BB936923 ( RCC09932 )

[UP]


[1][TOP]
>UniRef100_P08297 Early nodulin-75 n=1 Tax=Glycine max RepID=NO75_SOYBN
          Length = 309

 Score =  276 bits (707), Expect = 4e-73
 Identities = 119/174 (68%), Positives = 130/174 (74%), Gaps = 16/174 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEK-----PPHEHSP 165
           P +  PP+E PPPEY PPHEKPPPEYQPPH K PH NPPP++QPPHEK     PPHE  P
Sbjct: 75  PEYLPPPHEKPPPEYLPPHEKPPPEYQPPHEKPPHENPPPEHQPPHEKPPEHQPPHEKPP 134

Query: 166 PGYQPPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEK-----PP 312
           P Y+PPHE PPPE+QPPHEK      PPH K PPEYQPPHE PPPE+ PPHEK     PP
Sbjct: 135 PEYEPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEHQPPHEKPPEHQPP 194

Query: 313 HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           HE PPPEY PPHEKPP     PEYQPP +KPPHE PPP++QPP+EKPP E  PP
Sbjct: 195 HEKPPPEYQPPHEKPP-----PEYQPPQEKPPHEKPPPEYQPPHEKPPPEHQPP 243

 Score =  263 bits (673), Expect = 3e-69
 Identities = 117/180 (65%), Positives = 127/180 (70%), Gaps = 22/180 (12%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P +  PP  +PPPEYQPPHEK PPEY PP    PH  PPP+Y PPHEKPP E+ PP  +P
Sbjct: 52  PPYYPPPVHHPPPEYQPPHEKTPPEYLPP----PHEKPPPEYLPPHEKPPPEYQPPHEKP 107

Query: 181 PHEIPPPEHQPPHEK-----PPHAKSPPEYQPPHEHPPPEYLPPHEK------PPHENPP 327
           PHE PPPEHQPPHEK     PPH K PPEY+PPHE PPPEY PPHEK      PPHE PP
Sbjct: 108 PHENPPPEHQPPHEKPPEHQPPHEKPPPEYEPPHEKPPPEYQPPHEKPPPEYQPPHEKPP 167

Query: 328 PEYNPPHEKPPHEH-----PSPEYQPPHQK------PPHENPPPKFQPPNEKPPHEKSPP 474
           PEY PPHEKPP EH       PE+QPPH+K      PPHE PPP++QPP EKPPHEK PP
Sbjct: 168 PEYQPPHEKPPPEHQPPHEKPPEHQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPHEKPPP 227

 Score =  261 bits (666), Expect = 2e-68
 Identities = 120/182 (65%), Positives = 127/182 (69%), Gaps = 25/182 (13%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQP------HVNPPPQYQPPHEKPP---- 150
           P H KPP+ENPPPE+QPPHEKPP E+QPPH K P      H  PPP+YQPPHEKPP    
Sbjct: 102 PPHEKPPHENPPPEHQPPHEKPP-EHQPPHEKPPPEYEPPHEKPPPEYQPPHEKPPPEYQ 160

Query: 151 --HEHSPPGYQPPHEIPPPEHQPPHEK-----PPHAKSPPEYQPPHEHPPPEYLPPHEKP 309
             HE  PP YQPPHE PPPEHQPPHEK     PPH K PPEYQPPHE PPPEY PP EKP
Sbjct: 161 PPHEKPPPEYQPPHEKPPPEHQPPHEKPPEHQPPHEKPPPEYQPPHEKPPPEYQPPQEKP 220

Query: 310 PHENPPPEYNPPHEKPPHEHPSP-EYQPPHQKPPHENPPPKFQPPNEK-------PPHEK 465
           PHE PPPEY PPHEKPP EH  P E  PP   PP+E PPP ++PP EK       PPHEK
Sbjct: 221 PHEKPPPEYQPPHEKPPPEHQPPHEKPPPVYPPPYEKPPPVYEPPYEKPPPVVYPPPHEK 280

Query: 466 SP 471
            P
Sbjct: 281 PP 282

 Score =  238 bits (608), Expect = 1e-61
 Identities = 108/177 (61%), Positives = 121/177 (68%), Gaps = 18/177 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQP------HVNPPPQYQPPHEK-----P 147
           P   +PP+E PPPEYQPPHEKPPPEYQPPH K P      H  PPP++QPPHEK     P
Sbjct: 134 PPEYEPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEHQPPHEKPPEHQP 193

Query: 148 PHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEK------P 309
           PHE  PP YQPPHE PPPE+QPP EKPPH K PPEYQPPHE PPPE+ PPHEK      P
Sbjct: 194 PHEKPPPEYQPPHEKPPPEYQPPQEKPPHEKPPPEYQPPHEKPPPEHQPPHEKPPPVYPP 253

Query: 310 PHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP-NEKPPHEKSPPA 477
           P+E PPP Y PP+EKP    P   Y PPH+KPP   PPP  +PP    PP+ + PP+
Sbjct: 254 PYEKPPPVYEPPYEKP----PPVVYPPPHEKPPIYEPPPLEKPPVYNPPPYGRYPPS 306

 Score =  197 bits (502), Expect = 2e-49
 Identities = 92/156 (58%), Positives = 104/156 (66%), Gaps = 12/156 (7%)
 Frame = +1

Query: 43  YQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHS-PPGYQPPHEIPPPEHQPPH 219
           Y+PP  + PP Y+PP          P Y+PP+  PP  H  PP YQPPHE  PPE+ P  
Sbjct: 33  YEPPPIEKPPTYEPP----------PFYKPPYYPPPVHH-PPPEYQPPHEKTPPEYLP-- 79

Query: 220 EKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK-----PPHEHPSPEY 384
             PPH K PPEY PPHE PPPEY PPHEKPPHENPPPE+ PPHEK     PPHE P PEY
Sbjct: 80  --PPHEKPPPEYLPPHEKPPPEYQPPHEKPPHENPPPEHQPPHEKPPEHQPPHEKPPPEY 137

Query: 385 QPPHQK------PPHENPPPKFQPPNEKPPHEKSPP 474
           +PPH+K      PPHE PPP++QPP+EKPP E  PP
Sbjct: 138 EPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPP 173

[2][TOP]
>UniRef100_Q41402 Nodulin n=1 Tax=Sesbania rostrata RepID=Q41402_SESRO
          Length = 330

 Score =  245 bits (625), Expect = 1e-63
 Identities = 113/169 (66%), Positives = 121/169 (71%), Gaps = 16/169 (9%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPP------HEHSPPGYQ 177
           PPYE PPPEYQPPHEKPPPEYQPPH      NPPP+YQPPHEKPP      HE  PP YQ
Sbjct: 92  PPYEKPPPEYQPPHEKPPPEYQPPHE-----NPPPEYQPPHEKPPPEYQPPHEKPPPEYQ 146

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP-EYNPPHEK 354
           PPHE PPPE+QPPHEKP     PPEYQPP E PPP Y PP+EKPPHE PP  E  PP+EK
Sbjct: 147 PPHEKPPPEYQPPHEKP-----PPEYQPPQEKPPPVYPPPYEKPPHEKPPSYEKPPPYEK 201

Query: 355 PPHEHPSPEYQPPHQKPPHENP---------PPKFQPPNEKPPHEKSPP 474
           PPHE P P  +PPH+KPPHE P         PP  +PP+EKPPHEK PP
Sbjct: 202 PPHEKP-PYEKPPHEKPPHEKPPYDKPPYEKPPHEKPPHEKPPHEKPPP 249

 Score =  243 bits (619), Expect = 6e-63
 Identities = 110/175 (62%), Positives = 121/175 (69%), Gaps = 17/175 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQP------HVNPPPQYQPPHEKPPHEHS 162
           P   +PP+ENPPPEYQPPHEKPPPEYQPPH K P      H  PPP+YQPPHEKPP E+ 
Sbjct: 109 PPEYQPPHENPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQ 168

Query: 163 PPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQ-PPHEHPPPEYLPPHEKPPHENP----- 324
           PP  +PP   PPP  +PPHEKPP  + PP Y+ PPHE PP E  PPHEKPPHE P     
Sbjct: 169 PPQEKPPPVYPPPYEKPPHEKPPSYEKPPPYEKPPHEKPPYE-KPPHEKPPHEKPPYDKP 227

Query: 325 ----PPEYNPPHEKPPHEHPSPEYQPPHQKPPHE-NPPPKFQPPNEKPPHEKSPP 474
               PP   PPHEKPPHE P PEY+PPH+KPP E  PP +  PP EKPPHEK PP
Sbjct: 228 PYEKPPHEKPPHEKPPHEKPPPEYKPPHEKPPPEYKPPHEKPPPYEKPPHEKPPP 282

 Score =  239 bits (609), Expect = 9e-62
 Identities = 109/166 (65%), Positives = 120/166 (72%), Gaps = 14/166 (8%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-KPPHEHSPPGYQPPHEI 192
           PPYE PPP Y PP+EKPPP Y PP+ K P V PPP  +PP E +PPHE  PP YQPPHE 
Sbjct: 59  PPYEKPPPVYSPPYEKPPPVYPPPYEKPPPVYPPPYEKPPPEYQPPHEKPPPEYQPPHEN 118

Query: 193 PPPEHQPPHEKPP------HAKSPPEYQPPHEHPPPEYLPPHEK------PPHENPPPEY 336
           PPPE+QPPHEKPP      H K PPEYQPPHE PPPEY PPHEK      PP E PPP Y
Sbjct: 119 PPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPPVY 178

Query: 337 NPPHEKPPHEH-PSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
            PP+EKPPHE  PS E  PP++KPPHE PP + +PP+EKPPHEK P
Sbjct: 179 PPPYEKPPHEKPPSYEKPPPYEKPPHEKPPYE-KPPHEKPPHEKPP 223

 Score =  231 bits (588), Expect = 2e-59
 Identities = 104/174 (59%), Positives = 120/174 (68%), Gaps = 16/174 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P   +PP+E PPPEYQPPHEKPPPEYQPPH K     PPP+YQPP EKPP  + PP  +P
Sbjct: 131 PPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEK-----PPPEYQPPQEKPPPVYPPPYEKP 185

Query: 181 PH------EIPPPEHQPPHEKPPHAKSPPEYQPPHEHP---------PPEYLPPHEKPPH 315
           PH      E PPP  +PPHEKPP+ K PP  +PPHE P         PP   PPHEKPPH
Sbjct: 186 PHEKPPSYEKPPPYEKPPHEKPPYEK-PPHEKPPHEKPPYDKPPYEKPPHEKPPHEKPPH 244

Query: 316 ENPPPEYNPPHEKPPHEHPSP-EYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           E PPPEY PPHEKPP E+  P E  PP++KPPHE PPP+++PP+EKPP  + PP
Sbjct: 245 EKPPPEYKPPHEKPPPEYKPPHEKPPPYEKPPHEKPPPEYKPPHEKPPPPEYPP 298

 Score =  223 bits (567), Expect = 7e-57
 Identities = 102/184 (55%), Positives = 115/184 (62%), Gaps = 26/184 (14%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ- 177
           P   +PP+E PPPEYQPPHEKPPPEYQPP  K P V PPP  +PPHEKPP    PP Y+ 
Sbjct: 142 PPEYQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPPVYPPPYEKPPHEKPPSYEKPPPYEK 201

Query: 178 ---------------PPHEIPP---------PEHQPPHEKPPHAKSPPEYQPPHEHPPPE 285
                          PPHE PP         P  +PPHEKPPH K PPEY+PPHE PPPE
Sbjct: 202 PPHEKPPYEKPPHEKPPHEKPPYDKPPYEKPPHEKPPHEKPPHEKPPPEYKPPHEKPPPE 261

Query: 286 YLPPHEKPP-HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHE 462
           Y PPHEKPP +E PP E  PP  KPPHE P     PP + PP+  PPP+++PP+EKPP  
Sbjct: 262 YKPPHEKPPPYEKPPHEKPPPEYKPPHEKP-----PPPEYPPYVKPPPEYKPPHEKPPGY 316

Query: 463 KSPP 474
             PP
Sbjct: 317 NPPP 320

 Score =  221 bits (563), Expect = 2e-56
 Identities = 104/183 (56%), Positives = 119/183 (65%), Gaps = 27/183 (14%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPP--HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPP------HEH 159
           ++ +PP    PP Y+PP  +EKPPP Y+PP    P+  PPP Y PP+EKPP      +E 
Sbjct: 26  NYYEPPPIEKPPTYEPPPTYEKPPPVYKPPIFPPPYEKPPPVYSPPYEKPPPVYPPPYEK 85

Query: 160 SPPGYQPPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEK----- 306
            PP Y PP+E PPPE+QPPHEK      PPH   PPEYQPPHE PPPEY PPHEK     
Sbjct: 86  PPPVYPPPYEKPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPPEYQPPHEKPPPEY 145

