (41%), Positives = 50/91 (54%)
 Frame = +3

Query: 222 STSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQS 401
           S SP  SPAPP     +PP    ++PPP     PT+ SSPPP  AS P  Q++P P   S
Sbjct: 140 SPSPRVSPAPPVGTPPSPPAVSPSTPPPDNVPSPTSSSSPPPPVASSP--QNSPSPPPPS 197

Query: 402 SPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              P+S  P P +S+  P P + P +S PP+
Sbjct: 198 GSEPLSPPPTPARSTISPPPPSVPSSSSPPS 228

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 46/111 (41%), Positives = 60/111 (54%), Gaps = 17/111 (15%)
 Frame = +3

Query: 216 PPSTSP----NASPAP---PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           PP+++P    N++P P   P PP+   P +P+ SP P    PP    SPP V  S PP  
Sbjct: 114 PPTSAPPPAVNSTPPPVLSPPPPSEGSP-SPRVSPAPPVGTPP----SPPAVSPSTPPPD 168

Query: 375 SAPPPVQQSS-PPPVSSTPPPVQSSPPPA---PVTPPPA------SPPPAS 497
           + P P   SS PPPV+S+P    S PPP+   P++PPP       SPPP S
Sbjct: 169 NVPSPTSSSSPPPPVASSPQNSPSPPPPSGSEPLSPPPTPARSTISPPPPS 219

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 43/98 (43%), Positives = 52/98 (53%), Gaps = 11/98 (11%)
 Frame = +3

Query: 234 NASPAPPTPP-TNTPPTTPQASPPPVQSAPPTA--------QSSPP-PVQASPPPVQSAP 383
           +ASP+P +PP T T P++  +S     S PP          Q +P  P   SPPP QS P
Sbjct: 3   SASPSPNSPPSTATSPSSSSSSNSSSNSQPPAGSDPNQTSDQVAPSTPSNPSPPPTQSPP 62

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPP-APVTPPPASPPPA 494
           P V  S P    S PPP  S PPP +P   PPASPPP+
Sbjct: 63  PSVTASPP---ESPPPPPASIPPPTSPPPSPPASPPPS 97

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 44/105 (41%), Positives = 53/105 (50%), Gaps = 14/105 (13%)
 Frame = +3

Query: 216 PPSTSPNASPA--PPTPP-TNTP-PTTPQASPPPVQSAPPTAQSSPPPVQA---SPPPVQ 374
           PP  +P + PA  P TPP  N P PT+  + PPPV S+P  + S PPP  +   SPPP  
Sbjct: 149 PPVGTPPSPPAVSPSTPPPDNVPSPTSSSSPPPPVASSPQNSPSPPPPSGSEPLSPPPTP 208

Query: 375 -----SAPPP--VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
                S PPP     SSPP +S   PP  SS    P + P  S P
Sbjct: 209 ARSTISPPPPSVPSSSSPPSISPPAPPSNSSDTGTPTSSPLPSIP 253

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 34/86 (39%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query: 246 APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPV--QSAPPPVQQSSPPPVS 419
           A  +P  N+PP+T  A+ P   S+  ++ +S PP  + P     Q AP      SPPP  
Sbjct: 2   ASASPSPNSPPST--ATSPSSSSSSNSSSNSQPPAGSDPNQTSDQVAPSTPSNPSPPPTQ 59

Query: 420 STPPPVQSSPPPAPVTPPPASPPPAS 497
           S PP V +SPP +P  PP + PPP S
Sbjct: 60  SPPPSVTASPPESPPPPPASIPPPTS 85

[92][TOP]
>UniRef100_Q9ASK4 Os01g0110500 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q9ASK4_ORYSJ
          Length = 698

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 46/97 (47%), Positives = 54/97 (55%), Gaps = 2/97 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A   P+T PNA+PA P  TPP  +PP    A+PPP   +PP +    PPV A PPP    
Sbjct: 24  ATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPDSPPPSPPPAPPV-AVPPPATVP 82

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PPPV  +SPPP  S   P  S P   PV P PA+ PP
Sbjct: 83  PPPVPVASPPPTPSATLPPPSPPASVPVPPTPATTPP 119

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 42/100 (42%), Positives = 52/100 (52%), Gaps = 5/100 (5%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A  PP + P + P PPTP T  P  +P   PP   S PP++ +  PP     PP +S  P
Sbjct: 97  ATLPPPSPPASVPVPPTPATTPPKPSPVQQPPVAASPPPSSPADLPPPN---PPARSDTP 153

Query: 387 PVQQSSPPPVSSTP-----PPVQSSPPPAPVTPPPASPPP 491
           PV QS PPP   +P     PP+  SP  +P  P PASP P
Sbjct: 154 PVVQSPPPPHRRSPRTPWAPPMAPSPSGSPTKPSPASPSP 193

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 53/124 (42%), Positives = 62/124 (50%), Gaps = 30/124 (24%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPT----PPTNTPPTTPQASPPPVQSA-------------PPTAQSSP 341
           QP S  P+  PAPP     P T  PP  P ASPPP  SA             PPT  ++P
Sbjct: 59  QPDSPPPSPPPAPPVAVPPPATVPPPPVPVASPPPTPSATLPPPSPPASVPVPPTPATTP 118

Query: 342 --------PPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPP---APVTP--PPAS 482
                   PPV ASPPP  S+P  +   +PP  S TPP VQS PPP   +P TP  PP +
Sbjct: 119 PKPSPVQQPPVAASPPP--SSPADLPPPNPPARSDTPPVVQSPPPPHRRSPRTPWAPPMA 176

Query: 483 PPPA 494
           P P+
Sbjct: 177 PSPS 180

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 44/105 (41%), Positives = 57/105 (54%), Gaps = 8/105 (7%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASP------PPVQSAPPTAQSSPPPVQAS 359
           S+ +  P + +P  + A P+  T TP T P A+P      PP  S P  + ++PPP   S
Sbjct: 3   SSPSPSPGTATPATAAAAPSTATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPDS 62

Query: 360 PPPVQSAPPPVQQSSPPPVSSTPPPVQ-SSPPPAP-VTPPPASPP 488
           PPP     PPV  + PPP +  PPPV  +SPPP P  T PP SPP
Sbjct: 63  PPPSPPPAPPV--AVPPPATVPPPPVPVASPPPTPSATLPPPSPP 105

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 48/109 (44%), Positives = 54/109 (49%), Gaps = 9/109 (8%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           +A    P  T P AS  PP P   TPP  P + PP    APP A   PPP    PPPV  
Sbjct: 33  NATPADPSITPPAAS--PPLPSAATPPPQPDSPPPSPPPAPPVA--VPPPATVPPPPVPV 88

Query: 378 APPPVQQSS--PPP-----VSSTPPPVQSSPPPAPVTPPP--ASPPPAS 497
           A PP   S+  PPP     V   P P  + P P+PV  PP  ASPPP+S
Sbjct: 89  ASPPPTPSATLPPPSPPASVPVPPTPATTPPKPSPVQQPPVAASPPPSS 137

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 39/94 (41%), Positives = 48/94 (51%), Gaps = 4/94 (4%)
 Frame = +3

Query: 222 STSPNASPAPPTPPTNTP-PTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           ++SP+ SP   TP T    P+T   +P    +A P   S  PP  + P P  + PPP   
Sbjct: 2   ASSPSPSPGTATPATAAAAPSTATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPD 61

Query: 399 SSPPPVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
           S PP  S  P P  + PPPA V PPP   ASPPP
Sbjct: 62  SPPP--SPPPAPPVAVPPPATVPPPPVPVASPPP 93

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +3

Query: 267 NTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSS 446
           ++P  +P  + P   +A P+  +  P  Q +  P   +  P   S P P ++TPPP   S
Sbjct: 3   SSPSPSPGTATPATAAAAPSTATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPDS 62

Query: 447 PPPA-PVTPPPASPPPAS 497
           PPP+ P  PP A PPPA+
Sbjct: 63  PPPSPPPAPPVAVPPPAT 80

[93][TOP]
>UniRef100_B8ACV5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8ACV5_ORYSI
          Length = 698

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 46/97 (47%), Positives = 54/97 (55%), Gaps = 2/97 (2%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A   P+T PNA+PA P  TPP  +PP    A+PPP   +PP +    PPV A PPP    
Sbjct: 24  ATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPDSPPPSPPPAPPV-AVPPPATVP 82

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PPPV  +SPPP  S   P  S P   PV P PA+ PP
Sbjct: 83  PPPVPVASPPPTPSATLPPPSPPASVPVPPTPATTPP 119

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 42/100 (42%), Positives = 52/100 (52%), Gaps = 5/100 (5%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A  PP + P + P PPTP T  P  +P   PP   S PP++ +  PP     PP +S  P
Sbjct: 97  ATLPPPSPPASVPVPPTPATTPPKPSPVQQPPVAASPPPSSPADLPPPN---PPARSDTP 153

Query: 387 PVQQSSPPPVSSTP-----PPVQSSPPPAPVTPPPASPPP 491
           PV QS PPP   +P     PP+  SP  +P  P PASP P
Sbjct: 154 PVVQSPPPPHRRSPRTPWAPPMAPSPSGSPTKPSPASPSP 193

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 53/124 (42%), Positives = 62/124 (50%), Gaps = 30/124 (24%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPT----PPTNTPPTTPQASPPPVQSA-------------PPTAQSSP 341
           QP S  P+  PAPP     P T  PP  P ASPPP  SA             PPT  ++P
Sbjct: 59  QPDSPPPSPPPAPPVAVPPPATVPPPPVPVASPPPTPSATLPPPSPPASVPVPPTPATTP 118

Query: 342 --------PPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPP---APVTP--PPAS 482
                   PPV ASPPP  S+P  +   +PP  S TPP VQS PPP   +P TP  PP +
Sbjct: 119 PKPSPVQQPPVAASPPP--SSPADLPPPNPPARSDTPPVVQSPPPPHRRSPRTPWAPPMA 176

Query: 483 PPPA 494
           P P+
Sbjct: 177 PSPS 180

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 44/105 (41%), Positives = 57/105 (54%), Gaps = 8/105 (7%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASP------PPVQSAPPTAQSSPPPVQAS 359
           S+ +  P + +P  + A P+  T TP T P A+P      PP  S P  + ++PPP   S
Sbjct: 3   SSPSPSPGTATPATAAAAPSTATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPDS 62

Query: 360 PPPVQSAPPPVQQSSPPPVSSTPPPVQ-SSPPPAP-VTPPPASPP 488
           PPP     PPV  + PPP +  PPPV  +SPPP P  T PP SPP
Sbjct: 63  PPPSPPPAPPV--AVPPPATVPPPPVPVASPPPTPSATLPPPSPP 105

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 48/109 (44%), Positives = 54/109 (49%), Gaps = 9/109 (8%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           +A    P  T P AS  PP P   TPP  P + PP    APP A   PPP    PPPV  
Sbjct: 33  NATPADPSITPPAAS--PPLPSAATPPPQPDSPPPSPPPAPPVA--VPPPATVPPPPVPV 88

Query: 378 APPPVQQSS--PPP-----VSSTPPPVQSSPPPAPVTPPP--ASPPPAS 497
           A PP   S+  PPP     V   P P  + P P+PV  PP  ASPPP+S
Sbjct: 89  ASPPPTPSATLPPPSPPASVPVPPTPATTPPKPSPVQQPPVAASPPPSS 137

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 39/94 (41%), Positives = 48/94 (51%), Gaps = 4/94 (4%)
 Frame = +3

Query: 222 STSPNASPAPPTPPTNTP-PTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           ++SP+ SP   TP T    P+T   +P    +A P   S  PP  + P P  + PPP   
Sbjct: 2   ASSPSPSPGTATPATAAAAPSTATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPD 61

Query: 399 SSPPPVSSTPPPVQSSPPPAPVTPPP---ASPPP 491
           S PP  S  P P  + PPPA V PPP   ASPPP
Sbjct: 62  SPPP--SPPPAPPVAVPPPATVPPPPVPVASPPP 93

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +3

Query: 267 NTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSS 446
           ++P  +P  + P   +A P+  +  P  Q +  P   +  P   S P P ++TPPP   S
Sbjct: 3   SSPSPSPGTATPATAAAAPSTATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPDS 62

Query: 447 PPPA-PVTPPPASPPPAS 497
           PPP+ P  PP A PPPA+
Sbjct: 63  PPPSPPPAPPVAVPPPAT 80

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 46/116 (39%), Positives = 61/116 (52%), Gaps = 21/116 (18%)
 Frame = +3

Query: 210 QQPP--STSPNASPA---PPTPP--TNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP 368
           QQPP  ++ P +SPA   PP PP  ++TPP   Q+ PPP + +P T  +  PP+  SP  
Sbjct: 125 QQPPVAASPPPSSPADLPPPNPPARSDTPPVV-QSPPPPHRRSPRTPWA--PPMAPSPSG 181

Query: 369 VQSAPPPVQQSSPPPVSSTP----PPVQSSP---PPAP------VTPP-PASPPPA 494
             + P P   +SP P++  P    P   SSP   P AP      VTPP P S PP+
Sbjct: 182 SPTKPSP---ASPSPIAGDPIIPTPNNPSSPLATPSAPGSGTPVVTPPAPVSGPPS 234

[94][TOP]
>UniRef100_P13983 Extensin n=1 Tax=Nicotiana tabacum RepID=EXTN_TOBAC
          Length = 620

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 51/105 (48%), Positives = 55/105 (52%), Gaps = 13/105 (12%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPT--NTPPTTPQASPP----PVQSAPPTAQSSPPPVQASPPPV-- 371
           PPS+ P  S +PP PPT   +PP  P  SPP    P  S PP   S PPP  A PPP+  
Sbjct: 373 PPSSPPPPSFSPP-PPTYEQSPPPPPAYSPPLPAPPTYSPPPPTYSPPPPTYAQPPPLPP 431

Query: 372 -QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA----SPPP 491
             S PPP     PPP  S PPP  S PPPA   PPP     SPPP
Sbjct: 432 TYSPPPPAYSPPPPPTYSPPPPTYSPPPPAYAQPPPPPPTYSPPP 476

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 50/106 (47%), Positives = 56/106 (52%), Gaps = 14/106 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPT-TPQASPPPVQSAPPTAQSSPPP---------VQASPP 365
           PP  SP  SP PP    + PPT TP  SPPP   +PP   S PPP         + + PP
Sbjct: 291 PPPPSPIYSPPPPAYSPSPPPTPTPTFSPPPPAYSPPPTYSPPPPTYLPLPSSPIYSPPP 350

Query: 366 PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP----ASPPP 491
           PV S PPP   S PPP +  PPP  SSPPP   +PPP     SPPP
Sbjct: 351 PVYSPPPPPSYSPPPP-TYLPPPPPSSPPPPSFSPPPPTYEQSPPP 395

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 52/112 (46%), Positives = 58/112 (51%), Gaps = 20/112 (17%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT----PPTNTPPTTPQASPPPVQ---SAPPTAQSSPPPVQASPPPVQ 374
           PP+ SP   PAPPT    PPT +PP    A PPP+    S PP A S PPP   SPPP  
Sbjct: 396 PPAYSPPL-PAPPTYSPPPPTYSPPPPTYAQPPPLPPTYSPPPPAYSPPPPPTYSPPPPT 454

Query: 375 SAPPP---VQQSSPPPVSSTPPPVQSSPPPAPV----------TPPPASPPP 491
            +PPP    Q   PPP  S PPP  S PPP+P+           PP  SPPP
Sbjct: 455 YSPPPPAYAQPPPPPPTYSPPPPAYSPPPPSPIYSPPPPQVQPLPPTFSPPP 506

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/110 (47%), Positives = 56/110 (50%), Gaps = 15/110 (13%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAP-----PTAQSSPPPVQASPPPVQS 377
           Q P  SP  SP PPT   + PP +P  SPPP   +P     PT   SPPP   SPPP  S
Sbjct: 274 QSPQPSPTYSPPPPT--YSPPPPSPIYSPPPPAYSPSPPPTPTPTFSPPPPAYSPPPTYS 331

Query: 378 APPPVQ--------QSSPPPVSSTPPPVQSSPPPAPV--TPPPASPPPAS 497
            PPP           S PPPV S PPP   SPPP      PPP+SPPP S
Sbjct: 332 PPPPTYLPLPSSPIYSPPPPVYSPPPPPSYSPPPPTYLPPPPPSSPPPPS 381

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/100 (44%), Positives = 52/100 (52%), Gaps = 5/100 (5%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           +Q P   P  SP  P PPT +PP    + PPP  + PP      PP  + PPP  S PPP
Sbjct: 390 EQSPPPPPAYSPPLPAPPTYSPPPPTYSPPPPTYAQPPPL----PPTYSPPPPAYSPPPP 445

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVT---PPP--ASPPPA 494
              S PPP  S PPP  + PPP P T   PPP  + PPP+
Sbjct: 446 PTYSPPPPTYSPPPPAYAQPPPPPPTYSPPPPAYSPPPPS 485

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 47/109 (43%), Positives = 53/109 (48%), Gaps = 15/109 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAP-----PTPPTNTPPTTPQASPP--------PVQSAPPTAQSSPPPVQA 356
           PP+ SP+  P P     P PP  +PP T    PP        P+ S PP   S PPP   
Sbjct: 302 PPAYSPSPPPTPTPTFSPPPPAYSPPPTYSPPPPTYLPLPSSPIYSPPPPVYSPPPPPSY 361

Query: 357 SPPPVQSAPPPVQQSSPPPVSSTPPPV--QSSPPPAPVTPPPASPPPAS 497
           SPPP    PPP   S PPP  S PPP   QS PPP   +PP  +PP  S
Sbjct: 362 SPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPPTYS 410

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/98 (50%), Positives = 54/98 (55%), Gaps = 6/98 (6%)
 Frame = +3

Query: 216 PPSTSPNASPA-PPTPPTNTPPTTPQASPPPVQSAPP-TAQSSPPPVQASPPPVQSAPPP 389
           PP  SP   P+  P PPT  PP  P + PPP  S PP T + SPPP  A  PP+   P P
Sbjct: 350 PPVYSPPPPPSYSPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPL---PAP 406

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVT---PPPA-SPPP 491
              S PPP  S PPP  + PPP P T   PPPA SPPP
Sbjct: 407 PTYSPPPPTYSPPPPTYAQPPPLPPTYSPPPPAYSPPP 444

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/103 (47%), Positives = 57/103 (55%), Gaps = 9/103 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA--SPPPVQSAP 383
           PP T   + P PP  +PP   PPT   + PPP  S PP   + PPP+    SPPP   +P
Sbjct: 385 PPPTYEQSPPPPPAYSPPLPAPPT--YSPPPPTYSPPPPTYAQPPPLPPTYSPPPPAYSP 442

Query: 384 PPVQQSSPPPVS-STPPPVQSSPPPAPVT---PPPA-SPPPAS 497
           PP    SPPP + S PPP  + PPP P T   PPPA SPPP S
Sbjct: 443 PPPPTYSPPPPTYSPPPPAYAQPPPPPPTYSPPPPAYSPPPPS 485

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/105 (44%), Positives = 53/105 (50%), Gaps = 14/105 (13%)
 Frame = +3

Query: 219 PSTSPNASPAPPT----PPTNTPPTTPQASPPPV--QSAPPTAQSSPP----PVQASPPP 368
           P   P+ SP PPT    PP ++PP    + PPP   QS PP    SPP    P  + PPP
Sbjct: 355 PPPPPSYSPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPPTYSPPPP 414

Query: 369 VQSAPPPVQQSSP--PPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
             S PPP     P  PP  S PPP  S PPP   +PPP   SPPP
Sbjct: 415 TYSPPPPTYAQPPPLPPTYSPPPPAYSPPPPPTYSPPPPTYSPPP 459

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 47/119 (39%), Positives = 59/119 (49%), Gaps = 27/119 (22%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT---PPTNTPP--------TTPQASPPPVQSAPPTAQS--------- 335
           PP+ +P  SP PP    PPT +PP        ++P  SPPP   +PP   S         
Sbjct: 310 PPTPTPTFSPPPPAYSPPPTYSPPPPTYLPLPSSPIYSPPPPVYSPPPPPSYSPPPPTYL 369

Query: 336 SPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQS----SPPPAPVTPPP---ASPPP 491
            PPP  + PPP  S PPP  + SPPP  +  PP+ +    SPPP   +PPP   A PPP
Sbjct: 370 PPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPPTYSPPPPTYSPPPPTYAQPPP 428

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 53/128 (41%), Positives = 59/128 (46%), Gaps = 33/128 (25%)
 Frame = +3

Query: 207 AQQPP----STSPNASPAP---PTPPTNTPPTTP------QASPPPVQSAPPTAQSSPPP 347
           AQ PP    S SP   P P   P PPT+  PT        Q  PP  + APPT + +PP 
Sbjct: 184 AQPPPTPIYSPSPQVQPPPTYSPPPPTHVQPTPSPPSRGHQPQPPTHRHAPPTHRHAPPT 243

Query: 348 VQASP-------------PPVQSAPPP--VQQSSPPPVSSTPPPVQSSPPPAPV--TPPP 476
            Q SP             PP  S PPP   Q   P P  S PPP  S PPP+P+   PPP
Sbjct: 244 HQPSPLRHLPPSPRRQPQPPTYSPPPPAYAQSPQPSPTYSPPPPTYSPPPPSPIYSPPPP 303

Query: 477 A---SPPP 491
           A   SPPP
Sbjct: 304 AYSPSPPP 311

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 51/118 (43%), Positives = 54/118 (45%), Gaps = 20/118 (16%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASP----APPT----------PPTNTPPTTPQASPPP---VQSAPPT 326
           S G Q  P T  +A P    APPT          P     P  P  SPPP    QS  P+
Sbjct: 220 SRGHQPQPPTHRHAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPTYSPPPPAYAQSPQPS 279

Query: 327 AQSSPPPVQASPP---PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              SPPP   SPP   P+ S PPP    SPPP   TP P  S PPPA   PP  SPPP
Sbjct: 280 PTYSPPPPTYSPPPPSPIYSPPPPAYSPSPPP---TPTPTFSPPPPAYSPPPTYSPPP 334

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 47/103 (45%), Positives = 51/103 (49%), Gaps = 11/103 (10%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT----PPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPPVQSA 380
           PP T     P PPT    PP  +PP  P  SPPP   S PP A + PPP    PPP  S 
Sbjct: 419 PPPTYAQPPPLPPTYSPPPPAYSPPPPPTYSPPPPTYSPPPPAYAQPPP----PPPTYSP 474

Query: 381 PPPVQQSSPPPVSS--TPPPVQSSPPPAPVTPPPAS----PPP 491
           PPP    SPPP S   +PPP Q  P P   +PPP      PPP
Sbjct: 475 PPPA--YSPPPPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPP 515

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 48/116 (41%), Positives = 52/116 (44%), Gaps = 23/116 (19%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPT------------PPTNTPPTTPQASPPP---VQSAPPTAQSSPPP 347
           QPP   P  SP PP             PPT +PP    A PPP     S PP A S PPP
Sbjct: 425 QPPPLPPTYSPPPPAYSPPPPPTYSPPPPTYSPPPPAYAQPPPPPPTYSPPPPAYSPPPP 484

Query: 348 VQA-SPPPVQSAPPPVQQSSPPP--VSSTPPPVQSSPPPAPV-----TPPPASPPP 491
               SPPP Q  P P   S PPP  +   PPP +   PP P      +PP  SPPP
Sbjct: 485 SPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQPPSPPTFSPPP 540

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 42/97 (43%), Positives = 46/97 (47%), Gaps = 10/97 (10%)
 Frame = +3

Query: 231 PNASPAPPTPPTNTPPTTPQASPPP---VQSAPPT--AQSSPPPVQASP--PPVQSAPPP 389
           P+  P PPTP    PP+ P  SPPP   + S PP      +P P    P  PP  SAPPP
Sbjct: 516 PHRQPRPPTPTYGQPPSPPTFSPPPPRQIHSPPPPHWQPRTPTPTYGQPPSPPTFSAPPP 575

Query: 390 VQQSSPPP---VSSTPPPVQSSPPPAPVTPPPASPPP 491
            Q  SPPP       P P    PP  P T  P SPPP
Sbjct: 576 RQIHSPPPPHRQPRPPTPTYGQPPSPPTTYSPPSPPP 612

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 43/105 (40%), Positives = 48/105 (45%), Gaps = 10/105 (9%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPPPVQSAP 383
           QPP   P  SP PP    + PP +P  SPPP Q  P     SPPP   +   PPP +   
Sbjct: 464 QPPPPPPTYSPPPPA--YSPPPPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPR 521

Query: 384 PPVQ---QSSPPPVSSTPPP--VQSSPPP--APVTPPPASPPPAS 497
           PP     Q   PP  S PPP  + S PPP   P TP P    P S
Sbjct: 522 PPTPTYGQPPSPPTFSPPPPRQIHSPPPPHWQPRTPTPTYGQPPS 566

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 47/110 (42%), Positives = 49/110 (44%), Gaps = 15/110 (13%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPT----PPTNTPPTTPQASPPPVQSAPPTAQSSPP-PVQASP--P 365
           A  PP  SP  SP PP     PPT +PP   +   PP    PP  Q  PP P    P  P
Sbjct: 478 AYSPPPPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPP----PPHRQPRPPTPTYGQPPSP 533

Query: 366 PVQSAPPPVQQSSPPP---VSSTPPPVQSSPPPAPV--TPPPA---SPPP 491
           P  S PPP Q  SPPP      TP P    PP  P    PPP    SPPP
Sbjct: 534 PTFSPPPPRQIHSPPPPHWQPRTPTPTYGQPPSPPTFSAPPPRQIHSPPP 583

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 41/113 (36%), Positives = 50/113 (44%), Gaps = 19/113 (16%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP-- 383
           Q PPS   +  P+PP+   + PP T  A PPP     P+ Q  PPP  + PPP    P  
Sbjct: 161 QHPPS---HRRPSPPSRHGHPPPPT-YAQPPPTPIYSPSPQVQPPPTYSPPPPTHVQPTP 216

Query: 384 ----------PPVQQSSPPPVSSTPPPVQSSP----PPAP---VTPPPASPPP 491
                     PP  + +PP     PP  Q SP    PP+P     PP  SPPP
Sbjct: 217 SPPSRGHQPQPPTHRHAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPTYSPPP 269

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 43/129 (33%), Positives = 52/129 (40%), Gaps = 33/129 (25%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPT----PPTNTPPTTPQASPPPVQSAPPTA-------------QSS 338
           ++P   S +  P PPT    PPT     +PQ  PPP  S PP               Q  
Sbjct: 167 RRPSPPSRHGHPPPPTYAQPPPTPIYSPSPQVQPPPTYSPPPPTHVQPTPSPPSRGHQPQ 226

Query: 339 PPPVQASPPPVQSAPP-------------PVQQSSPPPVSSTPPPVQSSPPPAPV---TP 470
           PP  + +PP  + APP             P +Q  PP  S  PP    SP P+P     P
Sbjct: 227 PPTHRHAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPTYSPPPPAYAQSPQPSPTYSPPP 286

Query: 471 PPASPPPAS 497
           P  SPPP S
Sbjct: 287 PTYSPPPPS 295

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 34/94 (36%), Positives = 40/94 (42%), Gaps = 4/94 (4%)
 Frame = +3

Query: 216 PPSTSPNASPA----PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PPS  P   P+    PP+P     P +   +PP  Q  P   + SPP     PPP   A 
Sbjct: 126 PPSHGPGHLPSHGQRPPSPSHGHAPPSGGHTPPRGQHPPSHRRPSPPSRHGHPPPPTYAQ 185

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
           PP      P     PPP  S PPP  V P P+ P
Sbjct: 186 PPPTPIYSPSPQVQPPPTYSPPPPTHVQPTPSPP 219

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 38/96 (39%), Positives = 48/96 (50%), Gaps = 2/96 (2%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           QPP +S   SP  P+ PT TPP+      P  + APP   + PPP     PP    PPP 
Sbjct: 41  QPPPSSIGLSP--PSAPTTTPPSRGHVPSP--RHAPPR-HAYPPPSHGHLPPSVGGPPPH 95

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPPA 494
           +   PP     PPP   SP  +P  PPP+  +PPP+
Sbjct: 96  RGHLPPSRGFNPPP---SPVISPSHPPPSYGAPPPS 128

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 39/107 (36%), Positives = 49/107 (45%), Gaps = 9/107 (8%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPT----PPTNTP---PTTPQASPPPVQS-APPTAQSSPPPVQ 353
           S G   PPS   + S  PP+    PP++ P   P+  Q  P P    APP+   +PP  Q
Sbjct: 102 SRGFNPPPSPVISPSHPPPSYGAPPPSHGPGHLPSHGQRPPSPSHGHAPPSGGHTPPRGQ 161

Query: 354 ASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-SPPP 491
             P   + +PP      PPP  + PPP     P   V PPP  SPPP
Sbjct: 162 HPPSHRRPSPPSRHGHPPPPTYAQPPPTPIYSPSPQVQPPPTYSPPP 208

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 38/100 (38%), Positives = 46/100 (46%), Gaps = 6/100 (6%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPP----TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP--V 371
           Q+PPS  P+   APP    TPP    P + +   PP +   P     PPP  A PPP  +
Sbjct: 139 QRPPS--PSHGHAPPSGGHTPPRGQHPPSHRRPSPPSRHGHP-----PPPTYAQPPPTPI 191

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            S  P VQ   PPP  S PPP    P P+P +      PP
Sbjct: 192 YSPSPQVQ---PPPTYSPPPPTHVQPTPSPPSRGHQPQPP 228

[95][TOP]
>UniRef100_UPI00019829A2 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019829A2
          Length = 726

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 48/103 (46%), Positives = 55/103 (53%), Gaps = 11/103 (10%)
 Frame = +3

Query: 216 PPSTSPNASPA----------PPTPPTNTPPTTPQASPPPVQSAPPTAQS-SPPPVQASP 362
           PPS+ PNA P           PP  P   P   P ASPPP    P  A S S PP  + P
Sbjct: 39  PPSSQPNADPPDGAAGSTSSPPPQSPPAVPAAPPPASPPPPPPTPSLANSPSSPPPPSPP 98

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PP  +APPP    S PP++  PPP  S+P P P+TPPP SPPP
Sbjct: 99  PPSPNAPPPTPPPS-PPIAPVPPP--SNPSPPPLTPPPTSPPP 138

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 51/103 (49%), Positives = 58/103 (56%), Gaps = 9/103 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTP--PTTPQASPPPVQSAPPTA----QSSPPPVQ---ASPPP 368
           PP T P  SP PP PPTN P  P  P  + PPV S PP +    +SSPPP +    SPPP
Sbjct: 127 PPLTPPPTSPPPPPPPTNPPRSPPPPPPTEPPVTSPPPPSSNPPKSSPPPSEPPKTSPPP 186

Query: 369 VQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             S PPPV   SPP  S + PP  S PPP PV P  ++PP  S
Sbjct: 187 -PSKPPPV---SPPSPSPSSPPEDSPPPPVPVPPSNSTPPAPS 225

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 41/94 (43%), Positives = 48/94 (51%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           Q PP+      PA P PP  TP      S PP  S PP + ++PPP     PP+   PPP
Sbjct: 62  QSPPAVPAAPPPASPPPPPPTPSLANSPSSPPPPSPPPPSPNAPPPTPPPSPPIAPVPPP 121

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               SPPP+  TPPP    PPP P  PP + PPP
Sbjct: 122 -SNPSPPPL--TPPPTSPPPPPPPTNPPRSPPPP 152

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 46/112 (41%), Positives = 57/112 (50%), Gaps = 12/112 (10%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPA-------PPTPPT----NTPPTTPQASPPPVQ-SAPPTAQSSP 341
           +     PP  SP A PA       PP PPT    N+P + P  SPPP   +APP      
Sbjct: 53  AGSTSSPPPQSPPAVPAAPPPASPPPPPPTPSLANSPSSPPPPSPPPPSPNAPPPTPPPS 112

Query: 342 PPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PP+   PPP   +PPP+   +PPP S  PPP  ++PP +P  PPP  PP  S
Sbjct: 113 PPIAPVPPPSNPSPPPL---TPPPTSPPPPPPPTNPPRSPPPPPPTEPPVTS 161

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 46/95 (48%), Positives = 56/95 (58%), Gaps = 3/95 (3%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           PS+ P  SP PP+P  N PP TP  SPP +   PP +  SPPP+  +PPP    PPP   
Sbjct: 89  PSSPPPPSPPPPSP--NAPPPTPPPSPP-IAPVPPPSNPSPPPL--TPPPTSPPPPPPPT 143

Query: 399 S---SPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           +   SPPP   T PPV S PPP+   PP +SPPP+
Sbjct: 144 NPPRSPPPPPPTEPPVTSPPPPSS-NPPKSSPPPS 177

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 50/114 (43%), Positives = 61/114 (53%), Gaps = 18/114 (15%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASP----APPTPPTNTPPTTPQASPPPVQSAPPTAQ---------SSP 341
           A A  PP++SP+A P    A P PP ++PP  P++S PP  S+ P A          SSP
Sbjct: 2   ATASPPPNSSPSAVPPTSAATPPPPLSSPPPPPESSTPP--SSQPNADPPDGAAGSTSSP 59

Query: 342 PPVQASPPPVQSAPPPVQQSSPPPV-----SSTPPPVQSSPPPAPVTPPPASPP 488
           PP   SPP V +APPP     PPP      S + PP  S PPP+P  PPP  PP
Sbjct: 60  PP--QSPPAVPAAPPPASPPPPPPTPSLANSPSSPPPPSPPPPSPNAPPPTPPP 111

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 48/102 (47%), Positives = 57/102 (55%), Gaps = 8/102 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTP--PTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP  SPNA   PPTPP + P  P  P ++P P    PP     PPP   +PP     PPP
Sbjct: 97  PPPPSPNA--PPPTPPPSPPIAPVPPPSNPSPPPLTPPPTSPPPPPPPTNPPRSPPPPPP 154

Query: 390 VQQ--SSPPPVSSTPPPVQSSPPPA--PVT--PPPASPPPAS 497
            +   +SPPP SS PP  +SSPPP+  P T  PPP+ PPP S
Sbjct: 155 TEPPVTSPPPPSSNPP--KSSPPPSEPPKTSPPPPSKPPPVS 194

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 47/99 (47%), Positives = 53/99 (53%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTP---PTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PP T P + P  P PP + P   P TP  + PP    P     SPPP   + PPV S PP
Sbjct: 105 PPPTPPPSPPIAPVPPPSNPSPPPLTPPPTSPPPPPPPTNPPRSPPPPPPTEPPVTSPPP 164

Query: 387 PVQQSSPPPVSSTPP--PVQSSPPPAPVTPPPASPPPAS 497
           P   SS PP SS PP  P ++SPPP P  PPP SPP  S
Sbjct: 165 P---SSNPPKSSPPPSEPPKTSPPP-PSKPPPVSPPSPS 199

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 46/94 (48%), Positives = 53/94 (56%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP+ S   SP+ P PP+  PP +P A PP    +PP A   PPP   SPPP+   PPP  
Sbjct: 80  PPTPSLANSPSSPPPPS-PPPPSPNAPPPTPPPSPPIAPV-PPPSNPSPPPL--TPPPT- 134

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            S PPP   T PP +S PPP P  PP  SPPP S
Sbjct: 135 -SPPPPPPPTNPP-RSPPPPPPTEPPVTSPPPPS 166

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 46/100 (46%), Positives = 53/100 (53%), Gaps = 5/100 (5%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNT-----PPTTPQASPPPVQSAPPTAQSSPPPVQASPPPV 371
           A  PP ++P  SP P TPP  +     PPT P  SPPP     P   S PPP  +S PP 
Sbjct: 116 APVPPPSNP--SPPPLTPPPTSPPPPPPPTNPPRSPPPPPPTEPPVTSPPPP--SSNPPK 171