Query: 307 -PPHENPPPEYNPPHEKPPHEH------PSPEYQPPHQKPPHENPPP-KFQPPNEKPPHE 462
            PPHE PPPEY PPHEKPP E+      P P Y PP++KPPHE PP  +  PP EKPPHE
Sbjct: 146 QPPHEKPPPEYQPPHEKPPPEYQPPQEKPPPVYPPPYEKPPHEKPPSYEKPPPYEKPPHE 205

Query: 463 KSP 471
           K P
Sbjct: 206 KPP 208

 Score =  218 bits (554), Expect = 2e-55
 Identities = 104/178 (58%), Positives = 119/178 (66%), Gaps = 21/178 (11%)
 Frame = +1

Query: 1   PHHAKPP-YENPPPEYQPPHEKPPPEYQPPH-GKQPHVNPPPQYQPPHEK------PPHE 156
           P +  PP YE PPP Y+PP   PPP  +PP     P+  PPP Y PP+EK      PP+E
Sbjct: 37  PTYEPPPTYEKPPPVYKPPIF-PPPYEKPPPVYSPPYEKPPPVYPPPYEKPPPVYPPPYE 95

Query: 157 HSPPGYQPPHEIPPPEHQPPHE------KPPHAKSPPEYQPPHEHPPPEYLPPHEK---- 306
             PP YQPPHE PPPE+QPPHE      +PPH K PPEYQPPHE PPPEY PPHEK    
Sbjct: 96  KPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPE 155

Query: 307 --PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEKSP 471
             PPHE PPPEY PP EKPP  +P P  +PPH+KPP +E PPP  +PP+EKPP+EK P
Sbjct: 156 YQPPHEKPPPEYQPPQEKPPPVYPPPYEKPPHEKPPSYEKPPPYEKPPHEKPPYEKPP 213

 Score =  187 bits (476), Expect = 2e-46
 Identities = 88/163 (53%), Positives = 102/163 (62%), Gaps = 12/163 (7%)
 Frame = +1

Query: 22  YENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPP 201
           Y  PPP  +PP  +PPP Y+          PPP Y+PP   PP+E  PP Y PP+E PPP
Sbjct: 27  YYEPPPIEKPPTYEPPPTYE---------KPPPVYKPPIFPPPYEKPPPVYSPPYEKPPP 77

Query: 202 EHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHE------KPPH 363
            + PP+EKPP     P Y PP+E PPPEY PPHEK     PPPEY PPHE      +PPH
Sbjct: 78  VYPPPYEKPP-----PVYPPPYEKPPPEYQPPHEK-----PPPEYQPPHENPPPEYQPPH 127

Query: 364 EHPSPEYQPPHQK------PPHENPPPKFQPPNEKPPHEKSPP 474
           E P PEYQPPH+K      PPHE PPP++QPP+EKPP E  PP
Sbjct: 128 EKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPP 170

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 41/114 (35%), Positives = 50/114 (43%), Gaps = 52/114 (45%)
 Frame = +1

Query: 289 LPPHEKPPHEN-----------------------------PPPEYNPPHEK--------- 354
           L  + +PP                                PPP Y+PP+EK         
Sbjct: 24  LANYYEPPPIEKPPTYEPPPTYEKPPPVYKPPIFPPPYEKPPPVYSPPYEKPPPVYPPPY 83

Query: 355 --------PPHEHPSPEYQPPHQK------PPHENPPPKFQPPNEKPPHEKSPP 474
                   PP+E P PEYQPPH+K      PPHENPPP++QPP+EKPP E  PP
Sbjct: 84  EKPPPVYPPPYEKPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPPEYQPP 137

[3][TOP]
>UniRef100_Q9FUR5 ENOD2f (Fragment) n=1 Tax=Maackia amurensis RepID=Q9FUR5_9FABA
          Length = 308

 Score =  235 bits (600), Expect = 1e-60
 Identities = 109/188 (57%), Positives = 121/188 (64%), Gaps = 30/188 (15%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQP------HVNPPPQYQPPHEKPP---- 150
           P   +PP+E PPPEYQPPHEKPPPEY PPH K P      +  PPP+YQPP+EKPP    
Sbjct: 72  PPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYP 131

Query: 151 --HEHSPPGYQPPHEIPPPEHQPPHEKPP------HAKSPPEYQPPHEHPPPEYLPPHEK 306
             HE  P  Y PPHE PPP +QPP+EKPP      H K PP YQPP+E PPP Y PPHEK
Sbjct: 132 PPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEK 191

Query: 307 ------PPHENPPPEYNPPHEK------PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEK 450
                 PPHE PPP Y PP+EK      PPHE P  EY PPH+KPP+E PPP + PP EK
Sbjct: 192 PPIEYPPPHEKPPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEK 251

Query: 451 PPHEKSPP 474
           PP    PP
Sbjct: 252 PPPLYPPP 259

 Score =  234 bits (596), Expect = 3e-60
 Identities = 111/199 (55%), Positives = 125/199 (62%), Gaps = 41/199 (20%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEK------PPHEHS 162
           P +  PP   PPPEYQPPHEKPPPEYQPPH K     PPP+YQPPHEK      PPHE  
Sbjct: 50  PEYEPPPEYEPPPEYQPPHEKPPPEYQPPHEK-----PPPEYQPPHEKPPPEYPPPHEKP 104

Query: 163 PPGYQPPHEIPPPEHQPPHEK-----------------PPHAKSPPEYQPPHEHPPPEYL 291
           PP + PP+E PPPE+QPP+EK                 PPH K PP YQPP+E PP EY 
Sbjct: 105 PPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYP 164

Query: 292 PPHEK------PPHENPPPEYNPPHEK------PPHEHPSPEYQPPHQK------PPHEN 417
           PPHEK      PP+E PPP Y PPHEK      PPHE P P YQPP++K      PPHE 
Sbjct: 165 PPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPPTYPPPHEK 224

Query: 418 PPPKFQPPNEKPPHEKSPP 474
           PP ++ PP+EKPP+EK PP
Sbjct: 225 PPIEYPPPHEKPPYEKPPP 243

 Score =  227 bits (579), Expect = 3e-58
 Identities = 109/185 (58%), Positives = 119/185 (64%), Gaps = 27/185 (14%)
 Frame = +1

Query: 1   PHHAKPP--YENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEK------PPHE 156
           P   KPP  Y+ PP  Y PPH KPPPEY+PP    P   PPP+YQPPHEK      PPHE
Sbjct: 25  PEIEKPPPVYQPPPVHYPPPHVKPPPEYEPP----PEYEPPPEYQPPHEKPPPEYQPPHE 80

Query: 157 HSPPGYQPPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEK---- 306
             PP YQPPHE PPPE+ PPHEK      PP+ K PPEYQPP+E PPP Y PPHEK    
Sbjct: 81  KPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPVE 140

Query: 307 --PPHENPPPEYNPPHEK------PPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-KPPH 459
             PPHE PPP Y PP+EK      PPHE P P YQPP++KPP   PPP  +PP E  PPH
Sbjct: 141 YPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPH 200

Query: 460 EKSPP 474
           EK PP
Sbjct: 201 EKPPP 205

 Score =  223 bits (569), Expect = 4e-57
 Identities = 107/184 (58%), Positives = 116/184 (63%), Gaps = 26/184 (14%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQP------HVNPPPQYQPPHEKPP---- 150
           P    PPYE PPPEYQPP+EKPPP Y PPH K P      H  PPP YQPP+EKPP    
Sbjct: 105 PPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYP 164

Query: 151 --HEHSPPGYQPPHEIPPPEHQPPHEKPP------HAKSPPEYQPPHEHPPPEYLPPHEK 306
             HE  PP YQPP+E PPP + PPHEKPP      H K PP YQPP+E PPP Y PPHEK
Sbjct: 165 PPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPPTYPPPHEK 224

Query: 307 PPHENPPPEYNPPHEK------PPHEHPSPEYQPP-HQKPPHENPPPKFQPP-NEKPPHE 462
           PP E PPP   PP+EK      PP+E P P Y PP H KPPH   PP ++PP  E PP E
Sbjct: 225 PPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPPHHEKPPFYKPPVYEPPPLE 284

Query: 463 KSPP 474
           K PP
Sbjct: 285 KPPP 288

 Score =  207 bits (526), Expect = 4e-52
 Identities = 96/168 (57%), Positives = 108/168 (64%), Gaps = 14/168 (8%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQP------HVNPPPQYQPPHEKPP------HEH 159
           PP+E PP EY PPHEKPPP YQPP+ K P      H  PPP YQPP+EKPP      HE 
Sbjct: 132 PPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEK 191

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN 339
            P  Y PPHE PPP +QPP+EKP     PP Y PPHE PP EY PPHEKPP+E PPP Y 
Sbjct: 192 PPIEYPPPHEKPPPVYQPPYEKP-----PPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYP 246

Query: 340 PPHEKPPHEHPSPEYQPP--HQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           PP+EKPP  +P P +  P  H+KPP   PP    PP EKPP  + PP+
Sbjct: 247 PPYEKPPPLYPPPHHHKPPHHEKPPFYKPPVYEPPPLEKPPPVEKPPS 294

 Score =  196 bits (499), Expect = 5e-49
 Identities = 90/158 (56%), Positives = 104/158 (65%), Gaps = 2/158 (1%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-KPPHEHSPPGYQPPHE 189
           +PPYE PP EY PPHEKPPP YQPP+ K P V PPP  +PP E  PPHE  PP YQPP+E
Sbjct: 153 QPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQPPYE 212

Query: 190 IPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEH 369
            PPP + PPHEKPP    PP  +PP+E PPP Y PP+EKPP   PPP     H KPPH  
Sbjct: 213 KPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPH----HHKPPHHE 268

Query: 370 PSPEYQPP-HQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
             P Y+PP ++ PP E PPP  +PP+ KPP  +  P S
Sbjct: 269 KPPFYKPPVYEPPPLEKPPPVEKPPSYKPPPYRHYPPS 306

 Score =  183 bits (464), Expect = 6e-45
 Identities = 87/157 (55%), Positives = 98/157 (62%), Gaps = 8/157 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQP------HVNPPPQYQPPHEKPPHEHS 162
           P    PP+E PPP YQPP+EKPPP Y PPH K P      H  PPP YQPP+EKP     
Sbjct: 160 PIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQPPYEKP----- 214

Query: 163 PPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPP-HEKPPHENPPPEYN 339
           PP Y PPHE PP E+ PPHEKPP+ K PP Y PP+E PPP Y PP H KPPH   PP Y 
Sbjct: 215 PPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPPHHEKPPFYK 274

Query: 340 PP-HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE 447
           PP +E PP E P P  +PP  KP    PP +  PP++
Sbjct: 275 PPVYEPPPLEKPPPVEKPPSYKP----PPYRHYPPSK 307

 Score =  182 bits (461), Expect = 1e-44
 Identities = 89/167 (53%), Positives = 99/167 (59%), Gaps = 34/167 (20%)
 Frame = +1

Query: 76  YQPPHGKQPHVNPPPQYQPP--------------HEKPPHEHSPPGYQPPHEI-PPPEHQ 210
           Y+PP  + P    PP Y+PP              H  PPH   PP Y+PP E  PPPE+Q
Sbjct: 6   YKPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYEPPPEYQ 65

Query: 211 PPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEK------PPHENPPPEYNPPHEK 354
           PPHEK      PPH K PPEYQPPHE PPPEY PPHEK      PP+E PPPEY PP+EK
Sbjct: 66  PPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEK 125

Query: 355 PPHEHPSPEYQPP-HQKPPHENPPPKFQPPNEK------PPHEKSPP 474
           PP  +P P  +PP    PPHE PPP +QPP EK      PPHEK PP
Sbjct: 126 PPPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPP 172

 Score =  174 bits (442), Expect = 2e-42
 Identities = 92/187 (49%), Positives = 100/187 (53%), Gaps = 61/187 (32%)
 Frame = +1

Query: 94  KQPHVNPPPQ------------------------YQPPHEKPPHEHS-------PPGYQP 180
           K P   PPP                         Y PPH KPP E+        PP YQP
Sbjct: 7   KPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYEPPPEYQP 66

Query: 181 PHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEK------PPHENP 324
           PHE PPPE+QPPHEK      PPH K PPEY PPHE PPPE+ PP+EK      PP+E P
Sbjct: 67  PHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKP 126

Query: 325 PPEYNPPHEK------PPHEHPSPEYQPPHQK------PPHENPPPKFQPPNEK------ 450
           PP Y PPHEK      PPHE P P YQPP++K      PPHE PPP +QPP EK      
Sbjct: 127 PPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYP 186

Query: 451 PPHEKSP 471
           PPHEK P
Sbjct: 187 PPHEKPP 193

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 45/101 (44%), Positives = 53/101 (52%), Gaps = 24/101 (23%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPP------HEHSPPGY 174
           +PPYE PPP Y PPHEKPP EY PPH K P+  PPP Y PP+EKPP      H H PP +
Sbjct: 208 QPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPPHH 267

Query: 175 Q------------------PPHEIPPPEHQPPHEKPPHAKS 243
           +                  PP E PP    PP+   P +K+
Sbjct: 268 EKPPFYKPPVYEPPPLEKPPPVEKPPSYKPPPYRHYPPSKN 308

[4][TOP]
>UniRef100_O49151 Early nodulin (Fragment) n=1 Tax=Maackia amurensis
           RepID=O49151_9FABA
          Length = 447

 Score =  232 bits (591), Expect = 1e-59
 Identities = 109/188 (57%), Positives = 121/188 (64%), Gaps = 30/188 (15%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEK------PPHEHS 162
           P +  PP   PPPEYQPPHEKPPPEYQPPH K     PPP+YQPPHEK      PPHE  
Sbjct: 63  PEYEPPPEYQPPPEYQPPHEKPPPEYQPPHEK-----PPPEYQPPHEKPPPEYPPPHEKP 117

Query: 163 PPGYQPPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEK------ 306
           PP + PP+E PPPE+QPP+EK      PPH K P EY PPHE PPP Y PP+EK      
Sbjct: 118 PPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYP 177

Query: 307 PPHENPPPEYNPPHEK------PPHEHPSPEYQPPHQK------PPHENPPPKFQPPNEK 450
           PPHE PPP Y PP+EK      PPHE P  EY PPH+K      PP+E PPP + PP+EK
Sbjct: 178 PPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEK 237

Query: 451 PPHEKSPP 474
           PP E  PP
Sbjct: 238 PPIEYPPP 245

 Score =  231 bits (588), Expect = 2e-59
 Identities = 115/227 (50%), Positives = 127/227 (55%), Gaps = 69/227 (30%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQP------HVNPPPQYQPPHEKPP---- 150
           P   +PP+E PPPEYQPPHEKPPPEY PPH K P      +  PPP+YQPP+EKPP    
Sbjct: 85  PPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYP 144

Query: 151 -------------HEHSPPGYQPPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEH 273
                        HE  PP YQPP+E PP E+ PPHEK      PP+ K PP Y PPHE 
Sbjct: 145 PPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEK 204

Query: 274 PPPEYLPPHEK-----------------PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQK 402
           PP EY PPHEK                 PPHE PP EY PPHEKPP+E P PEYQPP++K
Sbjct: 205 PPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPEYQPPYEK 264

Query: 403 -----------------PPHENPPPKFQPPNEK------PPHEKSPP 474
                            PPHE PPP +QPP EK      PPHEK PP
Sbjct: 265 PPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPP 311

 Score =  231 bits (588), Expect = 2e-59
 Identities = 108/179 (60%), Positives = 119/179 (66%), Gaps = 25/179 (13%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPP------QYQPPHEK------PPHE 156
           +PPYE PP EY PPHEKPPP YQPP+ K P V PPP      +Y PPHEK      PP+E
Sbjct: 166 QPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYE 225

Query: 157 HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEK------PPHE 318
             PP Y PPHE PP E+ PPHEKPP+ K PPEYQPP+E PPP Y PPHEK      PPHE
Sbjct: 226 KPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHE 285

Query: 319 NPPPEYNPPHEK------PPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-KPPHEKSPP 474
            PPP Y PP+EK      PPHE P P YQPP++KPP   PPP  +PP E  PPHEK PP
Sbjct: 286 KPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPP 344

 Score =  230 bits (586), Expect = 4e-59
 Identities = 105/178 (58%), Positives = 116/178 (65%), Gaps = 24/178 (13%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPP------HEHSPPGY 174
           +PPYE PPP Y PPHEKPP EY PPH K P+  PPP+YQPP+EKPP      HE  P  Y
Sbjct: 221 QPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEY 280

Query: 175 QPPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEK------PPHE 318
            PPHE PPP +QPP+EK      PPH K PP YQPP+E PPP Y PPHEK      PPHE
Sbjct: 281 PPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHE 340

Query: 319 NPPPEYNPPHEK------PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP Y PP+EK      PPHE P  EY PPH+KPP+E PPP + PP EKPP    PP
Sbjct: 341 KLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPP 398

 Score =  227 bits (579), Expect = 3e-58
 Identities = 107/195 (54%), Positives = 121/195 (62%), Gaps = 41/195 (21%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGK-----------------QPHVNPPPQYQPPHE 141
           +PPYE PPP Y PPHEKPP EY PPH K                  PH  PP +Y PPHE
Sbjct: 188 QPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHE 247

Query: 142 KPPHEHSPPGYQPPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHE 303
           KPP+E  PP YQPP+E PPP + PPHEK      PPH K PP YQPP+E PP EY PPHE
Sbjct: 248 KPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHE 307

Query: 304 K------PPHENPPPEYNPPHEKPPHEHPSPE------YQPPHQK------PPHENPPPK 429
           K      PP+E PPP Y PPHEKPP E+P P       YQPP++K      PPHE PP +
Sbjct: 308 KPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIE 367

Query: 430 FQPPNEKPPHEKSPP 474
           + PP+EKPP+EK PP
Sbjct: 368 YPPPHEKPPYEKPPP 382

 Score =  227 bits (578), Expect = 4e-58
 Identities = 109/185 (58%), Positives = 119/185 (64%), Gaps = 27/185 (14%)
 Frame = +1

Query: 1   PHHAKPP--YENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEK------PPHE 156
           P   KPP  Y+ PP  Y PPH KPPPEY+PP    P   PPP+YQPPHEK      PPHE
Sbjct: 38  PEIEKPPPVYQPPPVHYPPPHVKPPPEYEPP----PEYQPPPEYQPPHEKPPPEYQPPHE 93

Query: 157 HSPPGYQPPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEK---- 306
             PP YQPPHE PPPE+ PPHEK      PP+ K PPEYQPP+E PPP Y PPHEK    
Sbjct: 94  KPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIE 153

Query: 307 --PPHENPPPEYNPPHEK------PPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-KPPH 459
             PPHE PPP Y PP+EK      PPHE P P YQPP++KPP   PPP  +PP E  PPH
Sbjct: 154 YPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPH 213

Query: 460 EKSPP 474
           EK PP
Sbjct: 214 EKLPP 218

 Score =  220 bits (561), Expect = 3e-56
 Identities = 109/202 (53%), Positives = 119/202 (58%), Gaps = 42/202 (20%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQP------HVNPPPQYQPPHEKPP---- 150
           P H KPPYE PPPEYQPP+EKPPP Y PPH K P      H  PPP YQPP+EKPP    
Sbjct: 244 PPHEKPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYP 303

Query: 151 --HEHSPPGYQPPHEIPPPEHQPPHEKPP------HAKSPPEYQPPHEHPPPEYLPPHEK 306
             HE  PP YQPP+E PPP + PPHEKPP      H K PP YQPP+E PPP Y PPHEK
Sbjct: 304 PPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEK 363

Query: 307 PPHENPPPEYNPPHEKPP------HEHPSPEYQPPHQ-KPPH-----------------E 414
           PP E PPP   PP+EKPP      +E P P Y PPH  KPPH                 E
Sbjct: 364 PPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPPHHEKPPFYKPPVYEPPPLE 423

Query: 415 NPPPKFQPPNEKPPHEKSPPAS 480
            PPP  +PP+ KPP  +  P S
Sbjct: 424 KPPPVEKPPSYKPPPYRHYPPS 445

 Score =  220 bits (560), Expect = 4e-56
 Identities = 106/188 (56%), Positives = 120/188 (63%), Gaps = 34/188 (18%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPH-EKPPPEYQPP--HGKQPHVNPPPQYQPPHE-------KPPHEHS 162
           +PP    PP Y+PP  EKPPP YQPP  H   PHV PPP+Y+PP E       +PPHE  
Sbjct: 25  EPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYQPPPEYQPPHEKP 84

Query: 163 PPGYQPPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEK------ 306
           PP YQPPHE PPPE+QPPHEK      PPH K PPE+ PP+E PPPEY PP+EK      
Sbjct: 85  PPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYP 144

Query: 307 PPHENPPPEYNPPHEK------PPHEHPSPEYQPPHQK------PPHENPPPKFQPPNEK 450
           PPHE PP EY PPHEK      PP+E P  EY PPH+K      PP+E PPP + PP+EK
Sbjct: 145 PPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEK 204

Query: 451 PPHEKSPP 474
           PP E  PP
Sbjct: 205 PPIEYPPP 212

 Score =  219 bits (559), Expect = 6e-56
 Identities = 101/178 (56%), Positives = 118/178 (66%), Gaps = 20/178 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-KPPHEHSPPGYQ 177
           P H KPP E PPP  +PP+EKPPPEYQPP+ K P + PPP  +PP E  PPHE  PP YQ
Sbjct: 233 PPHEKPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQ 292

Query: 178 PPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEK------PPHEN 321
           PP+E PP E+ PPHEK      PP+ K PP Y PPHE PP EY PPHEK      PP+E 
Sbjct: 293 PPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYEK 352

Query: 322 PPPEYNPPHEKPPHEHPSPEYQPPHQK------PPHENPPPKFQPP-NEKPPHEKSPP 474
           PPP Y PPHEKPP E+P P  +PP++K      PP+E PPP + PP + KPPH + PP
Sbjct: 353 PPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPPHHEKPP 410

 Score =  182 bits (461), Expect = 1e-44
 Identities = 89/167 (53%), Positives = 99/167 (59%), Gaps = 34/167 (20%)
 Frame = +1

Query: 76  YQPPHGKQPHVNPPPQYQPP--------------HEKPPHEHSPPGYQPPHEI-PPPEHQ 210
           Y+PP  + P    PP Y+PP              H  PPH   PP Y+PP E  PPPE+Q
Sbjct: 19  YKPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYQPPPEYQ 78

Query: 211 PPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEK------PPHENPPPEYNPPHEK 354
           PPHEK      PPH K PPEYQPPHE PPPEY PPHEK      PP+E PPPEY PP+EK
Sbjct: 79  PPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEK 138

Query: 355 PPHEHPSPEYQPP-HQKPPHENPPPKFQPPNEK------PPHEKSPP 474
           PP  +P P  +PP    PPHE PPP +QPP EK      PPHEK PP
Sbjct: 139 PPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPP 185

 Score =  174 bits (442), Expect = 2e-42
 Identities = 92/187 (49%), Positives = 100/187 (53%), Gaps = 61/187 (32%)
 Frame = +1

Query: 94  KQPHVNPPPQ------------------------YQPPHEKPPHEHS-------PPGYQP 180
           K P   PPP                         Y PPH KPP E+        PP YQP
Sbjct: 20  KPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYQPPPEYQP 79

Query: 181 PHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEK------PPHENP 324
           PHE PPPE+QPPHEK      PPH K PPEY PPHE PPPE+ PP+EK      PP+E P
Sbjct: 80  PHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKP 139

Query: 325 PPEYNPPHEK------PPHEHPSPEYQPPHQK------PPHENPPPKFQPPNEK------ 450
           PP Y PPHEK      PPHE P P YQPP++K      PPHE PPP +QPP EK      
Sbjct: 140 PPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYP 199

Query: 451 PPHEKSP 471
           PPHEK P
Sbjct: 200 PPHEKPP 206

 Score =  172 bits (437), Expect = 8e-42
 Identities = 85/156 (54%), Positives = 95/156 (60%), Gaps = 21/156 (13%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPP------QYQPPHEK------PPHE 156
           +PPYE PP EY PPHEKPPP YQPP+ K P V PPP      +Y PPHEK      PP+E
Sbjct: 292 QPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYE 351

Query: 157 HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEY------LPP-HEKPPH 315
             PP Y PPHE PP E+ PPHEKPP+ K PP Y PP+E PPP Y       PP HEKPP 
Sbjct: 352 KPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPPHHEKPPF 411

Query: 316 ENPPPEYNPPHEKPPHEHPSPEYQPPHQK--PPHEN 417
             PP    PP EKPP     P Y+PP  +  PP +N
Sbjct: 412 YKPPVYEPPPLEKPPPVEKPPSYKPPPYRHYPPSKN 447

[5][TOP]
>UniRef100_Q9FUR7 ENOD2 (Fragment) n=1 Tax=Styphnolobium japonicum RepID=Q9FUR7_SOPJA
          Length = 269

 Score =  209 bits (533), Expect = 6e-53
 Identities = 116/237 (48%), Positives = 125/237 (52%), Gaps = 78/237 (32%)
 Frame = +1

Query: 1   PHHAKPP------YENPPPEYQPP-HEKPPPEYQPP--------HGKQPHVNPPPQYQPP 135
           PHH  PP      +E PPPEYQPP HEKPPPEYQPP        +   PHV PPP YQPP
Sbjct: 25  PHHEIPPPVYPSPHEKPPPEYQPPPHEKPPPEYQPPPHVKPPPAYQPPPHVKPPPVYQPP 84

Query: 136 HEK--------PPHEHSPPGYQPPHEI------PPPEHQPP---HEKPPHAKSPPEYQPP 264
           H +        PPHE  PP YQPPH +      PPP H+ P   H+ PPH K PPEYQPP
Sbjct: 85  HHEKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPHHEKPPPVHQPPPHEKPPPEYQPP 144