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            S PP     + PP  S PPPV S P P+P +PP  SPPP
Sbjct: 172 SSPPPSEPPKTSPPPPSKPPPV-SPPSPSPSSPPEDSPPP 210

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 47/101 (46%), Positives = 57/101 (56%), Gaps = 9/101 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT--PPTNTPPTT--PQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP+  P  SP PP+  PP ++PP +  P+ SPPP    PP +  SP P   S PP  S P
Sbjct: 153 PPTEPPVTSPPPPSSNPPKSSPPPSEPPKTSPPPPSKPPPVSPPSPSP---SSPPEDSPP 209

Query: 384 PPVQQSSPPPVSSTPP---PVQSSP--PPAPVTPPPASPPP 491
           PPV     PP +STPP   P  S P  PP+P +PP  SPPP
Sbjct: 210 PPV---PVPPSNSTPPAPSPSGSQPATPPSPNSPPKGSPPP 247

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 42/97 (43%), Positives = 51/97 (52%), Gaps = 6/97 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPP------TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           PPS  P  SP PP      +PP+ +P + P+ SPPP    PP+  + P P   SP   Q 
Sbjct: 175 PPSEPPKTSPPPPSKPPPVSPPSPSPSSPPEDSPPPPVPVPPSNSTPPAP---SPSGSQP 231

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           A PP   S  PP  S PPP   +PPP   +PPP SPP
Sbjct: 232 ATPPSPNS--PPKGSPPPPRTPTPPPPARSPPPLSPP 266

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/101 (43%), Positives = 53/101 (52%), Gaps = 14/101 (13%)
 Frame = +3

Query: 237 ASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQ---ASPPP----VQSAPPPVQ 395
           ASP P + P+  PPT+    PPP+ S PP  +SS PP     A PP       S+PPP  
Sbjct: 4   ASPPPNSSPSAVPPTSAATPPPPLSSPPPPPESSTPPSSQPNADPPDGAAGSTSSPPP-- 61

Query: 396 QSSPPPVSSTPPPVQS-SPPP------APVTPPPASPPPAS 497
             SPP V + PPP     PPP      +P +PPP SPPP S
Sbjct: 62  -QSPPAVPAAPPPASPPPPPPTPSLANSPSSPPPPSPPPPS 101

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/81 (46%), Positives = 46/81 (56%), Gaps = 5/81 (6%)
 Frame = +3

Query: 264 TNTPPTTPQASPPPVQSAPPTAQSSPPPVQAS--PPPVQSAPPPVQQSSPPP---VSSTP 428
           T +PP  P +SP  V   PPT+ ++PPP  +S  PPP  S PP  Q ++ PP     ST 
Sbjct: 3   TASPP--PNSSPSAV---PPTSAATPPPPLSSPPPPPESSTPPSSQPNADPPDGAAGSTS 57

Query: 429 PPVQSSPPPAPVTPPPASPPP 491
            P   SPP  P  PPPASPPP
Sbjct: 58  SPPPQSPPAVPAAPPPASPPP 78

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PPS SP++ P   P PP   PP+    S PP  S P  +Q + PP   SPP  + +PPP 
Sbjct: 195 PPSPSPSSPPEDSPPPPVPVPPSN---STPPAPS-PSGSQPATPPSPNSPP--KGSPPPP 248

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           +  +PPP + +PPP+  SPP +P TP   S  P+
Sbjct: 249 RTPTPPPPARSPPPL--SPPSSPQTPNSPSDSPS 280

[96][TOP]
>UniRef100_Q9FFW5 Similarity to protein kinase n=1 Tax=Arabidopsis thaliana
           RepID=Q9FFW5_ARATH
          Length = 681

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/107 (50%), Positives = 60/107 (56%), Gaps = 15/107 (14%)
 Frame = +3

Query: 216 PPSTSPNASPAP----PTPPTNTPPTTPQASPPPVQSAPPTAQSS-PPPVQASPPPVQSA 380
           P S S   +P P    PT P+  PP TP  SPP  QS PP   SS PPPV +SPPP  S 
Sbjct: 13  PSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPP--QSPPPVVSSSPPPPVVSSPPPSSSP 70

Query: 381 P--PPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPPA-----SPPP 491
           P  PPV  S PP V+S+PPP   + S PP  P T PPA     SPPP
Sbjct: 71  PPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPP 117

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 53/102 (51%), Positives = 65/102 (63%), Gaps = 9/102 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQAS--PPPVQSAPPP 389
           PPS+  N+S   P PP  T PTTP A PPPV + PP+   SPPPV +S  PPPV S+PPP
Sbjct: 12  PPSS--NSSTTAP-PPLQTQPTTPSA-PPPV-TPPPSPPQSPPPVVSSSPPPPVVSSPPP 66

Query: 390 VQQSSP-PPVSSTPPPVQSSPPPAPV---TPPPASP---PPA 494
                P PPV ++PPP  +S PP PV   +PPP++P   PPA
Sbjct: 67  SSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPA 108

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 51/111 (45%), Positives = 58/111 (52%), Gaps = 20/111 (18%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP--PPVQASPPP--VQSAPP 386
           PS  P  +P PP+PP + PP    + PPPV S+PP + S P  PPV  SPPP    S PP
Sbjct: 32  PSAPPPVTP-PPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPP 90

Query: 387 PVQQSSPPP-------------VSSTPPPVQSSPPPAPVT---PPPASPPP 491
           PV  +SPPP             VS  PPP  S  PPAP T   PP  SP P
Sbjct: 91  PVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSP 141

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 43/90 (47%), Positives = 51/90 (56%), Gaps = 6/90 (6%)
 Frame = +3

Query: 240 SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVS 419
           S  PP P  + P +    + PP     PT  S+PPPV   P P QS PP V  S PPPV 
Sbjct: 2   SLVPPLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVV 61

Query: 420 STPPPVQSSPPPAP---VTPPP---ASPPP 491
           S+PPP  SSPPP+P    +PPP   +SPPP
Sbjct: 62  SSPPP-SSSPPPSPPVITSPPPTVASSPPP 90

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 48/100 (48%), Positives = 54/100 (54%), Gaps = 3/100 (3%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQA-SPPPVQSAPPTAQSSPP-PVQASPPPVQSA 380
           A  PP     ASP P TP T TPP  PQ  SPPP    PP A  SPP P   +PPP  S 
Sbjct: 85  ASSPPPPVVIASPPPSTPAT-TPPAPPQTVSPPP----PPDASPSPPAPTTTNPPPKPSP 139

Query: 381 PPPVQQSSPPPVSSTPP-PVQSSPPPAPVTPPPASPPPAS 497
            PP +  SPP  + +PP P  S+P P   T PP  PPPA+
Sbjct: 140 SPPGETPSPPGETPSPPKPSPSTPTPTTTTSPP--PPPAT 177

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 49/123 (39%), Positives = 60/123 (48%), Gaps = 24/123 (19%)
 Frame = +3

Query: 195 VSAGAQQPP--STSPNASPAPPTPP--TNTPPTTPQASPPPV-------------QSAPP 323
           V + +  PP  S+ P +S  PP+PP  T+ PPT   + PPPV               APP
Sbjct: 51  VVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPP 110

Query: 324 TAQSSPPPVQAS---PPPVQSAPPPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPP---AS 482
              S PPP  AS   P P  + PPP    SPP  + +PP    SPP P+P TP P    S
Sbjct: 111 QTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTS 170

Query: 483 PPP 491
           PPP
Sbjct: 171 PPP 173

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 38/95 (40%), Positives = 46/95 (48%), Gaps = 3/95 (3%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP---PVQASPPPVQSAPPP 389
           P   P+ASP+PP P T  PP  P  SPP    +PP    SPP   P   +P    S PPP
Sbjct: 115 PPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPP 174

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              S+ PP S+   P   +PPP P+   P   P A
Sbjct: 175 PATSASPPSSNPTDPSTLAPPPTPLPVVPREKPIA 209

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 42/104 (40%), Positives = 51/104 (49%), Gaps = 9/104 (8%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASP----PPVQSAPPTAQSSPPPVQASPPPVQ 374
           A  PPST     PAP  P T +PP  P ASP    P   + PP    SPP    SPP   
Sbjct: 95  ASPPPSTPATTPPAP--PQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGET 152

Query: 375 SAPPPVQQSSPPPVSST---PPPVQSSPPPA--PVTPPPASPPP 491
            +PP    S+P P ++T   PPP  S+ PP+  P  P   +PPP
Sbjct: 153 PSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPP 196

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 41/99 (41%), Positives = 47/99 (47%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAP-PTAQSSPPPVQASPPPVQSAPPPV 392
           PP  SP+     P+PP  TP     + P P  S P PT  +SPP     PPP  SA PP 
Sbjct: 134 PPKPSPSPPGETPSPPGETP-----SPPKPSPSTPTPTTTTSPP-----PPPATSASPP- 182

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTP---PPASPP-PAS 497
             S+P   S+  PP    P P PV P   P A P  PAS
Sbjct: 183 -SSNPTDPSTLAPP----PTPLPVVPREKPIAKPTGPAS 216

[97][TOP]
>UniRef100_B9H3S0 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9H3S0_POPTR
          Length = 686

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 50/100 (50%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP-------PVQ 374
           PP  SP ASP PP PP  TPP+ P A PP   +APP     PPP+  SPP       PV 
Sbjct: 59  PPPPSPPASP-PPAPPALTPPSPPTAPPPASTTAPPP----PPPISTSPPPRASPTTPVT 113

Query: 375 SAPPP--VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           S PPP  V  S PPP +   PP  +SPPP P   PP SPP
Sbjct: 114 SPPPPQAVSPSPPPPANDPIPPATNSPPP-PTEKPPESPP 152

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/107 (46%), Positives = 59/107 (55%), Gaps = 11/107 (10%)
 Frame = +3

Query: 210 QQPPSTSPNASP-APP--------TPPTNTPPTTPQASPPPVQSA--PPTAQSSPPPVQA 356
           Q PP   P ASP APP        TPP   PP +P ASPPP   A  PP+  ++PPP   
Sbjct: 30  QSPPPAPPAASPPAPPPPSPIIPSTPPPFPPPPSPPASPPPAPPALTPPSPPTAPPPAST 89

Query: 357 SPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           + PP    PPP   +SPPP +S   PV S PPP  V+P P  PPPA+
Sbjct: 90  TAPP----PPPPISTSPPPRASPTTPVTSPPPPQAVSPSP--PPPAN 130

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 50/121 (41%), Positives = 59/121 (48%), Gaps = 28/121 (23%)
 Frame = +3

Query: 216 PPSTSPNASPAPP----TPPTNTPPTTPQASPPPVQSA------------PPTAQSSPPP 347
           PP  S  A P PP    +PP    PTTP  SPPP Q+             PP   S PPP
Sbjct: 84  PPPASTTAPPPPPPISTSPPPRASPTTPVTSPPPPQAVSPSPPPPANDPIPPATNSPPPP 143

Query: 348 VQ---ASPPPVQSAPPP---VQQSSPPPVSSTPPP----VQSSPPPAPVT--PPPASPPP 491
            +    SPP + + PPP    Q  SPPP +++PPP    +QS PP  P T   PPA  PP
Sbjct: 144 TEKPPESPPALPTVPPPPPSSQSDSPPPTTNSPPPPISTLQSPPPSIPSTSSTPPAISPP 203

Query: 492 A 494
           A
Sbjct: 204 A 204

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 46/101 (45%), Positives = 56/101 (55%), Gaps = 10/101 (9%)
 Frame = +3

Query: 219 PSTSPN-ASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQ--ASPPPVQSA-PP 386
           PST  N A+P P +PP   P  +P A PPP    P T    PPP    ASPPP   A  P
Sbjct: 18  PSTPSNPATPPPQSPPPAPPAASPPAPPPPSPIIPSTPPPFPPPPSPPASPPPAPPALTP 77

Query: 387 PVQQSSPPPVSST----PPPVQSSPPP--APVTPPPASPPP 491
           P   ++PPP S+T    PPP+ +SPPP  +P TP  + PPP
Sbjct: 78  PSPPTAPPPASTTAPPPPPPISTSPPPRASPTTPVTSPPPP 118

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 53/126 (42%), Positives = 66/126 (52%), Gaps = 33/126 (26%)
 Frame = +3

Query: 216 PPSTSPNASPA--PPTPPTNTPP--TTPQASPPPVQSAPP------TAQSSPPPVQA--- 356
           PP++ P A PA  PP+PPT  PP  TT    PPP+ ++PP      T  +SPPP QA   
Sbjct: 64  PPASPPPAPPALTPPSPPTAPPPASTTAPPPPPPISTSPPPRASPTTPVTSPPPPQAVSP 123

Query: 357 SPPP---------VQSAPPPVQQ--SSPPPVSSTPPPVQSS----PPPAPVTPPP----- 476
           SPPP           S PPP ++   SPP + + PPP  SS    PPP   +PPP     
Sbjct: 124 SPPPPANDPIPPATNSPPPPTEKPPESPPALPTVPPPPPSSQSDSPPPTTNSPPPPISTL 183

Query: 477 ASPPPA 494
            SPPP+
Sbjct: 184 QSPPPS 189

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 47/114 (41%), Positives = 60/114 (52%), Gaps = 14/114 (12%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPT--PPTNT---PPTTPQASPPPVQSAPPTAQSSPPPVQA-- 356
           S  A  PP+      P+PPT  PP +T   PP  P ++ PP +++P T  +SPPP QA  
Sbjct: 63  SPPASPPPAPPALTPPSPPTAPPPASTTAPPPPPPISTSPPPRASPTTPVTSPPPPQAVS 122

Query: 357 -SPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA------SPPPAS 497
            SPPP  + P P   +SPPP +  PP    SPP  P  PPP       SPPP +
Sbjct: 123 PSPPPPANDPIPPATNSPPPPTEKPP---ESPPALPTVPPPPPSSQSDSPPPTT 173

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 46/99 (46%), Positives = 56/99 (56%), Gaps = 9/99 (9%)
 Frame = +3

Query: 216 PPSTSP--NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS-SPPPVQASPPP----VQ 374
           PP+  P   A+ +PP PPT  PP +P A P  V   PP++QS SPPP   SPPP    +Q
Sbjct: 127 PPANDPIPPATNSPP-PPTEKPPESPPALPT-VPPPPPSSQSDSPPPTTNSPPPPISTLQ 184

Query: 375 SAPP--PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
           S PP  P   S+PP +S   PPV SS   +P  P PA P
Sbjct: 185 SPPPSIPSTSSTPPAISPPAPPVNSSVTGSPTPPFPAIP 223

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 44/107 (41%), Positives = 53/107 (49%), Gaps = 14/107 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT-----PPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA-SPPPVQS 377
           PP  + + SP PP      P TN+PP  P   PP    A PT    PP  Q+ SPPP  +
Sbjct: 116 PPPQAVSPSPPPPANDPIPPATNSPPP-PTEKPPESPPALPTVPPPPPSSQSDSPPPTTN 174

Query: 378 APPP---VQQSSPPPV---SSTPPPVQSSPPP--APVTPPPASPPPA 494
           +PPP     QS PP +   SSTPP +    PP  + VT  P  P PA
Sbjct: 175 SPPPPISTLQSPPPSIPSTSSTPPAISPPAPPVNSSVTGSPTPPFPA 221

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 38/92 (41%), Positives = 49/92 (53%), Gaps = 10/92 (10%)
 Frame = +3

Query: 252 PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP------PVQQSSPPP 413
           P P T+ P    Q   PP+ S P    ++PPP    P P  ++PP      P+  S+PPP
Sbjct: 2   PPPSTSQPD---QTIDPPLPSTPSNP-ATPPPQSPPPAPPAASPPAPPPPSPIIPSTPPP 57

Query: 414 VSSTPPPVQSSPPPAP--VTP--PPASPPPAS 497
               P P  +SPPPAP  +TP  PP +PPPAS
Sbjct: 58  FPPPPSP-PASPPPAPPALTPPSPPTAPPPAS 88

[98][TOP]
>UniRef100_Q09085 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q09085_PHAVU
          Length = 368

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 48/109 (44%), Positives = 59/109 (54%), Gaps = 13/109 (11%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPV--QASPPP 368
           + PP  SP+  P     +PP P  + PP     SPPP   +PP + S PPP   ++ PPP
Sbjct: 209 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPP 268

Query: 369 VQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
             S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 269 DPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 317

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 47/109 (43%), Positives = 55/109 (50%), Gaps = 13/109 (11%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPPP 368
           + PP   P+  P     +PP P  + PP     SPPP   +PP      SPPP   SPPP
Sbjct: 193 KSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 252

Query: 369 VQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
             S PPP    SPPP   +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 253 SPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 301

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 45/95 (47%), Positives = 52/95 (54%), Gaps = 8/95 (8%)
 Frame = +3

Query: 231 PNASPAPPTPPTNTPPTTPQASPPP---VQSAPPTAQSSPPP--VQASPPPVQSAPPPVQ 395
           P  SP+PP P     P  P  SPPP    +S PP   S PPP   ++ PPP  S PPP  
Sbjct: 164 PPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYY 223

Query: 396 QSSPPPVSSTPPP---VQSSPPPAPVTPPPASPPP 491
             SPPP S +PPP    +S PPP+P  PP  SPPP
Sbjct: 224 YKSPPPPSPSPPPPYYYKSPPPPSPSPPPSPSPPP 258

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 45/107 (42%), Positives = 54/107 (50%), Gaps = 13/107 (12%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPP----TNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPPP 368
           + PP  SP+  P+P  PP     + PP  P   PP    +PP    SPPP    ++ PPP
Sbjct: 241 KSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 300

Query: 369 VQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPP 491
             S PPP    SPPP S  PP     +S PPP+P  PPP    SPPP
Sbjct: 301 SPSPPPPYYYKSPPPPSPDPPTPYYYKSPPPPSPSPPPPYYYVSPPP 347

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 50/110 (45%), Positives = 56/110 (50%), Gaps = 18/110 (16%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPP---VQSAPPTAQSSPPPV--QASPPPVQSA 380
           PPS SP  SP+PP P     P  P  SPPP    +S PP + S PPP   ++ PPP  S 
Sbjct: 245 PPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSP 304

Query: 381 PPPVQQSSPPPVSSTPP--------PVQSSPPPAP---VTPPP--ASPPP 491
           PPP    SPPP S  PP        P  S  PP P   V+PPP   SPPP
Sbjct: 305 PPPYYYKSPPPPSPDPPTPYYYKSPPPPSPSPPPPYYYVSPPPPTKSPPP 354

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 46/110 (41%), Positives = 57/110 (51%), Gaps = 14/110 (12%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPP 365
           + PP  SP+  P     +PP P   +PP +P   PP    +PP    SPPP    ++ PP
Sbjct: 225 KSPPPPSPSPPPPYYYKSPPPPSP-SPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPP 283

Query: 366 PVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           P  S PPP    SPPP S +PPP    +S PPP+P  P P    SPPP S
Sbjct: 284 PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPDPPTPYYYKSPPPPS 333

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 49/111 (44%), Positives = 56/111 (50%), Gaps = 15/111 (13%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPPP 368
           + PP  SP+  P     +PP P  + PP     SPPP   +PP      SPPP   SPPP
Sbjct: 177 KSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 236

Query: 369 ---VQSAPPPVQQSSPPPVSSTPPP--VQSSPPPAPVTPPP---ASPPPAS 497
               +S PPP    SPPP  S PPP   +S PPP P  PPP    SPPP S
Sbjct: 237 PYYYKSPPPP--SPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPS 285

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 49/115 (42%), Positives = 57/115 (49%), Gaps = 21/115 (18%)
 Frame = +3

Query: 216 PPSTSPNA----SPAPPTPPTNTPPTTPQASPPPVQSAPPTA--QSSPPPVQASPPPV-- 371
           PPS SP+     SP PP      PP   ++ PPP  S PP    +S PPP  + PPP   
Sbjct: 133 PPSPSPSPYYYKSPPPPHKDPYYPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYY 192

Query: 372 -------QSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
                   S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 193 KSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 247

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 44/111 (39%), Positives = 50/111 (45%), Gaps = 18/111 (16%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAP-PTAQSSPPP-----------VQASP 362
           P   P    +PP P     P     SPPP   +P P    SPPP            ++ P
Sbjct: 105 PYHKPYYYNSPPPPYYYKSPPYYYKSPPPPSPSPSPYYYKSPPPPHKDPYYPPYYYKSPP 164

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           PP  S PPP    SPPP S +PPP    +S PPP P  PPP    SPPP S
Sbjct: 165 PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPS 215

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 42/102 (41%), Positives = 47/102 (46%), Gaps = 18/102 (17%)
 Frame = +3

Query: 240 SPAPPTPPT--NTPPTTPQASPPPVQSAPPTAQSSPPPVQ--------ASPPPVQSAP-- 383
           SP P   P   N+PP      PP    +PP    SPPP           SPPP    P  
Sbjct: 102 SPTPYHKPYYYNSPP------PPYYYKSPPYYYKSPPPPSPSPSPYYYKSPPPPHKDPYY 155

Query: 384 PPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPP 491
           PP    SPPP S +PPP    +S PPP+P  PPP    SPPP
Sbjct: 156 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPP 197

[99][TOP]
>UniRef100_A9STR8 Predicted protein (Fragment) n=1 Tax=Physcomitrella patens subsp.
           patens RepID=A9STR8_PHYPA
          Length = 325

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 48/100 (48%), Positives = 56/100 (56%), Gaps = 6/100 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT-PPTNTPPTT---PQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP +SP  +P+PP   PT+ PP     P   PPPV+S PP     P P   +PPP+   P
Sbjct: 95  PPESSPPPNPSPPPLDPTSPPPDPFQPPPFVPPPVESPPPILPPPPQPAPVAPPPIIVTP 154

Query: 384 PPVQQSS--PPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PP       PPP  ST PP   SPPPA  +PPP SPPPAS
Sbjct: 155 PPQVPPPVLPPPAPSTAPPPSISPPPAN-SPPPWSPPPAS 193

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 44/106 (41%), Positives = 54/106 (50%), Gaps = 5/106 (4%)
 Frame = +3

Query: 192 FVSAGAQQPPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPP 368
           F  A    PP+  P+ + APP P    PP  P ++SPPP  S PP   +SPPP    PPP
Sbjct: 65  FPPAWTDSPPAPPPDTT-APPDPAGQPPPLLPPESSPPPNPSPPPLDPTSPPPDPFQPPP 123

Query: 369 VQ----SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
                  +PPP+    P P    PPP+  +PPP    PPP  PPPA
Sbjct: 124 FVPPPVESPPPILPPPPQPAPVAPPPIIVTPPPQ--VPPPVLPPPA 167

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/106 (46%), Positives = 57/106 (53%), Gaps = 12/106 (11%)
 Frame = +3

Query: 216 PPSTSPNA------SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPV-- 371
           PP  +P A      +P P  PP   PP  P  +PPP  S PP   +SPPP   SPPP   
Sbjct: 139 PPQPAPVAPPPIIVTPPPQVPPPVLPPPAPSTAPPPSISPPPA--NSPPP--WSPPPASP 194

Query: 372 -QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVT---PPPASPPPAS 497
            QS+PPP     PPP  S PP  +SSPPP P +   PPP + PPAS
Sbjct: 195 PQSSPPP----PPPPSGSPPPSRESSPPPPPASAPAPPPTAVPPAS 236

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 49/115 (42%), Positives = 59/115 (51%), Gaps = 15/115 (13%)
 Frame = +3

Query: 192 FVSAGAQQP-----PSTSPNASPAPPTPPTNTP-PTTPQASPPPVQSAPPTAQSSPPPVQ 353
           F+   AQ P     P+  P  + +PP PP +T  P  P   PPP+   PP  +SSPPP  
Sbjct: 49  FIGNPAQAPFDGNNPAFPPAWTDSPPAPPPDTTAPPDPAGQPPPL--LPP--ESSPPP-N 103

Query: 354 ASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPP-------PAPVTPPP--ASPPP 491
            SPPP+    PP     PPP    PPPV+S PP       PAPV PPP   +PPP
Sbjct: 104 PSPPPLDPTSPPPDPFQPPPF--VPPPVESPPPILPPPPQPAPVAPPPIIVTPPP 156

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 46/105 (43%), Positives = 57/105 (54%), Gaps = 2/105 (1%)
 Frame = +3

Query: 189 VFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTA--QSSPPPVQASP 362
           + V+   Q PP   P  +P+   PP+ +PP  P  SPPP  S PP +  QSSPPP    P
Sbjct: 150 IIVTPPPQVPPPVLPPPAPSTAPPPSISPP--PANSPPP-WSPPPASPPQSSPPP----P 202

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PP   +PPP ++SSPPP     PP   +P P P   PPAS P  S
Sbjct: 203 PPPSGSPPPSRESSPPP-----PPAS-APAPPPTAVPPASAPRGS 241

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 6/100 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPP---TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PPS SP  + +PP    PP + P ++P   PPP  S PP+ +SSPPP  AS P    APP
Sbjct: 173 PPSISPPPANSPPPWSPPPASPPQSSPPPPPPPSGSPPPSRESSPPPPPASAP----APP 228

Query: 387 PVQQSSPPPVSST--PPPVQSSPPPAP-VTPPPASPPPAS 497
           P   ++ PP S+    PP+  +P   P +T P  +PPP++
Sbjct: 229 P---TAVPPASAPRGSPPISLAPAVIPRITQPDFTPPPST 265

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 34/96 (35%), Positives = 50/96 (52%), Gaps = 7/96 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP-------PPVQ 374
           PP++ P +SP PP PP+ +PP + ++SPPP    PP +  +PPP    P       PP+ 
Sbjct: 190 PPASPPQSSPPPPPPPSGSPPPSRESSPPP----PPASAPAPPPTAVPPASAPRGSPPIS 245

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPAS 482
            AP  + + + P    TPPP  +   P+   P P S
Sbjct: 246 LAPAVIPRITQP--DFTPPPSTNHSGPSSALPSPPS 279

[100][TOP]
>UniRef100_A8JFD4 Glyoxal or galactose oxidase (Fragment) n=1 Tax=Chlamydomonas
           reinhardtii RepID=A8JFD4_CHLRE
          Length = 898

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 42/94 (44%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = +3

Query: 213 QPPSTSP-NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           +PPS SP + SP  P PP+  PP+ P  SPPP    PP+     PP  + PPP  S P P
Sbjct: 237 RPPSPSPPSPSPPSPRPPSPRPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPTP 296

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                P  V ++P P  S PPP P +PPP  PPP
Sbjct: 297 SPPPPPSTVLTSPSPPPSPPPPRPPSPPPPRPPP 330

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 41/95 (43%), Positives = 51/95 (53%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           +PP   P+ SP  P+PP+ +PP+    SP P    PP+ +  P P   SP P    PP  
Sbjct: 198 RPPPPPPSPSPPSPSPPSPSPPSPSPPSPSPPSPRPPSPR-PPSPSPPSPSPPSPRPPSP 256

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           +  SPPP  S PPP    P P P +PPP SPPP S
Sbjct: 257 RPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPS 290

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 44/101 (43%), Positives = 54/101 (53%), Gaps = 1/101 (0%)
 Frame = +3

Query: 198 SAGAQQPPSTSP-NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           S  +  PPS SP + SP  P+PP+  PP+    SP P   +PP+ +  P P   SPPP  
Sbjct: 207 SPPSPSPPSPSPPSPSPPSPSPPSPRPPSPRPPSPSPPSPSPPSPRP-PSPRPPSPPPPS 265

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             PP     SPPP S  PP   S PPP+P  P P+ PPP S
Sbjct: 266 PPPPSPPPPSPPPPSPPPP---SPPPPSPSPPTPSPPPPPS 303

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 46/109 (42%), Positives = 54/109 (49%), Gaps = 16/109 (14%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP--VQASPPPVQSAPPP 389
           PP + P  SP PP+PP   PP+ P  SPPP   +PPT    PPP  V  SP P  S PPP
Sbjct: 262 PPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPSPPTPSPPPPPSTVLTSPSPPPSPPPP 318

Query: 390 VQQSSPPPVSSTP-PPVQS-------------SPPPAPVTPPPASPPPA 494
              S PPP    P PP+               +PP AP+ PP +  PPA
Sbjct: 319 RPPSPPPPRPPPPRPPLPGTGGPKPSGDAFPPTPPDAPLFPPLSPSPPA 367

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 48/109 (44%), Positives = 55/109 (50%), Gaps = 11/109 (10%)
 Frame = +3

Query: 198 SAGAQQPPSTSP-NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQS-SPPPVQASPPPV 371
           S  +  PPS SP + SP  P PP+  PP+    SP P    PP+ +  SPPP   SPPP 
Sbjct: 212 SPPSPSPPSPSPPSPSPPSPRPPSPRPPSPSPPSPSPPSPRPPSPRPPSPPP--PSPPPP 269

Query: 372 QSAPPPVQQSSPPPVSSTPP---PVQSSPPPAPVT------PPPASPPP 491
              PP     SPPP S  PP   P   SPPP P T      PPP+ PPP
Sbjct: 270 SPPPPSPPPPSPPPPSPPPPSPSPPTPSPPPPPSTVLTSPSPPPSPPPP 318

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 44/106 (41%), Positives = 49/106 (46%), Gaps = 12/106 (11%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP---PVQSAPP 386
           PP   P+  P  P PP  TP + P  S PP+   PP    SP P   SPP   P   +PP
Sbjct: 165 PPRPPPSPPPPRPPPPVVTPASRPADSSPPLPPRPPPPPPSPSPPSPSPPSPSPPSPSPP 224

Query: 387 PVQQSSPPPVSSTPP---PVQSSPP------PAPVTPPPASPPPAS 497
                SP P S  PP   P   SPP      P P +PPP SPPP S
Sbjct: 225 SPSPPSPRPPSPRPPSPSPPSPSPPSPRPPSPRPPSPPPPSPPPPS 270

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 44/95 (46%), Positives = 52/95 (54%), Gaps = 1/95 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP-PVQASPPPVQSAPPPV 392
           PP+ SP  SP+PP PP + PP  P+  PP V  A   A SSPP P +  PPP   +PP  
Sbjct: 155 PPAQSP-MSPSPPRPPPSPPP--PRPPPPVVTPASRPADSSPPLPPRPPPPPPSPSPPSP 211

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              SP P S +PP   S P P P +P P SP P S
Sbjct: 212 SPPSPSPPSPSPPS-PSPPSPRPPSPRPPSPSPPS 245

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 40/102 (39%), Positives = 49/102 (48%), Gaps = 6/102 (5%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP-- 383
           ++PP   P   P PP P T  PP   Q+   P+  +PP    SPPP +  PP V  A   
Sbjct: 132 KRPPPPGPPLPPLPPRPQTPPPPPPAQS---PMSPSPPRPPPSPPPPRPPPPVVTPASRP 188

Query: 384 ----PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
               PP+    PPP  S  PP  S P P+P +P P SP P S
Sbjct: 189 ADSSPPLPPRPPPPPPSPSPPSPSPPSPSPPSPSPPSPSPPS 230

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 39/99 (39%), Positives = 47/99 (47%), Gaps = 6/99 (6%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTP----PTTPQASPPPVQSAPPTAQSSPPPVQASPP-PVQSAP 383
           P   P     PP PP  +P    P  P  SPPP +  PP    +  P  +SPP P +  P
Sbjct: 142 PPLPPRPQTPPPPPPAQSPMSPSPPRPPPSPPPPRPPPPVVTPASRPADSSPPLPPRPPP 201

Query: 384 PPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
           PP   S P P   +P P   SPP P+P +P P SP P S
Sbjct: 202 PPPSPSPPSPSPPSPSPPSPSPPSPSPPSPRPPSPRPPS 240

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 41/111 (36%), Positives = 44/111 (39%), Gaps = 13/111 (11%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTT-----PQASPPPVQSAPPTAQSSPPPVQASPPP 368
           G   P    P   P PP+PP            P    PP+   PP  Q+ PPP  A  P 
Sbjct: 102 GGGNPSPRPPRPPPKPPSPPKKKKKKVKVKKRPPPPGPPLPPLPPRPQTPPPPPPAQSP- 160

Query: 369 VQSAPPPVQQSSPPPVSSTPP-------PVQSSPP-PAPVTPPPASPPPAS 497
             S  PP    SPPP    PP       P  SSPP P    PPP SP P S
Sbjct: 161 -MSPSPPRPPPSPPPPRPPPPVVTPASRPADSSPPLPPRPPPPPPSPSPPS 210

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 41/122 (33%), Positives = 56/122 (45%), Gaps = 15/122 (12%)
 Frame = +3

Query: 171 VGLICAVFVSAGAQQPPSTSPNASPAP----PTPPTNTP--PTTPQASPPPVQSAPPTAQ 332
           + L+  + ++AG Q  PS  P+ +PAP    P PP+  P  P  P   PP   ++  TA 
Sbjct: 1   LSLMSCLGLAAGQQASPS--PSPAPAPTATAPRPPSPAPVAPRPPLPRPPIGGASNATAV 58

Query: 333 SSPPPVQASPPP---VQSAPPPVQQSSP-PPVSSTPPPVQS-----SPPPAPVTPPPASP 485
             PPP+ A+PPP     + P PV    P     S   P  +     +P P P  PPP  P
Sbjct: 59  PRPPPLLATPPPSPLTVATPGPVPAPMPGDSTDSADAPTAALIGGGNPSPRPPRPPPKPP 118

Query: 486 PP 491
            P
Sbjct: 119 SP 120

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 32/87 (36%), Positives = 39/87 (44%), Gaps = 2/87 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPST   +   PP+PP   PP     SPPP +  PP     P P    P P   A PP  
Sbjct: 301 PPSTVLTSPSPPPSPPPPRPP-----SPPPPRPPPP---RPPLPGTGGPKPSGDAFPPTP 352

Query: 396 QSSP--PPVSSTPPPVQSSPPPAPVTP 470
             +P  PP+S +PP +   P P    P
Sbjct: 353 PDAPLFPPLSPSPPALMRPPSPPLADP 379

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 46/150 (30%), Positives = 59/150 (39%), Gaps = 52/150 (34%)
 Frame = +3

Query: 198 SAGAQQPPSTSP----------------NASPAPPTPPT-NTPPTTP--QASPPPV---- 308
           +A A +PPS +P                NA+  P  PP   TPP +P   A+P PV    
Sbjct: 26  TATAPRPPSPAPVAPRPPLPRPPIGGASNATAVPRPPPLLATPPPSPLTVATPGPVPAPM 85

Query: 309 ------QSAPPTAQ----SSPPPVQASPPPVQSAPP-------PVQQSSPPP-------- 413
                  +  PTA      +P P    PPP   +PP        V++  PPP        
Sbjct: 86  PGDSTDSADAPTAALIGGGNPSPRPPRPPPKPPSPPKKKKKKVKVKKRPPPPGPPLPPLP 145

Query: 414 ----VSSTPPPVQSSPPPAPVTPPPASPPP 491
                   PPP QS   P+P  PPP+ PPP
Sbjct: 146 PRPQTPPPPPPAQSPMSPSPPRPPPSPPPP 175

[101][TOP]
>UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas
           reinhardtii RepID=A8J1N3_CHLRE
          Length = 527

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 45/94 (47%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           QPP   P  SP PP+P    PP+ P  SP P   APP   S PPP    PPP    PPP 
Sbjct: 382 QPPLPPPPPSPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPP----PPPPPPPPPPP 437

Query: 393 QQSSP-PPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               P PP  S PPP    P PAP +PPP  PPP
Sbjct: 438 PPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPP 471