Query: 265 -HEHPPPEYLPP-HEKPP--------HENPPPEYNPPH--------EKPPHEHPSPEYQP 390
            H  PPP Y PP H KPP        HE PPPEY PPH        + PPHE P P YQP
Sbjct: 145 PHVKPPPVYQPPPHVKPPPVYQPPPHHEIPPPEYQPPHHVKPPPVYQPPPHEKPPPVYQP 204

Query: 391 PH--------------------QKPPHENPPPKFQPP-NEKPP-------HEKSPPA 477
           PH                    Q PPH  PPP +QPP +EKPP       HEK PPA
Sbjct: 205 PHHEIPPPVYPPPRENKPPPEYQPPPHVKPPPAYQPPPHEKPPPVYPPPHHEKPPPA 261

 Score =  205 bits (522), Expect = 1e-51
 Identities = 109/202 (53%), Positives = 119/202 (58%), Gaps = 44/202 (21%)
 Frame = +1

Query: 1   PHHAKPP-------YENPPPEYQPP-HEKPPPEYQPPHGKQPHVNPPPQYQPPH-EKPPH 153
           P H KPP       +E PPPEYQPP HEKPPPEYQPPH    HV PPP Y PPH EKPP 
Sbjct: 72  PPHVKPPPVYQPPHHEKPPPEYQPPPHEKPPPEYQPPH----HVKPPPVYPPPHHEKPPP 127

Query: 154 EHSPPGYQPPHEIPPPEHQPP--------HEKPPHAKSPPEYQPP--HEHPPPEYLPPH- 300
            H PP    PHE PPPE+QPP        ++ PPH K PP YQPP  HE PPPEY PPH 
Sbjct: 128 VHQPP----PHEKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHHEIPPPEYQPPHH 183

Query: 301 -------EKPPHENPPPEYNPPHEK-------PPHEH-PSPEYQPP--------HQKPPH 411
                  + PPHE PPP Y PPH +       PP E+ P PEYQPP        +Q PPH
Sbjct: 184 VKPPPVYQPPPHEKPPPVYQPPHHEIPPPVYPPPRENKPPPEYQPPPHVKPPPAYQPPPH 243

Query: 412 ENPPPKFQPP-NEKPPHEKSPP 474
           E PPP + PP +EKPP    PP
Sbjct: 244 EKPPPVYPPPHHEKPPPAYPPP 265

 Score =  199 bits (506), Expect = 8e-50
 Identities = 102/181 (56%), Positives = 110/181 (60%), Gaps = 23/181 (12%)
 Frame = +1

Query: 1   PHHAKPP-------YENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
           PHH KPP       +E PPP Y  PHEKPPPEYQPP    PH  PPP+YQPP    PH  
Sbjct: 13  PHHEKPPPAYPPPHHEIPPPVYPSPHEKPPPEYQPP----PHEKPPPEYQPP----PHVK 64

Query: 160 SPPGYQPP-HEIPPPEHQPPHEKPPHAKSPPEYQPP-HEHPPPEYLPPHE-KPPHENPPP 330
            PP YQPP H  PPP +QPPH    H K PPEYQPP HE PPPEY PPH  KPP   PPP
Sbjct: 65  PPPAYQPPPHVKPPPVYQPPH----HEKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPP 120

Query: 331 EYNPP---HEKPPHEHPSPEYQPP--------HQKPPHENPPPKFQPP--NEKPPHEKSP 471
            +  P   H+ PPHE P PEYQPP        +Q PPH  PPP +QPP  +E PP E  P
Sbjct: 121 HHEKPPPVHQPPPHEKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHHEIPPPEYQP 180

Query: 472 P 474
           P
Sbjct: 181 P 181

 Score =  197 bits (502), Expect = 2e-49
 Identities = 110/228 (48%), Positives = 119/228 (52%), Gaps = 70/228 (30%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPH-EKPPPEYQPPHGK-------QPHVNPPPQYQ-PPHEKPPH 153
           PHH KPP     P YQPPH EKPPP Y PPH +        PH  PPP+YQ PPHEKPP 
Sbjct: 1   PHHVKPP-----PVYQPPHHEKPPPAYPPPHHEIPPPVYPSPHEKPPPEYQPPPHEKPPP 55

Query: 154 EHS-------PPGYQ-PPHEIPPPEHQPPH--------EKPPHAKSPPEYQPPHE-HPPP 282
           E+        PP YQ PPH  PPP +QPPH        + PPH K PPEYQPPH   PPP
Sbjct: 56  EYQPPPHVKPPPAYQPPPHVKPPPVYQPPHHEKPPPEYQPPPHEKPPPEYQPPHHVKPPP 115

Query: 283 EYLPP--------HEKPPHENPPPEYN-PPHEKPP--------------------HEHPS 375
            Y PP        H+ PPHE PPPEY  PPH KPP                    HE P 
Sbjct: 116 VYPPPHHEKPPPVHQPPPHEKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHHEIPP 175

Query: 376 PEYQPPH--------QKPPHENPPPKFQPPNEK-------PPHEKSPP 474
           PEYQPPH        Q PPHE PPP +QPP+ +       PP E  PP
Sbjct: 176 PEYQPPHHVKPPPVYQPPPHEKPPPVYQPPHHEIPPPVYPPPRENKPP 223

 Score =  194 bits (493), Expect = 3e-48
 Identities = 103/194 (53%), Positives = 113/194 (58%), Gaps = 43/194 (22%)
 Frame = +1

Query: 1   PHHAKPP-------YENPPPEYQPPHE-KPPPEYQPPHGKQP--------HVNPPPQYQP 132
           PHH KPP       +E PPPEYQPPH  KPPP Y PPH ++P        H  PPP+YQP
Sbjct: 84  PHHEKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPHHEKPPPVHQPPPHEKPPPEYQP 143

Query: 133 P-HEKP-------PHEHSPPGYQPP--HEIPPPEHQPPHEKPPHAKSPPEYQ-PPHEHPP 279
           P H KP       PH   PP YQPP  HEIPPPE+QPPH    H K PP YQ PPHE PP
Sbjct: 144 PPHVKPPPVYQPPPHVKPPPVYQPPPHHEIPPPEYQPPH----HVKPPPVYQPPPHEKPP 199

Query: 280 PEYLPPHEK-------PPHEN-PPPEYNPP--------HEKPPHEHPSPEYQPPHQKPPH 411
           P Y PPH +       PP EN PPPEY PP        ++ PPHE P P Y PPH    H
Sbjct: 200 PVYQPPHHEIPPPVYPPPRENKPPPEYQPPPHVKPPPAYQPPPHEKPPPVYPPPH----H 255

Query: 412 ENPPPKFQPPNEKP 453
           E PPP + PP+EKP
Sbjct: 256 EKPPPAYPPPHEKP 269

[6][TOP]
>UniRef100_Q06841 Early nodulin-75 (Fragment) n=1 Tax=Lupinus luteus RepID=NO75_LUPLU
          Length = 434

 Score =  209 bits (533), Expect = 6e-53
 Identities = 103/191 (53%), Positives = 117/191 (61%), Gaps = 33/191 (17%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQP------HVNPPPQYQPPHEKPPHEH- 159
           P   KPP  +PPP + PPHEKPP EY PPH K P      HV PP QY PPHEKPP E+ 
Sbjct: 28  PPFEKPPPAHPPPVHPPPHEKPPIEYPPPHTKPPIEYPPPHVKPPIQYPPPHEKPPIEYP 87

Query: 160 ----SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPE-----YQPPHEHPPPEYLPPHEKPP 312
                PP Y+PP+E PPP H PPHEKPP   SPP      ++PP+E PP  + PPH+KPP
Sbjct: 88  LPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPP 147

Query: 313 ------HENPPPEYNPPHEKPPHEHPSP------EYQPPHQK-----PPHENPPPKFQPP 441
                 HE PP EY PPHEKPP E+P P      EY PPH+K     PP+E PPP   PP
Sbjct: 148 IEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPP 207

Query: 442 NEKPPHEKSPP 474
           +EKPP E  PP
Sbjct: 208 DEKPPIEYPPP 218

 Score =  206 bits (524), Expect = 6e-52
 Identities = 98/181 (54%), Positives = 113/181 (62%), Gaps = 22/181 (12%)
 Frame = +1

Query: 1   PHHAKPPYENPPP------EYQPPHEKPPPEYQPPHGKQP-----HVNPPPQYQPPHEKP 147
           P H KPP E PPP      +Y PPHEKPP EY  PH K P     +  PPP + PPHEKP
Sbjct: 55  PPHTKPPIEYPPPHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKP 114

Query: 148 PHEHSPPG-----YQPPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLP 294
           P E+SPP      ++PP+E PP  H PPH+K      PPH K P EY PPHE PP EY P
Sbjct: 115 PIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPP 174

Query: 295 PHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PHEKPP E PPP   PP  +PP+E P P + PP +KPP E PPP  +PP  +PP+EK PP
Sbjct: 175 PHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPP 234

Query: 475 A 477
           A
Sbjct: 235 A 235

 Score =  203 bits (517), Expect = 4e-51
 Identities = 90/170 (52%), Positives = 106/170 (62%), Gaps = 16/170 (9%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGK----------------QPHVNPPPQYQPPHEK 144
           +PPYE PPP + PPHEKPP EY PPH K                 PH  PP +Y PPHEK
Sbjct: 97  EPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPPIEYHPPHEK 156

Query: 145 PPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP 324
           PP E+ PP  +PP E PPP  +PP E PP  + PP Y+PP+E PPP + PP EKPP E P
Sbjct: 157 PPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIEYP 216

Query: 325 PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP   PP  +PP+E P P   PPH KPP E PPP  +PP  +PP+E+SPP
Sbjct: 217 PPLEKPPVHEPPYEKPPPAQPPPHDKPPIEYPPPHEKPPVYEPPYERSPP 266

 Score =  201 bits (512), Expect = 2e-50
 Identities = 98/196 (50%), Positives = 114/196 (58%), Gaps = 38/196 (19%)
 Frame = +1

Query: 1   PHHAKPPYENPPPE-----YQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           P H KPP  +PPP      ++PP EKPPP + PP    PH  PP +Y PPH KPP E+ P
Sbjct: 7   PPHEKPPIVHPPPHEKPPLFEPPFEKPPPAHPPPVHPPPHEKPPIEYPPPHTKPPIEYPP 66

Query: 166 PG------YQPPHEIPPPEHQPPHEKPP-----HAKSPPEYQPPHEHPPPEYLPPHEK-- 306
           P       Y PPHE PP E+  PHEKPP     + K PP + PPHE PP EY PPHEK  
Sbjct: 67  PHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPP 126

Query: 307 --------------PPHENPPPEYNPPHEKPPHEHPSP------EYQPPHQKPPHENPPP 426
                         PPH+ PP EY+PPHEKPP E+P P      EY PPH+KPP E PPP
Sbjct: 127 VHEPPYEKPPLVHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPP 186

Query: 427 KFQPPNEKPPHEKSPP 474
             +PP  +PP+EK PP
Sbjct: 187 HEKPPVYEPPYEKPPP 202

 Score =  198 bits (504), Expect = 1e-49
 Identities = 92/174 (52%), Positives = 109/174 (62%), Gaps = 16/174 (9%)
 Frame = +1

Query: 1   PHHAKPPYENP-----PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           P H KPP E P     PP Y+PP+EKPPP + PPH K P    PP  +PP  +PP+E  P
Sbjct: 77  PPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPP 136

Query: 166 PGYQPPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEK-----PP 312
             + PPH+ PP E+ PPHEK      PPH K P EY PPHE PP EY PPHEK     PP
Sbjct: 137 LVHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPP 196

Query: 313 HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           +E PPP + PP EKPP E+P P  +PP  +PP+E PPP   PP++KPP E  PP
Sbjct: 197 YEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPAQPPPHDKPPIEYPPP 250

 Score =  196 bits (498), Expect = 7e-49
 Identities = 92/179 (51%), Positives = 103/179 (57%), Gaps = 21/179 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQ-----YQPPHEKPPHEHSP 165
           P    PP+E PP EY PPHEKPP EY PPH K P   PPP      Y+PP+EKPP  H P
Sbjct: 147 PIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPP 206

Query: 166 PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPP----------- 312
           P  +PP E PPP  +PP  +PP+ K PP   PPH+ PP EY PPHEKPP           
Sbjct: 207 PDEKPPIEYPPPLEKPPVHEPPYEKPPPAQPPPHDKPPIEYPPPHEKPPVYEPPYERSPP 266

Query: 313 -----HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
                HE PP  Y PPHEK P   P  E  PP   PPHE PP ++ PP+EKPP E  PP
Sbjct: 267 VHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPP 325

 Score =  193 bits (491), Expect = 4e-48
 Identities = 83/158 (52%), Positives = 101/158 (63%), Gaps = 5/158 (3%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP++ PP EY PPHEKPP EY PPH K P   PPP  +PP E PP    PP Y+PP+E P
Sbjct: 141 PPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKP 200