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 45/105 (42%), Positives = 51/105 (48%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP 362
           C   V AG   PPS  P  SP PP+P   +PP  P   PPP   APP+     PP  +  
Sbjct: 185 CCPQVQAGTPSPPSPLP-PSPRPPSPKPPSPPPPP--GPPPPSPAPPSPSPPSPPPPSPQ 241

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PPV  +P P     PPP S  PP     P PAP +P P SP P S
Sbjct: 242 PPVPPSPAPPTPPGPPPPSPAPPNPPPPPSPAPPSPKPPSPEPPS 286

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 45/98 (45%), Positives = 49/98 (50%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASP----PPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PPS +P A P+PP PP   PP  P   P    PP  S PP +   P P   SPPP    P
Sbjct: 412 PPSPAPPAPPSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPP 471

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PP    SP P S  PP   S PPP+P  P PA P P S
Sbjct: 472 PP----SPYPPSPAPPLPPSPPPPSPYPPSPAPPVPPS 505

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 47/94 (50%), Positives = 48/94 (51%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P  SPAPP+P    PP  P  SP P   APP   S PPP    P P   APP   
Sbjct: 368 PPSPLP-PSPAPPSPQPPLPPPPP--SPYPPSPAPPVPPSPPPPSPYPPSPAPPAPP--- 421

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP    PPP    PPP P  PPP SPPP S
Sbjct: 422 --SPPPPPPPPPPPPPPPPPFPPFPPPPSPPPPS 453

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 45/102 (44%), Positives = 51/102 (50%), Gaps = 8/102 (7%)
 Frame = +3

Query: 216 PPSTSPNA--SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PPS  P    SPAPPTPP   PP+    +PPP  S  P +   P P   SPPP  S  PP
Sbjct: 237 PPSPQPPVPPSPAPPTPPGPPPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPPPSPEPP 296

Query: 390 V------QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                  +  SP P    PPP    P P+P +PPP SPPP S
Sbjct: 297 SPKPPSPEPPSPQPPLPPPPPSPYPPSPSPPSPPPPSPPPPS 338

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 45/96 (46%), Positives = 50/96 (52%), Gaps = 4/96 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP-PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA---SPPPVQSAP 383
           PP   P  SPAPP+P P + PP +PQ   PP   APPT    PPP  A    PPP   AP
Sbjct: 216 PPPGPPPPSPAPPSPSPPSPPPPSPQPPVPP-SPAPPTPPGPPPPSPAPPNPPPPPSPAP 274

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           P  +  SP P S  PPP    P P P +P P SP P
Sbjct: 275 PSPKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQP 310

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 42/98 (42%), Positives = 48/98 (48%), Gaps = 3/98 (3%)
 Frame = +3

Query: 213 QPPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           +PPS  P + P PP   PP+  PP+    SPPP    PP   S  PP    PPP   APP
Sbjct: 205 RPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTPPGPPPPSPAPP 264

Query: 387 -PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            P    SP P S  PP  +   PP P +P P SP P S
Sbjct: 265 NPPPPPSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPS 302

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 46/94 (48%), Positives = 48/94 (51%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P  SPAPP PP+  PP  P   PPP    PP     PPP   SPPP    PP   
Sbjct: 407 PPSPYP-PSPAPPAPPSPPPPPPPPPPPPP---PPPPFPPFPPP--PSPPPPSPGPPSPA 460

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SPPP    PPP  S  PP+P  P P SPPP S
Sbjct: 461 PPSPPPPPPPPPP--SPYPPSPAPPLPPSPPPPS 492

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 48/113 (42%), Positives = 56/113 (49%), Gaps = 18/113 (15%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPT-AQSSPPP------------ 347
           +PPS  P   P PP+P  P+ +PP+ P  SPPP   APP+ A  SPPP            
Sbjct: 304 EPPSPQPPLPPPPPSPYPPSPSPPSPPPPSPPPPSPAPPSPAPPSPPPPCECLAGERELT 363

Query: 348 ---VQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
              +  SP P   APP  Q   PPP  S  PP  S  PP P +PPP SP P S
Sbjct: 364 CAFLPPSPLPPSPAPPSPQPPLPPPPPSPYPP--SPAPPVPPSPPPPSPYPPS 414

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 47/102 (46%), Positives = 51/102 (50%), Gaps = 8/102 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P   P PP PP   PP+ P  SP P   APP+    PPP   SP P   APP   
Sbjct: 427 PPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPP--L 484

Query: 396 QSSPPPVSSTP----PPVQSSP-PPAPVTP---PPASPPPAS 497
             SPPP S  P    PPV  SP PP+P  P   PP+ PPP S
Sbjct: 485 PPSPPPPSPYPPSPAPPVPPSPAPPSPEPPSPAPPSPPPPPS 526

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 43/106 (40%), Positives = 51/106 (48%), Gaps = 2/106 (1%)
 Frame = +3

Query: 186 AVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP 365
           A+F S     P   +   SP  P PP+  PP+    SPPP    PP + + P P   SPP
Sbjct: 177 AIFDSGNGCCPQVQAGTPSPPSPLPPSPRPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPP 236

Query: 366 PVQSAPPPVQQSSPPPVSSTPPPVQSSP--PPAPVTPPPASPPPAS 497
           P  S  PPV  S  PP    PPP   +P  PP P +P P SP P S
Sbjct: 237 P-PSPQPPVPPSPAPPTPPGPPPPSPAPPNPPPPPSPAPPSPKPPS 281

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 42/97 (43%), Positives = 45/97 (46%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A   P   P  SPAPP PP   PP+    SP P    PP+    P P   SP P    PP
Sbjct: 249 APPTPPGPPPPSPAPPNPP--PPPSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPSPEPP 306

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             Q   PPP  S  PP  S P P P +PPP SP P S
Sbjct: 307 SPQPPLPPPPPSPYPPSPSPPSPPPPSPPPPSPAPPS 343

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 40/94 (42%), Positives = 46/94 (48%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PPS +P   P PP+P  P+  PP+    SPPP  S  P +   P P   SP P    PPP
Sbjct: 258 PPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPPP 317

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
                 P   S PPP    P PAP +P P SPPP
Sbjct: 318 SPYPPSPSPPSPPPPSPPPPSPAPPSPAPPSPPP 351

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 38/97 (39%), Positives = 45/97 (46%), Gaps = 1/97 (1%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP-PPVQASPPPVQSA 380
           G   P    P+ SP  P PP+  PP  P  +PP     PP + + P PP   SP P    
Sbjct: 219 GPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTPPGPPPPSPAPPNPPPPPSPAPPSPK 278

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PP  +  SPPP  S  PP    P P P +P P  PPP
Sbjct: 279 PPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPP 315

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 45/99 (45%), Positives = 48/99 (48%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPPPVQSAP--- 383
           PP   P   P PP PP   PP  P  SPPP    PP+ A  SPPP    PPP    P   
Sbjct: 424 PPPPPPPPPPPPPPPP--FPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPA 481

Query: 384 PPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
           PP+  S PPP    P P    PP PAP +P P SP P S
Sbjct: 482 PPLPPSPPPPSPYPPSPAPPVPPSPAPPSPEPPSPAPPS 520

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 43/106 (40%), Positives = 50/106 (47%), Gaps = 13/106 (12%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTP-PTNTPPTTPQAS-PPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           +PPS  P  SP PP+P P +  P +PQ   PPP  S  P + S P P   SPPP   APP
Sbjct: 283 EPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPPPSPYPPSPSPPSPPPPSPPPPSPAPP 342

Query: 387 PVQQSSPPP-----------VSSTPPPVQSSPPPAPVTPPPASPPP 491
                SPPP             +  PP    P PAP +P P  PPP
Sbjct: 343 SPAPPSPPPPCECLAGERELTCAFLPPSPLPPSPAPPSPQPPLPPP 388

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 38/92 (41%), Positives = 45/92 (48%), Gaps = 1/92 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP + P  SP PP+P     P +P   PPP   + P   S  PP+  SPPP    P P  
Sbjct: 445 PPPSPPPPSPGPPSPA----PPSPPPPPPPPPPS-PYPPSPAPPLPPSPPP----PSPYP 495

Query: 396 QSSPPPVSSTPPPVQSSPP-PAPVTPPPASPP 488
            S  PPV  +P P    PP PAP +PPP   P
Sbjct: 496 PSPAPPVPPSPAPPSPEPPSPAPPSPPPPPSP 527

[102][TOP]
>UniRef100_C0PJH9 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0PJH9_MAIZE
          Length = 691

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 45/102 (44%), Positives = 57/102 (55%), Gaps = 5/102 (4%)
 Frame = +3

Query: 207 AQQPPSTSPNASPA-PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           A   P T PNA+PA PP+ P   PP    ++PPP  ++PP +   PPP    PPP+ ++P
Sbjct: 33  ASPAPVTQPNATPADPPSSPVAPPPVPSASTPPPQLTSPPPSLPPPPPDAVPPPPLVASP 92

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASP----PPAS 497
           PP   +  PP  S P PV   PPP P  PP ASP    PPA+
Sbjct: 93  PPAPAAVVPP-PSPPAPVAVPPPPTPAAPPKASPIHIRPPAA 133

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 42/97 (43%), Positives = 56/97 (57%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPV-QASPPPVQSAPPPV 392
           P S +P+ +   PTP +  P T P A+P    + PP++  +PPPV  AS PP Q   PP 
Sbjct: 18  PSSATPSPATTTPTPASPAPVTQPNATP----ADPPSSPVAPPPVPSASTPPPQLTSPPP 73

Query: 393 QQSSPPPVSSTPPPVQSSPPPAP--VTPPPASPPPAS 497
               PPP +  PPP+ +SPPPAP  V PPP+ P P +
Sbjct: 74  SLPPPPPDAVPPPPLVASPPPAPAAVVPPPSPPAPVA 110

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/97 (43%), Positives = 54/97 (55%), Gaps = 6/97 (6%)
 Frame = +3

Query: 222 STSPNASPAP---PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           ++SP+ SP     P PP++  P+    +P P   AP T  ++ P   A PP    APPPV
Sbjct: 2   ASSPSPSPGTIRAPLPPSSATPSPATTTPTPASPAPVTQPNATP---ADPPSSPVAPPPV 58

Query: 393 QQ-SSPPPVSSTPPPVQSSPPPAPVTPPP--ASPPPA 494
              S+PPP  ++PPP    PPP  V PPP  ASPPPA
Sbjct: 59  PSASTPPPQLTSPPPSLPPPPPDAVPPPPLVASPPPA 95

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 43/101 (42%), Positives = 49/101 (48%), Gaps = 3/101 (2%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           SA    P  TSP  S  PP PP   PP    ASPPP  +A     S P PV   PPP  +
Sbjct: 60  SASTPPPQLTSPPPS-LPPPPPDAVPPPPLVASPPPAPAAVVPPPSPPAPVAVPPPPTPA 118

Query: 378 APPPVQ--QSSPPPVSSTPPPVQSSP-PPAPVTPPPASPPP 491
           APP        PP  +S PP +  +P PPA  TPP  + PP
Sbjct: 119 APPKASPIHIRPPAAASPPPTILPTPNPPADPTPPTLAQPP 159

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 41/98 (41%), Positives = 48/98 (48%), Gaps = 5/98 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP----PPVQASPPPVQSAP 383
           P   SP  +PA   PP  +PP      PPP  +APP A  SP    PP  ASPPP     
Sbjct: 87  PLVASPPPAPAAVVPPP-SPPAPVAVPPPPTPAAPPKA--SPIHIRPPAAASPPPTILPT 143

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVT-PPPASPPPA 494
           P       PP  + PPP +  PP  P T PPP +PPP+
Sbjct: 144 PNPPADPTPPTLAQPPPPRRRPPRTPQTEPPPLAPPPS 181

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/107 (35%), Positives = 50/107 (46%), Gaps = 10/107 (9%)
 Frame = +3

Query: 207 AQQPPSTSPNASP-APPTPPTNTPPTTPQASPP--PVQSAPPTAQSSPPPVQASP----- 362
           A  PP+ +    P +PP P    PP TP A P   P+   PP A S PP +  +P     
Sbjct: 90  ASPPPAPAAVVPPPSPPAPVAVPPPPTPAAPPKASPIHIRPPAAASPPPTILPTPNPPAD 149

Query: 363 --PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             PP  + PPP ++  P    + PPP+   P   PV P  +SP P S
Sbjct: 150 PTPPTLAQPPPPRRRPPRTPQTEPPPLAPPPSGIPVKPSTSSPSPTS 196

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 46/117 (39%), Positives = 54/117 (46%), Gaps = 20/117 (17%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTPPTNTPPTTPQASP-----PPVQSAPPTAQSSP-------P 344
           A A   P  SP A  A P PPT  P   P+ASP     P   S PPT   +P       P
Sbjct: 95  APAAVVPPPSPPAPVAVPPPPT--PAAPPKASPIHIRPPAAASPPPTILPTPNPPADPTP 152

Query: 345 PVQASPPPVQSAPPPVQQSSPPPVSSTPP-----PVQSSPPPA---PVTPPPASPPP 491
           P  A PPP +  PP   Q+ PPP++  P      P  SSP P    P+ P P+SP P
Sbjct: 153 PTLAQPPPPRRRPPRTPQTEPPPLAPPPSGIPVKPSTSSPSPTSADPLIPTPSSPSP 209

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 42/105 (40%), Positives = 49/105 (46%), Gaps = 7/105 (6%)
 Frame = +3

Query: 201 AGAQQPPSTSPNAS-PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           A A  PP+  P  + PA PTPPT   P      PPP +  P T Q+ PPP+    PP   
Sbjct: 132 AAASPPPTILPTPNPPADPTPPTLAQP------PPPRRRPPRTPQTEPPPL---APPPSG 182

Query: 378 APPPVQQSSPPPVSSTP-PPVQSSPPPAPVTPP-----PASPPPA 494
            P     SSP P S+ P  P  SSP P   T P     P+ P PA
Sbjct: 183 IPVKPSTSSPSPTSADPLIPTPSSPSPPGTTTPGSGSTPSVPAPA 227

[103][TOP]
>UniRef100_B9IAD8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IAD8_POPTR
          Length = 379

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/115 (45%), Positives = 61/115 (53%), Gaps = 21/115 (18%)
 Frame = +3

Query: 216 PPSTSPNA----------SPAPPTPPTNTPPTTPQASPPP---VQSAPPTAQSSPPPV-- 350
           PPS+SP            SP+PP P     P  P  SPPP    +S PP + S PPP   
Sbjct: 214 PPSSSPPPPYYYKSPPPLSPSPPPPYYYKSPPPPDPSPPPPYHYKSPPPPSPSPPPPYYY 273

Query: 351 QASPPPVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           ++ PPP  S PPP   SSPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 274 RSPPPPSSSPPPPYHYSSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 328

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/108 (45%), Positives = 59/108 (54%), Gaps = 12/108 (11%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           + PP  SP+  P     +PP P  + PPT    SPPP   +PP     PP +  SPPP  
Sbjct: 50  KSPPPPSPSPPPPYEYKSPPPPSPHPPPTYVYKSPPPPSPSPP-----PPYIYKSPPPPS 104

Query: 375 -SAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
            S PPP +  SPPP SS+PPP    +S PPP+P  PPP    SPPP S
Sbjct: 105 PSPPPPYEYKSPPPPSSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPS 152

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 48/105 (45%), Positives = 57/105 (54%), Gaps = 9/105 (8%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPPPVQSA 380
           + PP  SP  SP PP    + PP +P   PP    +PP   SSPPP    ++ PPP  S 
Sbjct: 82  KSPPPPSP--SPPPPYIYKSPPPPSPSPPPPYEYKSPPPPSSSPPPPYIYKSPPPPSPSP 139

Query: 381 PPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 140 PPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYYYKSPPPPS 184

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 48/105 (45%), Positives = 57/105 (54%), Gaps = 9/105 (8%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPPPVQSA 380
           + PP  SP  SP PP    + PP +P   PP V  +PP   SSPPP    ++  PP  S 
Sbjct: 162 KSPPPPSP--SPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSSSPPPPYYYKSPSPPSSSP 219

Query: 381 PPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           PPP    SPPP+S +PPP    +S PPP P  PPP    SPPP S
Sbjct: 220 PPPYYYKSPPPLSPSPPPPYYYKSPPPPDPSPPPPYHYKSPPPPS 264

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 47/99 (47%), Positives = 55/99 (55%), Gaps = 11/99 (11%)
 Frame = +3

Query: 231 PNASPAPPTPPTNTPPTTPQASPPP---VQSAPPTAQSSPPPV--QASPPPVQSAPPPVQ 395
           P  SP+PP P     P  P +SPPP     S PP + S PPP   ++ PPP  S PPP  
Sbjct: 261 PPPSPSPPPPYYYRSPPPPSSSPPPPYHYSSPPPPSPSPPPPYYYKSPPPPSPSPPPPYY 320

Query: 396 QSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPA 494
             SPPP S +PPP    +S PPP+P  PPP    SPPPA
Sbjct: 321 YKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYHSPPPA 359

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 49/119 (41%), Positives = 64/119 (53%), Gaps = 23/119 (19%)
 Frame = +3

Query: 210 QQPPSTSPNASPA----PPTPPTNTPP--------TTPQASPPP---VQSAPPTAQSSPP 344
           + PP  SP+  P      P PP+++PP        + P +SPPP    +S PP + S PP
Sbjct: 178 KSPPPPSPSPPPPYVYKSPPPPSSSPPPPYYYKSPSPPSSSPPPPYYYKSPPPLSPSPPP 237

Query: 345 P--VQASPPPVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           P   ++ PPP  S PPP    SPPP S +PPP    +S PPP+   PPP   +SPPP S
Sbjct: 238 PYYYKSPPPPDPSPPPPYHYKSPPPPSPSPPPPYYYRSPPPPSSSPPPPYHYSSPPPPS 296

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 47/108 (43%), Positives = 58/108 (53%), Gaps = 12/108 (11%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           + PP  SP+  P     +PP P ++ PP     SPPP   +PP     PP V  SPPP  
Sbjct: 98  KSPPPPSPSPPPPYEYKSPPPPSSSPPPPYIYKSPPPPSPSPP-----PPYVYKSPPPPS 152

Query: 375 SAPPP--VQQSSPPPVSSTPPP--VQSSPPPAPVTPPP---ASPPPAS 497
            +PPP  + +S PPP  S PPP   +S PPP+P  PPP    SPPP S
Sbjct: 153 PSPPPPYIYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPS 200

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 50/115 (43%), Positives = 59/115 (51%), Gaps = 21/115 (18%)
 Frame = +3

Query: 216 PPSTSPNA----------SPAPPTPPTNTPPTTPQASPPP---VQSAPPTAQSSPPP--V 350
           PPS+SP            SP+PP P     P  P  SPPP    +S PP + S PPP   
Sbjct: 118 PPSSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYYY 177

Query: 351 QASPPPVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           ++ PPP  S PPP    SPPP SS+PPP    +S  PP+   PPP    SPPP S
Sbjct: 178 KSPPPPSPSPPPPYVYKSPPPPSSSPPPPYYYKSPSPPSSSPPPPYYYKSPPPLS 232

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 52/118 (44%), Positives = 61/118 (51%), Gaps = 24/118 (20%)
 Frame = +3

Query: 216 PPSTSPNASPAP-----PTPPTNTPPTTPQ-ASPPPVQSAPPTAQ--SSPPPVQAS---- 359
           PPS+SP   P P     P+PP+++PP      SPPP+  +PP      SPPP   S    
Sbjct: 198 PPSSSP---PPPYYYKSPSPPSSSPPPPYYYKSPPPLSPSPPPPYYYKSPPPPDPSPPPP 254

Query: 360 ------PPPVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
                 PPP  S PPP    SPPP SS+PPP     S PPP+P  PPP    SPPP S
Sbjct: 255 YHYKSPPPPSPSPPPPYYYRSPPPPSSSPPPPYHYSSPPPPSPSPPPPYYYKSPPPPS 312

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 45/111 (40%), Positives = 55/111 (49%), Gaps = 17/111 (15%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPPPVQSA 380
           + PP   P+ SP PP    + PP +P   PP    +PP   SSPPP     + PPP  S 
Sbjct: 242 KSPPP--PDPSPPPPYHYKSPPPPSPSPPPPYYYRSPPPPSSSPPPPYHYSSPPPPSPSP 299

Query: 381 PPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP-----------ASPPP 491
           PPP    SPPP S +PPP    +S PPP+P  PPP           + PPP
Sbjct: 300 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPP 350

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 45/98 (45%), Positives = 52/98 (53%), Gaps = 11/98 (11%)
 Frame = +3

Query: 231 PNASPAPPTPPTNTPPTTPQASPPP---VQSAPPTAQSSPPP--VQASPPPVQSAPPPVQ 395
           P  SP+PP P     P  P  SPPP    +S PP + S PPP   ++ PPP  S PPP  
Sbjct: 149 PPPSPSPPPPYIYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSSSPPPPYY 208

Query: 396 QSSPPPVSSTPPP--VQSSPPPAPVTPPP----ASPPP 491
             SP P SS+PPP     SPPP   +PPP     SPPP
Sbjct: 209 YKSPSPPSSSPPPPYYYKSPPPLSPSPPPPYYYKSPPP 246

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 50/119 (42%), Positives = 60/119 (50%), Gaps = 23/119 (19%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPPP 368
           + PP  SP+  P     +PP P  + PP     SPPP   +PP      SPPP  +SPPP
Sbjct: 226 KSPPPLSPSPPPPYYYKSPPPPDPSPPPPYHYKSPPPPSPSPPPPYYYRSPPPPSSSPPP 285

Query: 369 VQ--SAPPPVQQS--------SPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
               S+PPP   S        SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 286 PYHYSSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPS 344

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 45/110 (40%), Positives = 56/110 (50%), Gaps = 16/110 (14%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPPPVQSA 380
           + PP   P++SP PP    + PP +P   PP V  +PP    SPPP    ++ PPP  S 
Sbjct: 114 KSPPP--PSSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSP 171

Query: 381 PPPVQQSSPPPVS---------STPPPVQSSPPP----APVTPPPASPPP 491
           PPP    SPPP S          +PPP  SSPPP       +PP +SPPP
Sbjct: 172 PPPYYYKSPPPPSPSPPPPYVYKSPPPPSSSPPPPYYYKSPSPPSSSPPP 221

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 47/118 (39%), Positives = 58/118 (49%), Gaps = 24/118 (20%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTA---QSSPPPVQASPP 365
           + PP  SP+  P     +PP P ++ PP    +SPPP   +PP     +S PPP  + PP
Sbjct: 258 KSPPPPSPSPPPPYYYRSPPPPSSSPPPPYHYSSPPPPSPSPPPPYYYKSPPPPSPSPPP 317

Query: 366 PV---------QSAPPPVQQSSPPPVSSTPPP--VQSSPPPAPVTPP-----PASPPP 491
           P           S PPP    SPPP S +PPP     SPPPA  +PP      ASPPP
Sbjct: 318 PYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYHSPPPAMKSPPLSVYIYASPPP 375

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 38/88 (43%), Positives = 43/88 (48%), Gaps = 6/88 (6%)
 Frame = +3

Query: 246 APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP--VQSAPPPVQQSSPPP-V 416
           +PP P     P  P  SPPP     P    SPPP    PPP  V  +PPP   S PPP +
Sbjct: 42  SPPPPYVYKSPPPPSPSPPP-----PYEYKSPPPPSPHPPPTYVYKSPPPPSPSPPPPYI 96

Query: 417 SSTPPPVQSSPPPA---PVTPPPASPPP 491
             +PPP   SPPP       PPP+S PP
Sbjct: 97  YKSPPPPSPSPPPPYEYKSPPPPSSSPP 124

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 38/84 (45%), Positives = 45/84 (53%), Gaps = 15/84 (17%)
 Frame = +3

Query: 291 ASPPPVQSAPPTAQSSPPPVQASPPPVQ--SAPPP--------VQQSSPPPVSSTPPP-- 434
           +SPPP    P   +S PPP  + PPP +  S PPP        V +S PPP  S PPP  
Sbjct: 41  SSPPP----PYVYKSPPPPSPSPPPPYEYKSPPPPSPHPPPTYVYKSPPPPSPSPPPPYI 96

Query: 435 VQSSPPPAPVTPPP---ASPPPAS 497
            +S PPP+P  PPP    SPPP S
Sbjct: 97  YKSPPPPSPSPPPPYEYKSPPPPS 120

[104][TOP]
>UniRef100_A7PES6 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PES6_VITVI
          Length = 486

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 47/84 (55%), Positives = 51/84 (60%), Gaps = 1/84 (1%)
 Frame = +3

Query: 240 SPAPPTPPT-NTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPV 416
           +P PP+PP   +PP TP  SPPPV S PP   SSPPP   SPPP   +PPP    SPPP 
Sbjct: 409 TPPPPSPPVFPSPPPTPVYSPPPVFSPPPPVLSSPPP--PSPPPPSPSPPPPPVYSPPP- 465

Query: 417 SSTPPPVQSSPPPAPVTPPPASPP 488
              PPPV S PPP P  PPP  PP
Sbjct: 466 ---PPPVYSPPPPPP--PPPPPPP 484

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 48/91 (52%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = +3

Query: 225 TSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSS 404
           +S   SP  P+ PT  PP     SPP   S PPT   SPPPV + PPPV S+PPP    S
Sbjct: 396 SSFRCSPFVPSLPTPPPP-----SPPVFPSPPPTPVYSPPPVFSPPPPVLSSPPP---PS 447

Query: 405 PPPVSST--PPPVQSSPPPAPVTPPPASPPP 491
           PPP S +  PPPV S PPP PV  PP  PPP
Sbjct: 448 PPPPSPSPPPPPVYSPPPPPPVYSPPPPPPP 478

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 42/95 (44%), Positives = 48/95 (50%), Gaps = 1/95 (1%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP 362
           C+ FV +    PP  SP   P+PP  P  +PP    + PPPV S+PP     PP     P
Sbjct: 400 CSPFVPS-LPTPPPPSPPVFPSPPPTPVYSPPPV-FSPPPPVLSSPPPPSPPPPSPSPPP 457

Query: 363 PPVQSAPPPVQ-QSSPPPVSSTPPPVQSSPPPAPV 464
           PPV S PPP    S PPP    PPP    PPP PV
Sbjct: 458 PPVYSPPPPPPVYSPPPP----PPP---PPPPPPV 485

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 29/58 (50%), Positives = 34/58 (58%)
 Frame = +3

Query: 321 PTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           P+  + PPP     PPV  +PPP    SPPPV S PPPV SSPPP      P+ PPP+
Sbjct: 405 PSLPTPPPP----SPPVFPSPPPTPVYSPPPVFSPPPPVLSSPPP------PSPPPPS 452

[105][TOP]
>UniRef100_Q7REV3 Drosophila melanogaster CG8797 gene product-related (Fragment) n=1
           Tax=Plasmodium yoelii yoelii RepID=Q7REV3_PLAYO
          Length = 2198

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/99 (46%), Positives = 46/99 (46%), Gaps = 3/99 (3%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           G QQPP       P    PP       P Q  PPP Q  PP  Q  PPP Q  PPP Q  
Sbjct: 455 GQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQ 514

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           PPP QQ  PPP    PPP Q  PPP    PPP    PPP
Sbjct: 515 PPPGQQ-QPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPP 552

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/99 (46%), Positives = 46/99 (46%), Gaps = 3/99 (3%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           G QQPP       P    PP       P Q  PPP Q  PP  Q  PPP Q  PPP Q  
Sbjct: 462 GQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQ 521

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           PPP QQ  PPP    PPP Q  PPP    PPP    PPP
Sbjct: 522 PPPGQQ-QPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPP 559

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/99 (46%), Positives = 46/99 (46%), Gaps = 3/99 (3%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           G QQPP       P    PP       P Q  PPP Q  PP  Q  PPP Q  PPP Q  
Sbjct: 469 GQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQ 528

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           PPP QQ  PPP    PPP Q  PPP    PPP    PPP
Sbjct: 529 PPPGQQ-QPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPP 566

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/99 (46%), Positives = 46/99 (46%), Gaps = 3/99 (3%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           G QQPP       P    PP       P Q  PPP Q  PP  Q  PPP Q  PPP Q  
Sbjct: 476 GQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQ 535

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           PPP QQ  PPP    PPP Q  PPP    PPP    PPP
Sbjct: 536 PPPGQQ-QPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPP 573

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/99 (46%), Positives = 46/99 (46%), Gaps = 3/99 (3%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           G QQPP       P    PP       P Q  PPP Q  PP  Q  PPP Q  PPP Q  
Sbjct: 483 GQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQ 542

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           PPP QQ  PPP    PPP Q  PPP    PPP    PPP
Sbjct: 543 PPPGQQ-QPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPP 580

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/99 (46%), Positives = 46/99 (46%), Gaps = 3/99 (3%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           G QQPP       P    PP       P Q  PPP Q  PP  Q  PPP Q  PPP Q  
Sbjct: 490 GQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQ 549

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           PPP QQ  PPP    PPP Q  PPP    PPP    PPP
Sbjct: 550 PPPGQQ-QPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPP 587

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/99 (46%), Positives = 46/99 (46%), Gaps = 3/99 (3%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           G QQPP       P    PP       P Q  PPP Q  PP  Q  PPP Q  PPP Q  
Sbjct: 497 GQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQ 556

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           PPP QQ  PPP    PPP Q  PPP    PPP    PPP
Sbjct: 557 PPPGQQ-QPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPP 594

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 45/99 (45%), Positives = 45/99 (45%), Gaps = 3/99 (3%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           G QQP        P    PP       P Q  PPP Q  PP  Q  PPP Q  PPP Q  
Sbjct: 441 GQQQPAPGQQQPVPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQ 500

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           PPP QQ  PPP    PPP Q  PPP    PPP    PPP
Sbjct: 501 PPPGQQQ-PPPGQQQPPPGQQQPPPGQQQPPPGQQQPPP 538

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 44/97 (45%), Positives = 45/97 (46%), Gaps = 3/97 (3%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTP-PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           QQP       +P    P P    P   Q  PPP Q  PP  Q  PPP Q  PPP Q  PP
Sbjct: 436 QQPVPGQQQPAPGQQQPVPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPP 495

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           P QQ  PPP    PPP Q  PPP    PPP    PPP
Sbjct: 496 PGQQ-QPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPP 531

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 37/80 (46%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           G QQPP       P    PP       P Q  PPP Q  PP  Q  PPP Q  PPP Q  
Sbjct: 518 GQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQ 577

Query: 381 PPPVQQSSPPPVSSTPPPVQ 440
           PPP QQ  PPP    PPP Q
Sbjct: 578 PPPGQQ-QPPPGQQQPPPGQ 596

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 34/70 (48%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = +3

Query: 288 QASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVT 467
           Q  P P Q  P   Q  P P Q  PPP Q  PPP QQ  PPP    PPP Q  PPP    
Sbjct: 435 QQQPVPGQQQPAPGQQQPVPGQQQPPPGQQQPPPGQQ-QPPPGQQQPPPGQQQPPPGQQQ 493

Query: 468 PPPA--SPPP 491
           PPP    PPP
Sbjct: 494 PPPGQQQPPP 503

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 30/66 (45%), Positives = 30/66 (45%), Gaps = 1/66 (1%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           G QQPP       P    PP       P Q  PPP Q  PP  Q  PPP Q  PPP Q  
Sbjct: 532 GQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQPPPGQQQ 591

Query: 381 PPPVQQ 398
           PPP QQ
Sbjct: 592 PPPGQQ 597

[106][TOP]
>UniRef100_UPI0001982858 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982858
          Length = 238

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 42/91 (46%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P+T+P ASP+P   P ++P   P Q SP PVQ+ P  A + PPPV   P P  + PPP  
Sbjct: 52  PATTPVASPSPKVSPASSPTVPPPQVSPAPVQAPPLPAPAPPPPVPPPPVPAPATPPPAP 111

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
             +PPP +  P PV  +P PAPV  PPA  P
Sbjct: 112 APAPPPPAPAPVPVPPTPAPAPVPVPPAPVP 142

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 47/113 (41%), Positives = 61/113 (53%), Gaps = 2/113 (1%)
 Frame = +3

Query: 159 IVLVVGLICAVFVSAGAQQPPSTSPNASPAPP-TPPTNTPPTTPQASPPPVQSAPPTAQS 335
           + ++V +  A   +A     P+ +P A+  PP TP    P TTP ASP P  S  P +  
Sbjct: 13  LFILVAIANAQAPAASPSVLPTPTPVAATQPPSTPVIPAPATTPVASPSPKVS--PASSP 70

Query: 336 SPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPV-TPPPASPPP 491
           + PP Q SP PVQ APP    + PPPV   P P  ++PPPAP   PPP +P P
Sbjct: 71  TVPPPQVSPAPVQ-APPLPAPAPPPPVPPPPVPAPATPPPAPAPAPPPPAPAP 122

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 42/100 (42%), Positives = 50/100 (50%), Gaps = 6/100 (6%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTP-----PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA-SPPP 368
           A   P  SP +SP  P P     P   PP    A PPPV   P  A ++PPP  A +PPP
Sbjct: 58  ASPSPKVSPASSPTVPPPQVSPAPVQAPPLPAPAPPPPVPPPPVPAPATPPPAPAPAPPP 117

Query: 369 VQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
              AP PV    PP  +  P PV  +P PAP++ PPA  P
Sbjct: 118 PAPAPVPV----PPTPAPAPVPVPPAPVPAPISEPPAPAP 153

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 43/109 (39%), Positives = 53/109 (48%), Gaps = 7/109 (6%)
 Frame = +3

Query: 189 VFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP---PPVQAS 359
           + V+    Q P+ SP+  P P       PP+TP     P  +  P A  SP   P    +
Sbjct: 15  ILVAIANAQAPAASPSVLPTPTPVAATQPPSTPVI---PAPATTPVASPSPKVSPASSPT 71

Query: 360 PPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPP----PASPPPA 494
            PP Q +P PV Q+ P P  + PPPV   P PAP TPP    PA PPPA
Sbjct: 72  VPPPQVSPAPV-QAPPLPAPAPPPPVPPPPVPAPATPPPAPAPAPPPPA 119

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 38/115 (33%), Positives = 45/115 (39%), Gaps = 24/115 (20%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP    APP P    PP  P    P   + PP    +PPP   +P PV   P P  
Sbjct: 74  PPQVSPAPVQAPPLPAPAPPPPVPPPPVPAPATPPPAPAPAPPPPAPAPVPVPPTPAPAP 133

Query: 396 QSSPP-----PVSSTPPPVQS-------------------SPPPAPVTPPPASPP 488
              PP     P+S  P P  +                   +P PAPVTP P +PP
Sbjct: 134 VPVPPAPVPAPISEPPAPAPAPTKHKHRRRRHKHKKHHHHAPAPAPVTPSPPAPP 188

[107][TOP]
>UniRef100_Q9CAL8 Putative uncharacterized protein F24J13.3 n=1 Tax=Arabidopsis
           thaliana RepID=Q9CAL8_ARATH
          Length = 710

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 50/105 (47%), Positives = 62/105 (59%), Gaps = 5/105 (4%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTP-QASPPPVQSAPPTAQSSPPPVQASPPP-- 368
           SA +  PP TS + S APP   +  PP+ P  +SPPP   + P A  SPPP  +SPPP  
Sbjct: 13  SADSAPPPDTSSDGSAAPPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPP 72

Query: 369 VQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVT--PPPASPPPAS 497
           + S+PPP    +PPP SS PPP   +PPP P+   PP  SPPP S
Sbjct: 73  LDSSPPPPPDLTPPP-SSPPPP--DAPPPIPIVFPPPIDSPPPES 114

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 50/97 (51%), Positives = 58/97 (59%), Gaps = 7/97 (7%)
 Frame = +3