Query: 196 PPEHQPPHEK-----PPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           PP H PP EK     PP  + PP ++PP+E PPP   PPH+KPP E PPP   PP  +PP
Sbjct: 201 PPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPAQPPPHDKPPIEYPPPHEKPPVYEPP 260

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           +E   P + P H+KPP   PPP  + P  +PP+EK+PP
Sbjct: 261 YERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPP 298

 Score =  189 bits (480), Expect = 8e-47
 Identities = 92/184 (50%), Positives = 107/184 (58%), Gaps = 27/184 (14%)
 Frame = +1

Query: 1   PHHAKPPYENPPPE-----YQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           P H KPP E PPP      Y+PP+EKPPP + PP  K P   PPP  +PP  +PP+E  P
Sbjct: 174 PPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPP 233

Query: 166 PGYQPPHEIPPPEHQPPHEKPP-----HAKSPPEYQPPHEHPPPEYLPPHEK-------- 306
           P   PPH+ PP E+ PPHEKPP     + +SPP + P HE PP  Y PPHEK        
Sbjct: 234 PAQPPPHDKPPIEYPPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPY 293

Query: 307 --------PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKP-PHENPPPKFQPPNEKPPH 459
                   PPHE PP EY PPHEKPP E+P P  +PP + P P E PP   +PP E PPH
Sbjct: 294 EKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPH 353

Query: 460 EKSP 471
           EK P
Sbjct: 354 EKPP 357

 Score =  189 bits (479), Expect = 1e-46
 Identities = 95/185 (51%), Positives = 111/185 (60%), Gaps = 32/185 (17%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGK-----QPHVNPPPQYQPPHEKPPHEH-----S 162
           +PPYE PPP + PP EKPP EY PP  K      P+  PPP   PPH+KPP E+      
Sbjct: 194 EPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPAQPPPHDKPPIEYPPPHEK 253

Query: 163 PPGYQPPHEIPPPEHQPPHEKPPHAKSPPE-----YQPPHEHPPPEYLPPHEK------P 309
           PP Y+PP+E  PP H P HEKPP    PP      ++PP+E  PP +LPPHEK      P
Sbjct: 254 PPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAP 313

Query: 310 PHENPPPEYNPPHEKPPHEHPSPEYQPP-HQKPPHENP----PPKFQPPNEK------PP 456
           PHE PP EY PPH KPP E+PSP  +PP H+KPP E P    PP ++PP EK      PP
Sbjct: 314 PHEKPPVEYPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPHEKPPVYEPPYEKPPSVCPPP 373

Query: 457 HEKSP 471
           HEK P
Sbjct: 374 HEKPP 378

 Score =  187 bits (476), Expect = 2e-46
 Identities = 95/191 (49%), Positives = 110/191 (57%), Gaps = 33/191 (17%)
 Frame = +1

Query: 1   PHHAKPPYENPPP------EYQPPHEKPPPEYQPPHGKQP-----HVNPPPQYQPPHEKP 147
           P H KPP E PPP      EY PPHEKPP EY PPH K P     +  PPP + PP EKP
Sbjct: 152 PPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKP 211

Query: 148 PHEH-----SPPGYQPPHEIPPPEHQPPHEKPP------HAKSPPEYQPPHEHPPPEYLP 294
           P E+      PP ++PP+E PPP   PPH+KPP      H K PP Y+PP+E  PP + P
Sbjct: 212 PIEYPPPLEKPPVHEPPYEKPPPAQPPPHDKPPIEYPPPHEK-PPVYEPPYERSPPVHPP 270

Query: 295 PHEKPPHENPPPE-----YNPPHEK------PPHEHPSPEYQPPHQKPPHENPPPKFQPP 441
            HEKPP   PPP      + PP+EK      PPHE P  EY PPH+KPP E PPP  +PP
Sbjct: 271 SHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVKPP 330

Query: 442 NEKPPHEKSPP 474
            E P   + PP
Sbjct: 331 VEYPSPAEKPP 341

 Score =  185 bits (470), Expect = 1e-45
 Identities = 91/190 (47%), Positives = 109/190 (57%), Gaps = 32/190 (16%)
 Frame = +1

Query: 1   PHHAKPPYENPPP-----EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           P   KPP E PPP      ++PP+EKPPP   PPH K P   PPP  +PP  +PP+E SP
Sbjct: 206 PPDEKPPIEYPPPLEKPPVHEPPYEKPPPAQPPPHDKPPIEYPPPHEKPPVYEPPYERSP 265

Query: 166 PGYQPPHEIPPPEHQPPHEK-----PPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP 330
           P + P HE PP  + PPHEK     PP+ K+PP + PPHE PP EY PPHEKPP E PPP
Sbjct: 266 PVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPP 325

Query: 331 EYNPP------------HEKPPHEHP----SPEYQPPHQKPPHENPPPKFQPPNEK---- 450
              PP            HEKPP E P     P Y+PP++KPP   PPP  +PP+ +    
Sbjct: 326 HVKPPVEYPSPAEKPPTHEKPPIEFPPHEKPPVYEPPYEKPPSVCPPPHEKPPHHEKRSA 385

Query: 451 --PPHEKSPP 474
             PPH + PP
Sbjct: 386 LYPPHHRKPP 395

 Score =  180 bits (456), Expect = 5e-44
 Identities = 83/158 (52%), Positives = 98/158 (62%), Gaps = 11/158 (6%)
 Frame = +1

Query: 34  PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQP 213
           PP + PPHEKPP  + PPH K      PP ++PP EKPP  H PP + PPHE PP E+ P
Sbjct: 2   PPVHPPPHEKPPIVHPPPHEK------PPLFEPPFEKPPPAHPPPVHPPPHEKPPIEYPP 55

Query: 214 PHEKPP------HAKSPPEYQPPHEHPPPEYLPPHEKPP-----HENPPPEYNPPHEKPP 360
           PH KPP      H K P +Y PPHE PP EY  PHEKPP     +E PPP + PPHEKPP
Sbjct: 56  PHTKPPIEYPPPHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPP 115

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            E+  P  +PP  +PP+E PP    PP++KPP E  PP
Sbjct: 116 IEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPPIEYHPP 153

 Score =  152 bits (385), Expect = 9e-36
 Identities = 81/170 (47%), Positives = 91/170 (53%), Gaps = 16/170 (9%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQP----------------HVNPPPQYQPPHEK 144
           +PPYE  PP + P HEKPP  Y PPH K P                H  PP +Y PPHEK
Sbjct: 258 EPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEK 317

Query: 145 PPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP 324
           PP E     Y PPH  PP E+  P EKPP  + PP   PPHE  PP Y PP+EKPP   P
Sbjct: 318 PPVE-----YPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPHE-KPPVYEPPYEKPPSVCP 371

Query: 325 PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP   PPH    HE  S  Y P H+KPP+ + P     P +KPP  KSPP
Sbjct: 372 PPHEKPPH----HEKRSALYPPHHRKPPNHHKP----LPYKKPPFYKSPP 413

 Score =  132 bits (331), Expect = 2e-29
 Identities = 61/106 (57%), Positives = 70/106 (66%), Gaps = 1/106 (0%)
 Frame = +1

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN 339
           SPP + PPHE PP  H PPHEKPP  + PP  +PP  HPPP + PPHEKPP E PPP   
Sbjct: 1   SPPVHPPPHEKPPIVHPPPHEKPPLFE-PPFEKPPPAHPPPVHPPPHEKPPIEYPPPHTK 59

Query: 340 PPHE-KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP E  PPH  P  +Y PPH+KPP E P P  +PP  +PP+EK PP
Sbjct: 60  PPIEYPPPHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPP 105

 Score =  127 bits (320), Expect = 3e-28
 Identities = 62/126 (49%), Positives = 72/126 (57%), Gaps = 5/126 (3%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPP-HEKPPHE----HSPPGYQP 180
           PP+E PP EY PPHEKPP EY PPH K P   P P  +PP HEKPP E      PP Y+P
Sbjct: 302 PPHEKPPIEYAPPHEKPPVEYPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPHEKPPVYEP 361

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P+E PP    PPHEKPPH +      PPH   PP +   H+  P++ PP   +PP EKP 
Sbjct: 362 PYEKPPSVCPPPHEKPPHHEKRSALYPPHHRKPPNH---HKPLPYKKPPFYKSPPVEKPS 418

Query: 361 HEHPSP 378
                P
Sbjct: 419 SYESQP 424

[7][TOP]
>UniRef100_P93237 Proline-rich protein PRP2 n=1 Tax=Lupinus luteus RepID=P93237_LUPLU
          Length = 894

 Score =  209 bits (532), Expect = 8e-53
 Identities = 103/191 (53%), Positives = 117/191 (61%), Gaps = 33/191 (17%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQP------HVNPPPQYQPPHEKPPHEH- 159
            P   KPP  +PPP + PPHEKPP EY PPH K P      HV PP QY PPHEKPP E+ 
Sbjct: 486  PPFEKPPPVHPPPVHPPPHEKPPIEYPPPHTKPPIEYPPPHVKPPIQYPPPHEKPPIEYP 545

Query: 160  ----SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPE-----YQPPHEHPPPEYLPPHEKPP 312
                 PP Y+PP+E PPP H PPHEKPP   SPP      ++PP+E PP  + PPH+KPP
Sbjct: 546  LPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPP 605

Query: 313  ------HENPPPEYNPPHEKPPHEHPSP------EYQPPHQK-----PPHENPPPKFQPP 441
                  HE PP EY PPHEKPP E+P P      EY PPH+K     PP+E PPP   PP
Sbjct: 606  IEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPP 665

Query: 442  NEKPPHEKSPP 474
            +EKPP E  PP
Sbjct: 666  DEKPPIEYPPP 676

 Score =  205 bits (522), Expect = 1e-51
 Identities = 100/190 (52%), Positives = 116/190 (61%), Gaps = 32/190 (16%)
 Frame = +1

Query: 1   PHHAKPP-----YENPPPEYQPPHEKPPPEYQPPHGKQP-----HVNPPPQYQPPHEKPP 150
           P H KPP     YE PPP + PPH+KP  EY PPH K P     +  PPP + PPHEKPP
Sbjct: 245 PPHEKPPIHESPYEKPPPVHPPPHDKPSIEYPPPHEKPPVYEPPYDKPPPVHPPPHEKPP 304

Query: 151 HEHSPPG-----YQPPHEIPPPEHQPPHEKPP------HAKSPPEYQPPHEHPPPEYLPP 297
            E+ PP      ++PP+E PPPEH PPH+KPP      H K P EY PPHE PP EY PP
Sbjct: 305 IEYPPPHEKPPVHEPPYEKPPPEHSPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPP 364

Query: 298 HEKPPHENPPP------EYNPPHEK-----PPHEHPSPEYQPPHQKPPHENPPPKFQPPN 444
           HEKPP E PPP      EY PPHEK     PP+E   P + PP +KPP E PPP  +PP 
Sbjct: 365 HEKPPIEYPPPHEKPSIEYPPPHEKSPVYEPPYEKSPPVHPPPDEKPPIEYPPPHEKPPV 424

Query: 445 EKPPHEKSPP 474
            +PP++K PP
Sbjct: 425 HEPPYKKPPP 434

 Score =  204 bits (520), Expect = 2e-51
 Identities = 97/180 (53%), Positives = 112/180 (62%), Gaps = 22/180 (12%)
 Frame = +1

Query: 1    PHHAKPPYENPPP------EYQPPHEKPPPEYQPPHGKQP-----HVNPPPQYQPPHEKP 147
            P H KPP E PPP      +Y PPHEKPP EY  PH K P     +  PPP + PPHEKP
Sbjct: 513  PPHTKPPIEYPPPHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKP 572

Query: 148  PHEHSPPG-----YQPPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLP 294
            P E+SPP      ++PP+E PP  H PPH+K      PPH K P EY PPHE PP EY P
Sbjct: 573  PIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPP 632

Query: 295  PHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            PHEKPP E PPP   PP  +PP+E P P + PP +KPP E PPP  +PP  +PP+EK PP
Sbjct: 633  PHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPP 692

 Score =  203 bits (516), Expect = 5e-51
 Identities = 90/170 (52%), Positives = 106/170 (62%), Gaps = 16/170 (9%)
 Frame = +1

Query: 13   KPPYENPPPEYQPPHEKPPPEYQPPHGK----------------QPHVNPPPQYQPPHEK 144
            +PPYE PPP + PPHEKPP EY PPH K                 PH  PP +Y PPHEK
Sbjct: 555  EPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPPIEYHPPHEK 614

Query: 145  PPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP 324
            PP E+ PP  +PP E PPP  +PP E PP  + PP Y+PP+E PPP + PP EKPP E P
Sbjct: 615  PPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIEYP 674