Query: 222 STSPNASPAPPTPPTNTPPTTPQ---ASPPPVQSAPPT---AQSSPPPVQASPPPVQSAP 383
           S SP +SP  P+  +  PP T     A+PPP  SAPP    A SSPPP   S PP   +P
Sbjct: 2   SDSPTSSPPAPSADSAPPPDTSSDGSAAPPPTDSAPPPSPPADSSPPPALPSLPPAVFSP 61

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAP-VTPPPASPPP 491
           PP   SSPP     PPP+ SSPPP P +TPPP+SPPP
Sbjct: 62  PPTV-SSPP-----PPPLDSSPPPPPDLTPPPSSPPP 92

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 40/95 (42%), Positives = 47/95 (49%), Gaps = 3/95 (3%)
 Frame = +3

Query: 222 STSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQ-ASPPPVQSAPPPVQQ 398
           S  P  S  PP P  ++PP  P  +PPP    PP A   PPP+    PPP+ S PP    
Sbjct: 60  SPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDA---PPPIPIVFPPPIDSPPPESTN 116

Query: 399 SSPPPVSSTPPPVQSSPPPAPVTPPPAS--PPPAS 497
           S PPP    PPP  +    +P  PPP    PPPAS
Sbjct: 117 SPPPPEVFEPPPPPADEDESPPAPPPPEQLPPPAS 151

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 44/109 (40%), Positives = 51/109 (46%), Gaps = 11/109 (10%)
 Frame = +3

Query: 198 SAGAQQPPSTS--PNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQ------SSPPPVQ 353
           SA    PP+ S  P A P+ P    + PPT     PPP+ S+PP         SSPPP  
Sbjct: 35  SAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPD 94

Query: 354 ASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPV---TPPPASPPP 491
           A PP     PPP+    P   +S PPP    PPP P      PPA PPP
Sbjct: 95  APPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPP 143

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 40/109 (36%), Positives = 51/109 (46%), Gaps = 16/109 (14%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPT-NTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P   P+ +P P +PP  + PP  P   PPP+ S PP + +SPPP +   PP    PPP  
Sbjct: 77  PPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPP----PPPAD 132

Query: 396 QSSPPPVSSTPPPVQSSPP---------------PAPVTPPPASPPPAS 497
           +   PP  + PPP Q  PP               P P T PPA   PA+
Sbjct: 133 EDESPP--APPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAPSAPAT 179

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 38/94 (40%), Positives = 47/94 (50%), Gaps = 3/94 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPP---TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PP    ++SP PP   TPP ++PP  P  +PPP+    P    SPPP   + PP    PP
Sbjct: 68  PPPPPLDSSPPPPPDLTPPPSSPP--PPDAPPPIPIVFPPPIDSPPPESTNSPP----PP 121

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
            V +  PPP      P   +PPP    PPPAS P
Sbjct: 122 EVFEPPPPPADEDESP--PAPPPPEQLPPPASSP 153

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 37/109 (33%), Positives = 46/109 (42%), Gaps = 15/109 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT------PPTNTPPTTPQASPPP---VQSAPPTAQSS------PPPV 350
           PP +SP    APP       PP ++PP     SPPP    +  PP A         PPP 
Sbjct: 85  PPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPE 144

Query: 351 QASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           Q  PP       P +     P  +T PP  S+P  +P  PP A P  +S
Sbjct: 145 QLPPPASSPQGGPKKPKKHHPGPATSPPAPSAPATSPPAPPNAPPRNSS 193

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 43/122 (35%), Positives = 56/122 (45%), Gaps = 28/122 (22%)
 Frame = +3

Query: 216 PP--STSPNASPAPPTPPTNTPP-------TTPQASPPPVQSAPPTA--QSSPP------ 344
           PP  S  P ++ +PP P    PP        +P A PPP Q  PP +  Q  P       
Sbjct: 105 PPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHH 164

Query: 345 PVQASPPPVQSAP---PPVQQSSPPPVSSTPPPVQSSPPPAPVTPP----PAS----PPP 491
           P  A+ PP  SAP   PP   ++PP  SS   P +S+    P+T P    P+S    PPP
Sbjct: 165 PGPATSPPAPSAPATSPPAPPNAPPRNSSHALPPKSTAAGGPLTSPSRGVPSSGNSVPPP 224

Query: 492 AS 497
           A+
Sbjct: 225 AN 226

[108][TOP]
>UniRef100_Q6SSE8 Minus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE8_CHLRE
          Length = 3889

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 43/96 (44%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P + P P P PP+  PP+ P  SP P   APP     PPP    P P   +PPP
Sbjct: 867  EPPSPAPPSPPPPSPEPPSPAPPSPPLPSPEPPSPAPPLP---PPPSPEPPSPAPPSPPP 923

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                 P P  S PPP    P PAP +PPP SP P S
Sbjct: 924  PSPEPPSPAPSPPPPSPEPPSPAPPSPPPPSPEPPS 959

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 46/97 (47%), Positives = 54/97 (55%), Gaps = 4/97 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTP-PTTPQASPPPVQSAPPT-AQSSPPPVQASPP-PVQSAPP 386
            PPS  P  SPAPP+PP  +P P +P  SPPP    PP+ A  SPPP    PP P    PP
Sbjct: 908  PPSPEP-PSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPLPP 966

Query: 387  PVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPA 494
            P     P P   +PPP    PP PAP+ PPP+  PP+
Sbjct: 967  PPSPEPPSPAPPSPPPPSPEPPSPAPLPPPPSPEPPS 1003

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 44/107 (41%), Positives = 51/107 (47%), Gaps = 12/107 (11%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT-----------AQSSPPPVQAS 359
            +PPS +P+  P  P PP+  PP+ P  SP P   APP            A  SPPP    
Sbjct: 927  EPPSPAPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPE 986

Query: 360  PPPVQSAPPPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
            PP     PPP     P P   +PPP    PP PAP +PPP SP P S
Sbjct: 987  PPSPAPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 1033

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 44/97 (45%), Positives = 50/97 (51%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P + P P P PP+  PP  P  SP P   APP    SPPP    PP    +PPP
Sbjct: 882  EPPSPAPPSPPLPSPEPPSPAPPLPPPPSPEPPSPAPP----SPPPPSPEPPSPAPSPPP 937

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 P P   +PPP    PP PAP  PPP SP P S
Sbjct: 938  PSPEPPSPAPPSPPPPSPEPPSPAPPLPPPPSPEPPS 974

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 47/105 (44%), Positives = 52/105 (49%), Gaps = 5/105 (4%)
 Frame = +3

Query: 198  SAGAQQPPSTSPNA-SPAPPTPPTNTP--PTTPQASPPPVQSAPPTAQSSPPPVQASPP- 365
            S     PP  SP   SPAPP PP  +P  P+    SPPP    PP+   SPPP    PP 
Sbjct: 885  SPAPPSPPLPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPS 944

Query: 366  PVQSAPPPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
            P   +PPP     P P    PPP    PP PAP +PPP SP P S
Sbjct: 945  PAPPSPPPPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPS 989

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 46/98 (46%), Positives = 52/98 (53%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPP-PVQSAP 383
            PPS  P  SPAPP+P  P+  PP+    SPPP    PP+ A  SPPP    PP P   +P
Sbjct: 1086 PPSPEP-PSPAPPSPRPPSPEPPSPVPPSPPPPSPEPPSPAPPSPPPPSLEPPSPAPPSP 1144

Query: 384  PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            PP     P P  S PPP    P P P +PPP SP P S
Sbjct: 1145 PPPSPEPPSPAPSPPPPSPEPPSPVPPSPPPPSPEPPS 1182

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 45/98 (45%), Positives = 51/98 (52%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTP--PTTPQASPPPVQSAPPTAQSSPPPVQASPP-PVQSAPP 386
            PPS  P  SPAPP PP  +P  P+    SPPP    PP+    PPP    PP P   +PP
Sbjct: 952  PPSPEP-PSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPLPPPPSPEPPSPAPPSPP 1010

Query: 387  PVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
            P     P P   +PPP    PP PAP +PPP SP P S
Sbjct: 1011 PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 1048

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 46/98 (46%), Positives = 53/98 (54%), Gaps = 4/98 (4%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTP-PTTPQASPPPVQSAPPT-AQSSPPPVQASPP-PVQSAPP 386
            PPS  P  SPAPP+PP  +P P +P   PPP    PP+ A  SPPP    PP P   +PP
Sbjct: 967  PPSPEP-PSPAPPSPPPPSPEPPSPAPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 1025

Query: 387  PVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
            P     P P   +PPP    PP PAP +P P SP P S
Sbjct: 1026 PPSPEPPSPAPPSPPPPSPEPPSPAPPSPAPPSPEPPS 1063

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 45/97 (46%), Positives = 50/97 (51%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216  PPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPP-PVQSAPP 386
            PPS  P  SPAP P PP+  PP+    SPPP    PP+ A   PPP    PP P   +PP
Sbjct: 923  PPSPEP-PSPAPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPLPPPPSPEPPSPAPPSPP 981

Query: 387  PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            P     P P    PPP    P PAP +PPP SP P S
Sbjct: 982  PPSPEPPSPAPLPPPPSPEPPSPAPPSPPPPSPEPPS 1018

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 41/96 (42%), Positives = 48/96 (50%), Gaps = 1/96 (1%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            +PPS +P   P  P PP+  PP+ P  SP P   APP   S PPP    P P   +PPP 
Sbjct: 986  EPPSPAPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPP---SPPPPSPEPPSPAPPSPPPP 1042

Query: 393  QQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                P P   +P P    PP PAP +P P SP P S
Sbjct: 1043 SPEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPS 1078

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 44/98 (44%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
            +PPS +P  SPAPP+P  P+  PP+    SP P   APP+ +   PP    P PV  +PP
Sbjct: 1060 EPPSPAP-PSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPSPR---PPSPEPPSPVPPSPP 1115

Query: 387  PVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
            P     P P   +PPP    PP PAP +PPP SP P S
Sbjct: 1116 PPSPEPPSPAPPSPPPPSLEPPSPAPPSPPPPSPEPPS 1153

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 46/108 (42%), Positives = 54/108 (50%), Gaps = 14/108 (12%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPP-------TNTPPTTPQASPPPVQSAPPT----AQSSPPPVQASP 362
            PP++    SPAPP+PP       +  PP+ P  SP P   APP+    +   P P    P
Sbjct: 847  PPASPEPTSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPLPSPEPPSPAPPLP 906

Query: 363  PPVQSAPPPVQQSSPPPVSSTPP-PVQSSPPPAPVTPPPA--SPPPAS 497
            PP    PP     SPPP S  PP P  S PPP+P  P PA  SPPP S
Sbjct: 907  PPPSPEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPAPPSPPPPS 954

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 47/104 (45%), Positives = 55/104 (52%), Gaps = 10/104 (9%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTPPTNTP----PTTPQASPP-PVQSAPPTAQSSPP-PVQASPPPVQ 374
            +PPS +P  SPAPP+P   +P    P  P   PP PV  +PP     PP P   SPPP  
Sbjct: 1075 EPPSPAP-PSPAPPSPEPPSPAPPSPRPPSPEPPSPVPPSPPPPSPEPPSPAPPSPPPPS 1133

Query: 375  SAPPPVQQSSPPPVSSTPP-PVQSSPPPAPVTP---PPASPPPA 494
              PP     SPPP S  PP P  S PPP+P  P   PP+ PPP+
Sbjct: 1134 LEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPVPPSPPPPS 1177

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 42/98 (42%), Positives = 48/98 (48%), Gaps = 5/98 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP-----PVQASPPPVQSA 380
           PP   P + P PP  P+  P   P  SPPP + +PP   S PP     P+  SPPP    
Sbjct: 702 PPPPLPPSPPLPPVTPSPPPRPPPPKSPPPPKPSPPPRPSPPPRPPPRPLPPSPPPPPPL 761

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PP     SP P S  PPP  S PPP+P  P P  P PA
Sbjct: 762 PP--NPPSPAPPSPPPPPSPSIPPPSPGPPSPEPPSPA 797

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 43/100 (43%), Positives = 51/100 (51%), Gaps = 6/100 (6%)
 Frame = +3

Query: 213  QPPSTSPNA----SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
            +PPS +P +    SP PP+P    PP +P+   P   S PP +   P P   SPPP    
Sbjct: 971  EPPSPAPPSPPPPSPEPPSPAPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPE 1030

Query: 381  PPPVQQSSPPPVSSTPP-PVQSSP-PPAPVTPPPASPPPA 494
            PP     SPPP S  PP P   SP PP+P  P PA P PA
Sbjct: 1031 PPSPAPPSPPPPSPEPPSPAPPSPAPPSPEPPSPAPPSPA 1070

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 45/103 (43%), Positives = 53/103 (51%), Gaps = 8/103 (7%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP---PVQSA 380
            +PPS +P + P P P PP+  PP+ P  SP P   APP    SPPP    PP   P   A
Sbjct: 1000 EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP----SPPPPSPEPPSPAPPSPA 1055

Query: 381  PPPVQQSSPPPVSSTP----PPVQSSPPPAPVTPPPASPPPAS 497
            PP  +  SP P S  P    PP  + P PAP +P P SP P S
Sbjct: 1056 PPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPS 1098

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 47/105 (44%), Positives = 55/105 (52%), Gaps = 10/105 (9%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPP----PV 371
            +PPS +P  SPAPP+P  P+  PP+    SP P   APP+ A  SP P   +PP    P 
Sbjct: 1045 EPPSPAP-PSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPSPRPPS 1103

Query: 372  QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPP---PASPPPAS 497
               P PV  S PPP    P P   SPPP  + PP   P SPPP S
Sbjct: 1104 PEPPSPVPPSPPPPSPEPPSPAPPSPPPPSLEPPSPAPPSPPPPS 1148

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 44/106 (41%), Positives = 53/106 (50%), Gaps = 12/106 (11%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNT--PPTTPQASPPPVQSAPPTAQSSPPPVQASPP-PVQSAPP 386
            PPS  P  SPAPP+PP  +  PP+    SPPP    PP+   SPPP    PP PV  +PP
Sbjct: 1116 PPSPEP-PSPAPPSPPPPSLEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPVPPSPP 1174

Query: 387  PVQQSSPPPVSSTPPP---------VQSSPPPAPVTPPPASPPPAS 497
            P     P P   +P P          QS P P P +P P++P P S
Sbjct: 1175 PPSPEPPSPAPPSPAPPLPLPPSPHTQSPPSPVPPSPAPSAPSPPS 1220

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 42/101 (41%), Positives = 51/101 (50%), Gaps = 7/101 (6%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP----PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
            PPS +P + P PP+P    P+  PP+    SP P  +APP+     P   +  PP    P
Sbjct: 765  PPSPAPPSPPPPPSPSIPPPSPGPPSPEPPSPAPPSAAPPSPMPPSPAPPSPDPPSPKPP 824

Query: 384  PPVQQSSPPPVSSTPPPVQSSPPPA---PVTPPPASPPPAS 497
             PV  S  PP    P PV  SPPPA   P +P P SPPP S
Sbjct: 825  SPVPPSPLPPSPEPPSPVPPSPPPASPEPTSPAPPSPPPPS 865

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 44/104 (42%), Positives = 51/104 (49%), Gaps = 8/104 (7%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAPPTPPTNTPPTTPQASPP-PVQSAPPTAQ-------SSPPPVQASP 362
            A QPPS +P  SPAPP PP+  PP  P   PP P    PP+ Q       + P P   SP
Sbjct: 1339 APQPPSPTP-PSPAPPVPPSPEPPVPPGPDPPLPPSPTPPSPQPPVPPSPTPPSPQPPSP 1397

Query: 363  PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
             P   AP    Q SP P S  PP     PPP+P +PP    PP+
Sbjct: 1398 APPSPAPSAPLQPSPDPPSPQPPSPAPGPPPSPPSPPSTPSPPS 1441

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 45/108 (41%), Positives = 50/108 (46%), Gaps = 14/108 (12%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            P    P+  P PP PP    P  P   PPP  S PP +   P P   SP P  +APP   
Sbjct: 748  PRPLPPSPPPPPPLPPNPPSPAPPSPPPPPSPSIPPPSPGPPSPEPPSPAPPSAAPPSPM 807

Query: 396  QSSPPPVSSTPP------PVQSSP------PPAPV--TPPPASPPPAS 497
              SP P S  PP      PV  SP      PP+PV  +PPPASP P S
Sbjct: 808  PPSPAPPSPDPPSPKPPSPVPPSPLPPSPEPPSPVPPSPPPASPEPTS 855

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 42/97 (43%), Positives = 48/97 (49%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPS-TSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS   P+  PA P P +  PP+ P  SP P   APP   S PPP    P P   +PP 
Sbjct: 837  EPPSPVPPSPPPASPEPTSPAPPSPPPPSPEPPSPAPP---SPPPPSPEPPSPAPPSPPL 893

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 P P    PPP    PP PAP +PPP SP P S
Sbjct: 894  PSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPS 930

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 43/96 (44%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTPPTNTP--PTTPQASPPPVQSAPPT-AQSSPPPVQASPPPVQSAP 383
            +PPS  P  SP PP+PP  +P  P+    SPPP    PP+ A  SPPP    PP    +P
Sbjct: 1100 RPPSPEP-PSPVPPSPPPPSPEPPSPAPPSPPPPSLEPPSPAPPSPPPPSPEPPSPAPSP 1158

Query: 384  PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PP     P PV  +PPP  S  PP+P  P PA P P
Sbjct: 1159 PPPSPEPPSPVPPSPPP-PSPEPPSPAPPSPAPPLP 1193

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 41/97 (42%), Positives = 50/97 (51%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSP-NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P +A+P  P PP+  PP+    SP P    PP   S  PP    P PV  +PPP
Sbjct: 792  EPPSPAPPSAAPPSPMPPSPAPPSPDPPSPKPPSPVPP---SPLPPSPEPPSPVPPSPPP 848

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                   P   +PPP    PP PAP +PPP SP P S
Sbjct: 849  ASPEPTSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 885

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 45/105 (42%), Positives = 53/105 (50%), Gaps = 10/105 (9%)
 Frame = +3

Query: 213  QPPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPT----AQSSPPPVQASPPPVQ 374
            +PPS  P  SP PP+P  P+  PP+ P ASP P   APP+    +   P P   SPPP  
Sbjct: 822  KPPSPVP-PSPLPPSPEPPSPVPPSPPPASPEPTSPAPPSPPPPSPEPPSPAPPSPPPPS 880

Query: 375  SAPPPVQQSSPPPVSSTPP----PVQSSPPPAPVTPPPASPPPAS 497
              PP     SPP  S  PP    P+   P P P +P P SPPP S
Sbjct: 881  PEPPSPAPPSPPLPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPS 925

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 44/98 (44%), Positives = 53/98 (54%), Gaps = 4/98 (4%)
 Frame = +3

Query: 213  QPPSTSP-NASPAPPTPPTNTPPTTPQASPPPVQSAP--PTAQSSPPPVQASP-PPVQSA 380
            +PPS SP + +P+ P+PP+  PP+    SP P+   P  PT  S  PPV  SP PPV   
Sbjct: 1306 EPPSPSPPSPAPSVPSPPSPAPPSPMPPSPAPLAPQPPSPTPPSPAPPVPPSPEPPVPPG 1365

Query: 381  PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            P P    SP P S  PP   S  PP+P  P PA P PA
Sbjct: 1366 PDPPLPPSPTPPSPQPPVPPSPTPPSPQPPSPAPPSPA 1403

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 43/99 (43%), Positives = 48/99 (48%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAP--PTAQSSPPPVQASPPPVQSAP 383
            PPS  P  SP PP+P  P+  PP+    SPPP    P  P   S PPP    P P   +P
Sbjct: 818  PPSPKP-PSPVPPSPLPPSPEPPSPVPPSPPPASPEPTSPAPPSPPPPSPEPPSPAPPSP 876

Query: 384  PPVQQSSPPPVSSTPP-PVQSSPPPAPVTPPPASPPPAS 497
            PP     P P   +PP P    P PAP  PPP SP P S
Sbjct: 877  PPPSPEPPSPAPPSPPLPSPEPPSPAPPLPPPPSPEPPS 915

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 42/96 (43%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P + P P P PP+  PP+ P  SP P   APP + + P P   SP P   APP 
Sbjct: 1015 EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPAPPSPEPPSPAPPSPAPPS 1073

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             +  SP P S  PP  +  P PAP +P P SP P S
Sbjct: 1074 PEPPSPAPPSPAPPSPE-PPSPAPPSPRPPSPEPPS 1108

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 42/97 (43%), Positives = 49/97 (50%), Gaps = 2/97 (2%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS  P + P P P PP+  PP+ P  S  P   APP    SPPP    PP    +PPP
Sbjct: 1105 EPPSPVPPSPPPPSPEPPSPAPPSPPPPSLEPPSPAPP----SPPPPSPEPPSPAPSPPP 1160

Query: 390  VQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPPAS 497
                 P PV  +PPP    PP PAP +P P  P P S
Sbjct: 1161 PSPEPPSPVPPSPPPPSPEPPSPAPPSPAPPLPLPPS 1197

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 45/105 (42%), Positives = 54/105 (51%), Gaps = 10/105 (9%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +PPS +P + P P P PP+  PP+    SP P   APP+  + P P   SP P   APP 
Sbjct: 1030 EPPSPAPPSPPPPSPEPPSPAPPSPAPPSPEPPSPAPPSP-APPSPEPPSPAPPSPAPPS 1088

Query: 390  VQQSSPPPVSSTPP------PVQSSPP---PAPVTPPPASPPPAS 497
             +  SP P S  PP      PV  SPP   P P +P P SPPP S
Sbjct: 1089 PEPPSPAPPSPRPPSPEPPSPVPPSPPPPSPEPPSPAPPSPPPPS 1133

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 48/107 (44%), Positives = 55/107 (51%), Gaps = 15/107 (14%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTP-PTTPQASPPPVQSAPPT-AQSSPPPVQASPP---PVQSA 380
            PPS  P  SPAPP+PP  +P P +P  SPPP    PP+    SPPP    PP   P   A
Sbjct: 1131 PPSLEP-PSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPVPPSPPPPSPEPPSPAPPSPA 1189

Query: 381  PP------PVQQSSPPPVSSTPPPVQSSP----PPAPVTPPPASPPP 491
            PP      P  QS P PV  +P P   SP    PP+P+ P P SP P
Sbjct: 1190 PPLPLPPSPHTQSPPSPVPPSPAPSAPSPPSPQPPSPLAPSPPSPAP 1236

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/102 (43%), Positives = 48/102 (47%), Gaps = 5/102 (4%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAP-PTAQSSPPPVQASPPPVQSAP 383
            A  PPS +P A  +P  PP  T PT P    PP  + P PT  S  PP    P P   AP
Sbjct: 1228 APSPPSPAPQAPSSPFPPPQPTAPTAPPPPFPPSPAPPSPTPPSPEPPAPQPPSPTPHAP 1287

Query: 384  PPVQQSSPPPVSSTPP----PVQSSPPPAPVTPPPASPPPAS 497
            P  +  SP P S  PP    P  S P PAP  P P SP P S
Sbjct: 1288 PSPEPPSPTPPSPLPPSPEPPSPSPPSPAPSVPSPPSPAPPS 1329

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 40/97 (41%), Positives = 47/97 (48%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPT--TPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PP  SP+  P  P PP+  PP+   P A+PP      P   S  PP    P PV  +P P
Sbjct: 774  PPPPSPSIPPPSPGPPSPEPPSPAPPSAAPPSPMPPSPAPPSPDPPSPKPPSPVPPSPLP 833

Query: 390  VQQSSPPPVSSTPPPVQSSP-PPAPVTPPPASPPPAS 497
                 P PV  +PPP    P  PAP +PPP SP P S
Sbjct: 834  PSPEPPSPVPPSPPPASPEPTSPAPPSPPPPSPEPPS 870

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 48/121 (39%), Positives = 59/121 (48%), Gaps = 24/121 (19%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAP----PTPPTNTPPTTPQASPPPVQSAP----PTAQSSPPPVQASP 362
            A QPPS +P+A P+P    PTPP+  PP+    SP P   AP    P + + P P+  SP
Sbjct: 1276 APQPPSPTPHAPPSPEPPSPTPPSPLPPSPEPPSPSPPSPAPSVPSPPSPAPPSPMPPSP 1335

Query: 363  PPVQSAPP---------PVQQSSPPPVSSTP-PPVQSSP------PPAPVTPPPASPPPA 494
             P+   PP         PV  S  PPV   P PP+  SP      PP P +P P SP P 
Sbjct: 1336 APLAPQPPSPTPPSPAPPVPPSPEPPVPPGPDPPLPPSPTPPSPQPPVPPSPTPPSPQPP 1395

Query: 495  S 497
            S
Sbjct: 1396 S 1396

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 41/97 (42%), Positives = 48/97 (49%), Gaps = 9/97 (9%)
 Frame = +3

Query: 231 PNASPAPPTPPTNTPPTTPQASP-PPVQSAPPTAQ---SSPPPVQASPPPVQSAPP---- 386
           P   P PP PP   PP  P + P PPV  +PP       SPPP + SPPP  S PP    
Sbjct: 689 PFRPPIPPRPPRPPPPPLPPSPPLPPVTPSPPPRPPPPKSPPPPKPSPPPRPSPPPRPPP 748

Query: 387 -PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
            P+  S PPP    P P   +PP  P  P P+ PPP+
Sbjct: 749 RPLPPSPPPPPPLPPNPPSPAPPSPPPPPSPSIPPPS 785

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 42/99 (42%), Positives = 48/99 (48%), Gaps = 5/99 (5%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAP-PTAQSSPPPVQASPPPVQSAPPPV 392
            PPS  P  SPAPP+PP  +P     A P P   +P P + + P P   SP P   APP  
Sbjct: 1026 PPSPEP-PSPAPPSPPPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPSP 1084

Query: 393  QQSSPPPVSSTP----PPVQSSPPPAPVTPPPASPPPAS 497
               SP P S  P    PP    P P P +PPP SP P S
Sbjct: 1085 APPSPEPPSPAPPSPRPPSPEPPSPVPPSPPPPSPEPPS 1123

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 39/97 (40%), Positives = 47/97 (48%), Gaps = 4/97 (4%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASP-PPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           P    P   P PP+PP   PP TP   P PP   +PP  + SPPP  + PP     P P 
Sbjct: 696 PRPPRPPPPPLPPSPP--LPPVTPSPPPRPPPPKSPPPPKPSPPPRPSPPPRPPPRPLPP 753

Query: 393 QQSSPPPVSSTPP---PVQSSPPPAPVTPPPASPPPA 494
               PPP+   PP   P    PPP+P  PPP+  PP+
Sbjct: 754 SPPPPPPLPPNPPSPAPPSPPPPPSPSIPPPSPGPPS 790

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 42/102 (41%), Positives = 47/102 (46%), Gaps = 9/102 (8%)
 Frame = +3

Query: 216  PPSTSPNASPAP-------PTPPTNTPPTTPQASPPPVQSAPPTAQSSPP--PVQASPPP 368
            PPS  P   P P       PTPP+  PP  P  +PP  Q   P   S  P  P+Q SP P
Sbjct: 1355 PPSPEPPVPPGPDPPLPPSPTPPSPQPPVPPSPTPPSPQPPSPAPPSPAPSAPLQPSPDP 1414

Query: 369  VQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              S  PP     PPP   +PP   S P PAP+ P P  PP A
Sbjct: 1415 -PSPQPPSPAPGPPPSPPSPPSTPSPPSPAPLAPAPPVPPMA 1455

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 45/107 (42%), Positives = 53/107 (49%), Gaps = 15/107 (14%)
 Frame = +3

Query: 216 PPST--SPNASPAPPTPPT-------------NTPPTTPQASPPPVQSAPPTAQSSPPPV 350
           PP++  +P A P PP PPT               PP  P+  PPP+  +PP      PPV
Sbjct: 661 PPASPLTPAAPPRPPLPPTWPGKWEGAWPFRPPIPPRPPRPPPPPLPPSPPL-----PPV 715

Query: 351 QASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             SPPP    PPP +  SPPP   +PPP  S PP  P  P P SPPP
Sbjct: 716 TPSPPP---RPPPPK--SPPPPKPSPPPRPSPPPRPPPRPLPPSPPP 757

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 39/93 (41%), Positives = 43/93 (46%)
 Frame = +3

Query: 219  PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
            PS  P  SP P  PP   PP+ P   P P     P   S PPP   S PP    PP  + 
Sbjct: 734  PSPPPRPSPPPRPPPRPLPPSPPPPPPLPPNPPSPAPPSPPPPPSPSIPPPSPGPPSPEP 793

Query: 399  SSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
             SP P S+ PP     P PAP +P P SP P S
Sbjct: 794  PSPAPPSAAPPS-PMPPSPAPPSPDPPSPKPPS 825

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 47/101 (46%), Positives = 52/101 (51%), Gaps = 7/101 (6%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTP--PTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPPPVQSAPP 386
            PPS  P  SPAPP+P  P+  PP+    SP P    PP+    SPPP  ASP P   APP
Sbjct: 803  PPSPMP-PSPAPPSPDPPSPKPPSPVPPSPLPPSPEPPSPVPPSPPP--ASPEPTSPAPP 859

Query: 387  PVQQSSPPPVS----STPPPVQSSPPPAPVTPPPASPPPAS 497
                 SP P S    S PPP    P PAP +PP  SP P S
Sbjct: 860  SPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPLPSPEPPS 900

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 45/108 (41%), Positives = 52/108 (48%), Gaps = 15/108 (13%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTP-PTTPQA-SPPPVQSAPPT-AQSSPPPVQASPP------- 365
            PPS  P  SP PP+PP  +P PT+P   SPPP    PP+ A  SPPP    PP       
Sbjct: 833  PPSPEP-PSPVPPSPPPASPEPTSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSP 891

Query: 366  --PVQSAPPPVQQSSPPPVSSTPPPVQSSPP---PAPVTPPPASPPPA 494
              P    P P     PPP    P P   SPP   P P +P P+ PPP+
Sbjct: 892  PLPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPSPPPPS 939

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 39/104 (37%), Positives = 47/104 (45%), Gaps = 10/104 (9%)
 Frame = +3

Query: 216  PPSTSPNASPAP----PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
            P  T+P A P P    P PP+ TPP+    +P P    P    S  PP    P P+  +P
Sbjct: 1246 PQPTAPTAPPPPFPPSPAPPSPTPPSPEPPAPQPPSPTPHAPPSPEPPSPTPPSPLPPSP 1305

Query: 384  PPVQQSSPPPVSSTPPPVQSSPP------PAPVTPPPASPPPAS 497
             P   S P P  S P P   +PP      PAP+ P P SP P S
Sbjct: 1306 EPPSPSPPSPAPSVPSPPSPAPPSPMPPSPAPLAPQPPSPTPPS 1349

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 41/101 (40%), Positives = 46/101 (45%), Gaps = 8/101 (7%)
 Frame = +3

Query: 216  PPS-TSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            PPS T P+  P  P PP+  P    Q SP P    PP+    PPP   SPP   S P P 
Sbjct: 1384 PPSPTPPSPQPPSPAPPSPAPSAPLQPSPDPPSPQPPSPAPGPPPSPPSPPSTPSPPSPA 1443

Query: 393  QQSSPPPVSSTPPPVQSSPPPAPVTPP-------PASPPPA 494
              +  PPV    P   S P P+P  PP       PASP PA
Sbjct: 1444 PLAPAPPVPPMAPQPPSPPLPSPPFPPQPSPTITPASPQPA 1484

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 39/97 (40%), Positives = 44/97 (45%), Gaps = 3/97 (3%)
 Frame = +3

Query: 216  PPSTSPNASPAPP---TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
            PP + P   P+PP   +PP   PP     SPPP    PP   S  PP    PPP  S PP
Sbjct: 725  PPKSPPPPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLPPNPPSPAPP-SPPPPPSPSIPP 783

Query: 387  PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            P      P   S  PP  + P P P +P P SP P S
Sbjct: 784  PSPGPPSPEPPSPAPPSAAPPSPMPPSPAPPSPDPPS 820

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 45/113 (39%), Positives = 56/113 (49%), Gaps = 13/113 (11%)
 Frame = +3

Query: 198  SAGAQQPPS-TSPNASPAPPTPPTNTPPTTPQASPP-PVQSAP--------PTAQSS-PP 344
            S   Q PPS   P+ +P+ P+PP+  PP+    SPP P   AP        PTA ++ PP
Sbjct: 1197 SPHTQSPPSPVPPSPAPSAPSPPSPQPPSPLAPSPPSPAPQAPSSPFPPPQPTAPTAPPP 1256

Query: 345  PVQASPPPVQSAPPPVQQSSPPPVSSTP--PPVQSSPPPAPVTPPPASPPPAS 497
            P   SP P    PP  +  +P P S TP  PP    P P P +P P SP P S
Sbjct: 1257 PFPPSPAPPSPTPPSPEPPAPQPPSPTPHAPPSPEPPSPTPPSPLPPSPEPPS 1309

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 39/94 (41%), Positives = 45/94 (47%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            PP  +   +P PP PP+  PP  T P   PP  Q   PT  + P P   SP P    PP 
Sbjct: 1245 PPQPTAPTAPPPPFPPSPAPPSPTPPSPEPPAPQPPSPTPHAPPSPEPPSPTPPSPLPPS 1304

Query: 390  VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
             +  SP P S  P  V S P PAP +P P SP P
Sbjct: 1305 PEPPSPSPPSPAPS-VPSPPSPAPPSPMPPSPAP 1337

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 43/107 (40%), Positives = 54/107 (50%), Gaps = 13/107 (12%)
 Frame = +3

Query: 216  PPSTSPNA----SPAPPTPPTNTPPT-TPQASPPPVQSAPPTAQSSPPP-VQASPPPVQS 377
            PPS +P+A    SP PP+P   +PP+  PQA   P     PTA ++PPP    SP P   
Sbjct: 1208 PPSPAPSAPSPPSPQPPSPLAPSPPSPAPQAPSSPFPPPQPTAPTAPPPPFPPSPAPPSP 1267

Query: 378  APPPVQQSSPPPVSSTP-------PPVQSSPPPAPVTPPPASPPPAS 497
             PP  +  +P P S TP       PP  + P P P +P P SP P S
Sbjct: 1268 TPPSPEPPAPQPPSPTPHAPPSPEPPSPTPPSPLPPSPEPPSPSPPS 1314

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 41/106 (38%), Positives = 49/106 (46%), Gaps = 12/106 (11%)
 Frame = +3

Query: 207  AQQPPSTSPNA-SPAPPTPP--TNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
            A  PP  SP   SP PP+PP  +  PP+    SP P    PP+  +  PP    P P  S
Sbjct: 1155 APSPPPPSPEPPSPVPPSPPPPSPEPPSPAPPSPAPPLPLPPSPHTQSPPSPVPPSPAPS 1214

Query: 378  APPPVQQSSPPPVSSTPP------PVQSSPPP---APVTPPPASPP 488
            AP P     P P++ +PP      P    PPP   AP  PPP  PP
Sbjct: 1215 APSPPSPQPPSPLAPSPPSPAPQAPSSPFPPPQPTAPTAPPPPFPP 1260

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 46/130 (35%), Positives = 58/130 (44%), Gaps = 36/130 (27%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPT-------PPTNTP-PTTPQASP--PPVQSAPPTAQSSPP----- 344
           Q PP  +P + P+PPT       PP++ P P  P A P  PP+  A P   ++PP     
Sbjct: 618 QPPPPPAPPSPPSPPTTPDVPPMPPSSPPAPVMPPAPPPQPPIPPASPLTPAAPPRPPLP 677

Query: 345 --------------------PVQASPPPVQSAPP-PVQQSSPPPVSSTPPPVQSSPPPAP 461
                               P +  PPP+  +PP P    SPPP    PPP +S PPP P
Sbjct: 678 PTWPGKWEGAWPFRPPIPPRPPRPPPPPLPPSPPLPPVTPSPPP---RPPPPKSPPPPKP 734