Query: 325  PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            PP   PP  +PP+E P P   PPH KPP E PPP  +PP  +PP+E+SPP
Sbjct: 675  PPLEKPPVHEPPYEKPPPVQPPPHDKPPIEYPPPHEKPPVYEPPYERSPP 724

 Score =  202 bits (514), Expect = 9e-51
 Identities = 94/176 (53%), Positives = 108/176 (61%), Gaps = 22/176 (12%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGK-----QPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           +PPY+ PPP + PPHEKPP EY PPH K      P+  PPP++ PPH+KPP E+ PP  +
Sbjct: 286 EPPYDKPPPVHPPPHEKPPIEYPPPHEKPPVHEPPYEKPPPEHSPPHDKPPIEYHPPHEK 345

Query: 178 PPHEIPPPEHQPPHE-KPPHAKSPPEYQPPHEHPPPEYLPPHEK---------------- 306
           PP E PPP  +PP E  PPH K P EY PPHE P  EY PPHEK                
Sbjct: 346 PPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPSIEYPPPHEKSPVYEPPYEKSPPVHP 405

Query: 307 PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP E PP EY PPHEKPP   P  +  PPH KPP E PPP  +PP  +PP+EKSPP
Sbjct: 406 PPDEKPPIEYPPPHEKPPVHEPPYKKPPPHDKPPIEYPPPHEKPPVYEPPYEKSPP 461

 Score =  201 bits (511), Expect = 2e-50
 Identities = 98/196 (50%), Positives = 114/196 (58%), Gaps = 38/196 (19%)
 Frame = +1

Query: 1    PHHAKPPYENPPPE-----YQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
            P H KPP  +PPP      ++PP EKPPP + PP    PH  PP +Y PPH KPP E+ P
Sbjct: 465  PPHEKPPIVHPPPHEKPPLFEPPFEKPPPVHPPPVHPPPHEKPPIEYPPPHTKPPIEYPP 524

Query: 166  PG------YQPPHEIPPPEHQPPHEKPP-----HAKSPPEYQPPHEHPPPEYLPPHEK-- 306
            P       Y PPHE PP E+  PHEKPP     + K PP + PPHE PP EY PPHEK  
Sbjct: 525  PHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPP 584

Query: 307  --------------PPHENPPPEYNPPHEKPPHEHPSP------EYQPPHQKPPHENPPP 426
                          PPH+ PP EY+PPHEKPP E+P P      EY PPH+KPP E PPP
Sbjct: 585  VHEPPYEKPPLVHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPP 644

Query: 427  KFQPPNEKPPHEKSPP 474
              +PP  +PP+EK PP
Sbjct: 645  HEKPPVYEPPYEKPPP 660

 Score =  200 bits (509), Expect = 4e-50
 Identities = 100/203 (49%), Positives = 121/203 (59%), Gaps = 45/203 (22%)
 Frame = +1

Query: 1   PHHAKPP------YENPPPEYQPPHEKPPPEYQPPHG---------------KQPHVNPP 117
           P H KPP      YE PPP Y+PP+EK PP +QPP+                + P+  PP
Sbjct: 202 PPHKKPPIGYPPSYEKPPPVYEPPYEKSPPVHQPPYETPPIENPPHEKPPIHESPYEKPP 261

Query: 118 PQYQPPHEKP------PHEHSPPGYQPPHEIPPPEHQPPHEK------PPHAKSPPEYQP 261
           P + PPH+KP      PHE  PP Y+PP++ PPP H PPHEK      PPH K PP ++P
Sbjct: 262 PVHPPPHDKPSIEYPPPHE-KPPVYEPPYDKPPPVHPPPHEKPPIEYPPPHEK-PPVHEP 319

Query: 262 PHEHPPPEYLPPHEK------PPHENPPPEYNPPHEKPPHEHPSP------EYQPPHQKP 405
           P+E PPPE+ PPH+K      PPHE PP EY PPHEKPP E+P P      EY PPH+KP
Sbjct: 320 PYEKPPPEHSPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKP 379

Query: 406 PHENPPPKFQPPNEKPPHEKSPP 474
             E PPP  + P  +PP+EKSPP
Sbjct: 380 SIEYPPPHEKSPVYEPPYEKSPP 402

 Score =  200 bits (508), Expect = 5e-50
 Identities = 91/171 (53%), Positives = 111/171 (64%), Gaps = 13/171 (7%)
 Frame = +1

Query: 1   PH-HAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           PH H  PP++ PP  Y P +EKPPP Y+PP+ K P V+ PP   PP E PPHE  PP ++
Sbjct: 196 PHVHPPPPHKKPPIGYPPSYEKPPPVYEPPYEKSPPVHQPPYETPPIENPPHE-KPPIHE 254

Query: 178 PPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN 339
            P+E PPP H PPH+K      PPH K PP Y+PP++ PPP + PPHEKPP E PPP   
Sbjct: 255 SPYEKPPPVHPPPHDKPSIEYPPPHEK-PPVYEPPYDKPPPVHPPPHEKPPIEYPPPHEK 313

Query: 340 PPHEKPPHEHPSPEYQPPHQK------PPHENPPPKFQPPNEKPPHEKSPP 474
           PP  +PP+E P PE+ PPH K      PPHE PP ++ PP+EKPP E  PP
Sbjct: 314 PPVHEPPYEKPPPEHSPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPP 364

 Score =  200 bits (508), Expect = 5e-50
 Identities = 89/165 (53%), Positives = 106/165 (64%), Gaps = 12/165 (7%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQP------HVNPPPQYQPPHEKPPHEHSPPGY 174
           +PPYE PPPE+ PPH+KPP EY PPH K P      H  PP +Y PPHEKPP E+ PP  
Sbjct: 318 EPPYEKPPPEHSPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHE 377

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
           +P  E PPP  + P  +PP+ KSPP + PP E PP EY PPHEKPP   PP +  PPH+K
Sbjct: 378 KPSIEYPPPHEKSPVYEPPYEKSPPVHPPPDEKPPIEYPPPHEKPPVHEPPYKKPPPHDK 437

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEK------PPHEKSP 471
           PP E+P P  +PP  +PP+E  PP   PP+EK      PPHEK P
Sbjct: 438 PPIEYPPPHEKPPVYEPPYEKSPPVHPPPHEKPPIVHPPPHEKPP 482

 Score =  199 bits (507), Expect = 6e-50
 Identities = 97/186 (52%), Positives = 109/186 (58%), Gaps = 32/186 (17%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQP-----------HVNPPPQYQPPHEKPP--- 150
           +PPYE  PP + PP EKPP EY PPH K P           H  PP +Y PPHEKPP   
Sbjct: 394 EPPYEKSPPVHPPPDEKPPIEYPPPHEKPPVHEPPYKKPPPHDKPPIEYPPPHEKPPVYE 453

Query: 151 --HEHSPPGYQPPHEIPPPEHQPPHEKPP----------HAKSPPEYQPPHEHPPPEYLP 294
             +E SPP + PPHE PP  H PPHEKPP              PP + PPHE PP EY P
Sbjct: 454 PPYEKSPPVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPVHPPPVHPPPHEKPPIEYPP 513

Query: 295 PHEKPPHENPPP------EYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPP 456
           PH KPP E PPP      +Y PPHEKPP E+P P  +PP  +PP+E PPP   PP+EKPP
Sbjct: 514 PHTKPPIEYPPPHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPP 573

Query: 457 HEKSPP 474
            E SPP
Sbjct: 574 IEYSPP 579

 Score =  199 bits (505), Expect = 1e-49
 Identities = 94/173 (54%), Positives = 106/173 (61%), Gaps = 16/173 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPP------QYQPPHEK-----P 147
           P    PP+E PP EY PPHEKPP EY PPH K P   PPP      +Y PPHEK     P
Sbjct: 336 PIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPSIEYPPPHEKSPVYEP 395

Query: 148 PHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEK-----PP 312
           P+E SPP + PP E PP E+ PPHEKPP  + P +  PPH+ PP EY PPHEK     PP
Sbjct: 396 PYEKSPPVHPPPDEKPPIEYPPPHEKPPVHEPPYKKPPPHDKPPIEYPPPHEKPPVYEPP 455

Query: 313 HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           +E  PP + PPHEKPP  HP P  +PP  +PP E PPP   PP   PPHEK P
Sbjct: 456 YEKSPPVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPVHPPPVHPPPHEKPP 508

 Score =  198 bits (503), Expect = 2e-49
 Identities = 92/174 (52%), Positives = 109/174 (62%), Gaps = 16/174 (9%)
 Frame = +1

Query: 1    PHHAKPPYENP-----PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
            P H KPP E P     PP Y+PP+EKPPP + PPH K P    PP  +PP  +PP+E  P
Sbjct: 535  PPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPP 594

Query: 166  PGYQPPHEIPPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEK-----PP 312
              + PPH+ PP E+ PPHEK      PPH K P EY PPHE PP EY PPHEK     PP
Sbjct: 595  LVHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPP 654

Query: 313  HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            +E PPP + PP EKPP E+P P  +PP  +PP+E PPP   PP++KPP E  PP
Sbjct: 655  YEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPVQPPPHDKPPIEYPPP 708

 Score =  196 bits (499), Expect = 5e-49
 Identities = 90/177 (50%), Positives = 114/177 (64%), Gaps = 23/177 (12%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQ-------------PPHEKPPH 153
           +PPYE PP  + PPHEKPPP Y+ P  K PHV+PPP ++             PP  +PP+
Sbjct: 167 EPPYEKPPILHPPPHEKPPPLYESPSEKPPHVHPPPPHKKPPIGYPPSYEKPPPVYEPPY 226

Query: 154 EHSPPGYQPPHEIPPPEHQPPHEKPP-----HAKSPPEYQPPHEHPPPEYLPPHEK---- 306
           E SPP +QPP+E PP E+ PPHEKPP     + K PP + PPH+ P  EY PPHEK    
Sbjct: 227 EKSPPVHQPPYETPPIEN-PPHEKPPIHESPYEKPPPVHPPPHDKPSIEYPPPHEKPPVY 285

Query: 307 -PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            PP++ PPP + PPHEKPP E+P P  +PP  +PP+E PPP+  PP++KPP E  PP
Sbjct: 286 EPPYDKPPPVHPPPHEKPPIEYPPPHEKPPVHEPPYEKPPPEHSPPHDKPPIEYHPP 342

 Score =  196 bits (497), Expect = 9e-49
 Identities = 92/179 (51%), Positives = 103/179 (57%), Gaps = 21/179 (11%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQ-----YQPPHEKPPHEHSP 165
            P    PP+E PP EY PPHEKPP EY PPH K P   PPP      Y+PP+EKPP  H P
Sbjct: 605  PIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPP 664

Query: 166  PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPP----------- 312
            P  +PP E PPP  +PP  +PP+ K PP   PPH+ PP EY PPHEKPP           
Sbjct: 665  PDEKPPIEYPPPLEKPPVHEPPYEKPPPVQPPPHDKPPIEYPPPHEKPPVYEPPYERSPP 724

Query: 313  -----HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
                 HE PP  Y PPHEK P   P  E  PP   PPHE PP ++ PP+EKPP E  PP
Sbjct: 725  VHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPP 783

 Score =  193 bits (490), Expect = 6e-48
 Identities = 83/158 (52%), Positives = 101/158 (63%), Gaps = 5/158 (3%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP++ PP EY PPHEKPP EY PPH K P   PPP  +PP E PP    PP Y+PP+E P
Sbjct: 599  PPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKP 658

Query: 196  PPEHQPPHEK-----PPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            PP H PP EK     PP  + PP ++PP+E PPP   PPH+KPP E PPP   PP  +PP
Sbjct: 659  PPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPVQPPPHDKPPIEYPPPHEKPPVYEPP 718

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            +E   P + P H+KPP   PPP  + P  +PP+EK+PP
Sbjct: 719  YERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPP 756

 Score =  192 bits (489), Expect = 7e-48
 Identities = 96/180 (53%), Positives = 108/180 (60%), Gaps = 23/180 (12%)
 Frame = +1

Query: 1   PHHAKPPYENPPP------EYQPPHEKPPPEYQPPHGKQPHVNPPP------QYQPPHEK 144
           P H KPP E PPP      EY PPHEK P  Y+PP+ K P V+PPP      +Y PPHEK
Sbjct: 363 PPHEKPPIEYPPPHEKPSIEYPPPHEKSPV-YEPPYEKSPPVHPPPDEKPPIEYPPPHEK 421

Query: 145 PPHEHSPPGYQPPHEIPPPEHQPPHEKPP-----HAKSPPEYQPPHEHPPPEYLPPHEK- 306
           PP    P    PPH+ PP E+ PPHEKPP     + KSPP + PPHE PP  + PPHEK 
Sbjct: 422 PPVHEPPYKKPPPHDKPPIEYPPPHEKPPVYEPPYEKSPPVHPPPHEKPPIVHPPPHEKP 481

Query: 307 ----PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-KPPHEKSP 471
               PP E PPP + PP   PPHE P  EY PPH KPP E PPP  +PP +  PPHEK P
Sbjct: 482 PLFEPPFEKPPPVHPPPVHPPPHEKPPIEYPPPHTKPPIEYPPPHVKPPIQYPPPHEKPP 541

 Score =  192 bits (489), Expect = 7e-48
 Identities = 96/195 (49%), Positives = 111/195 (56%), Gaps = 37/195 (18%)
 Frame = +1

Query: 1    PHHAKPPYENPPPE-----YQPPHEKPPPEYQPPHGKQPHVNPPPQ-----YQPPHEKPP 150
            P H KPP E PPP      Y+PP+EK PP + PPH K P V+PPP      ++PP EKPP
Sbjct: 433  PPHDKPPIEYPPPHEKPPVYEPPYEKSPPVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPP 492

Query: 151  HEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP-- 324
              H PP + PPHE PP E+ PPH KPP      EY PPH  PP +Y PPHEKPP E P  
Sbjct: 493  PVHPPPVHPPPHEKPPIEYPPPHTKPPI-----EYPPPHVKPPIQYPPPHEKPPIEYPLP 547

Query: 325  ---PPEYNPPHEKPPHEHPSP------EYQPPHQK----------------PPHENPPPK 429
               PP Y PP+EKPP  HP P      EY PPH+K                PPH+ PP +
Sbjct: 548  HEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPPIE 607

Query: 430  FQPPNEKPPHEKSPP 474
            + PP+EKPP E  PP
Sbjct: 608  YHPPHEKPPIEYPPP 622

 Score =  192 bits (487), Expect = 1e-47
 Identities = 94/184 (51%), Positives = 110/184 (59%), Gaps = 27/184 (14%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPH-------EKPPPEYQPPHGKQPHVNPPPQYQ--PPHEKPPHE 156
           ++ +P YE P P ++PP         +PPP Y PP  K    NPPP Y+  PPHEKPPHE
Sbjct: 24  NYKQPTYEPPTPIFEPPPFETLPPVYEPPPVYHPPREKPSIENPPPSYEKPPPHEKPPHE 83

Query: 157 HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEK------PPHE 318
            SPP Y PPHE P PE  P HE     KSPP Y  PHE PP E  PPH+K      PP+E
Sbjct: 84  KSPPEYSPPHEEPTPEFPPSHE-----KSPPLYPSPHEKPPIECPPPHDKLPPIYEPPNE 138

Query: 319 NPPPEYNPPHEK------PPHEHPSPEYQPPHQK------PPHENPPPKFQPPNEKPPHE 462
            PPP + PPHEK      PPHE PSP Y+PP++K      PPHE PPP ++ P+EKPPH 
Sbjct: 139 KPPPLHPPPHEKPPIDYPPPHEKPSPVYEPPYEKPPILHPPPHEKPPPLYESPSEKPPHV 198

Query: 463 KSPP 474
             PP
Sbjct: 199 HPPP 202

 Score =  189 bits (480), Expect = 8e-47
 Identities = 94/185 (50%), Positives = 110/185 (59%), Gaps = 32/185 (17%)
 Frame = +1

Query: 13   KPPYENPPPEYQPPHEKPPPEY----------QPPHGKQPHVNPPPQYQPPHEKPPHEHS 162
            +PPYE PPP + PP EKPP EY          +PP+ K P V PPP  +PP E PP    
Sbjct: 652  EPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPVQPPPHDKPPIEYPPPHEK 711

Query: 163  PPGYQPPHEIPPPEHQPPHEKPPHAKSPPE-----YQPPHEHPPPEYLPPHEKPP----- 312
            PP Y+PP+E  PP H P HEKPP    PP      ++PP+E  PP +LPPHEKPP     
Sbjct: 712  PPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAP 771

Query: 313  -HENPPPEYNPPHEKPPHEHPSPEYQPP-HQKPPHENP----PPKFQPPNEK------PP 456
             HE PP EY PPH KPP E+PSP  +PP H+KPP E P    PP ++PP EK      PP
Sbjct: 772  PHEKPPVEYPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPHEKPPVYEPPYEKPPSVCPPP 831

Query: 457  HEKSP 471
            HEK P
Sbjct: 832  HEKPP 836

 Score =  188 bits (477), Expect = 2e-46
 Identities = 90/181 (49%), Positives = 109/181 (60%), Gaps = 28/181 (15%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQP------HVNPPPQYQPPHEKPPHEHSPP--- 168
           PP+E PP +Y PPHEKP P Y+PP+ K P      H  PPP Y+ P EKPPH H PP   
Sbjct: 146 PPHEKPPIDYPPPHEKPSPVYEPPYEKPPILHPPPHEKPPPLYESPSEKPPHVHPPPPHK 205

Query: 169 ----GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLP----PHEKPPHENP 324
               GY P +E PPP ++PP+EK P    PP   PP E+PP E  P    P+EKPP  +P
Sbjct: 206 KPPIGYPPSYEKPPPVYEPPYEKSPPVHQPPYETPPIENPPHEKPPIHESPYEKPPPVHP 265

Query: 325 PP------EYNPPHEK-----PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           PP      EY PPHEK     PP++ P P + PPH+KPP E PPP  +PP  +PP+EK P
Sbjct: 266 PPHDKPSIEYPPPHEKPPVYEPPYDKPPPVHPPPHEKPPIEYPPPHEKPPVHEPPYEKPP 325

Query: 472 P 474
           P
Sbjct: 326 P 326

 Score =  188 bits (477), Expect = 2e-46
 Identities = 92/184 (50%), Positives = 107/184 (58%), Gaps = 27/184 (14%)
 Frame = +1

Query: 1    PHHAKPPYENPPPE-----YQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
            P H KPP E PPP      Y+PP+EKPPP + PP  K P   PPP  +PP  +PP+E  P
Sbjct: 632  PPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPP 691

Query: 166  PGYQPPHEIPPPEHQPPHEKPP-----HAKSPPEYQPPHEHPPPEYLPPHEK-------- 306
            P   PPH+ PP E+ PPHEKPP     + +SPP + P HE PP  Y PPHEK        
Sbjct: 692  PVQPPPHDKPPIEYPPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPY 751

Query: 307  --------PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKP-PHENPPPKFQPPNEKPPH 459
                    PPHE PP EY PPHEKPP E+P P  +PP + P P E PP   +PP E PPH
Sbjct: 752  EKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPH 811

Query: 460  EKSP 471
            EK P
Sbjct: 812  EKPP 815

 Score =  187 bits (475), Expect = 3e-46
 Identities = 95/191 (49%), Positives = 110/191 (57%), Gaps = 33/191 (17%)
 Frame = +1

Query: 1    PHHAKPPYENPPP------EYQPPHEKPPPEYQPPHGKQP-----HVNPPPQYQPPHEKP 147
            P H KPP E PPP      EY PPHEKPP EY PPH K P     +  PPP + PP EKP
Sbjct: 610  PPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKP 669

Query: 148  PHEH-----SPPGYQPPHEIPPPEHQPPHEKPP------HAKSPPEYQPPHEHPPPEYLP 294
            P E+      PP ++PP+E PPP   PPH+KPP      H K PP Y+PP+E  PP + P
Sbjct: 670  PIEYPPPLEKPPVHEPPYEKPPPVQPPPHDKPPIEYPPPHEK-PPVYEPPYERSPPVHPP 728

Query: 295  PHEKPPHENPPPE-----YNPPHEK------PPHEHPSPEYQPPHQKPPHENPPPKFQPP 441
             HEKPP   PPP      + PP+EK      PPHE P  EY PPH+KPP E PPP  +PP
Sbjct: 729  SHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVKPP 788

Query: 442  NEKPPHEKSPP 474
             E P   + PP
Sbjct: 789  VEYPSPAEKPP 799

 Score =  186 bits (471), Expect = 9e-46
 Identities = 92/189 (48%), Positives = 104/189 (55%), Gaps = 31/189 (16%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQ--PPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEK---------- 144
           P   KP  ENPPP Y+  PPHEKPP E  PP    PH  P P++ P HEK          
Sbjct: 57  PPREKPSIENPPPSYEKPPPHEKPPHEKSPPEYSPPHEEPTPEFPPSHEKSPPLYPSPHE 116

Query: 145 -------PPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHE 303
                  PPH+  PP Y+PP+E PPP H PPHEKP     P +Y PPHE P P Y PP+E
Sbjct: 117 KPPIECPPPHDKLPPIYEPPNEKPPPLHPPPHEKP-----PIDYPPPHEKPSPVYEPPYE 171

Query: 304 K------PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPP------HENPPPKFQPPNE 447
           K      PPHE PPP Y  P EKPPH HP     PPH+KPP      +E PPP ++PP E
Sbjct: 172 KPPILHPPPHEKPPPLYESPSEKPPHVHP----PPPHKKPPIGYPPSYEKPPPVYEPPYE 227

Query: 448 KPPHEKSPP 474
           K P    PP
Sbjct: 228 KSPPVHQPP 236

 Score =  184 bits (467), Expect = 3e-45
 Identities = 92/198 (46%), Positives = 106/198 (53%), Gaps = 40/198 (20%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-KPPHEHSPPGYQ 177
           P H KPP+E  PPEY PPHE+P PE+ P H K P + P P  +PP E  PPH+  PP Y+
Sbjct: 75  PPHEKPPHEKSPPEYSPPHEEPTPEFPPSHEKSPPLYPSPHEKPPIECPPPHDKLPPIYE 134

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPP------HENPPPEYN 339
           PP+E PPP H PPHEKPP      +Y PPHE P P Y PP+EKPP      HE PPP Y 
Sbjct: 135 PPNEKPPPLHPPPHEKPPI-----DYPPPHEKPSPVYEPPYEKPPILHPPPHEKPPPLYE 189

Query: 340 PPHEKPPHEHPSPEY-----------------------------QPPHQKPPHENPP--- 423
            P EKPPH HP P +                             QPP++ PP ENPP   
Sbjct: 190 SPSEKPPHVHPPPPHKKPPIGYPPSYEKPPPVYEPPYEKSPPVHQPPYETPPIENPPHEK 249

Query: 424 -PKFQPPNEKPPHEKSPP 474
            P  + P EKPP    PP
Sbjct: 250 PPIHESPYEKPPPVHPPP 267

 Score =  183 bits (465), Expect = 4e-45
 Identities = 89/171 (52%), Positives = 101/171 (59%), Gaps = 17/171 (9%)
 Frame = +1

Query: 13   KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEI 192
            +PPYE PPP   PPH+KPP EY PPH K P   PP +  PP   P HE  P  Y PPHE 
Sbjct: 684  EPPYEKPPPVQPPPHDKPPIEYPPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHE- 742

Query: 193  PPPEHQPPHEK------PPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP-HE 351
              P H+PP+EK      PPH K P EY PPHE PP EY PPH KPP E P P   PP HE
Sbjct: 743  KSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVKPPVEYPSPAEKPPTHE 802

Query: 352  KPPHEHP----SPEYQPPHQKPPHENPPPKFQPPNEK------PPHEKSPP 474
            KPP E P     P Y+PP++KPP   PPP  +PP+ +      PPH + PP
Sbjct: 803  KPPIEFPPHEKPPVYEPPYEKPPSVCPPPHEKPPHHEKRSALYPPHHRKPP 853

 Score =  178 bits (452), Expect = 1e-43
 Identities = 94/197 (47%), Positives = 106/197 (53%), Gaps = 44/197 (22%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQ--PPHEKPPHEHSPPGYQPPHE 189
           P +E PP E  PP  +PPP Y PP  K    NPPP Y+  PPHEKPPHE SPP Y PPHE
Sbjct: 35  PIFEPPPFETLPPVYEPPPVYHPPREKPSIENPPPSYEKPPPHEKPPHEKSPPEYSPPHE 94

Query: 190 IPPPEHQPPHEK-----------------PPHAKSPPEYQPPHEHPPPEYLPPHEKPP-- 312
            P PE  P HEK                 PPH K PP Y+PP+E PPP + PPHEKPP  
Sbjct: 95  EPTPEFPPSHEKSPPLYPSPHEKPPIECPPPHDKLPPIYEPPNEKPPPLHPPPHEKPPID 154

Query: 313 ----HENPPPEYNPPHEKPPHEHPSP-EYQPPHQKPPHENP----------------PPK 429
               HE P P Y PP+EKPP  HP P E  PP  + P E P                PP 
Sbjct: 155 YPPPHEKPSPVYEPPYEKPPILHPPPHEKPPPLYESPSEKPPHVHPPPPHKKPPIGYPPS 214

Query: 430 FQ--PPNEKPPHEKSPP 474
           ++  PP  +PP+EKSPP
Sbjct: 215 YEKPPPVYEPPYEKSPP 231

 Score =  147 bits (372), Expect = 3e-34
 Identities = 81/173 (46%), Positives = 90/173 (52%), Gaps = 17/173 (9%)
 Frame = +1

Query: 13   KPPYENPPPEYQPPHEKPPPEYQPPHGKQP----------------HVNPPPQYQPPHEK 144
            +PPYE  PP + P HEKPP  Y PPH K P                H  PP +Y PPHEK
Sbjct: 716  EPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEK 775