Query: 462 VTPPPASPPP 491
             PP  SPPP
Sbjct: 735 SPPPRPSPPP 744

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 39/95 (41%), Positives = 46/95 (48%), Gaps = 2/95 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPP-TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           P + SP   P PP +PP   P   P+ SPPP     P   S PPP    P P   APP  
Sbjct: 714 PVTPSPPPRPPPPKSPPPPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLPPNPPSPAPP-- 771

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTP-PPASPPPA 494
               PPP  S PPP    P P P +P PP++ PP+
Sbjct: 772 -SPPPPPSPSIPPPSPGPPSPEPPSPAPPSAAPPS 805

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 47/113 (41%), Positives = 55/113 (48%), Gaps = 18/113 (15%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPT--NTPPTTPQASPPPVQ-SAPPTAQSSPP--PVQASPPPVQS 377
           QPP   P A P+PP+PPT  + PP  P + P PV   APP     PP  P+  + PP   
Sbjct: 618 QPPP--PPAPPSPPSPPTTPDVPPMPPSSPPAPVMPPAPPPQPPIPPASPLTPAAPPRPP 675

Query: 378 APP----------PVQQSSPP-PVSSTPPPVQSSPPPAPVT--PPPASPPPAS 497
            PP          P +   PP P    PPP+  SPP  PVT  PPP  PPP S
Sbjct: 676 LPPTWPGKWEGAWPFRPPIPPRPPRPPPPPLPPSPPLPPVTPSPPPRPPPPKS 728

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 41/109 (37%), Positives = 51/109 (46%), Gaps = 9/109 (8%)
 Frame = +3

Query: 198  SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPPVQASPPPV 371
            +A    PP   P+ +P  PTPP+  PP     SP P    S  P + + P P+  SP P 
Sbjct: 1249 TAPTAPPPPFPPSPAPPSPTPPSPEPPAPQPPSPTPHAPPSPEPPSPTPPSPLPPSPEPP 1308

Query: 372  QSAPPPVQQSSPPPVSSTPP-PVQSSP------PPAPVTPPPASPPPAS 497
              +PP    S P P S  PP P+  SP      PP+P  P PA P P S
Sbjct: 1309 SPSPPSPAPSVPSPPSPAPPSPMPPSPAPLAPQPPSPTPPSPAPPVPPS 1357

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 36/97 (37%), Positives = 44/97 (45%), Gaps = 5/97 (5%)
 Frame = +3

Query: 216  PPS-TSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
            PPS T P+  P  P PP+ TP   P   PP      P   S  PP  + P P  S P P 
Sbjct: 1264 PPSPTPPSPEPPAPQPPSPTPHAPPSPEPPSPTPPSPLPPSPEPPSPSPPSPAPSVPSPP 1323

Query: 393  QQSSPPPVSSTPPPVQSSP----PPAPVTPPPASPPP 491
              + P P+  +P P+   P    PP+P  P P SP P
Sbjct: 1324 SPAPPSPMPPSPAPLAPQPPSPTPPSPAPPVPPSPEP 1360

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 37/92 (40%), Positives = 46/92 (50%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
            PPS +P   P PP+P T +PP+    SP P   +PP+ Q  P P+  SPP      P   
Sbjct: 1185 PPSPAPPL-PLPPSPHTQSPPSPVPPSPAPSAPSPPSPQ-PPSPLAPSPPSPAPQAPSSP 1242

Query: 396  QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               P P + T PP    P PAP +P P SP P
Sbjct: 1243 FPPPQPTAPTAPPPPFPPSPAPPSPTPPSPEP 1274

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 46/104 (44%), Positives = 51/104 (49%), Gaps = 10/104 (9%)
 Frame = +3

Query: 216  PPSTSPNASPAP--PTPPTNTPPT----TPQASPPPVQSA--PPTAQSSPPPVQASPPPV 371
            PPS  P  SPAP  P PP+ TPP+     P +  PPV     PP   S  PP    P P 
Sbjct: 1327 PPSPMP-PSPAPLAPQPPSPTPPSPAPPVPPSPEPPVPPGPDPPLPPSPTPPSPQPPVPP 1385

Query: 372  QSAPPPVQQSSPPPVSSTP-PPVQSSP-PPAPVTPPPASPPPAS 497
               PP  Q  SP P S  P  P+Q SP PP+P  P PA  PP S
Sbjct: 1386 SPTPPSPQPPSPAPPSPAPSAPLQPSPDPPSPQPPSPAPGPPPS 1429

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 40/96 (41%), Positives = 48/96 (50%), Gaps = 7/96 (7%)
 Frame = +3

Query: 213  QPPSTSPNASPAP-------PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPV 371
            QPPS +P  SPAP       P PP+  PP+ P   PPP   +PP+  S P P   +P P 
Sbjct: 1393 QPPSPAP-PSPAPSAPLQPSPDPPSPQPPS-PAPGPPPSPPSPPSTPSPPSPAPLAPAP- 1449

Query: 372  QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA 479
               PP   Q   PP+ S P P Q SP   P +P PA
Sbjct: 1450 -PVPPMAPQPPSPPLPSPPFPPQPSPTITPASPQPA 1484

[109][TOP]
>UniRef100_Q10I10 Os03g0568800 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q10I10_ORYSJ
          Length = 675

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 47/108 (43%), Positives = 58/108 (53%), Gaps = 8/108 (7%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPV-----QASP 362
           + G  +PP  S +ASP+P  PP    P++PQ  PPP    PP     PPP      Q+  
Sbjct: 18  AGGPPEPPPQSSSASPSPSPPPPPPTPSSPQRPPPP---PPPATPPPPPPASPGKNQSPA 74

Query: 363 PPVQSAPPPVQQ---SSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            P Q +PPPV     SSPPP  +TPP    SPPP   +PPP SPPP +
Sbjct: 75  SPSQDSPPPVASPSVSSPPPAPTTPP----SPPPPSKSPPPPSPPPTT 118

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 47/101 (46%), Positives = 54/101 (53%), Gaps = 8/101 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA----SPPPVQSAP 383
           PP T  +    PP PP  TPP  P ASP   QS    +Q SPPPV +    SPPP  + P
Sbjct: 40  PPPTPSSPQRPPPPPPPATPPPPPPASPGKNQSPASPSQDSPPPVASPSVSSPPPAPTTP 99

Query: 384 P--PVQQSSPPPVSSTPPPVQSSPPPAPVTPPP--ASPPPA 494
           P  P    SPPP S  PPP  SS PP+  +PP    SPPP+
Sbjct: 100 PSPPPPSKSPPPPS--PPPTTSSTPPSHQSPPEEGTSPPPS 138

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 43/96 (44%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +3

Query: 225 TSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQ-SSPPPVQASPPPVQSAPPPVQQS 401
           T+   +  PP PP  +   +P  SPPP    P + Q   PPP  A+PPP   A P   QS
Sbjct: 13  TATAPAGGPPEPPPQSSSASPSPSPPPPPPTPSSPQRPPPPPPPATPPPPPPASPGKNQS 72

Query: 402 SPPPVSSTPPPVQ----SSPPPAPVTPPPASPPPAS 497
              P   +PPPV     SSPPPAP TPP  SPPP S
Sbjct: 73  PASPSQDSPPPVASPSVSSPPPAPTTPP--SPPPPS 106

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 45/103 (43%), Positives = 51/103 (49%), Gaps = 12/103 (11%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP+ S  PP P T   P  P  SPPP   +PP   SS PP   SPP   ++PPP  
Sbjct: 82  PPVASPSVSSPPPAPTTPPSPPPPSKSPPP--PSPPPTTSSTPPSHQSPPEEGTSPPPSP 139

Query: 396 QS-----SPPP------VSSTPPPVQSSPPPAP-VTPPPASPP 488
            S     SPPP       SSTPP    + PPAP   P P +PP
Sbjct: 140 SSGATTPSPPPNAQSSSSSSTPPAGAGTSPPAPREMPSPGTPP 182

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 48/112 (42%), Positives = 60/112 (53%), Gaps = 18/112 (16%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTP-----PTTP-QASPPPVQ----SAPPTAQSSPPPVQAS 359
           Q+PP   P A+P PP  P  +P     P +P Q SPPPV     S+PP A ++PP    S
Sbjct: 48  QRPPPPPPPATPPPP--PPASPGKNQSPASPSQDSPPPVASPSVSSPPPAPTTPP----S 101

Query: 360 PPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--------SPPP 491
           PPP   +PPP    SPPP +S+ PP   SPP    +PPP+        SPPP
Sbjct: 102 PPPPSKSPPP---PSPPPTTSSTPPSHQSPPEEGTSPPPSPSSGATTPSPPP 150

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 37/97 (38%), Positives = 43/97 (44%), Gaps = 5/97 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P  S    TPP++  P     SPPP  S+  T  S PP  Q+S     S PP   
Sbjct: 111 PPSPPPTTS---STPPSHQSPPEEGTSPPPSPSSGATTPSPPPNAQSSSS--SSTPPAGA 165

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVT-----PPPASPPP 491
            +SPP     P P   +PP  P T      PP  PPP
Sbjct: 166 GTSPPAPREMPSP--GTPPSPPTTLITTQAPPIQPPP 200

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 40/106 (37%), Positives = 48/106 (45%), Gaps = 9/106 (8%)
 Frame = +3

Query: 204 GAQQPPSTSPNAS-PAPP-----TPPTNTPPTTPQASPPPVQSAP-PTAQSSPPP--VQA 356
           G   PPS S  A+ P+PP     +  ++TPP     SPP  +  P P    SPP   +  
Sbjct: 132 GTSPPPSPSSGATTPSPPPNAQSSSSSSTPPAGAGTSPPAPREMPSPGTPPSPPTTLITT 191

Query: 357 SPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
             PP+Q  PPP   S   P S T      SPP A  T   A PPPA
Sbjct: 192 QAPPIQPPPPPGGNSMIMPSSLTTAGTSQSPPDA--TTAGAPPPPA 235

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 40/104 (38%), Positives = 48/104 (46%), Gaps = 24/104 (23%)
 Frame = +3

Query: 216 PPSTSP-NASPAPPTPPTNTPPTTPQ--------ASPPPVQSA-------PPTAQSS--- 338
           PPS  P + SP PP+PP  T  T P          SPPP  S+       PP AQSS   
Sbjct: 99  PPSPPPPSKSPPPPSPPPTTSSTPPSHQSPPEEGTSPPPSPSSGATTPSPPPNAQSSSSS 158

Query: 339 --PPPVQ-ASPPPVQSAPPPVQQSSPPP--VSSTPPPVQSSPPP 455
             PP     SPP  +  P P    SPP   +++  PP+Q  PPP
Sbjct: 159 STPPAGAGTSPPAPREMPSPGTPPSPPTTLITTQAPPIQPPPPP 202

[110][TOP]
>UniRef100_C1FJL3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FJL3_9CHLO
          Length = 513

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 45/97 (46%), Positives = 53/97 (54%), Gaps = 6/97 (6%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNT--PPTTPQASPP--PVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           P  SP ++P P + PT    P   P A+P   P  +  PT   SPPP   SPPP   +PP
Sbjct: 181 PPFSPLSAPGPSSSPTGALAPAAAPAAAPSAAPTPTPTPTPSPSPPPPSPSPPPPSPSPP 240

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA--SPPP 491
           P   S PPP  S PPP  S PPP+P  PPPA  +PPP
Sbjct: 241 PPSPSPPPPSPSPPPPSPSPPPPSPSPPPPAADTPPP 277

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 40/80 (50%), Positives = 45/80 (56%), Gaps = 2/80 (2%)
 Frame = +3

Query: 228 SPNASPA--PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQS 401
           +P A+PA  P   PT TP  TP  SPPP   +PP    SPPP   SPPP   +PPP   S
Sbjct: 200 APAAAPAAAPSAAPTPTPTPTPSPSPPPPSPSPPPPSPSPPPPSPSPPPPSPSPPPPSPS 259

Query: 402 SPPPVSSTPPPVQSSPPPAP 461
            PPP  S PPP   +PPP P
Sbjct: 260 PPPPSPSPPPPAADTPPPTP 279

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 35/84 (41%), Positives = 44/84 (52%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A   P+ +P  SP+PP P  + PP +P  SPPP   +PP    SPPP   SPPP   +PP
Sbjct: 211 AAPTPTPTPTPSPSPPPPSPSPPPPSP--SPPPPSPSPPPPSPSPPPPSPSPPPPSPSPP 268

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPA 458
           P    +PPP   TP  V+     A
Sbjct: 269 PPAADTPPP---TPEQVEEKKAAA 289

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 39/93 (41%), Positives = 47/93 (50%), Gaps = 4/93 (4%)
 Frame = +3

Query: 231 PNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV---QQS 401
           PN  P P      TPP +P ++P P  S+ PT   +P    A+ P     P P      S
Sbjct: 168 PNDYPEP-YDDEGTPPFSPLSAPGP--SSSPTGALAPAAAPAAAPSAAPTPTPTPTPSPS 224

Query: 402 SPPPVSSTPPPVQSSPPPAPVTPPPA-SPPPAS 497
            PPP  S PPP  S PPP+P  PPP+ SPPP S
Sbjct: 225 PPPPSPSPPPPSPSPPPPSPSPPPPSPSPPPPS 257

[111][TOP]
>UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1
           Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE
          Length = 472

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 48/109 (44%), Positives = 52/109 (47%), Gaps = 6/109 (5%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP 362
           C V +   A  PP +    SP PP+P    PP+    SPPP    PP   S PPP   SP
Sbjct: 211 CPVSILGNAPPPPPSPQPPSPQPPSPSPPPPPSPAPPSPPPPSPLPP---SPPPPPPPSP 267

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTP------PPASPPP 491
           PP    PPP     PPP  S PPP    PP  PVTP      PPA PPP
Sbjct: 268 PPPPPPPPPPPPPPPPPSPSPPPP--ELPPAQPVTPARKRPPPPAPPPP 314

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 40/93 (43%), Positives = 46/93 (49%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           P S   NA P PP+P   +P     + PPP   APP    SPPP    P P+  +PPP  
Sbjct: 212 PVSILGNAPPPPPSPQPPSPQPPSPSPPPPPSPAPP----SPPP----PSPLPPSPPPPP 263

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
             SPPP    PPP    PPP   +PPP   PPA
Sbjct: 264 PPSPPPPPPPPPPPPPPPPPPSPSPPPPELPPA 296

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 40/84 (47%), Positives = 43/84 (51%)
 Frame = +3

Query: 246 APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSST 425
           APP PP+  PP+ PQ   PP  S PP    +PP    SPPP    PP     SPPP    
Sbjct: 219 APPPPPSPQPPS-PQ---PPSPSPPPPPSPAPP----SPPPPSPLPP-----SPPP---- 261

Query: 426 PPPVQSSPPPAPVTPPPASPPPAS 497
           PPP    PPP P  PPP  PPP S
Sbjct: 262 PPPPSPPPPPPPPPPPPPPPPPPS 285

[112][TOP]
>UniRef100_UPI000069F8DC UPI000069F8DC related cluster n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI000069F8DC
          Length = 171

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 51/106 (48%), Positives = 63/106 (59%), Gaps = 14/106 (13%)
 Frame = +3

Query: 216 PPSTS-PNASPAPPTPPTNTPPTTPQA-----SPPPVQSAPPTAQSSPPPVQASPPPVQS 377
           PPS S P  SP+ P P  + PP +P A     +PPP  SAPP + S+PPP  ++PPP  S
Sbjct: 19  PPSPSAPPPSPSAPPPSPSAPPPSPSAPSSPSAPPPSPSAPPPSPSAPPPSPSAPPPSPS 78

Query: 378 APPPVQQSSPPPVSSTP-----PPVQS-SPPPAPVTPP--PASPPP 491
           APPP   S+PPP  S P     PP Q   P PAP+ PP  P++PPP
Sbjct: 79  APPP-SPSAPPPSPSAPSQPLCPPSQPLCPLPAPLPPPPSPSAPPP 123

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 46/98 (46%), Positives = 60/98 (61%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           A   QP +  P+ S  PP+P  + PP +P A PPP  SAP ++ S+PPP  ++PPP  SA
Sbjct: 10  AWCDQPSAPPPSPSAPPPSP--SAPPPSPSA-PPPSPSAP-SSPSAPPPSPSAPPPSPSA 65

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PPP   S+PPP  S PPP  S+PPP+P  P     PP+
Sbjct: 66  PPP-SPSAPPPSPSAPPPSPSAPPPSPSAPSQPLCPPS 102

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 5/90 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP---- 383
           PPS S  +SP+ P P  + PP +P A PPP  SAPP + S+PPP  ++PPP  SAP    
Sbjct: 40  PPSPSAPSSPSAPPPSPSAPPPSPSA-PPPSPSAPPPSPSAPPPSPSAPPPSPSAPSQPL 98

Query: 384 -PPVQQSSPPPVSSTPPPVQSSPPPAPVTP 470
            PP Q   P P    PPP  S+PPP P  P
Sbjct: 99  CPPSQPLCPLPAPLPPPPSPSAPPPNPSAP 128

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 37/80 (46%), Positives = 50/80 (62%), Gaps = 7/80 (8%)
 Frame = +3

Query: 276 PTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP-----PVQQSSPPPVSSTPPPVQ 440
           P+ P+ +     SAPP + S+PPP  ++PPP  SAPP     P   S+PPP  S PPP  
Sbjct: 4   PSAPRRAWCDQPSAPPPSPSAPPPSPSAPPPSPSAPPPSPSAPSSPSAPPPSPSAPPPSP 63

Query: 441 SSPPPAPVTPP--PASPPPA 494
           S+PPP+P  PP  P++PPP+
Sbjct: 64  SAPPPSPSAPPPSPSAPPPS 83

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 43/89 (48%), Positives = 54/89 (60%), Gaps = 8/89 (8%)
 Frame = +3

Query: 252 PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP-----PPVQQSSPPPV 416
           P+ P       P A PPP  SAPP + S+PPP  ++PPP  SAP     PP   S+PPP 
Sbjct: 4   PSAPRRAWCDQPSA-PPPSPSAPPPSPSAPPPSPSAPPPSPSAPSSPSAPPPSPSAPPP- 61

Query: 417 S-STPPPVQSSPPPAPVTPP--PASPPPA 494
           S S PPP  S+PPP+P  PP  P++PPP+
Sbjct: 62  SPSAPPPSPSAPPPSPSAPPPSPSAPPPS 90

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 34/75 (45%), Positives = 44/75 (58%), Gaps = 8/75 (10%)
 Frame = +3

Query: 294 SPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPP------VSSTPPPVQSSPPP 455
           SP   + A     S+PPP  ++PPP  SAPPP   S+PPP        S PPP  S+PPP
Sbjct: 3   SPSAPRRAWCDQPSAPPPSPSAPPPSPSAPPP-SPSAPPPSPSAPSSPSAPPPSPSAPPP 61

Query: 456 APVTPP--PASPPPA 494
           +P  PP  P++PPP+
Sbjct: 62  SPSAPPPSPSAPPPS 76

[113][TOP]
>UniRef100_Q9SPI6 Putative uncharacterized protein n=1 Tax=Picea rubens
           RepID=Q9SPI6_PICRU
          Length = 165

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/113 (46%), Positives = 67/113 (59%), Gaps = 3/113 (2%)
 Frame = +3

Query: 159 IVLVVGLICAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSS 338
           + +V+ L+    VS+ AQ P S SP  SP  P P T   P T  A+PP   + PP   S+
Sbjct: 7   MTMVLFLLAGFLVSSMAQAP-SASPTKSPTTPAPTTTAAPPTTTAAPPTTTATPPV--ST 63

Query: 339 PPPVQASPPPVQSAPPPVQQSSPPPVS---STPPPVQSSPPPAPVTPPPASPP 488
           PPPV ASPPPV + PPPV  ++PPPV+   +TPP     P PA  TPPPA+ P
Sbjct: 64  PPPV-ASPPPV-ATPPPV--ATPPPVATPVATPPSPALVPSPAVATPPPAATP 112

[114][TOP]
>UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q852P0_VOLCA
          Length = 606

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 44/103 (42%), Positives = 48/103 (46%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP 362
           C   +    Q PP   P   P+PP PP   PP +P   PPP     P   S PPP    P
Sbjct: 195 CPQNIVVEPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP-----PPPPSPPPPPPPPP 249

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PP    PPP    SPPP    PPP  S PPP P   PP +PPP
Sbjct: 250 PPSPPPPPPPPSPSPPP----PPPSPSPPPPPPPPSPPPAPPP 288

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 46/94 (48%), Positives = 50/94 (53%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           QPP   P   P PP+PP   PP  P + PPP    PP +   PPP    PPP  S PPP 
Sbjct: 204 QPPPPPP--PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP----PPPPPSPPPP- 256

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
               PPP S +PPP   SP P P  PPP SPPPA
Sbjct: 257 ----PPPPSPSPPPPPPSPSPPP-PPPPPSPPPA 285

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 39/85 (45%), Positives = 40/85 (47%)
 Frame = +3

Query: 243 PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSS 422
           P PP PP   PP  P + PPP    PP    SPPP    PPP    PPP     P P   
Sbjct: 203 PQPPPPP---PPPPPPSPPPP---PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256

Query: 423 TPPPVQSSPPPAPVTPPPASPPPAS 497
            PPP  S PPP P   PP  PPP S
Sbjct: 257 PPPPSPSPPPPPPSPSPPPPPPPPS 281

[115][TOP]
>UniRef100_Q41707 Extensin class 1 protein n=1 Tax=Vigna unguiculata
           RepID=Q41707_VIGUN
          Length = 489

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 48/105 (45%), Positives = 57/105 (54%), Gaps = 9/105 (8%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPPPVQSA 380
           + PP  SP  SP PP    + PP +P   PP V  +PP    SPPP    ++ PPP  S 
Sbjct: 191 KSPPPPSP--SPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSP 248

Query: 381 PPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 249 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 293

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 48/105 (45%), Positives = 57/105 (54%), Gaps = 9/105 (8%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPPPVQSA 380
           + PP  SP  SP PP    + PP +P   PP V  +PP    SPPP    ++ PPP  S 
Sbjct: 319 KSPPPPSP--SPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSP 376

Query: 381 PPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 377 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 421

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 47/108 (43%), Positives = 56/108 (51%), Gaps = 19/108 (17%)
 Frame = +3

Query: 231 PNASPAPPTPP----------TNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPPPV 371
           P  SP+PP PP           + PP +P   PP V  +PP    SPPP    ++ PPP 
Sbjct: 58  PPPSPSPPPPPYVHKYPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPS 117

Query: 372 QSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
            S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 118 PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPS 165

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 49/119 (41%), Positives = 60/119 (50%), Gaps = 23/119 (19%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPV----------QSAPPTAQSSPP 344
           + PP  SP+  P     +PP P  + PP     SPPP           +S PP + S PP
Sbjct: 95  KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 154

Query: 345 P--VQASPPPVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           P   ++ PPP  S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 155 PYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 213

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 49/119 (41%), Positives = 60/119 (50%), Gaps = 23/119 (19%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPV----------QSAPPTAQSSPP 344
           + PP  SP+  P     +PP P  + PP     SPPP           +S PP + S PP
Sbjct: 159 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 218

Query: 345 P--VQASPPPVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           P   ++ PPP  S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 219 PYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 277

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 49/119 (41%), Positives = 60/119 (50%), Gaps = 23/119 (19%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPV----------QSAPPTAQSSPP 344
           + PP  SP+  P     +PP P  + PP     SPPP           +S PP + S PP
Sbjct: 223 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 282

Query: 345 P--VQASPPPVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           P   ++ PPP  S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 283 PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 341

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 49/119 (41%), Positives = 60/119 (50%), Gaps = 23/119 (19%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPV----------QSAPPTAQSSPP 344
           + PP  SP+  P     +PP P  + PP     SPPP           +S PP + S PP
Sbjct: 351 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 410

Query: 345 P--VQASPPPVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           P   ++ PPP  S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 411 PYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 469

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 48/119 (40%), Positives = 58/119 (48%), Gaps = 23/119 (19%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTA---QSSPPPVQASPP 365
           + PP  SP+  P     +PP P  + PP     SPPP   +PP     +S PPP  + PP
Sbjct: 111 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPP 170

Query: 366 PV---------QSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           P           S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 171 PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPS 229

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 48/119 (40%), Positives = 58/119 (48%), Gaps = 23/119 (19%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTA---QSSPPPVQASPP 365
           + PP  SP+  P     +PP P  + PP     SPPP   +PP     +S PPP  + PP
Sbjct: 207 KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 266

Query: 366 PV---------QSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           P           S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 267 PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 325

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 48/119 (40%), Positives = 58/119 (48%), Gaps = 23/119 (19%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTA---QSSPPPVQASPP 365
           + PP  SP+  P     +PP P  + PP     SPPP   +PP     +S PPP  + PP
Sbjct: 255 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 314

Query: 366 PV---------QSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           P           S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 315 PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPS 373

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 48/119 (40%), Positives = 58/119 (48%), Gaps = 23/119 (19%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTA---QSSPPPVQASPP 365
           + PP  SP+  P     +PP P  + PP     SPPP   +PP     +S PPP  + PP
Sbjct: 335 KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 394

Query: 366 PV---------QSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           P           S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 395 PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPS 453

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 48/119 (40%), Positives = 58/119 (48%), Gaps = 23/119 (19%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTA---QSSPPPVQASPP 365
           + PP  SP+  P     +PP P  + PP     SPPP   +PP     +S PPP  + PP
Sbjct: 143 KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 202

Query: 366 PV---------QSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           P           S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 203 PYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 261

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 46/108 (42%), Positives = 54/108 (50%), Gaps = 14/108 (12%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPPPVQSA 380
           + PP  SP  SP PP    + PP +P   PP V  +PP    SPPP    ++ PPP  S 
Sbjct: 127 KSPPPPSP--SPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSP 184

Query: 381 PPPVQQSSPPPVS---------STPPPVQSSPPPAPV--TPPPASPPP 491
           PPP    SPPP S          +PPP   SPPP  V  +PPP SP P
Sbjct: 185 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSP 232

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 46/109 (42%), Positives = 54/109 (49%), Gaps = 15/109 (13%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPPP 368
           + PP  SP+  P     +PP P  + PP     SPPP   +PP      SPPP   SPPP
Sbjct: 367 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 426

Query: 369 --VQSAPPPVQQSSPPP--VSSTPPPVQSSPPP----APVTPPPASPPP 491
             V  +PPP   S PPP    S PPP  S PPP    +P  P P+ PPP
Sbjct: 427 PYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 475

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 45/101 (44%), Positives = 50/101 (49%), Gaps = 9/101 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPP-VQSAPPTAQSSPPPVQASPPP--VQSAPP 386
           P  T P    APP    + PP +P   PPP V   PP    SPPP   SPPP  V  +PP
Sbjct: 39  PKQTPPYYYNAPPYYYKSPPPPSPSPPPPPYVHKYPPYYYKSPPPPSPSPPPPYVYKSPP 98

Query: 387 PVQQSSPPPV--SSTPPPVQSSPPP----APVTPPPASPPP 491
           P   S PPP    S PPP  S PPP    +P  P P+ PPP
Sbjct: 99  PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 139

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/109 (40%), Positives = 53/109 (48%), Gaps = 15/109 (13%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPPP 368
           + PP  SP+  P     +PP P  + PP     SPPP   +PP      SPPP   SPPP
Sbjct: 79  KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 138

Query: 369 ---VQSAPPPVQQSSPPPVSSTPPPVQSSPPP-----APVTPPPASPPP 491
               +S PPP     PP V  +PPP   SPPP     +P  P P+ PPP
Sbjct: 139 PYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 187

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/109 (40%), Positives = 53/109 (48%), Gaps = 15/109 (13%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPPP 368
           + PP  SP+  P     +PP P  + PP     SPPP   +PP      SPPP   SPPP
Sbjct: 271 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 330

Query: 369 ---VQSAPPPVQQSSPPPVSSTPPPVQSSPPP-----APVTPPPASPPP 491
               +S PPP     PP V  +PPP   SPPP     +P  P P+ PPP
Sbjct: 331 PYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 379

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 45/109 (41%), Positives = 54/109 (49%), Gaps = 15/109 (13%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPPP 368
           + PP  SP+  P     +PP P  + PP     SPPP   +PP      SPPP   SPPP
Sbjct: 287 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 346

Query: 369 --VQSAPPPVQQSSPPPVS-STPPPVQSSPPP-----APVTPPPASPPP 491
             V  +PPP   S PPP    +PPP   SPPP     +P  P P+ PPP
Sbjct: 347 PYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 395

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 44/111 (39%), Positives = 53/111 (47%), Gaps = 17/111 (15%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPPPVQSA 380
           + PP  SP  SP PP    + PP +P   PP    +PP    SPPP    ++ PPP  S 
Sbjct: 239 KSPPPPSP--SPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSP 296

Query: 381 PPPVQQSSPPPVS---------STPPPVQSSPPP-----APVTPPPASPPP 491
           PPP    SPPP S          +PPP   SPPP     +P  P P+ PPP
Sbjct: 297 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 347

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 43/106 (40%), Positives = 50/106 (47%), Gaps = 11/106 (10%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPT--AQSSPPPVQASPPP 368
           + PP  SP+  P     +PP P  + PP     SPPP   +PP      SPPP   SPPP
Sbjct: 383 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPP 442

Query: 369 --VQSAPPPVQQSSPPP--VSSTPPPVQSSPPPAPVTPPPASPPPA 494
                +PPP   S PPP    S PPP  S PPP       + PPPA
Sbjct: 443 PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYPYLYNSPPPPA 488

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 36/85 (42%), Positives = 42/85 (49%), Gaps = 14/85 (16%)
 Frame = +3

Query: 285 PQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP--------PPVQQSSPPPVSSTPPP-- 434
           P+ +PP   +APP    SPPP      P  S P        PP    SPPP S +PPP  
Sbjct: 39  PKQTPPYYYNAPPYYYKSPPP------PSPSPPPPPYVHKYPPYYYKSPPPPSPSPPPPY 92

Query: 435 -VQSSPPPAPVTPPP---ASPPPAS 497
             +S PPP+P  PPP    SPPP S
Sbjct: 93  VYKSPPPPSPSPPPPYYYKSPPPPS 117

[116][TOP]
>UniRef100_B6U4I2 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6U4I2_MAIZE
          Length = 217

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 47/113 (41%), Positives = 59/113 (52%), Gaps = 13/113 (11%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPA-PPTPPTNTPPTTPQASPP--PVQSAPPTAQSSPPPVQASPPP 368
           +A   +PP+ SP   P+ PP+   +TPP TP A+PP  P  + PP + S PPP   S PP
Sbjct: 107 AASPPEPPAASPPEPPSTPPSESPSTPPPTPTATPPDSPPSTPPPESPSDPPPESPSDPP 166

Query: 369 ----------VQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
                       S PPP   S PPP  +TPP   S PPP P   PP +P P+S
Sbjct: 167 PTPTATPPESPPSTPPPESPSDPPP--ATPPESPSDPPPTPAATPPTTPSPSS 217

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 50/105 (47%), Positives = 59/105 (56%), Gaps = 11/105 (10%)
 Frame = +3

Query: 216 PPSTSPNASP--APPTPPTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPPPVQ--SA 380
           PP T    SP  +P TPP  +PP  P ASPP   S PP+ + S+PPP   + PP    S 
Sbjct: 89  PPPTPSQPSPPESPSTPPAASPPEPPAASPPEPPSTPPSESPSTPPPTPTATPPDSPPST 148

Query: 381 PPPVQQSSPPPVS-STPPPVQSSPPPA--PVTPPPAS---PPPAS 497
           PPP   S PPP S S PPP  ++ PP   P TPPP S   PPPA+
Sbjct: 149 PPPESPSDPPPESPSDPPPTPTATPPESPPSTPPPESPSDPPPAT 193

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 44/97 (45%), Positives = 52/97 (53%), Gaps = 6/97 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP-PTNTPPTTPQASPP-PVQSAPPTAQSSPPPVQAS-PPPVQSA-P 383
           PP   P   P P  P P  +P T P ASPP P  ++PP   S+PP    S PPP  +A P
Sbjct: 82  PPMNPPPPPPTPSQPSPPESPSTPPAASPPEPPAASPPEPPSTPPSESPSTPPPTPTATP 141

Query: 384 PPVQQSSPPPVSSTPPPVQ--SSPPPAPVTPPPASPP 488
           P    S+PPP S + PP +  S PPP P   PP SPP
Sbjct: 142 PDSPPSTPPPESPSDPPPESPSDPPPTPTATPPESPP 178

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 42/86 (48%), Positives = 47/86 (54%), Gaps = 5/86 (5%)
 Frame = +3

Query: 249 PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPV-SST 425
           PP  P   PPT  Q SPP   S PP A S P P  ASPP   S PP    S+PPP  ++T
Sbjct: 82  PPMNPPPPPPTPSQPSPPESPSTPPAA-SPPEPPAASPPEPPSTPPSESPSTPPPTPTAT 140

Query: 426 PP--PVQSSPPPAPVTPPPASP--PP 491
           PP  P  + PP +P  PPP SP  PP
Sbjct: 141 PPDSPPSTPPPESPSDPPPESPSDPP 166

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 34/75 (45%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = +3

Query: 267 NTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQ-S 443
           + PP  P   PPP    PPT     PP   S PP  S P P   +SPP   STPP    S
Sbjct: 80  HVPPMNP---PPP----PPTPSQPSPPESPSTPPAASPPEP-PAASPPEPPSTPPSESPS 131

Query: 444 SPPPAPVTPPPASPP 488
           +PPP P   PP SPP
Sbjct: 132 TPPPTPTATPPDSPP 146

[117][TOP]
>UniRef100_A4S1A8 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901
           RepID=A4S1A8_OSTLU
          Length = 388

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 49/102 (48%), Positives = 57/102 (55%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP 362
           C   VS     PPS  P+  P+PP  P  +PP +P  SPPP  S PP+   SPPP   SP
Sbjct: 80  CGCGVSVCPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP--SPPPSPPPSPPP---SP 134

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           PP   +PPP    SPPP   +PPP   SPPP+P   PP SPP
Sbjct: 135 PP---SPPPNPPPSPPP---SPPP---SPPPSPPPSPPPSPP 167

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 46/97 (47%), Positives = 56/97 (57%)
 Frame = +3

Query: 204 GAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           G    PS  P+  P+PP  P  +PP +P  SPPP  S PP+   SPPP   SPPP   +P
Sbjct: 83  GVSVCPSPPPSPPPSPPPSPPPSPPPSPPPSPPP--SPPPSPPPSPPP---SPPP---SP 134

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PP    +PPP   +PPP   SPPP+P   PP SPPP+
Sbjct: 135 PPSPPPNPPP---SPPP---SPPPSPPPSPPPSPPPS 165

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 29/61 (47%), Positives = 35/61 (57%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P+  P+PP  P  +PP  P  SPPP  S PP+   SPPP   SPPP  S P P+ 
Sbjct: 119 PPSPPPSPPPSPPPSPPPSPPPNPPPSPPP--SPPPSPPPSPPP---SPPP--SPPVPID 171

Query: 396 Q 398
           +
Sbjct: 172 R 172

[118][TOP]
>UniRef100_A3KD22 Leucine-rich repeat/extensin 1 n=1 Tax=Nicotiana tabacum
           RepID=A3KD22_TOBAC
          Length = 723

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 49/109 (44%), Positives = 59/109 (54%), Gaps = 16/109 (14%)
 Frame = +3

Query: 213 QPPSTSPN-----------ASPAPPTPPTNTPPTTPQASP--PPVQSAPPTAQSSPPPVQ 353
           +PP+ +P+           + PAPPTPP N  P  P ++P   P  S PPT   SP   Q
Sbjct: 590 KPPTPTPSPPAGYTPPQEPSHPAPPTPPCNETPPPPPSTPHWQPKPSPPPTYNPSPSYTQ 649

Query: 354 ASPPPVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPPASPPP 491
           + PPP    PP    SSPPP SS+PPP     SSPPP P +PPP SP P
Sbjct: 650 SPPPP----PPTYTYSSPPPPSSSPPPPTYYYSSPPPPPPSPPPPSPSP 694

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 41/95 (43%), Positives = 51/95 (53%), Gaps = 3/95 (3%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQA-SPPPVQSAPP--TAQSSPPPVQASPPPVQSAP 383
           +PP+ +P + P PP      PP TPQ+  PPPV   PP  T QS PPPV  +P    S P
Sbjct: 526 EPPTYTPQSPPPPPPVHYEPPPYTPQSPPPPPVHYEPPTYTPQSPPPPVYVTP---SSPP 582

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           PPV +   PP  +  PP   +PP  P  P P +PP
Sbjct: 583 PPVYEHPKPPTPTPSPPAGYTPPQEPSHPAPPTPP 617

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 58/155 (37%), Positives = 63/155 (40%), Gaps = 28/155 (18%)
 Frame = +3

Query: 111 HTYRQINQPTHKMGTHIVLVVGLICAVFVSAGAQQPPSTSP----NASPAPPTPPTNTPP 278
           H +R    PTHK+                      PP  SP    + SP PP P    PP
Sbjct: 462 HQHRSPPPPTHKISP------------VTRHAPPPPPPPSPVYYHHPSPPPPQPVYYAPP 509

Query: 279 T----TPQASPPPVQSAPPT----AQSSPPPVQASPPPV--QSAPPP---------VQQS 401
           T    +P   PPPV   PPT    +   PPPV   PPP   QS PPP           QS
Sbjct: 510 TYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPPYTPQSPPPPPVHYEPPTYTPQS 569

Query: 402 SPPPV----SSTPPPVQSSP-PPAPVTPPPASPPP 491
            PPPV    SS PPPV   P PP P   PPA   P
Sbjct: 570 PPPPVYVTPSSPPPPVYEHPKPPTPTPSPPAGYTP 604

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 50/106 (47%), Positives = 55/106 (51%), Gaps = 14/106 (13%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPT-TPQASPPP--VQSAPP--TAQSSPPPVQASPPPV--- 371
           PP+  P + P PP P    PPT TPQ+ PPP  V   PP  T QS PPP     PP    
Sbjct: 508 PPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPPYTPQSPPPPPVHYEPPTYTP 567

Query: 372 QSAPPPVQ---QSSPPPVSSTP-PPVQSSPPPAPVTPP--PASPPP 491
           QS PPPV     S PPPV   P PP  +  PPA  TPP  P+ P P
Sbjct: 568 QSPPPPVYVTPSSPPPPVYEHPKPPTPTPSPPAGYTPPQEPSHPAP 613

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 38/101 (37%), Positives = 47/101 (46%), Gaps = 13/101 (12%)
 Frame = +3

Query: 231 PNASPAPPTPPTNTPPTTPQASPP-----PVQSAPPTAQSS--------PPPVQASPPPV 371
           P  +P P  PP    P  P+ SPP     P++S PP +  S        PPP Q++PPP 
Sbjct: 389 PKPTPKPKRPPVQNKPPAPKPSPPTKPIVPIESPPPPSSKSSGSHFKRSPPPPQSTPPPS 448

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
              PPPV  SSP     +PPP      P     PP  PPP+
Sbjct: 449 PPPPPPVYSSSPSHQHRSPPPPTHKISPVTRHAPPPPPPPS 489

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/101 (43%), Positives = 49/101 (48%), Gaps = 15/101 (14%)
 Frame = +3

Query: 234 NASPAP-PTPPTNTPPTTPQASPPPVQS---------APPTAQSSPPPVQASPPPVQSAP 383
           N  PAP P+PPT   P  P  SPPP  S         +PP  QS+PPP    PPPV S+ 
Sbjct: 402 NKPPAPKPSPPTK--PIVPIESPPPPSSKSSGSHFKRSPPPPQSTPPPSPPPPPPVYSSS 459

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPA-----SPPP 491
           P  Q  SPPP +    PV    PP P  P P      SPPP
Sbjct: 460 PSHQHRSPPPPTHKISPVTRHAPPPPPPPSPVYYHHPSPPP 500

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 45/98 (45%), Positives = 53/98 (54%), Gaps = 6/98 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPPP---VQSAP 383
           PP ++P+  P P  PPT  P  +   SPPP    PPT   SSPPP  +SPPP     S+P
Sbjct: 624 PPPSTPHWQPKPSPPPTYNPSPSYTQSPPP---PPPTYTYSSPPPPSSSPPPPTYYYSSP 680

Query: 384 PPVQQSSPPPVSSTPPP--VQSSPPPAPVTPPPASPPP 491
           PP   S PPP S +PPP   +  P P  V    ASPPP
Sbjct: 681 PPPPPSPPPP-SPSPPPPSYEHVPLPPIVGVSYASPPP 717

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 47/119 (39%), Positives = 56/119 (47%), Gaps = 27/119 (22%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPV--QSAPPTAQSSPPPVQASP--------- 362
           PP ++P  SP PP P  ++ P+    SPPP   + +P T  + PPP   SP         
Sbjct: 440 PPQSTPPPSPPPPPPVYSSSPSHQHRSPPPPTHKISPVTRHAPPPPPPPSPVYYHHPSPP 499

Query: 363 --PPVQSAPPPVQQSSPPPVSSTPPPV---------QSSPPPAPV--TPP---PASPPP 491
              PV  APP  +  SPPP    PPPV         QS PPP PV   PP   P SPPP
Sbjct: 500 PPQPVYYAPPTYKPQSPPP---PPPPVHYEPPTYTPQSPPPPPPVHYEPPPYTPQSPPP 555

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 43/110 (39%), Positives = 47/110 (42%), Gaps = 16/110 (14%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPT---------TPQASPPPVQSAPPTAQSSPPPVQASP 362
           Q PP   P     PP  P + PP          TPQ+ PPPV   P    S PPPV   P
Sbjct: 533 QSPPPPPPVHYEPPPYTPQSPPPPPVHYEPPTYTPQSPPPPVYVTP---SSPPPPVYEHP 589

Query: 363 PPVQSAPPPVQQSSPPPVSSTP----PPVQSSPPPAPVTP---PPASPPP 491
            P    P P    +PP   S P    PP   +PPP P TP   P  SPPP
Sbjct: 590 KPPTPTPSPPAGYTPPQEPSHPAPPTPPCNETPPPPPSTPHWQPKPSPPP 639

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 35/89 (39%), Positives = 45/89 (50%), Gaps = 15/89 (16%)
 Frame = +3

Query: 270 TPPTTPQASPPPVQSAPPTAQSSPPPVQASPP-----PVQSAPPPVQQSSPPPVSSTPPP 434
           +P   P+  P P    PP  Q+ PP  + SPP     P++S PPP  +SS      +PPP
Sbjct: 382 SPVVKPRPKPTPKPKRPP-VQNKPPAPKPSPPTKPIVPIESPPPPSSKSSGSHFKRSPPP 440

Query: 435 VQSSPPPAPVTPPPA----------SPPP 491
            QS+PPP+P  PPP           SPPP
Sbjct: 441 PQSTPPPSPPPPPPVYSSSPSHQHRSPPP 469

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 43/103 (41%), Positives = 49/103 (47%), Gaps = 11/103 (10%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS+  + S    +PP   P +TP  SPPP    PP   SSP     SPPP      PV 
Sbjct: 424 PPSSKSSGSHFKRSPPP--PQSTPPPSPPP---PPPVYSSSPSHQHRSPPPPTHKISPVT 478

Query: 396 QSSPPPVSSTPPPV------QSSPPPAPV--TPP---PASPPP 491
           + +PPP    PPP        S PPP PV   PP   P SPPP
Sbjct: 479 RHAPPP---PPPPSPVYYHHPSPPPPQPVYYAPPTYKPQSPPP 518

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 36/94 (38%), Positives = 45/94 (47%), Gaps = 9/94 (9%)
 Frame = +3

Query: 216 PPST---SPNASPAPPTPP---TNTPPTTPQASPPP---VQSAPPTAQSSPPPVQASPPP 368
           PP T   SP+ + +PP PP   T + P  P +SPPP     S+PP    SPPP   SPP 
Sbjct: 637 PPPTYNPSPSYTQSPPPPPPTYTYSSPPPPSSSPPPPTYYYSSPPPPPPSPPPPSPSPP- 695

Query: 369 VQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTP 470
               PP  +    PP+      V  + PP PV P
Sbjct: 696 ----PPSYEHVPLPPIVG----VSYASPPPPVIP 721

[119][TOP]
>UniRef100_A3KD20 Leucine-rich repeat/extensin n=1 Tax=Nicotiana plumbaginifolia
           RepID=A3KD20_NICPL
          Length = 725

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 48/117 (41%), Positives = 56/117 (47%), Gaps = 23/117 (19%)
 Frame = +3

Query: 210 QQPPSTSPNASPA--PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP------VQASPP 365
           Q+P   +P   P   PPTPP +TP   P+ SPPP  +  P+   SPPP        + PP
Sbjct: 603 QEPSHPAPPTPPCNEPPTPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPP 662

Query: 366 PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP---------------ASPPP 491
           P  S PPP    S PP  S PPP  S PPP+P  PPP               ASPPP
Sbjct: 663 PSPSPPPPTYYYSSPPPPSPPPPSPSPPPPSPSPPPPSYEHVPLPPVVGVSYASPPP 719

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 51/108 (47%), Positives = 56/108 (51%), Gaps = 9/108 (8%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTP-PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP--- 368
           AG   P   S  A P PP   P   PP+TP   P P  S PPT   SP   Q+ PPP   
Sbjct: 597 AGYTPPQEPSHPAPPTPPCNEPPTPPPSTPHWQPKP--SPPPTYNPSPSYTQSPPPPPPT 654

Query: 369 -VQSAPPPVQQSSPPPV---SSTPPPVQSSPPPAPVTPPPA-SPPPAS 497
              S+PPP   S PPP    SS PPP  S PPP+P  PPP+ SPPP S
Sbjct: 655 YTYSSPPPPSPSPPPPTYYYSSPPPP--SPPPPSPSPPPPSPSPPPPS 700

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 48/104 (46%), Positives = 53/104 (50%), Gaps = 4/104 (3%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASP--PPVQSAPPTAQSSPPPVQASPPPV 371
           S  A   P   P+  PAPPTPP N PPT P ++P   P  S PPT   SP   Q+ PPP 
Sbjct: 594 SPPAGYTPPQEPS-HPAPPTPPCNEPPTPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPP- 651

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPV--TPPPASPPPAS 497
              PP    SSPPP      P  S PPP     +PPP SPPP S
Sbjct: 652 ---PPTYTYSSPPP------PSPSPPPPTYYYSSPPPPSPPPPS 686

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 55/144 (38%), Positives = 62/144 (43%), Gaps = 17/144 (11%)
 Frame = +3

Query: 111 HTYRQINQPTHKMGTHIVLVVGLICAVFVSAGAQQPPSTSP----NASPAPPTPPTNTPP 278
           H +R    PTHK+                   +  PP  SP    + SP+PP PP    P
Sbjct: 460 HKHRSPPPPTHKISP------------VTRHASPPPPPPSPVYYHHPSPSPPPPPVYYAP 507

Query: 279 TT--PQA---SPPPVQSAPPT-AQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQ 440
            T  PQ+    PPPV   PPT    SPPP    PPPV   PP     SPPP    PPPV 
Sbjct: 508 PTYKPQSPPPPPPPVHYEPPTYTPQSPPP----PPPVHYEPPTYTPQSPPP----PPPVH 559

Query: 441 SSP-------PPAPVTPPPASPPP 491
             P       PP PV   P+SPPP
Sbjct: 560 YEPPTYTPHSPPPPVYVTPSSPPP 583

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 52/119 (43%), Positives = 61/119 (51%), Gaps = 25/119 (21%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPT-TPQASPPP--VQSAPPT----AQSSPPPVQASPPPV- 371
           PP+  P + P PP P    PPT TPQ+ PPP  V   PPT    +   PPPV   PP   
Sbjct: 507 PPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYT 566

Query: 372 -QSAPPP--VQQSSPPPVS-----STP-PPVQSSPP-----PAPVTPP---PASPPPAS 497
             S PPP  V  SSPPP +      TP PP   +PP     PAP TPP   P +PPP++
Sbjct: 567 PHSPPPPVYVTPSSPPPPTPVYEHPTPSPPAGYTPPQEPSHPAPPTPPCNEPPTPPPST 625

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 43/114 (37%), Positives = 53/114 (46%), Gaps = 27/114 (23%)
 Frame = +3

Query: 231 PNASPAPPTPPTNTPPTTPQASPP-----PVQSAPPTAQSS--------PPPVQASPPPV 371
           P  +P P  PP    P  P+ S P     P++S PP +  S        PPP Q++PPP 
Sbjct: 389 PKPTPKPKRPPVQNKPPAPKPSTPSRPVAPIESPPPPSSKSSGSHFKRSPPPPQSTPPP- 447

Query: 372 QSAPPPVQQSSPPPVSSTPPPV---------QSSPPPAPVTP-----PPASPPP 491
            S PPPV  SSP     +PPP           +SPPP P +P     P  SPPP
Sbjct: 448 -SPPPPVYSSSPSHKHRSPPPPTHKISPVTRHASPPPPPPSPVYYHHPSPSPPP 500

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 47/122 (38%), Positives = 56/122 (45%), Gaps = 28/122 (22%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPV--QSAPPTAQSSPPPVQASP------- 362
           + PP       P+PP P  ++ P+    SPPP   + +P T  +SPPP   SP       
Sbjct: 436 RSPPPPQSTPPPSPPPPVYSSSPSHKHRSPPPPTHKISPVTRHASPPPPPPSPVYYHHPS 495

Query: 363 -----PPVQSAPPPVQQSSPPPVSSTPPPV---------QSSPPPAPV--TPP---PASP 485
                PPV  APP  +  SPPP    PPPV         QS PPP PV   PP   P SP
Sbjct: 496 PSPPPPPVYYAPPTYKPQSPPP---PPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPQSP 552

Query: 486 PP 491
           PP
Sbjct: 553 PP 554

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 41/105 (39%), Positives = 55/105 (52%), Gaps = 12/105 (11%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNTPPTTPQAS-------PPPVQSAPPTAQSSPPPVQASPP-- 365
           +PP+  P+    P  P  + PP + ++S       PPP QS PP   S PPPV +S P  
Sbjct: 403 KPPAPKPSTPSRPVAPIESPPPPSSKSSGSHFKRSPPPPQSTPP--PSPPPPVYSSSPSH 460

Query: 366 PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPV---TPPPASPPP 491
             +S PPP  + SP    ++PPP    PPP+PV    P P+ PPP
Sbjct: 461 KHRSPPPPTHKISPVTRHASPPP----PPPSPVYYHHPSPSPPPP 501

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 43/97 (44%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPPPVQSAPP 386
           Q PP   P     PPT    +PP      PPPV   PPT    SPPP    PPPV   PP
Sbjct: 513 QSPPPPPPPVHYEPPTYTPQSPP-----PPPPVHYEPPTYTPQSPPP----PPPVHYEPP 563

Query: 387 P-VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
                S PPPV  TP    S PPP PV   P   PPA
Sbjct: 564 TYTPHSPPPPVYVTP---SSPPPPTPVYEHPTPSPPA 597

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 41/101 (40%), Positives = 51/101 (50%), Gaps = 10/101 (9%)
 Frame = +3

Query: 216 PPSTSPNAS--PAPPTPPTNTPPTTPQASPPPVQSAPPTAQ--SSPPPVQASPPPVQSAP 383
           PPS+  + S     P PP +TPP +P   PPPV S+ P+ +  S PPP     P  + A 
Sbjct: 424 PPSSKSSGSHFKRSPPPPQSTPPPSP---PPPVYSSSPSHKHRSPPPPTHKISPVTRHAS 480

Query: 384 PPVQQSSP-----PPVSSTPPPVQSSPPP-APVTPPPASPP 488
           PP    SP     P  S  PPPV  +PP   P +PPP  PP
Sbjct: 481 PPPPPPSPVYYHHPSPSPPPPPVYYAPPTYKPQSPPPPPPP 521

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 38/88 (43%), Positives = 41/88 (46%), Gaps = 4/88 (4%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           PS S   SP PP PPT T  + P  SP P    PPT   S PP  + PPP  S PPP   
Sbjct: 640 PSPSYTQSPPPP-PPTYTYSSPPPPSPSP---PPPTYYYSSPPPPSPPPPSPSPPPPSPS 695

Query: 399 SSPPPVSSTPPP----VQSSPPPAPVTP 470
             PP     P P    V  + PP PV P
Sbjct: 696 PPPPSYEHVPLPPVVGVSYASPPPPVIP 723

[120][TOP]
>UniRef100_UPI0001A7B3CA lipid binding / structural constituent of cell wall n=1
           Tax=Arabidopsis thaliana RepID=UPI0001A7B3CA
          Length = 275

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 50/118 (42%), Positives = 60/118 (50%), Gaps = 7/118 (5%)
 Frame = +3

Query: 159 IVLVVGLICAVFVSAGAQQPPSTSPNA-----SPA-PPTPPTNTPPT-TPQASPPPVQSA 317
           I+L++GL+ AV  +     PP  SP+       PA PP PPT  PPT TP+  PP V+  
Sbjct: 13  ILLLLGLL-AVSYACDCSDPPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPK--PPTVKPP 69

Query: 318 PPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PP     PPP    PP V+  PPP  +  PPP    PPP    PPP P   PP  P P
Sbjct: 70  PPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTP 127

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 44/99 (44%), Positives = 50/99 (50%), Gaps = 6/99 (6%)
 Frame = +3

Query: 213 QPPSTSPNAS--PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP---VQS 377
           +PP+  P     P PP P T  PPT     PP V+  PP     PPP    PPP   V+ 
Sbjct: 62  KPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKP 121

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAP-VTPPPASPPP 491
            PPP   + PPP   TPPP    PPP P VTPPP +P P
Sbjct: 122 PPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTP 160

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/97 (42%), Positives = 49/97 (50%), Gaps = 4/97 (4%)
 Frame = +3

Query: 213 QPPSTSPNASP--APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP--VQSA 380
           +PP+  P   P   PP PPT  PP  P   PPP    PPT +  PPP   +PPP    + 
Sbjct: 83  KPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPP----PPTVKPPPPPTPYTPPPPTPYTP 138

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PPP  +  PPPV + PPP  +   P P  PP   PPP
Sbjct: 139 PPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/95 (43%), Positives = 46/95 (48%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPPPV 392
           PP T    +  PP PP   PP  P   PPP    PP  +  PPP V+  PPP    PPP 
Sbjct: 78  PPYTPKPPTVKPPPPPYVKPPPPPTVKPPP----PPYVKPPPPPTVKPPPPPTPYTPPPP 133

Query: 393 QQSSPPP--VSSTPPPVQSSPPPAPVTPPPASPPP 491
              +PPP  V   PPPV + PPP P    P  PPP
Sbjct: 134 TPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPP 168

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 39/91 (42%), Positives = 44/91 (48%), Gaps = 4/91 (4%)
 Frame = +3

Query: 216 PPSTSPNASP--APPTPPT--NTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP+  P   P   PP PPT    PP TP   PPP    PP     PP V+  PPPV + P
Sbjct: 100 PPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPP-----PPTVKPPPPPVVTPP 154

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP 476
           PP    +P P +  PP     PPP P  PPP
Sbjct: 155 PP----TPTPEAPCPP-----PPPTPYPPPP 176

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 33/85 (38%), Positives = 36/85 (42%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           P   P   P PP  P   PP TP   P      PPT +  PPPV   PPP      P  +
Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPP------PPTVKPPPPPVVTPPPPT-----PTPE 161

Query: 399 SSPPPVSSTPPPVQSSPPPAPVTPP 473
           +  PP    PPP    PPP P T P
Sbjct: 162 APCPP----PPPTPYPPPPKPETCP 182

[121][TOP]
>UniRef100_UPI0001A7B0BB lipid binding / structural constituent of cell wall n=1
           Tax=Arabidopsis thaliana RepID=UPI0001A7B0BB
          Length = 370

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 50/118 (42%), Positives = 60/118 (50%), Gaps = 7/118 (5%)
 Frame = +3

Query: 159 IVLVVGLICAVFVSAGAQQPPSTSPNA-----SPA-PPTPPTNTPPT-TPQASPPPVQSA 317
           I+L++GL+ AV  +     PP  SP+       PA PP PPT  PPT TP+  PP V+  
Sbjct: 13  ILLLLGLL-AVSYACDCSDPPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPK--PPTVKPP 69

Query: 318 PPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PP     PPP    PP V+  PPP  +  PPP    PPP    PPP P   PP  P P
Sbjct: 70  PPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTP 127

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 44/99 (44%), Positives = 50/99 (50%), Gaps = 6/99 (6%)
 Frame = +3

Query: 213 QPPSTSPNAS--PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP---VQS 377
           +PP+  P     P PP P T  PPT     PP V+  PP     PPP    PPP   V+ 
Sbjct: 62  KPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKP 121

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAP-VTPPPASPPP 491
            PPP   + PPP   TPPP    PPP P VTPPP +P P
Sbjct: 122 PPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTP 160

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/97 (42%), Positives = 49/97 (50%), Gaps = 4/97 (4%)
 Frame = +3

Query: 213 QPPSTSPNASP--APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP--VQSA 380
           +PP+  P   P   PP PPT  PP  P   PPP    PPT +  PPP   +PPP    + 
Sbjct: 83  KPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPP----PPTVKPPPPPTPYTPPPPTPYTP 138

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PPP  +  PPPV + PPP  +   P P  PP   PPP
Sbjct: 139 PPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/95 (43%), Positives = 46/95 (48%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPPPV 392
           PP T    +  PP PP   PP  P   PPP    PP  +  PPP V+  PPP    PPP 
Sbjct: 78  PPYTPKPPTVKPPPPPYVKPPPPPTVKPPP----PPYVKPPPPPTVKPPPPPTPYTPPPP 133

Query: 393 QQSSPPP--VSSTPPPVQSSPPPAPVTPPPASPPP 491
              +PPP  V   PPPV + PPP P    P  PPP
Sbjct: 134 TPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPP 168

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 39/91 (42%), Positives = 44/91 (48%), Gaps = 4/91 (4%)
 Frame = +3

Query: 216 PPSTSPNASP--APPTPPT--NTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP+  P   P   PP PPT    PP TP   PPP    PP     PP V+  PPPV + P
Sbjct: 100 PPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPP-----PPTVKPPPPPVVTPP 154

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP 476
           PP    +P P +  PP     PPP P  PPP
Sbjct: 155 PP----TPTPEAPCPP-----PPPTPYPPPP 176

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 33/85 (38%), Positives = 36/85 (42%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           P   P   P PP  P   PP TP   P      PPT +  PPPV   PPP      P  +
Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPP------PPTVKPPPPPVVTPPPPT-----PTPE 161

Query: 399 SSPPPVSSTPPPVQSSPPPAPVTPP 473
           +  PP    PPP    PPP P T P
Sbjct: 162 APCPP----PPPTPYPPPPKPETCP 182

[122][TOP]
>UniRef100_Q4A2S6 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S6_EHV86
          Length = 430

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 49/95 (51%), Positives = 55/95 (57%), Gaps = 4/95 (4%)
 Frame = +3

Query: 216 PPSTSP-NASPAPPTPPTNTPPTTPQASPPP--VQSAPPTAQSSPPPVQASPPPVQSAPP 386
           PPS  P +  P+PP+ P   PP  P +SPPP  V SAPP+A   PPP Q  P PV S PP
Sbjct: 214 PPSPPPFSPPPSPPSQPPQPPPVLPPSSPPPSPVPSAPPSA---PPPTQPPPSPVPSTPP 270

Query: 387 PVQQSSPPPVSSTPPPVQSSP-PPAPVTPPPASPP 488
             Q  SPPP  S  PP+Q  P  P P  PPP SPP
Sbjct: 271 SPQPVSPPP--SPEPPLQPPPNVPYPYAPPPGSPP 303

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 45/102 (44%), Positives = 55/102 (53%), Gaps = 9/102 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTP-PTTPQASPPPV---QSAPPTAQSSPPPVQASPPPVQSAP 383
           PP T+P+ SP PP PP + P P+ P  SPPP       PP+   + PP   SP PV S P
Sbjct: 76  PPPTTPSPSPPPPMPPRSPPSPSPPSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVPSPP 135

Query: 384 PPV-----QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PP      + S PPP+   P P   SP P P+ PPP SP P+
Sbjct: 136 PPPSPFAPEPSPPPPMPPPPTPPPPSPSPPPLPPPPWSPDPS 177

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/98 (50%), Positives = 54/98 (55%), Gaps = 5/98 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPV--QSAPPP 389
           PP   PN  P PP PP+  PP +P  SPPP  S PP+  S PP     PPPV   S+PPP
Sbjct: 191 PPPHPPN-QPPPPYPPSQPPPFSPPPSPPPF-SPPPSPPSQPP----QPPPVLPPSSPPP 244

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPP---PASPPPA 494
               S PP  S PPP Q  P P P TPP   P SPPP+
Sbjct: 245 SPVPSAPP--SAPPPTQPPPSPVPSTPPSPQPVSPPPS 280

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 46/100 (46%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +3

Query: 216 PPST-SPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQA------SPPP-- 368
           PPS  +P  SP PP PP  TPP  P  SPPP+   P +   SPPP  +      SPPP  
Sbjct: 137 PPSPFAPEPSPPPPMPPPPTPPP-PSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHP 195

Query: 369 VQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
               PPP   S PPP S  P P   SPPP+P + PP  PP
Sbjct: 196 PNQPPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPPQPPP 235

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 46/102 (45%), Positives = 52/102 (50%), Gaps = 9/102 (8%)
 Frame = +3

Query: 216 PPST-SPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPV------- 371
           PPS  SP+  P+PP PP+   P  P+ SPPP    PPT    PPP   SPPP+       
Sbjct: 122 PPSIPSPSPVPSPPPPPS---PFAPEPSPPPPMPPPPT----PPPPSPSPPPLPPPPWSP 174

Query: 372 -QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
             S PPP     PPP     PP Q  PP  P  PPP SPPP+
Sbjct: 175 DPSPPPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPS 216

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 46/101 (45%), Positives = 51/101 (50%), Gaps = 8/101 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP  SP+ SP PP  P   PP+ P    PP Q  PP   S PPP    P P   +PPP  
Sbjct: 169 PPPWSPDPSPPPPPSPYMPPPSPPPH--PPNQPPPPYPPSQPPPFSPPPSPPPFSPPPSP 226

Query: 396 QSSPPPVSSTPPPV--QSSPPPAPV------TPPPASPPPA 494
            S PP     PPPV   SSPPP+PV       PPP  PPP+
Sbjct: 227 PSQPP----QPPPVLPPSSPPPSPVPSAPPSAPPPTQPPPS 263

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 46/98 (46%), Positives = 52/98 (53%), Gaps = 6/98 (6%)
 Frame = +3

Query: 216 PPSTSP---NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP--VQSA 380
           PPS  P   N SP+PP      PPTTP  SPPP    PP +  SP P   SPPP    S 
Sbjct: 61  PPSLPPWWPNVSPSPP------PPTTPSPSPPP--PMPPRSPPSPSPPSPSPPPSFPPSV 112

Query: 381 PPPVQQSSPPPVSSTPPPVQS-SPPPAPVTPPPASPPP 491
           PPP    + PP   +P PV S  PPP+P  P P+ PPP
Sbjct: 113 PPPSNPPNVPPSIPSPSPVPSPPPPPSPFAPEPSPPPP 150

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 49/108 (45%), Positives = 59/108 (54%), Gaps = 16/108 (14%)
 Frame = +3

Query: 216 PPST---SPNASPAPPT------PPTNTPPTTPQASPPPVQ--SAPPTAQSSPPPV--QA 356
           PPS     P+  P PP       PP+  PP +P  SPPP     +PP+    PPPV   +
Sbjct: 181 PPSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPPQPPPVLPPS 240

Query: 357 SPP--PVQSAPPPVQQSSPPPVSSTPPPVQSSPP-PAPVTPPPASPPP 491
           SPP  PV SAPP    S+PPP    P PV S+PP P PV+PPP+  PP
Sbjct: 241 SPPPSPVPSAPP----SAPPPTQPPPSPVPSTPPSPQPVSPPPSPEPP 284

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 42/98 (42%), Positives = 48/98 (48%), Gaps = 5/98 (5%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT---PPTNTPPTTPQASPPPVQS--APPTAQSSPPPVQASPPPVQSA 380
           PP   P  +P PP+   PP   PP +P  SPPP  S   PP +    PP Q  PP   S 
Sbjct: 148 PPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPPSQ 207

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           PPP      PP  S PP   S PP  P   PP+SPPP+
Sbjct: 208 PPPFSPPPSPPPFSPPPSPPSQPPQPPPVLPPSSPPPS 245

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 49/113 (43%), Positives = 54/113 (47%), Gaps = 19/113 (16%)
 Frame = +3

Query: 216 PPSTSPNA-----SPAP-PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ- 374
           PPS  PN      SP+P P+PP    P  P+ SPPP    PPT    PPP   SPPP+  
Sbjct: 114 PPSNPPNVPPSIPSPSPVPSPPPPPSPFAPEPSPPPPMPPPPT----PPPPSPSPPPLPP 169

Query: 375 -------SAPPPVQQSSPPPVSSTPPPVQSSPP-----PAPVTPPPASPPPAS 497
                  S PPP     PPP     PP Q  PP     P P +PPP SPPP S
Sbjct: 170 PPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPP-SPPPFS 221

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 47/117 (40%), Positives = 60/117 (51%), Gaps = 13/117 (11%)
 Frame = +3

Query: 177 LICAVFVSAGA-QQPPSTSPNASPAPPTPPTNTPP--TTPQASPPPVQSAPPTAQSSPPP 347
           ++C++    GA   PPS  P      P PP+N PP  + P + PPP  S PP +  S PP
Sbjct: 7   MLCSLNSIVGAPSSPPSHPPIWPHQSPPPPSNPPPPLSPPPSLPPPPPSPPPPSPPSLPP 66

Query: 348 ----VQASPP----PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPA--PVTPPPASPP 488
               V  SPP    P  S PPP+   SPP    +P P   SPPP+  P  PPP++PP
Sbjct: 67  WWPNVSPSPPPPTTPSPSPPPPMPPRSPP----SPSPPSPSPPPSFPPSVPPPSNPP 119

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 37/89 (41%), Positives = 47/89 (52%), Gaps = 7/89 (7%)
 Frame = +3

Query: 246 APPTPPTNTPPTTPQASPPPVQSAPPTAQ---SSPPPVQASPPPVQSAPPP----VQQSS 404
           AP +PP++ PP  P  SPPP  + PP      S PPP  + PPP   + PP    V  S 
Sbjct: 17  APSSPPSH-PPIWPHQSPPPPSNPPPPLSPPPSLPPPPPSPPPPSPPSLPPWWPNVSPSP 75

Query: 405 PPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PPP + +P P    PP +P +P P SP P
Sbjct: 76  PPPTTPSPSPPPPMPPRSPPSPSPPSPSP 104

[123][TOP]
>UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q948Y6_VOLCA
          Length = 1143

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 48/94 (51%), Positives = 49/94 (52%), Gaps = 2/94 (2%)
 Frame = +3

Query: 216 PPSTSPNASP--APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP   P  SP    P PP+  PP     SPPP  S PP     PPP   SPPP  S PPP
Sbjct: 496 PPFVPPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPP---SPPPPPSPPPP 552

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
               SPPP  S PPP   SPPP P  PPP SPPP
Sbjct: 553 ---PSPPPPPSPPPP--PSPPPPPSPPPPPSPPP 581

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 51/100 (51%), Positives = 53/100 (53%), Gaps = 8/100 (8%)
 Frame = +3

Query: 216 PPS---TSPNA-SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PPS   TSP   SP PP P   +PP  P  SPPP  S PP     PPP   SPPP  S P
Sbjct: 502 PPSPLLTSPRPPSPRPPRPSPPSPPPPP--SPPPPPSPPPPPSPPPPP---SPPPPPSPP 556

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPP----PASPPP 491
           PP    SPPP  S PPP    PPP+P  PP    P SPPP
Sbjct: 557 PP---PSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPP 593

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 46/94 (48%), Positives = 46/94 (48%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PPS  P  SP PP  P   P   P  SPPP  S PP     PPP   SPPP  S PPP  
Sbjct: 522 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP---SPPPPPSPPPP-- 576

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            S PPP S   PP   SPPP P  P P  P P S
Sbjct: 577 PSPPPPPSPRHPP---SPPPRPRPPRPQPPSPPS 607

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 43/93 (46%), Positives = 48/93 (51%), Gaps = 2/93 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQA--SPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP  SP   P+PP PP+  PP +P    SPPP  S PP     PPP   SPPP  S PPP
Sbjct: 526 PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP---SPPPPPSPPPP 582

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
                PP    +PPP    P P P +PP  SPP
Sbjct: 583 PSPRHPP----SPPPRPRPPRPQPPSPPSPSPP 611

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 43/91 (47%), Positives = 48/91 (52%)
 Frame = +3

Query: 225 TSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSS 404
           TSP   P PP+P   +P       P P   +PP   S PPP   SPPP  S PPP    S
Sbjct: 494 TSPPFVPPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPP--PSPPPPPSPPPP---PS 548

Query: 405 PPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PPP  S PPP    PPP+P  PPP+ PPP S
Sbjct: 549 PPPPPSPPPPPSPPPPPSP-PPPPSPPPPPS 578

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 41/92 (44%), Positives = 47/92 (51%), Gaps = 2/92 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQA--SPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP  SP   P+PP PP+  PP +P    SPPP  S PP    SPPP  + PPP    P P
Sbjct: 532 PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP--SPPPPPSPPPP----PSP 585

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASP 485
               SPPP    P P     PP+P +P P SP
Sbjct: 586 RHPPSPPPRPRPPRP----QPPSPPSPSPPSP 613

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 39/91 (42%), Positives = 43/91 (47%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           P   P+ S         +PP  P    P + S  P +   P P   SPPP  S PPP   
Sbjct: 478 PLECPSLSMLEGIAVKTSPPFVPPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPP--- 534

Query: 399 SSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            SPPP  S PPP   SPPP P  PPP SPPP
Sbjct: 535 PSPPPPPSPPPP--PSPPPPPSPPPPPSPPP 563

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 34/88 (38%), Positives = 42/88 (47%), Gaps = 2/88 (2%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQA--SPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP  SP   P+PP PP+  PP +P    SPPP  S PP     PPP    PP     P P
Sbjct: 538 PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRP 597

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPP 473
            +   P P S +PP  ++    A +T P
Sbjct: 598 PRPQPPSPPSPSPPSPRTDNVVAWITQP 625

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 27/73 (36%), Positives = 35/73 (47%)
 Frame = +3

Query: 279 TTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPA 458
           T+P   P          ++SPP V   P P+ ++P P     P P   +PPP  S PPP 
Sbjct: 476 TSPLECPSLSMLEGIAVKTSPPFVPPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPP 535

Query: 459 PVTPPPASPPPAS 497
              PPP+ PPP S
Sbjct: 536 SPPPPPSPPPPPS 548

[124][TOP]
>UniRef100_O23370 Cell wall protein like n=1 Tax=Arabidopsis thaliana
           RepID=O23370_ARATH
          Length = 428

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 50/118 (42%), Positives = 60/118 (50%), Gaps = 7/118 (5%)
 Frame = +3

Query: 159 IVLVVGLICAVFVSAGAQQPPSTSPNA-----SPA-PPTPPTNTPPT-TPQASPPPVQSA 317
           I+L++GL+ AV  +     PP  SP+       PA PP PPT  PPT TP+  PP V+  
Sbjct: 13  ILLLLGLL-AVSYACDCSDPPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPK--PPTVKPP 69

Query: 318 PPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PP     PPP    PP V+  PPP  +  PPP    PPP    PPP P   PP  P P
Sbjct: 70  PPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTP 127

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 44/99 (44%), Positives = 50/99 (50%), Gaps = 6/99 (6%)
 Frame = +3

Query: 213 QPPSTSPNAS--PAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP---VQS 377
           +PP+  P     P PP P T  PPT     PP V+  PP     PPP    PPP   V+ 
Sbjct: 62  KPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKP 121

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAP-VTPPPASPPP 491
            PPP   + PPP   TPPP    PPP P VTPPP +P P
Sbjct: 122 PPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTP 160

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/97 (42%), Positives = 49/97 (50%), Gaps = 4/97 (4%)
 Frame = +3

Query: 213 QPPSTSPNASP--APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP--VQSA 380
           +PP+  P   P   PP PPT  PP  P   PPP    PPT +  PPP   +PPP    + 
Sbjct: 83  KPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPP----PPTVKPPPPPTPYTPPPPTPYTP 138

Query: 381 PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PPP  +  PPPV + PPP  +   P P  PP   PPP
Sbjct: 139 PPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/95 (43%), Positives = 46/95 (48%), Gaps = 3/95 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-VQASPPPVQSAPPPV 392
           PP T    +  PP PP   PP  P   PPP    PP  +  PPP V+  PPP    PPP 
Sbjct: 78  PPYTPKPPTVKPPPPPYVKPPPPPTVKPPP----PPYVKPPPPPTVKPPPPPTPYTPPPP 133

Query: 393 QQSSPPP--VSSTPPPVQSSPPPAPVTPPPASPPP 491
              +PPP  V   PPPV + PPP P    P  PPP
Sbjct: 134 TPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPP 168

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 39/91 (42%), Positives = 44/91 (48%), Gaps = 4/91 (4%)
 Frame = +3

Query: 216 PPSTSPNASP--APPTPPT--NTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           PP+  P   P   PP PPT    PP TP   PPP    PP     PP V+  PPPV + P
Sbjct: 100 PPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPP-----PPTVKPPPPPVVTPP 154

Query: 384 PPVQQSSPPPVSSTPPPVQSSPPPAPVTPPP 476
           PP    +P P +  PP     PPP P  PPP
Sbjct: 155 PP----TPTPEAPCPP-----PPPTPYPPPP 176

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 33/85 (38%), Positives = 36/85 (42%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQ 398
           P   P   P PP  P   PP TP   P      PPT +  PPPV   PPP      P  +
Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPP------PPTVKPPPPPVVTPPPPT-----PTPE 161

Query: 399 SSPPPVSSTPPPVQSSPPPAPVTPP 473
           +  PP    PPP    PPP P T P
Sbjct: 162 APCPP----PPPTPYPPPPKPETCP 182

[125][TOP]
>UniRef100_C5Y027 Putative uncharacterized protein Sb04g010730 n=1 Tax=Sorghum
           bicolor RepID=C5Y027_SORBI
          Length = 569

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/101 (43%), Positives = 55/101 (54%), Gaps = 7/101 (6%)
 Frame = +3

Query: 216 PPSTSPNASPA-----PPTPPTNTPPTTPQASPPPVQSAPPTAQSSP--PPVQASPPPVQ 374
           PPS++P   P       PTP  ++PPT P  S PP  + PP   S P  PP  + PPP+ 
Sbjct: 241 PPSSTPTTPPTYPPNHQPTPSPSSPPTMPPQSSPPTNNLPPPPSSPPIAPPTYSQPPPLH 300

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           S+PPP Q + P P SS PPP  +     P TPPP + PP S
Sbjct: 301 SSPPPHQATPPQPSSSLPPPSST-----PTTPPPNNQPPLS 336

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 46/115 (40%), Positives = 57/115 (49%), Gaps = 24/115 (20%)
 Frame = +3

Query: 216 PPSTSPNASPA------PPTPPTNTPPTTPQASPPPVQSAPPT---AQSSPPPVQASP-- 362
           PPS++P  +P       PP+ P++ P   P  SPPP QS+PP      +SPPP  + P  
Sbjct: 152 PPSSTPTTAPIYPPNNQPPSSPSSPPTMPPHKSPPPQQSSPPAKPPTNNSPPPPSSPPIA 211

Query: 363 -------------PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
                        PP   A PP Q SSPPP SSTP    + PP    TP P+SPP
Sbjct: 212 PPTYSQPPSLIPSPPPHQATPPQQSSSPPPPSSTPTTPPTYPPNHQPTPSPSSPP 266

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 48/114 (42%), Positives = 58/114 (50%), Gaps = 21/114 (18%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT------PPTNTPPTTPQASP--PPVQSAPPTAQSSPPPVQASPPPV 371
           PP+  P+ SP P        PPTN  P  P + P  PP  S PP+   SPPP QA+PP  
Sbjct: 176 PPTMPPHKSPPPQQSSPPAKPPTNNSPPPPSSPPIAPPTYSQPPSLIPSPPPHQATPPQQ 235

Query: 372 QSAPPPVQQS-----------SPPPVSSTPP--PVQSSPPPAPVTPPPASPPPA 494
            S+PPP   +            P P  S+PP  P QSSPP   + PPP+SPP A
Sbjct: 236 SSSPPPPSSTPTTPPTYPPNHQPTPSPSSPPTMPPQSSPPTNNLPPPPSSPPIA 289

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 49/104 (47%), Positives = 54/104 (51%), Gaps = 9/104 (8%)
 Frame = +3

Query: 213 QPPSTSPNASPAPPTPPTNT-PPTTPQASP--PPVQSAPPTAQSSPPPVQASPPPVQSAP 383
           QP S+ P  S  P TPP N  PP +P   P  PP +S  P   S  PP    PPP  SAP
Sbjct: 312 QPSSSLPPPSSTPTTPPPNNQPPLSPSIPPTMPPYKSPVPPLSS--PPTNNLPPPSPSAP 369

Query: 384 ---PPVQQSSPPPVSSTPPPVQSSPPP---APVTPPPASPPPAS 497
              P   Q SPPP  +TPP   SSPPP    P TPPP + PP S
Sbjct: 370 TAPPTYTQPSPPPYQATPPQPSSSPPPPSSTPTTPPPNNQPPLS 413

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 49/105 (46%), Positives = 60/105 (57%), Gaps = 11/105 (10%)
 Frame = +3

Query: 216 PPSTSPNASPA-PPT-PPTNTPPTT---PQASPPPVQSAPPTAQSSPPPVQASPPPVQSA 380
           PP+  P  SP+ PPT PP ++PPT    P  S PP+  APPT  S PPP+ +SPPP Q+ 
Sbjct: 253 PPNHQPTPSPSSPPTMPPQSSPPTNNLPPPPSSPPI--APPT-YSQPPPLHSSPPPHQAT 309

Query: 381 PPPVQQSSPPPVSS-TPPPVQSSPPPAPVTPPPASP-----PPAS 497
           PP    S PPP S+ T PP  + PP +P  PP   P     PP S
Sbjct: 310 PPQPSSSLPPPSSTPTTPPPNNQPPLSPSIPPTMPPYKSPVPPLS 354

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 55/131 (41%), Positives = 67/131 (51%), Gaps = 31/131 (23%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAP--PTPPTNTPPTTPQAS--PPPVQSA------------PPTA 329
           S+    P S+SP  +P    P PP ++PP TP ++  PPP  S             PP++
Sbjct: 113 SSSGTPPQSSSPQETPPQQYPPPPKSSPPVTPPSNSFPPPPSSTPTTAPIYPPNNQPPSS 172

Query: 330 QSSPP--PVQASPPPVQSAPP--PVQQSSPPPVSSTP--PPVQS-------SPPPAPVTP 470
            SSPP  P   SPPP QS+PP  P   +SPPP SS P  PP  S       SPPP   TP
Sbjct: 173 PSSPPTMPPHKSPPPQQSSPPAKPPTNNSPPPPSSPPIAPPTYSQPPSLIPSPPPHQATP 232

Query: 471 P--PASPPPAS 497
           P   +SPPP S
Sbjct: 233 PQQSSSPPPPS 243

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 41/99 (41%), Positives = 56/99 (56%), Gaps = 6/99 (6%)
 Frame = +3

Query: 216 PPSTSPNASPA-PPTPPTNTPPTTPQASPP---PVQSAPPTAQSSP--PPVQASPPPVQS 377
           PP+  P +SP+ PPT P +  P   Q+SPP   P  ++PP   S P  PP  + PP +  
Sbjct: 164 PPNNQPPSSPSSPPTMPPHKSPPPQQSSPPAKPPTNNSPPPPSSPPIAPPTYSQPPSLIP 223

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           +PPP  Q++PP  SS+PPP  S+P   P  PP   P P+
Sbjct: 224 SPPP-HQATPPQQSSSPPPPSSTPTTPPTYPPNHQPTPS 261

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 45/120 (37%), Positives = 55/120 (45%), Gaps = 29/120 (24%)
 Frame = +3

Query: 216 PPSTSPNASPAPP--TPPTNT-----------PPTTPQASPPPVQSAPPTAQSSPPPVQA 356
           PP+  P  SP PP  +PPTN            PPT  Q SPPP Q+ PP   SSPPP  +
Sbjct: 340 PPTMPPYKSPVPPLSSPPTNNLPPPSPSAPTAPPTYTQPSPPPYQATPPQPSSSPPPPSS 399

Query: 357 SP--PPVQSAPP--------------PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           +P  PP  + PP              P+   S PP ++ PPP  S   P P    P +PP
Sbjct: 400 TPTTPPPNNQPPLSPSIPPTMPPYKSPMPPQSSPPTNNLPPPPPSYTQPTPSPSAPTTPP 459

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 48/105 (45%), Positives = 56/105 (53%), Gaps = 11/105 (10%)
 Frame = +3

Query: 216 PPSTSPNASPA-PPTPPTNTPPTTPQASPPPVQSAPPT--AQSSPPP-VQASPPPVQSAP 383
           PP+  P  SP+ PPT P    P  P +SPP     PP+  A ++PP   Q SPPP Q A 
Sbjct: 328 PPNNQPPLSPSIPPTMPPYKSPVPPLSSPPTNNLPPPSPSAPTAPPTYTQPSPPPYQ-AT 386

Query: 384 PPVQQSSPPPVSSTP--PPVQSSPPPAPVTPPPASP-----PPAS 497
           PP   SSPPP SSTP  PP  + PP +P  PP   P     PP S
Sbjct: 387 PPQPSSSPPPPSSTPTTPPPNNQPPLSPSIPPTMPPYKSPMPPQS 431

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 51/136 (37%), Positives = 62/136 (45%), Gaps = 36/136 (26%)
 Frame = +3

Query: 198 SAGAQQPPSTSP--NASPAPPTPPTNTPPTTPQ-----ASPPPVQSAPPTAQSSPPPVQA 356
           S+    PP +SP  N  P PP+ P   PPT  Q     +SPPP Q+ PP   SS PP  +
Sbjct: 263 SSPPTMPPQSSPPTNNLPPPPSSPPIAPPTYSQPPPLHSSPPPHQATPPQPSSSLPPPSS 322

Query: 357 SP--PPVQSAPP--------------PVQQSSPPPVSSTPPP-----------VQSSPPP 455
           +P  PP  + PP              PV   S PP ++ PPP            Q SPPP
Sbjct: 323 TPTTPPPNNQPPLSPSIPPTMPPYKSPVPPLSSPPTNNLPPPSPSAPTAPPTYTQPSPPP 382

Query: 456 APVTP--PPASPPPAS 497
              TP  P +SPPP S
Sbjct: 383 YQATPPQPSSSPPPPS 398

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 47/114 (41%), Positives = 54/114 (47%), Gaps = 19/114 (16%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSP--PPVQASPPPVQSAP 383
           Q+ PS S N S  PP+     P ++     PP Q  PP   S P  PP  + PPP  S P
Sbjct: 99  QESPSPS-NDSSGPPSSSGTPPQSSSPQETPPQQYPPPPKSSPPVTPPSNSFPPPPSSTP 157

Query: 384 -----------PPVQQSSPP--PVSSTPPPVQSSPPPAPVT----PPPASPPPA 494
                      PP   SSPP  P   +PPP QSSPP  P T    PPP+SPP A
Sbjct: 158 TTAPIYPPNNQPPSSPSSPPTMPPHKSPPPQQSSPPAKPPTNNSPPPPSSPPIA 211

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 37/105 (35%), Positives = 48/105 (45%), Gaps = 6/105 (5%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNT----PPTTPQASPPPVQSAPPTAQSSPP--PVQAS 359
           SA    P  T P+  P   TPP  +    PP++   +PPP  + PP + S PP  P   S
Sbjct: 367 SAPTAPPTYTQPSPPPYQATPPQPSSSPPPPSSTPTTPPP-NNQPPLSPSIPPTMPPYKS 425

Query: 360 PPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           P P QS+PP      PPP  + P P  S+P   P        PP+
Sbjct: 426 PMPPQSSPPTNNLPPPPPSYTQPTPSPSAPTTPPTEQDHGQTPPS 470

[126][TOP]
>UniRef100_C1E833 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E833_9CHLO
          Length = 1506

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 48/92 (52%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPP-TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP  SP +SP+PP TPP  +PP+ P A+PPP   +PP    SPPP   SPPP+ S PPPV
Sbjct: 316 PPPPSPPSSPSPPPTPPPPSPPSPPPAAPPP---SPP----SPPP-SPSPPPLPS-PPPV 366

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
               P P ++ PPP   SPPP P +PPP  PP
Sbjct: 367 ----PSPPAAPPPPSPPSPPPPPPSPPPLGPP 394

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 41/88 (46%), Positives = 50/88 (56%)
 Frame = +3

Query: 234 NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPP 413
           N +  PP PP + PP++P  SPPP         + PPP   SPPP  +APPP   S PP 
Sbjct: 309 NVNRVPPPPPPS-PPSSP--SPPP---------TPPPPSPPSPPP--AAPPPSPPSPPP- 353

Query: 414 VSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            S +PPP+   P P PV  PPA+PPP S
Sbjct: 354 -SPSPPPL---PSPPPVPSPPAAPPPPS 377

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 40/88 (45%), Positives = 45/88 (51%), Gaps = 2/88 (2%)
 Frame = +3

Query: 216 PPSTSPNASPA--PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP T P  SP   PP  P  +PP     SPPP  S PP    SPPPV + P    +APPP
Sbjct: 327 PPPTPPPPSPPSPPPAAPPPSPP-----SPPPSPSPPPL--PSPPPVPSPP----AAPPP 375

Query: 390 VQQSSPPPVSSTPPPVQSSPPPAPVTPP 473
               SPPP   +PPP+   PP   VT P
Sbjct: 376 PSPPSPPPPPPSPPPL--GPPFRWVTTP 401

[127][TOP]
>UniRef100_B9RLA3 ATP binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RLA3_RICCO
          Length = 811

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 51/108 (47%), Positives = 60/108 (55%), Gaps = 14/108 (12%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQ---ASPPPVQSAPPTAQSSPPPVQASPPPVQSA-- 380
           PPS +P+A    P PP N    TPQ   ASPPP  S PP + ++ PP   SPPP QS   
Sbjct: 89  PPSQTPSAVVVSP-PPANASAPTPQPPVASPPPTTSPPPPSPNADPPTSNSPPPPQSPVQ 147

Query: 381 -PPPVQQSSPP-----PVSSTPPPVQ---SSPPPAPVTPPPASPPPAS 497
            PPP   S+PP     P +S PPP     +SPPP+   PP  SPPPAS
Sbjct: 148 LPPPPVSSTPPATPSDPPTSPPPPSNTPTTSPPPSSARPPANSPPPAS 195

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 52/110 (47%), Positives = 59/110 (53%), Gaps = 13/110 (11%)
 Frame = +3

Query: 207 AQQPPSTS---PNASPAPPTPPTNTPPTTPQASPPP--VQSAPPT-AQSSPPPVQASP-- 362
           A  PP  S   P  SP  P PP++ PP  P + PPP    S PPT +  SPPP  A+P  
Sbjct: 188 ANSPPPASLSPPQESPPSPPPPSSKPPENPPSPPPPPATPSEPPTNSPPSPPPPPATPSE 247

Query: 363 PPVQSAPPPVQQSSPPPVSSTP-----PPVQSSPPPAPVTPPPASPPPAS 497
           PP  S+PPPV  S PPP  S P     PP  S PPPA   P  + PPPAS
Sbjct: 248 PPTNSSPPPV--SVPPPRRSPPGPAATPPTTSPPPPASTPPASSPPPPAS 295

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 48/104 (46%), Positives = 58/104 (55%), Gaps = 7/104 (6%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTP---PTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP---- 365
           + +PP   P+  P P TP   PTN+PP+ P   PPP   + P   SSPPPV   PP    
Sbjct: 210 SSKPPENPPSPPPPPATPSEPPTNSPPSPP---PPPATPSEPPTNSSPPPVSVPPPRRSP 266

Query: 366 PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           P  +A PP   +SPPP +STPP   S PPPA   P  + PPPAS
Sbjct: 267 PGPAATPPT--TSPPPPASTPP-ASSPPPPASAPPENSPPPPAS 307

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 52/121 (42%), Positives = 57/121 (47%), Gaps = 29/121 (23%)
 Frame = +3

Query: 216 PPSTSPNASPA--------------PPTPPTNTPPTTPQ---ASPPPVQSAPPTAQSSPP 344
           PP  SPNA P               PP P ++TPP TP     SPPP  + P T   SPP
Sbjct: 124 PPPPSPNADPPTSNSPPPPQSPVQLPPPPVSSTPPATPSDPPTSPPPPSNTPTT---SPP 180

Query: 345 PVQA-----SPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTP-------PPASPP 488
           P  A     SPPP   +PP     SPPP SS PP    SPPP P TP       PP+ PP
Sbjct: 181 PSSARPPANSPPPASLSPPQESPPSPPPPSSKPPENPPSPPPPPATPSEPPTNSPPSPPP 240

Query: 489 P 491
           P
Sbjct: 241 P 241

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 51/137 (37%), Positives = 70/137 (51%), Gaps = 14/137 (10%)
 Frame = +3

Query: 129 NQPTHKMGTHIVLVVGLICAVFVSAGAQQPPSTSPNASPAP----PTPPTNTPPT-TPQA 293
           ++P  K  + ++L +  +        +  PP      SP P     TP T +PP+ TP A
Sbjct: 37  SKPVQKDFSFLLLRIKEVVIESPPLQSSPPPPDPLTTSPIPQPNVTTPSTPSPPSQTPSA 96

Query: 294 ---SPPPVQSAPPTAQ---SSPPPVQASPPPVQSAPPPVQQSSPP---PVSSTPPPVQSS 446
              SPPP  ++ PT Q   +SPPP  + PPP  +A PP   S PP   PV   PPPV S+
Sbjct: 97  VVVSPPPANASAPTPQPPVASPPPTTSPPPPSPNADPPTSNSPPPPQSPVQLPPPPVSST 156

Query: 447 PPPAPVTPPPASPPPAS 497
           PP  P  PP + PPP++
Sbjct: 157 PPATPSDPPTSPPPPSN 173

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 53/119 (44%), Positives = 60/119 (50%), Gaps = 25/119 (21%)
 Frame = +3

Query: 216 PPSTSPNASPAPPT--PPTNTPP----TTPQASPP---PVQSAPPTAQSSPPPVQASP-- 362
           PPS +P  SP P +  PP N+PP    + PQ SPP   P  S PP    SPPP  A+P  
Sbjct: 170 PPSNTPTTSPPPSSARPPANSPPPASLSPPQESPPSPPPPSSKPPENPPSPPPPPATPSE 229

Query: 363 PPVQSAP---PPVQQSSPPPVSSTPPPVQSSP-----------PPAPVTPPPASPPPAS 497
           PP  S P   PP    S PP +S+PPPV   P           PP    PPPAS PPAS
Sbjct: 230 PPTNSPPSPPPPPATPSEPPTNSSPPPVSVPPPRRSPPGPAATPPTTSPPPPASTPPAS 288

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 49/103 (47%), Positives = 59/103 (57%), Gaps = 9/103 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQ-ASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP+T P+  P  P PP+NTP T+P  +S  P  ++PP A  SPP      PP  S+ PP 
Sbjct: 157 PPAT-PSDPPTSPPPPSNTPTTSPPPSSARPPANSPPPASLSPPQESPPSPPPPSSKPPE 215

Query: 393 QQSSPPPVSSTP--PPVQS--SPPPAPVTP--PP--ASPPPAS 497
              SPPP  +TP  PP  S  SPPP P TP  PP  +SPPP S
Sbjct: 216 NPPSPPPPPATPSEPPTNSPPSPPPPPATPSEPPTNSSPPPVS 258

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/102 (46%), Positives = 57/102 (55%), Gaps = 3/102 (2%)
 Frame = +3

Query: 195 VSAGAQQPPSTSPNASPAPPTPPTNTPP-TTPQASP--PPVQSAPPTAQSSPPPVQASPP 365
           +S   + PPS  P +S  P  PP+  PP  TP   P   P    PP A  S PP  +SPP
Sbjct: 196 LSPPQESPPSPPPPSSKPPENPPSPPPPPATPSEPPTNSPPSPPPPPATPSEPPTNSSPP 255

Query: 366 PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PV S PPP  + SPP  ++TPP   +SPPP   TPP +SPPP
Sbjct: 256 PV-SVPPP--RRSPPGPAATPP--TTSPPPPASTPPASSPPP 292

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 45/110 (40%), Positives = 56/110 (50%), Gaps = 12/110 (10%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPT----PPTNTPPTT-----PQASPPPVQSAPPTAQSSPP--- 344
           A   +PP+ SP + P PP     PPTN+ P       P+ SPP   + PPT    PP   
Sbjct: 225 ATPSEPPTNSPPSPPPPPATPSEPPTNSSPPPVSVPPPRRSPPGPAATPPTTSPPPPAST 284

Query: 345 PVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           P  +SPPP  SAPP  + S PPP S  P P  + PPP     PP+ P P+
Sbjct: 285 PPASSPPPPASAPP--ENSPPPPASIAPTPSNAPPPPGRTPFPPSQPTPS 332

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 50/114 (43%), Positives = 60/114 (52%), Gaps = 20/114 (17%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPT-TPQA---SPPPVQSAPPTAQ---SSPPPVQASPPPVQ 374
           P +TSP   P   TP T +PP+ TP A   SPPP  ++ PT Q   +SPPP  + PPP  
Sbjct: 70  PLTTSPIPQPNVTTPSTPSPPSQTPSAVVVSPPPANASAPTPQPPVASPPPTTSPPPPSP 129

Query: 375 SAPPPVQQSSPPPVS---------S-TPPPVQSSPPPAPVTP---PPASPPPAS 497
           +A PP   S PPP S         S TPP   S PP +P  P   P  SPPP+S
Sbjct: 130 NADPPTSNSPPPPQSPVQLPPPPVSSTPPATPSDPPTSPPPPSNTPTTSPPPSS 183

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 41/96 (42%), Positives = 53/96 (55%), Gaps = 7/96 (7%)
 Frame = +3

Query: 216 PPSTSPNASPAPP--TPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           P +T P  SP PP  TPP ++PP  P AS PP  S PP A  +P P  A PPP ++  PP
Sbjct: 269 PAATPPTTSPPPPASTPPASSPP--PPASAPPENSPPPPASIAPTPSNAPPPPGRTPFPP 326

Query: 390 VQ-----QSSPPPVSSTPPPVQSSPPPAPVTPPPAS 482
            Q      +S P  S++PP +  SPPP  ++  P S
Sbjct: 327 SQPTPSPSNSTPNASTSPPLITLSPPPPSLSSAPPS 362

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 44/99 (44%), Positives = 57/99 (57%), Gaps = 3/99 (3%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A  PP+TSP   P   TPP ++PP  P AS PP  S PP A  +P P  A PPP ++  P
Sbjct: 270 AATPPTTSP--PPPASTPPASSPP--PPASAPPENSPPPPASIAPTPSNAPPPPGRTPFP 325

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPP---ASPPPA 494
           P  Q +P P +ST P   +SPP   ++PPP   +S PP+
Sbjct: 326 P-SQPTPSPSNST-PNASTSPPLITLSPPPPSLSSAPPS 362

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 46/104 (44%), Positives = 58/104 (55%), Gaps = 10/104 (9%)
 Frame = +3

Query: 216 PPSTSPNASPAPP----TPPTNTPP---TTPQA-SPPPVQSAPPTAQSSPPPVQASPPPV 371
           PP + P    +PP    TPPT +PP   +TP A SPPP  SAPP  ++SPPP  +  P  
Sbjct: 255 PPVSVPPPRRSPPGPAATPPTTSPPPPASTPPASSPPPPASAPP--ENSPPPPASIAPTP 312

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPP--PASPPPAS 497
            +APPP  ++  PP   TP P  +S P A  +PP    SPPP S
Sbjct: 313 SNAPPPPGRTPFPPSQPTPSP-SNSTPNASTSPPLITLSPPPPS 355

[128][TOP]
>UniRef100_B9RKQ3 ATP binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RKQ3_RICCO
          Length = 670

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 48/101 (47%), Positives = 57/101 (56%), Gaps = 7/101 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPP--TAQSSPPPVQASPPPVQ---SA 380
           PPST  N +  PP  P   PP+TP A PP   +APP  T  + PP   A+PPP     SA
Sbjct: 9   PPST--NTTAPPPATPAAPPPSTPAAPPPATPAAPPPATPAAPPPATPAAPPPAPVTPSA 66

Query: 381 PPPVQQ--SSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
           PPP     SSPPP SS+ PP  S+P P+P T  P+ P P S
Sbjct: 67  PPPAPATPSSPPPTSSSSPPPPSTPSPSPPTSTPSPPSPPS 107

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 45/107 (42%), Positives = 54/107 (50%), Gaps = 9/107 (8%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPA------PPTPPTNTPPTTPQASPPPVQSAPPTA---QSSPPPV 350
           S     PP  +P A P       PP  P   PP TP A PP   +APP A    S+PPP 
Sbjct: 11  STNTTAPPPATPAAPPPSTPAAPPPATPAAPPPATPAAPPPATPAAPPPAPVTPSAPPPA 70

Query: 351 QASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
            A+P    S+PPP   SSPPP  STP P   +  P+P +PP  +P P
Sbjct: 71  PATP----SSPPPTSSSSPPP-PSTPSPSPPTSTPSPPSPPSTTPSP 112

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 45/95 (47%), Positives = 54/95 (56%), Gaps = 12/95 (12%)
 Frame = +3

Query: 237 ASPAPPTPP-TNT---PPTTPQASPPPVQSAPP--TAQSSPPPVQASPPPVQSA---PPP 389
           ++P P +PP TNT   PP TP A PP   +APP  T  + PP   A+PPP   A   P P
Sbjct: 2   SAPTPTSPPSTNTTAPPPATPAAPPPSTPAAPPPATPAAPPPATPAAPPPATPAAPPPAP 61

Query: 390 VQQSSPPPVSST---PPPVQSSPPPAPVTPPPASP 485
           V  S+PPP  +T   PPP  SS PP P TP P+ P
Sbjct: 62  VTPSAPPPAPATPSSPPPTSSSSPPPPSTPSPSPP 96

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 58/126 (46%), Positives = 62/126 (49%), Gaps = 29/126 (23%)
 Frame = +3

Query: 207 AQQPPSTS---PNASPA--PPTPPTNTPPTTPQASPP-PVQ-SAPPTAQ---SSPPPVQA 356
           A  PPST    P A+PA  PP  P   PP TP A PP PV  SAPP A    SSPPP  +
Sbjct: 23  AAPPPSTPAAPPPATPAAPPPATPAAPPPATPAAPPPAPVTPSAPPPAPATPSSPPPTSS 82

Query: 357 SPPPVQSAP---PPVQQSSPP-PVSSTPPPVQSS------------PPPAPVT---PPPA 479
           S PP  S P   PP    SPP P S+TP P  +S             PPAP T   P P 
Sbjct: 83  SSPPPPSTPSPSPPTSTPSPPSPPSTTPSPPTNSGTTPSTPTPTTRSPPAPPTSSSPSPP 142

Query: 480 SPPPAS 497
           SPP  S
Sbjct: 143 SPPSNS 148

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 51/107 (47%), Positives = 55/107 (51%), Gaps = 10/107 (9%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPP-PV-QSAPPTA---QSSPPPVQASP 362
           S  A  PP+T     PA P  P   PP TP A PP PV  SAPP A    SSPPP  +S 
Sbjct: 28  STPAAPPPATPAAPPPATPAAP---PPATPAAPPPAPVTPSAPPPAPATPSSPPPTSSSS 84

Query: 363 PPVQSAP---PPVQQSSPP-PVSSTP-PPVQSSPPPAPVTPPPASPP 488
           PP  S P   PP    SPP P S+TP PP  S   P+  TP   SPP
Sbjct: 85  PPPPSTPSPSPPTSTPSPPSPPSTTPSPPTNSGTTPSTPTPTTRSPP 131

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 36/92 (39%), Positives = 47/92 (51%), Gaps = 10/92 (10%)
 Frame = +3

Query: 252 PTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPV--SST 425
           PTP   +PP+T   +PPP   A P            PP   +APPP   ++PPP   ++ 
Sbjct: 4   PTP--TSPPSTNTTAPPPATPAAP------------PPSTPAAPPPATPAAPPPATPAAP 49

Query: 426 PPPVQSSPPPAPVTP--------PPASPPPAS 497
           PP   ++PPPAPVTP         P+SPPP S
Sbjct: 50  PPATPAAPPPAPVTPSAPPPAPATPSSPPPTS 81

[129][TOP]
>UniRef100_Q9SX31 F24J5.8 protein n=1 Tax=Arabidopsis thaliana RepID=Q9SX31_ARATH
          Length = 708

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 47/98 (47%), Positives = 54/98 (55%), Gaps = 6/98 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPP-PVQASPPPVQSAPPPV 392
           P +  PN +P PP P T +PP     +PPP    PP + S PP PV  SPPP  S PP  
Sbjct: 41  PSAPPPNRAPPPPPPVTTSPPPVANGAPPPPLPKPPESSSPPPQPVIPSPPPSTSPPPQP 100

Query: 393 QQSSPPPVSSTP----PPVQSS-PPPAPVTPPPASPPP 491
              SPPP +S P    PP+ SS PPPA V PP  SP P
Sbjct: 101 VIPSPPPSASPPPALVPPLPSSPPPPASVPPPRPSPSP 138

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 54/110 (49%), Positives = 62/110 (56%), Gaps = 14/110 (12%)
 Frame = +3

Query: 207 AQQPPSTSP----NASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           +  PP TSP    N + +P TPP  T P  P A PPP ++ PP     PPPV  SPPPV 
Sbjct: 11  SNSPPVTSPPPPLNNATSPATPPPVTSPLPPSA-PPPNRAPPP-----PPPVTTSPPPVA 64

Query: 375 S-APPPV-----QQSSPPPVSSTP-PPVQSSPPPAPV---TPPPASPPPA 494
           + APPP      + SSPPP    P PP  +SPPP PV    PP ASPPPA
Sbjct: 65  NGAPPPPLPKPPESSSPPPQPVIPSPPPSTSPPPQPVIPSPPPSASPPPA 114

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/96 (45%), Positives = 49/96 (51%), Gaps = 1/96 (1%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
           A  PP TSP    APP      PP     SPPPV +  P      PP  +SPPP    P 
Sbjct: 30  ATPPPVTSPLPPSAPPPNRAPPPPPPVTTSPPPVANGAPPPPLPKPPESSSPPPQPVIPS 89

Query: 387 PVQQSSPPPVSSTP-PPVQSSPPPAPVTPPPASPPP 491
           P   +SPPP    P PP  +SPPPA V P P+SPPP
Sbjct: 90  PPPSTSPPPQPVIPSPPPSASPPPALVPPLPSSPPP 125

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/124 (39%), Positives = 61/124 (49%), Gaps = 24/124 (19%)
 Frame = +3

Query: 195 VSAGAQQPPSTSPNASPAPPT-------PPTNTPPTTPQASPPPVQSAPPTA-----QSS 338
           V+ GA  PP   P  S +PP        PP+ +PP  P    PP  ++PP A      SS
Sbjct: 63  VANGAPPPPLPKPPESSSPPPQPVIPSPPPSTSPPPQPVIPSPPPSASPPPALVPPLPSS 122

Query: 339 PPPVQASPPPVQSAPPPVQQSSPPP----VSSTPPP-----VQSSPPPAPVTPP---PAS 482
           PPP  + PPP  S  PP+   SPPP    + S PPP      QS PPP+P +PP   P  
Sbjct: 123 PPPPASVPPPRPSPSPPILVRSPPPSVRPIQSPPPPPSDRPTQSPPPPSPPSPPSERPTQ 182

Query: 483 PPPA 494
            PP+
Sbjct: 183 SPPS 186

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 44/113 (38%), Positives = 56/113 (49%), Gaps = 22/113 (19%)
 Frame = +3

Query: 219 PSTSPNASPAP---------PTPPTNTPPTTPQASPPPVQSAPPTA----QSSPP----- 344
           PS  P+ASP P         P PP + PP  P  SPP +  +PP +    QS PP     
Sbjct: 103 PSPPPSASPPPALVPPLPSSPPPPASVPPPRPSPSPPILVRSPPPSVRPIQSPPPPPSDR 162

Query: 345 PVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTP----PPASPPP 491
           P Q+ PPP   +PP  + +  PP   +  P QS PPP+P +P    P  SPPP
Sbjct: 163 PTQSPPPPSPPSPPSERPTQSPPSPPSERPTQSPPPPSPPSPPSDRPSQSPPP 215

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 48/117 (41%), Positives = 59/117 (50%), Gaps = 23/117 (19%)
 Frame = +3

Query: 216 PPSTSP----NASPAPPTPP---TNTPPTTPQ-------ASPPP---VQSAPPTAQSSP- 341
           P +TSP    N +P PP P    +++PP  P         SPPP   + S PP+A   P 
Sbjct: 55  PVTTSPPPVANGAPPPPLPKPPESSSPPPQPVIPSPPPSTSPPPQPVIPSPPPSASPPPA 114

Query: 342 --PPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQ---SSPPPAPVTPPPASPPPAS 497
             PP+ +SPPP  S PPP    SPP +  +PPP      SPPP P   P  SPPP S
Sbjct: 115 LVPPLPSSPPPPASVPPPRPSPSPPILVRSPPPSVRPIQSPPPPPSDRPTQSPPPPS 171

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 44/94 (46%), Positives = 51/94 (54%), Gaps = 3/94 (3%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPP---PVQSAPP 386
           PPS  P  SP PP+PP + P   P  SPP   S  PT QS PPP   SPP   P QS PP
Sbjct: 158 PPSDRPTQSPPPPSPP-SPPSERPTQSPPSPPSERPT-QSPPPPSPPSPPSDRPSQSPPP 215

Query: 387 PVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           P + + P P   +P    +SPPP   + PP SPP
Sbjct: 216 PPEDTKPQPPRRSP----NSPPPT-FSSPPRSPP 244

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 51/112 (45%), Positives = 55/112 (49%), Gaps = 20/112 (17%)
 Frame = +3

Query: 216 PPSTS---PNASPAPPTPPTNTPPTT-PQASPPPVQSAPPTAQSSPPPVQASPP---PVQ 374
           PP  S   P  SP+PP    + PP+  P  SPPP  S  PT QS PPP   SPP   P Q
Sbjct: 124 PPPASVPPPRPSPSPPILVRSPPPSVRPIQSPPPPPSDRPT-QSPPPPSPPSPPSERPTQ 182

Query: 375 SAPPPVQ----QSSPPPVSSTPP---PVQSSPPPAPVTPP------PASPPP 491
           S P P      QS PPP   +PP   P QS PPP   T P      P SPPP
Sbjct: 183 SPPSPPSERPTQSPPPPSPPSPPSDRPSQSPPPPPEDTKPQPPRRSPNSPPP 234

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = +3

Query: 240 SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVS 419
           +P  P P +N+PP T  + PPP+ +A  T+ ++PPPV +  PP  SAPPP    +PPP  
Sbjct: 4   TPVQP-PVSNSPPVT--SPPPPLNNA--TSPATPPPVTSPLPP--SAPPP--NRAPPP-- 52

Query: 420 STPPPVQSSPPPAP--VTPPPASPPPAS 497
             PPPV +SPPP      PPP   PP S
Sbjct: 53  --PPPVTTSPPPVANGAPPPPLPKPPES 78

[130][TOP]
>UniRef100_A4HCC8 Putative uncharacterized protein n=1 Tax=Leishmania braziliensis
           RepID=A4HCC8_LEIBR
          Length = 814

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 51/109 (46%), Positives = 56/109 (51%), Gaps = 9/109 (8%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPT-NTPPTTPQASPPPVQSAPPTAQSSPPPVQAS---PP 365
           +A    PPST P A+  PP PP  + PP  P AS PP    PP A   PPP  AS   PP
Sbjct: 327 TAAVASPPSTPPPAASVPPPPPAASLPPPPPAASVPP---PPPAASLPPPPPAASVPPPP 383

Query: 366 PVQSAPPPVQQSS---PPPVSST--PPPVQSSPPPAPVTPPPASPPPAS 497
           P  S PPP   +S   PPP +S   PPP  S PPP P    P  PP AS
Sbjct: 384 PAASLPPPPPAASVPPPPPAASVPPPPPAASVPPPPPAASVPPPPPAAS 432

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 43/117 (36%), Positives = 54/117 (46%), Gaps = 14/117 (11%)
 Frame = +3

Query: 189 VFVSAGAQQPPSTSPNASPAPP-------TPPTNTPPTTPQASPPPVQSAPPTAQSSPPP 347
           +FV  G  Q  + +P  +P P        +PP+  PP      PPP  S PP     PPP
Sbjct: 303 IFVHCGCDQMGAPAPATAPGPAKYTAAVASPPSTPPPAASVPPPPPAASLPP-----PPP 357

Query: 348 VQASPPPVQSA----PPPVQQSSPPPVSST---PPPVQSSPPPAPVTPPPASPPPAS 497
             + PPP  +A    PPP     PPP +++   PPP  S PPP P    P  PP AS
Sbjct: 358 AASVPPPPPAASLPPPPPAASVPPPPPAASLPPPPPAASVPPPPPAASVPPPPPAAS 414

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 45/99 (45%), Positives = 49/99 (49%), Gaps = 8/99 (8%)
 Frame = +3

Query: 216 PPSTS----PNASPAPPTPP-TNTPPTTPQASPPPVQSAPPTAQSSPPPVQAS---PPPV 371
           PP+ S    P A+  PP PP  + PP  P AS PP    PP A   PPP  AS   PPP 
Sbjct: 347 PPAASLPPPPPAASVPPPPPAASLPPPPPAASVPP---PPPAASLPPPPPAASVPPPPPA 403

Query: 372 QSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
            S PPP   +S PP    PPP  S PPP P    P  PP
Sbjct: 404 ASVPPPPPAASVPP----PPPAASVPPPPPAASLPPPPP 438

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 48/117 (41%), Positives = 55/117 (47%), Gaps = 22/117 (18%)
 Frame = +3

Query: 207 AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQAS---PPPVQS 377
           A   P   P AS  PP P  + PP  P AS PP    PP A   PPP  AS   PPP  S
Sbjct: 358 AASVPPPPPAASLPPPPPAASVPPPPPAASLPP---PPPAASVPPPPPAASVPPPPPAAS 414

Query: 378 APPPVQQSS---PPPVSSTPPPVQS-------------SPPPA---PVTPPPASPPP 491
            PPP   +S   PPP +S PPP  +             +PPP+   P TPP A+ PP
Sbjct: 415 VPPPPPAASVPPPPPAASLPPPPPAGAGPLVRSPLLVVAPPPSASVPATPPVAAGPP 471

[131][TOP]
>UniRef100_Q6CCD3 YALI0C10450p n=1 Tax=Yarrowia lipolytica RepID=Q6CCD3_YARLI
          Length = 713

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 47/107 (43%), Positives = 60/107 (56%), Gaps = 9/107 (8%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPAPPTPPTNT-----PPTTPQASPPPVQSAPPTAQSSPPPVQASP 362
           S+    PPST+ +++P PP P T++     PPTT  ++PPP    PPT  S+PPP    P
Sbjct: 457 SSSTPPPPSTTSSSTPPPPPPTTSSSAPPPPPTTSSSAPPP----PPTTSSTPPP----P 508

Query: 363 PPVQSA----PPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
           PP  S+    PPP   S+PPP    PPP  S+ PP P T    SPPP
Sbjct: 509 PPTTSSTPPPPPPTTSSTPPP----PPPTTSTTPPPPPTTSSTSPPP 551

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 52/117 (44%), Positives = 64/117 (54%), Gaps = 19/117 (16%)
 Frame = +3

Query: 198 SAGAQQPPSTS--PNASPAPPTPPTN--TPP---TTPQASPPPVQSAPPTAQSSPPPVQA 356
           S+ +++P S+S  P +SP PP P T+  TPP   TT  ++PPP    PPT  SS PP   
Sbjct: 432 SSSSEEPVSSSEGPTSSPPPPPPTTSSSTPPPPSTTSSSTPPP---PPPTTSSSAPP--- 485

Query: 357 SPPPVQSA----PPPVQQSSPPP----VSSTPPP----VQSSPPPAPVTPPPASPPP 491
            PPP  S+    PPP   S+PPP     SSTPPP      S+PPP P T     PPP
Sbjct: 486 -PPPTTSSSAPPPPPTTSSTPPPPPPTTSSTPPPPPPTTSSTPPPPPPTTSTTPPPP 541

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 47/103 (45%), Positives = 57/103 (55%), Gaps = 9/103 (8%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQAS--PPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PP+TS +A P PPT  ++ PP  P  S  PPP    PPT  S+PPP    PPP  S+ PP
Sbjct: 476 PPTTSSSAPPPPPTTSSSAPPPPPTTSSTPPP---PPPTTSSTPPP----PPPTTSSTPP 528

Query: 390 VQQSSPPPVSST---PPPVQSS----PPPAPVTPPPASPPPAS 497
                PPP +ST   PPP  SS    PPP+    PP+S P +S
Sbjct: 529 ----PPPPTTSTTPPPPPTTSSTSPPPPPSSTYVPPSSSPTSS 567

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 44/122 (36%), Positives = 55/122 (45%), Gaps = 20/122 (16%)
 Frame = +3

Query: 186 AVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQAS-- 359
           A F +AG  +      ++S   P   +  P ++P   PPP    PPT  SS PP  ++  
Sbjct: 416 AGFAAAGQVENLENVESSSSEEPVSSSEGPTSSP---PPP----PPTTSSSTPPPPSTTS 468

Query: 360 ------PPPVQSA----PPPVQQSS----PPPVSSTPPP----VQSSPPPAPVTPPPASP 485
                 PPP  S+    PPP   SS    PP  SSTPPP      S+PPP P T     P
Sbjct: 469 SSTPPPPPPTTSSSAPPPPPTTSSSAPPPPPTTSSTPPPPPPTTSSTPPPPPPTTSSTPP 528

Query: 486 PP 491
           PP
Sbjct: 529 PP 530

[132][TOP]
>UniRef100_Q4A263 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
           RepID=Q4A263_EHV86
          Length = 403

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 45/92 (48%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPP-PVQSAPPTAQSSPPPVQASPPPVQSAPPPV 392
           PP +SP  SP PP+ P + PP++P +SPP P  S PP++  SPPP  +SPP    +PPP 
Sbjct: 144 PPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPP--SSPPSPPPSPPPS 201

Query: 393 QQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
              S PP  S+PP   SSPP +P + PP+SPP
Sbjct: 202 SPPSSPP--SSPP---SSPPSSPPSSPPSSPP 228

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/106 (45%), Positives = 58/106 (54%), Gaps = 2/106 (1%)
 Frame = +3

Query: 177 LICAVF--VSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPV 350
           L C +F  ++  A   P  S   +P PP PP   PP++P  SPPP  S P    SSPP  
Sbjct: 112 LDCCIFPNITGCAPCAPMLSCCLTPPPPPPPP-PPPSSPPPSPPPPSSPPSPPPSSPPSS 170

Query: 351 QASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
             SPPP   +PPP    SPPP SS P P  S PP +P + PP+SPP
Sbjct: 171 PPSPPP---SPPPSSPPSPPP-SSPPSPPPSPPPSSPPSSPPSSPP 212

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 43/91 (47%), Positives = 55/91 (60%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQ 395
           PP   P +SP P  PP ++PP+ P +SPP   S+PP+   SPPP  +SPP    + PP  
Sbjct: 140 PPPPPPPSSPPPSPPPPSSPPSPPPSSPP---SSPPSPPPSPPP--SSPPSPPPSSPPSP 194

Query: 396 QSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
             SPPP SS P    SSPP +P + PP+SPP
Sbjct: 195 PPSPPP-SSPPSSPPSSPPSSPPSSPPSSPP 224

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/102 (46%), Positives = 59/102 (57%)
 Frame = +3

Query: 183 CAVFVSAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASP 362
           CA  +S     PP   P   P P +PP + PP +   SPPP  S+PP++  SPPP   SP
Sbjct: 126 CAPMLSCCLTPPPPPPP--PPPPSSPPPSPPPPSSPPSPPP--SSPPSSPPSPPP---SP 178

Query: 363 PPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPP 488
           PP  S+PP    SSPP    +PPP  SSPP +P + PP+SPP
Sbjct: 179 PP--SSPPSPPPSSPPSPPPSPPP--SSPPSSPPSSPPSSPP 216

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 32/61 (52%), Positives = 37/61 (60%)
 Frame = +3

Query: 315 APPTAQSSPPPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPA 494
           AP  +    PP    PPP  S+PPP    SPPP SS P P  SSPP +P +PPP SPPP+
Sbjct: 127 APMLSCCLTPPPPPPPPPPPSSPPP----SPPPPSSPPSPPPSSPPSSPPSPPP-SPPPS 181

Query: 495 S 497
           S
Sbjct: 182 S 182

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 43/92 (46%), Positives = 55/92 (59%), Gaps = 1/92 (1%)
 Frame = +3

Query: 198 SAGAQQPPSTSPNASPA-PPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           S+    PPS  P+  P+ PP+PP ++PP+ P  SPPP  S+PP   SSPP   +SPP   
Sbjct: 165 SSPPSSPPSPPPSPPPSSPPSPPPSSPPSPP-PSPPP--SSPP---SSPP---SSPP--- 212

Query: 375 SAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTP 470
           S+PP    SSPP   S+PP   SSPP  P+ P
Sbjct: 213 SSPP----SSPP---SSPP---SSPPSPPLQP 234

[133][TOP]
>UniRef100_Q212G2 Peptidase C14, caspase catalytic subunit p20 n=1 Tax=Rhodopseudomonas
            palustris BisB18 RepID=Q212G2_RHOPB
          Length = 1026

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/113 (44%), Positives = 59/113 (52%), Gaps = 16/113 (14%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAPPTPPT-----NTPPTTPQASPPP--VQSAPPTA----QSSPPP-- 347
            A+  P+  P   PAPP PP        PP   QA PPP  V+ APP      Q+ PPP  
Sbjct: 900  ARPAPAAPPVVRPAPPPPPVVRQAPPPPPVVRQAPPPPPVVRQAPPPPPVVHQAPPPPPV 959

Query: 348  VQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPVTPP---PASPPPAS 497
            V+ +PPP    PPPV + +PPP    PPPV   PPP P  P    PA PPPA+
Sbjct: 960  VRQAPPPPPPPPPPVVRPAPPPPPPPPPPVMRPPPPPPPPPAAARPAPPPPAA 1012

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 51/106 (48%), Positives = 56/106 (52%), Gaps = 14/106 (13%)
 Frame = +3

Query: 216  PPSTSPNASPAPPTPPT-----NTPPTTPQASPPP--VQSAPPTAQSSPPPV--QASPPP 368
            PP   P A PAP  PP        PP   QA PPP  V+ APP     PPPV  QA PPP
Sbjct: 893  PPPPPPAARPAPAAPPVVRPAPPPPPVVRQAPPPPPVVRQAPP-----PPPVVRQAPPPP 947

Query: 369  --VQSAPPP---VQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPP 491
              V  APPP   V+Q+ PPP    PP V+ +PPP P  PPP   PP
Sbjct: 948  PVVHQAPPPPPVVRQAPPPPPPPPPPVVRPAPPPPPPPPPPVMRPP 993

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/124 (41%), Positives = 61/124 (49%), Gaps = 29/124 (23%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAPPTPPTNTPPTTP--------QASPPPVQSAPP-------TAQSSP 341
            A   P   P A+  P  PP   PP TP         A PP V+ APP        A ++P
Sbjct: 848  AAPAPVPPPPAAGRPTPPPAAAPPATPTPPAVRPAPAPPPVVRPAPPPPPPAARPAPAAP 907

Query: 342  PPVQASPPP---VQSAPPP---VQQSSPPP--VSSTPPP---VQSSPPPAPV---TPPPA 479
            P V+ +PPP   V+ APPP   V+Q+ PPP  V   PPP   V  +PPP PV    PPP 
Sbjct: 908  PVVRPAPPPPPVVRQAPPPPPVVRQAPPPPPVVRQAPPPPPVVHQAPPPPPVVRQAPPPP 967

Query: 480  SPPP 491
             PPP
Sbjct: 968  PPPP 971

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 43/119 (36%), Positives = 56/119 (47%), Gaps = 21/119 (17%)
 Frame = +3

Query: 204  GAQQPPSTSPNASPAPPTPPTNTPPTTPQASP-----PPVQSAPPTAQSSP--------- 341
            GA  PP   P    APP+P    P T P A+P     PP  +A P +Q+ P         
Sbjct: 756  GAPTPPGGKPGTPGAPPSPAAGAPTTAPAATPGGPTPPPAPNAKPASQALPGSNGQPLPP 815

Query: 342  --PPVQASPPPVQSAPPPVQQSSPPPVSSTPPPVQSSPPPAPV-----TPPPASPPPAS 497
              PP  A+PP   + PP     +PPP ++ P P   +P P P      TPPPA+ PPA+
Sbjct: 816  AAPPSPATPPSA-AKPPATVAPTPPPAAARPQPAAPAPVPPPPAAGRPTPPPAAAPPAT 873

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 43/101 (42%), Positives = 51/101 (50%), Gaps = 3/101 (2%)
 Frame = +3

Query: 198  SAGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS 377
            +AG   PP  +  A PA PTPP   P   P   PP V+ APP    +  P  A+PP V+ 
Sbjct: 858  AAGRPTPPPAA--APPATPTPPAVRPAPAP---PPVVRPAPPPPPPAARPAPAAPPVVRP 912

Query: 378  APPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPPASPPP 491
            APPP     PP V   PPP   V+ +PPP PV      PPP
Sbjct: 913  APPP-----PPVVRQAPPPPPVVRQAPPPPPVVRQAPPPPP 948

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 38/91 (41%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +3

Query: 231  PNASPAPPTPPTNT-PPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPPVQQSSP 407
            P A P+P TPP+   PP T   +PPP  + P  A  +P P    PPP    P P   ++ 
Sbjct: 815  PAAPPSPATPPSAAKPPATVAPTPPPAAARPQPAAPAPVP----PPPAAGRPTP-PPAAA 869

Query: 408  PPVSSTPPPVQSSPPPAPVT-PPPASPPPAS 497
            PP + TPP V+ +P P PV  P P  PPPA+
Sbjct: 870  PPATPTPPAVRPAPAPPPVVRPAPPPPPPAA 900

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 48/125 (38%), Positives = 57/125 (45%), Gaps = 27/125 (21%)
 Frame = +3

Query: 198  SAGAQQPPSTSPNASPAPPTPP--------------TNTPPTTPQASP----PPVQSAPP 323
            +AGA   P+T+P A+P  PTPP              +N  P  P A P    PP  + PP
Sbjct: 775  AAGA---PTTAPAATPGGPTPPPAPNAKPASQALPGSNGQPLPPAAPPSPATPPSAAKPP 831

Query: 324  -TAQSSPPPVQASPPPVQSAP--PPVQQSSPPPVSSTPPPVQSSPP---PAPVTPP---P 476
             T   +PPP  A P P   AP  PP     P P  +  PP   +PP   PAP  PP   P
Sbjct: 832  ATVAPTPPPAAARPQPAAPAPVPPPPAAGRPTPPPAAAPPATPTPPAVRPAPAPPPVVRP 891

Query: 477  ASPPP 491
            A PPP
Sbjct: 892  APPPP 896

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 46/104 (44%), Positives = 51/104 (49%), Gaps = 11/104 (10%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPPTPPT-----NTPPTTPQASPPP--VQSAPPTAQSSPPPV-QASPP 365
            +Q P   P    APP PP        PP   QA PPP  V+ APP     PPPV + +PP
Sbjct: 921  RQAPPPPPVVRQAPPPPPVVRQAPPPPPVVHQAPPPPPVVRQAPPPPPPPPPPVVRPAPP 980

Query: 366  PVQSAPPPVQQSSPPPVSSTPPPVQSSPPPA---PVTPPPASPP 488
            P    PPPV    PPP    PPP    PPPA   P  PPPA+ P
Sbjct: 981  PPPPPPPPV--MRPPP----PPP----PPPAAARPAPPPPAAKP 1014

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 42/110 (38%), Positives = 50/110 (45%), Gaps = 12/110 (10%)
 Frame = +3

Query: 198  SAGAQQPPST--SPNASPAPPTPPTNTPPTTPQASPPPVQSAP-----PTAQSSPPPVQA 356
            S G   PP+   SP   P+   PP    PT P A+  P  +AP     P A   P P  A
Sbjct: 808  SNGQPLPPAAPPSPATPPSAAKPPATVAPTPPPAAARPQPAAPAPVPPPPAAGRPTPPPA 867

Query: 357  SPPPVQSAPPPVQQSSPPP--VSSTPPPVQSSPPPAPVTPP---PASPPP 491
            + PP    PP V+ +  PP  V   PPP   +  PAP  PP   PA PPP
Sbjct: 868  AAPPATPTPPAVRPAPAPPPVVRPAPPPPPPAARPAPAAPPVVRPAPPPP 917

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 39/96 (40%), Positives = 44/96 (45%), Gaps = 2/96 (2%)
 Frame = +3

Query: 210  QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
            +Q P   P    APP      PP   QA PPP    PP  + +PPP    PPPV   PPP
Sbjct: 941  RQAPPPPPVVHQAPP-----PPPVVRQAPPPPPPPPPPVVRPAPPPPPPPPPPVMRPPPP 995

Query: 390  VQQSSPPPVSSTPPPVQSSPPPA--PVTPPPASPPP 491
                 PPP ++ P P    PPPA  P T P   P P
Sbjct: 996  ---PPPPPAAARPAP----PPPAAKPCTLPNGQPCP 1024

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 38/102 (37%), Positives = 50/102 (49%), Gaps = 7/102 (6%)
 Frame = +3

Query: 207  AQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPP 386
            A  PP  +    PA P P    PP   + +PPP  +A P A  +PP V+ +P     APP
Sbjct: 835  APTPPPAAARPQPAAPAP-VPPPPAAGRPTPPP--AAAPPATPTPPAVRPAP-----APP 886

Query: 387  PVQQSSPP-------PVSSTPPPVQSSPPPAPVTPPPASPPP 491
            PV + +PP       P  + PP V+ +PPP PV      PPP
Sbjct: 887  PVVRPAPPPPPPAARPAPAAPPVVRPAPPPPPVVRQAPPPPP 928

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 41/109 (37%), Positives = 49/109 (44%), Gaps = 11/109 (10%)
 Frame = +3

Query: 204  GAQQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSS------PPPVQASPP 365
            GA  P +      P  PTPP   P T P A P P   AP TA ++      PPP   + P
Sbjct: 742  GAPAPGTPPAAGKPGAPTPPGGKPGT-PGAPPSPAAGAPTTAPAATPGGPTPPPAPNAKP 800

Query: 366  PVQSAPPPVQQSSPP--PVSSTPPPVQSSPPP--APVTPPPAS-PPPAS 497
              Q+ P    Q  PP  P S   PP  + PP   AP  PP A+ P PA+
Sbjct: 801  ASQALPGSNGQPLPPAAPPSPATPPSAAKPPATVAPTPPPAAARPQPAA 849

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 44/157 (28%), Positives = 54/157 (34%), Gaps = 59/157 (37%)
 Frame = +3

Query: 204  GAQQPPSTSPNASPAPPTPPTNTPP---TTPQASP-----PPVQSAPPTAQSSP------ 341
            GA   P   P    APP+P   TPP   T P A+P     PP  +A P  Q+ P      
Sbjct: 677  GAPTLPGAKPGTPGAPPSPAAGTPPGATTAPAATPGGPTPPPAPNAKPATQALPGSNGQP 736

Query: 342  ------------PPVQASP---------PPVQSAPP------PVQQSSPPPVSSTPPPVQ 440
                        PP    P         P    APP      P    +  P   TPPP  
Sbjct: 737  LPAIPGAPAPGTPPAAGKPGAPTPPGGKPGTPGAPPSPAAGAPTTAPAATPGGPTPPPAP 796

Query: 441  S------------------SPPPAPVTPPPASPPPAS 497
            +                  + PP+P TPP A+ PPA+
Sbjct: 797  NAKPASQALPGSNGQPLPPAAPPSPATPPSAAKPPAT 833

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 35/114 (30%), Positives = 48/114 (42%), Gaps = 15/114 (13%)
 Frame = +3

Query: 201 AGAQQPPSTSPNASPAPPTPPTNTPPTTPQASPP----------PVQSAPPTAQSSPPPV 350
           +G   PP+    A+PA  TP   TPP+TP A P           P+ + P       PP 
Sbjct: 614 SGPLPPPAAGAPATPAV-TPGGPTPPSTPTAKPTSQALPGSNGQPLPAVPGAPTPGTPPA 672

Query: 351 QASP--PPVQSAPPPVQQSSPPPVSSTPPPVQSSP---PPAPVTPPPASPPPAS 497
              P  P +  A P    + P P + TPP   ++P   P  P  PP  +  PA+
Sbjct: 673 AGKPGAPTLPGAKPGTPGAPPSPAAGTPPGATTAPAATPGGPTPPPAPNAKPAT 726

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 38/123 (30%), Positives = 47/123 (38%), Gaps = 23/123 (18%)
 Frame = +3

Query: 195 VSAGAQQPPST-----------SPNASPAPPTPPTNTPPTTPQASPPPVQSAP---PTAQ 332
           V+ G   PPST             N  P P  P   TP T P A  P   + P   P   
Sbjct: 630 VTPGGPTPPSTPTAKPTSQALPGSNGQPLPAVPGAPTPGTPPAAGKPGAPTLPGAKPGTP 689

Query: 333 SSPP-PVQASPPPVQSAPPPVQQS-SPPPVSSTPPPVQSSP-------PPAPVTPPPASP 485
            +PP P   +PP   +AP       +PPP  +  P  Q+ P       P  P  P P +P
Sbjct: 690 GAPPSPAAGTPPGATTAPAATPGGPTPPPAPNAKPATQALPGSNGQPLPAIPGAPAPGTP 749

Query: 486 PPA 494
           P A
Sbjct: 750 PAA 752

[134][TOP]
>UniRef100_Q43682 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q43682_VIGUN
          Length = 280

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 47/103 (45%), Positives = 56/103 (54%), Gaps = 9/103 (8%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPPPVQSA 380
           + PP  SP  SP PP    + PP +P   PP V  +PP    SPPP    ++ PPP  S 
Sbjct: 29  KSPPPPSP--SPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSP 86

Query: 381 PPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPP 491
           PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP
Sbjct: 87  PPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPP 129

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/114 (42%), Positives = 60/114 (52%), Gaps = 18/114 (15%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPP-----VQSAPPTAQSSPPPV--Q 353
           + PP  SP+  P     +PP P  + PP     SPPP      +S PP + S PPP   +
Sbjct: 93  KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYK 152

Query: 354 ASPPPVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           + PPP  S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 153 SPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPS 206

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/116 (41%), Positives = 57/116 (49%), Gaps = 20/116 (17%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP-------------- 347
           + PP  SP  SP PP    + PP +P   PP V  +PP    SPPP              
Sbjct: 77  KSPPPPSP--SPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPPPYV 134

Query: 348 VQASPPPVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
            ++ PPP  S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 135 YKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPS 190

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 50/114 (43%), Positives = 59/114 (51%), Gaps = 18/114 (15%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPT--AQSSPPPVQASPPP 368
           + PP  SP+  P     +PP P  + PP     SPPP   +PP      SPPP   SPPP
Sbjct: 61  KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPP 120

Query: 369 --VQSAPPP----VQQSSPPPVSSTPPP--VQSSPPPAPVTPPP---ASPPPAS 497
             V  +PPP    V +S PPP  S PPP   +S PPP+P  PPP    SPPP S
Sbjct: 121 PYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS 174

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 49/119 (41%), Positives = 60/119 (50%), Gaps = 23/119 (19%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPV----------QSAPPTAQSSPP 344
           + PP  SP+  P     +PP P  + PP     SPPP           +S PP + S PP
Sbjct: 136 KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPP 195

Query: 345 P--VQASPPPVQSAPPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP---ASPPPAS 497
           P   ++ PPP  S PPP    SPPP S +PPP    +S PPP+P  PPP    SPPP S
Sbjct: 196 PYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS 254

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 43/95 (45%), Positives = 52/95 (54%), Gaps = 6/95 (6%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP---VQASPPPVQSA 380
           + PP  SP  SP PP    + PP +P   PP V  +PP    SPPP    ++ PPP  S 
Sbjct: 184 KSPPPPSP--SPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSP 241

Query: 381 PPPVQQSSPPPVSSTPPP---VQSSPPPAPVTPPP 476
           PPP    SPPP S +PPP    +S PPP+P  PPP
Sbjct: 242 PPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPP 276

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 48/108 (44%), Positives = 57/108 (52%), Gaps = 12/108 (11%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           + PP  SP+  P     +PP P  + PP     SPPP   +PP     PP V  SPPP  
Sbjct: 13  KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPP-----PPYVYKSPPPPS 67

Query: 375 SAPPP--VQQSSPPPVSSTPPP--VQSSPPPAPVTPPP---ASPPPAS 497
            +PPP  V +S PPP  S PPP   +S PPP+P  PPP    SPPP S
Sbjct: 68  PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS 115

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 48/108 (44%), Positives = 57/108 (52%), Gaps = 12/108 (11%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQ 374
           + PP  SP+  P     +PP P  + PP     SPPP   +PP     PP V  SPPP  
Sbjct: 168 KSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPP-----PPYVYKSPPPPS 222

Query: 375 SAPPP--VQQSSPPPVSSTPPP--VQSSPPPAPVTPPP---ASPPPAS 497
            +PPP  V +S PPP  S PPP   +S PPP+P  PPP    SPPP S
Sbjct: 223 PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS 270

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 49/114 (42%), Positives = 58/114 (50%), Gaps = 18/114 (15%)
 Frame = +3

Query: 210 QQPPSTSPNASP-----APPTPPTNTPPTTPQASPPPVQSAPPT--AQSSPPPVQASPPP 368
           + PP  SP+  P     +PP P  + PP     SPPP   +PP      SPPP   SPPP
Sbjct: 45  KSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPP 104

Query: 369 --VQSAPPPVQQSSPPP-VSSTPPP-----VQSSPPPAPVTPPP---ASPPPAS 497
             V  +PPP   S PPP V  +PPP      +S PPP+P  PPP    SPPP S
Sbjct: 105 PYVYKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS 158

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 44/101 (43%), Positives = 52/101 (51%), Gaps = 7/101 (6%)
 Frame = +3

Query: 210 QQPPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPT--AQSSPPPVQASPPP--VQS 377
           + PP   P    +PP P  + PP     SPPP   +PP      SPPP   SPPP  +  
Sbjct: 125 KSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYK 184

Query: 378 APPPVQQSSPPP-VSSTPPPVQSSPPPAPV--TPPPASPPP 491
           +PPP   S PPP V  +PPP   SPPP  V  +PPP SP P
Sbjct: 185 SPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSP 225

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 49/103 (47%), Positives = 56/103 (54%), Gaps = 11/103 (10%)
 Frame = +3

Query: 216 PPSTSPNA-----SPAPPTPPTNTPPTTPQASPPPVQSAPPT-AQSSPPPVQASPPP--V 371
           PPS SP       SP PP+P +  PP   ++ PPP  S PP     SPPP   SPPP  V
Sbjct: 1   PPSPSPPPPYVYKSPPPPSP-SPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYV 59

Query: 372 QSAPPPVQQSSPPP-VSSTPPPVQSSPPPAPV--TPPPASPPP 491
             +PPP   S PPP V  +PPP   SPPP  V  +PPP SP P
Sbjct: 60  YKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSP 102

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/102 (46%), Positives = 51/102 (50%), Gaps = 10/102 (9%)
 Frame = +3

Query: 216 PPSTSPNA-----SPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPPVQASPPP--VQ 374
           PPS SP       SP PP P     P  P  SPPP     P    SPPP   SPPP  V 
Sbjct: 113 PPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPP-----PYVYKSPPPPSPSPPPPYVY 167

Query: 375 SAPPPVQQSSPPP-VSSTPPPVQSSPPPAPV--TPPPASPPP 491
            +PPP   S PPP +  +PPP   SPPP  V  +PPP SP P
Sbjct: 168 KSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSP 209

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 38/86 (44%), Positives = 43/86 (50%), Gaps = 15/86 (17%)
 Frame = +3

Query: 285 PQASPPPVQSAPPTAQSSPPPVQASPPPV---------QSAPPPVQQSSPPPVSSTPPP- 434
           P  SPPP    P   +S PPP  + PPP           S PPP    SPPP S +PPP 
Sbjct: 2   PSPSPPP----PYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPP 57

Query: 435 --VQSSPPPAPVTPPP---ASPPPAS 497
              +S PPP+P  PPP    SPPP S
Sbjct: 58  YVYKSPPPPSPSPPPPYVYKSPPPPS 83

[135][TOP]
>UniRef100_C5XK46 Putative uncharacterized protein Sb03g034710 n=1 Tax=Sorghum
           bicolor RepID=C5XK46_SORBI
          Length = 731

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 51/116 (43%), Positives = 57/116 (49%), Gaps = 24/116 (20%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAPPTAQSSPPP----------VQASPP 365
           P    P  SP PPTP    P  TP   PPP  S PP    SPPP          + ASPP
Sbjct: 57  PAPVPPTPSPIPPTPAPVPPTPTPSPPPPPSPSPPPPVTPSPPPPASVPTPSPTLPASPP 116

Query: 366 PVQSAP---PPVQQSSPPPVS----STPPPVQSSPPPA--PVTPP-----PASPPP 491
           P  S P   PP+  S PPP S    S PPPV+  PPP+  P +PP     P+SPPP
Sbjct: 117 PPASVPTPSPPLPASPPPPASVPTPSPPPPVRRPPPPSSVPASPPPPDSVPSSPPP 172

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 46/100 (46%), Positives = 53/100 (53%), Gaps = 6/100 (6%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP----PTNTP-PTTPQASPPPVQSAPPTAQSSPP-PVQASPPPVQS 377
           P  + P+ +P PPTP    PT  P P TP   PP     PPT    PP P    P P  S
Sbjct: 22  PTPSPPSPAPVPPTPSPQPPTPAPVPPTPSTIPPTPAPVPPTPSPIPPTPAPVPPTPTPS 81

Query: 378 APPPVQQSSPPPVSSTPPPVQSSPPPAPVTPPPASPPPAS 497
            PPP   S PPPV+ +PPP  S P P+P T P + PPPAS
Sbjct: 82  PPPPPSPSPPPPVTPSPPPPASVPTPSP-TLPASPPPPAS 120

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 47/102 (46%), Positives = 55/102 (53%), Gaps = 10/102 (9%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTP----PTNTP-PTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQS- 377
           P +  P  +P PPTP    PT  P P TP  SPPP     P + S PPPV  SPPP  S 
Sbjct: 50  PSTIPPTPAPVPPTPSPIPPTPAPVPPTPTPSPPP-----PPSPSPPPPVTPSPPPPASV 104

Query: 378 -APPPVQQSSPPPVSSTP---PPVQSSPPPAPVTPPPASPPP 491
             P P   +SPPP +S P   PP+ +SPPP    P P+ PPP
Sbjct: 105 PTPSPTLPASPPPPASVPTPSPPLPASPPPPASVPTPSPPPP 146

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 50/112 (44%), Positives = 55/112 (49%), Gaps = 17/112 (15%)
 Frame = +3

Query: 207 AQQPPSTSPNA---SPAPPTPPTNTP-----PTTPQASPPPVQSAPPTAQSSPPPVQASP 362
           A  PP+ SP     +P PPTP T  P     P TP   PP     PPT   SPPP     
Sbjct: 30  APVPPTPSPQPPTPAPVPPTPSTIPPTPAPVPPTPSPIPPTPAPVPPTPTPSPPP----- 84

Query: 363 PPVQSAPPPVQQSSPPPVS---------STPPPVQSSPPPAPVTPPPASPPP 491
           PP  S PPPV  S PPP S         ++PPP  S P P+P  P PASPPP
Sbjct: 85  PPSPSPPPPVTPSPPPPASVPTPSPTLPASPPPPASVPTPSP--PLPASPPP 134

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/115 (40%), Positives = 59/115 (51%), Gaps = 22/115 (19%)
 Frame = +3

Query: 216 PPSTSPNASPAPPTPPTNTPPTTPQASPPPVQSAP---PTAQSSPPP----------VQA 356
           P    P  +P+PP PP+ +PP     SPPP  S P   PT  +SPPP          + A
Sbjct: 71  PAPVPPTPTPSPPPPPSPSPPPPVTPSPPPPASVPTPSPTLPASPPPPASVPTPSPPLPA 130

Query: 357 SPPP-----VQSAPPPVQQSSPPP-VSSTPPP---VQSSPPPAPVTPPPASPPPA 494
           SPPP       S PPPV++  PP  V ++PPP   V SSPPP    P   +PPP+
Sbjct: 131 SPPPPASVPTPSPPPPVRRPPPPSSVPASPPPPDSVPSSPPPPNGVPASPAPPPS 185

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 46/101 (45%), Positives = 55/101 (54%), Gaps = 8/101 (7%)
 Frame = +3

Query: 219 PSTSPNASPAPPTPPTNTP---PTTPQASPPPVQSAPPTAQSSPPPVQASPPPVQSAPPP 389
           PS  P  +P+PP PP + P   PT P + PPP     P+     PP+ ASPPP  S P P
Sbjct: 88  PSPPPPVTPSPP-PPASVPTPSPTLPASPPPPASVPTPS-----PPLPASPPPPASVPTP 141

Query: 390 VQQSSPPPVSSTPPP--VQSSPPP---APVTPPPASPPPAS 497
              S PPPV   PPP  V +SPPP    P +PPP +  PAS
Sbjc