Query: 145  PPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP 324
            PP E     Y PPH  PP E+  P EKPP  + PP   PPHE  PP Y PP+EKPP   P
Sbjct: 776  PPVE-----YPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPHE-KPPVYEPPYEKPPSVCP 829

Query: 325  PPEYNPPHEKPPHEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEKSPPAS 480
            PP   PPH    HE  S  Y P H+KPP H  P P  +PP  K    KS  A+
Sbjct: 830  PPHEKPPH----HEKRSALYPPHHRKPPNHHKPLPYKKPPFYKSHQWKSHQAT 878

 Score =  124 bits (312), Expect = 2e-27
 Identities = 61/130 (46%), Positives = 73/130 (56%), Gaps = 5/130 (3%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPP-HEKPPHE----HSPPGYQP 180
            PP+E PP EY PPHEKPP EY PPH K P   P P  +PP HEKPP E      PP Y+P
Sbjct: 760  PPHEKPPIEYAPPHEKPPVEYPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPHEKPPVYEP 819

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P+E PP    PPHEKPPH +      PPH   PP +   H+  P++ PP  +   H+   
Sbjct: 820  PYEKPPSVCPPPHEKPPHHEKRSALYPPHHRKPPNH---HKPLPYKKPP--FYKSHQWKS 874

Query: 361  HEHPSPEYQP 390
            H+  SP   P
Sbjct: 875  HQATSPNLMP 884

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 4/69 (5%)
 Frame = +1

Query: 280 PEYLPPHEKPPHENPPPEYNPP--HEKPPHEHPSPEYQPPHQKPPHENPPPKFQ--PPNE 447
           P  L  +++P +E P P + PP     PP   P P Y PP +KP  ENPPP ++  PP+E
Sbjct: 19  PPVLANYKQPTYEPPTPIFEPPPFETLPPVYEPPPVYHPPREKPSIENPPPSYEKPPPHE 78

Query: 448 KPPHEKSPP 474
           KPPHEKSPP
Sbjct: 79  KPPHEKSPP 87

[8][TOP]
>UniRef100_Q9FUR6 ENOD2 (Fragment) n=1 Tax=Cladrastis kentukea RepID=Q9FUR6_CLALU
          Length = 244

 Score =  207 bits (527), Expect = 3e-52
 Identities = 108/195 (55%), Positives = 116/195 (59%), Gaps = 38/195 (19%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPHEKPPPEYQPP-HGKQP-------HVNPPPQYQPP-------- 135
           HH  PP+E PPP Y PPHEKPPP YQPP H K P       HV PPP YQPP        
Sbjct: 44  HH--PPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYQPPPHVKPPPVYQPPPHVKPPPV 101

Query: 136 HEKPPHEHSPPGYQPPHEIPPPEHQPP-HEKPP------HAKSPPEYQPP-HEHPPPEYL 291
           ++ PPHE  P  Y PPHE PPP +QPP HEKPP      H K PP YQPP HE PPP Y 
Sbjct: 102 YQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYP 161

Query: 292 PPHEKPP-------HENPPPEYNPPHEK-------PPHEHPSPEYQPPHQKPPHENPPPK 429
           PPHEKPP       HE PPP Y PPHEK       PPHE P P Y+PP  +PP    PP 
Sbjct: 162 PPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKP-PVYKPPGYEPPPVEKPPV 220

Query: 430 FQPPNEKPPHEKSPP 474
           ++PP EKPP  K PP
Sbjct: 221 YKPPVEKPPSYKPPP 235

 Score =  197 bits (500), Expect = 4e-49
 Identities = 99/183 (54%), Positives = 109/183 (59%), Gaps = 25/183 (13%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPP--HEKPPHEHSPPGY 174
           P +  PP E PPP Y+PP   PPP + PPH K P V PPP  +PP  ++ PPHE  PP Y
Sbjct: 20  PTYEPPPTEKPPPVYKPPIY-PPPVHHPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVY 78

Query: 175 Q-PPHEIPPPEHQPPHEKPPHAKSPPEYQ-PPHEHPPPEYLPPHEK-------PPHENPP 327
           Q PPH  PPP +QP    PPH K PP YQ PPHE PP  Y PPHEK       PPHE PP
Sbjct: 79  QPPPHVKPPPVYQP----PPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPP 134

Query: 328 PEYNPPHEK-------PPHEHPSPEYQPPHQK-------PPHENPPPKFQPPNEKPPHEK 465
           P Y PPHEK       PPHE P P Y PPH+K       PPHE PPP + PP+EKPP   
Sbjct: 135 PVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVY 194

Query: 466 SPP 474
            PP
Sbjct: 195 QPP 197

 Score =  175 bits (444), Expect = 1e-42
 Identities = 87/158 (55%), Positives = 92/158 (58%), Gaps = 8/158 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPP-------HEH 159
           P +  PP+E PP  Y PPHEKPPP YQPP    PH  PPP Y PPHEKPP       HE 
Sbjct: 100 PVYQPPPHEKPPSVYPPPHEKPPPVYQPP----PHEKPPPVYPPPHEKPPPVYQPPPHEK 155

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYL-PPHEKPPHENPPPEY 336
            PP Y PPHE PPP +QPP    PH K PP Y PPHE PPP Y  PPHEKPP   PP   
Sbjct: 156 PPPVYPPPHEKPPPVYQPP----PHEKPPPVYPPPHEKPPPVYQPPPHEKPPVYKPPGYE 211

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEK 450
            PP EKP      P Y+PP +KPP   PPP    P  K
Sbjct: 212 PPPVEKP------PVYKPPVEKPPSYKPPPYGHYPPSK 243

 Score =  152 bits (384), Expect = 1e-35
 Identities = 82/174 (47%), Positives = 91/174 (52%), Gaps = 54/174 (31%)
 Frame = +1

Query: 115 PPQYQPP-------HEKPPHEHSPPGYQ----------PPHEIPPPEHQPPHEK------ 225
           PP Y+PP       +E PP E  PP Y+          PPHE PPP + PPHEK      
Sbjct: 8   PPTYEPPATEKPPTYEPPPTEKPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPVYQ 67

Query: 226 -PPHAKSPPEYQ-PPHEHPPPEYLPP--------HEKPPHENPPPEYNPPHEK------- 354
            PPH K PP YQ PPH  PPP Y PP        ++ PPHE PP  Y PPHEK       
Sbjct: 68  PPPHEKPPPVYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQP 127

Query: 355 PPHEHPSPEYQPPHQK-------PPHENPPPKFQPPNEK-------PPHEKSPP 474
           PPHE P P Y PPH+K       PPHE PPP + PP+EK       PPHEK PP
Sbjct: 128 PPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPP 181

 Score =  119 bits (298), Expect = 1e-25
 Identities = 64/135 (47%), Positives = 74/135 (54%), Gaps = 29/135 (21%)
 Frame = +1

Query: 157 HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEK------PPHE 318
           + PP Y+PP    PP ++PP    P  K PP Y+PP  +PPP + PPHEK      PPHE
Sbjct: 6   YKPPTYEPPATEKPPTYEPP----PTEKPPPVYKPPI-YPPPVHHPPHEKPPPVYPPPHE 60

Query: 319 NPPPEYN-PPHEK-------PPHEHPSPEYQPP--------HQKPPHENPPPKFQPPNEK 450
            PPP Y  PPHEK       PPH  P P YQPP        +Q PPHE PP  + PP+EK
Sbjct: 61  KPPPVYQPPPHEKPPPVYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEK 120

Query: 451 -------PPHEKSPP 474
                  PPHEK PP
Sbjct: 121 PPPVYQPPPHEKPPP 135

[9][TOP]
>UniRef100_UPI0001983482 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983482
          Length = 329

 Score =  198 bits (504), Expect = 1e-49
 Identities = 99/183 (54%), Positives = 115/183 (62%), Gaps = 25/183 (13%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPP------HGKQPHVNPPPQYQPPHEKPPHEHS 162
           P H KPP E PPPE++PP EKPPPE++PP        K P   PPP+++PP EKPP EH 
Sbjct: 57  PEH-KPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHK 115

Query: 163 PP------GYQPPHEIPPPEHQPPHEKPPH------AKSPPEYQPPHEHPPPEYLPPHEK 306
           PP       ++PP E PPPEH+PP EKPP        K PPE++PP E PPPE+ PP EK
Sbjct: 116 PPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEK 175

Query: 307 PPH------ENPPPEYNPPHEKPPHEHPSP-EYQPPHQKPPHENPPPKFQPPNEKPPHEK 465
           PP       E PPPE+ PP EKPP EH  P E  PP  KPP E PPP+ +PP EKPP E 
Sbjct: 176 PPPLHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEH 235

Query: 466 SPP 474
            PP
Sbjct: 236 KPP 238

 Score =  197 bits (501), Expect = 3e-49
 Identities = 96/172 (55%), Positives = 110/172 (63%), Gaps = 14/172 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQ------PPHGKQPHVNPPPQYQPPHEKPPHEHS 162
           P H KPP E PPPE++PP EKPPPE++      PP  K P   PPP+++PP EKPP EH 
Sbjct: 35  PEH-KPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHK 93

Query: 163 ------PPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPP-EYLPPHEKPPHEN 321
                 PP ++PP E PPPEH+PP EKPP    PP  +PP EH PP E  PP  KPP E 
Sbjct: 94  PPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEK 153

Query: 322 PPPEYNPPHEKPPHEHPSP-EYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PPPE+ PP EKPP EH  P E  PP  KPP E PPP+ +PP EKPP E  PP
Sbjct: 154 PPPEHKPPVEKPPPEHKPPVEKPPPLHKPPVEKPPPEHKPPVEKPPPEHKPP 205

 Score =  195 bits (495), Expect = 1e-48
 Identities = 95/172 (55%), Positives = 112/172 (65%), Gaps = 19/172 (11%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHS------PPGYQ 177
           PP+E PPPE++PP EKPPPE++PP  K     PPP+++PP EKPP EH       PP ++
Sbjct: 28  PPFEKPPPEHKPPVEKPPPEHKPPVEK-----PPPEHKPPVEKPPPEHKPPVEKPPPEHK 82

Query: 178 PPHEIPPPEHQPPHEKPPH------AKSPPEYQPPHEHPPPEYLPPHEKPPHEN------ 321
           PP E PPPEH+PP EKPP        K PPE++PP E PPPE+ PP EKPP E+      
Sbjct: 83  PPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEK 142

Query: 322 PPPEYNPPHEKPPHEHPSP-EYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PPPE+ PP EKPP EH  P E  PP  KPP E PPP  +PP EKPP E  PP
Sbjct: 143 PPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPLHKPPVEKPPPEHKPP 194

 Score =  185 bits (470), Expect = 1e-45
 Identities = 94/182 (51%), Positives = 112/182 (61%), Gaps = 24/182 (13%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPP------HGKQPHVNPPPQYQPPHEKPPHEHS 162
           P H KPP E PPPE++PP EKPPPE++PP        K P   PPP+++PP EKPP EH 
Sbjct: 90  PEH-KPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHK 148

Query: 163 PP------GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPP-EYLPPHEKPPHEN 321
           PP       ++PP E PPPEH+PP EKPP    PP  +PP EH PP E  PP  KPP E 
Sbjct: 149 PPVEKPPPEHKPPVEKPPPEHKPPVEKPPPLHKPPVEKPPPEHKPPVEKPPPEHKPPVEK 208

Query: 322 PPPEYNPPHEKPPHEH------PSPEYQPPHQKPP---HENPPPKFQPPNE--KPPHEKS 468
           PPPE+ PP EKPP EH      P PE++PP +KPP    E P P+ +PP    KPP  + 
Sbjct: 209 PPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKEKPLPEHKPPTPVGKPPKGEK 268

Query: 469 PP 474
           PP
Sbjct: 269 PP 270

 Score =  167 bits (423), Expect = 3e-40
 Identities = 89/188 (47%), Positives = 112/188 (59%), Gaps = 28/188 (14%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPP------HGKQPHVNPPPQYQPPHEKPPHEHS 162
           P H KPP E PPPE++PP EKPPPE++PP        K P   PPP+++PP EKPP  H 
Sbjct: 123 PEH-KPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPLHK 181

Query: 163 PP------GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP 324
           PP       ++PP E PPPEH+PP EKP     PPE++PP E PPPE+     KPP E P
Sbjct: 182 PPVEKPPPEHKPPVEKPPPEHKPPVEKP-----PPEHKPPVEKPPPEH-----KPPVEKP 231

Query: 325 PPEYNPPHEKPPHEH---PSPEYQPP--------HQKPPH-----ENPPPKFQPPNEKPP 456
           PPE+ PP EKPP EH   P PE++PP         +KPPH      +PP +    + KPP
Sbjct: 232 PPEHKPPVEKPPPEHKEKPLPEHKPPTPVGKPPKGEKPPHCGHNPGHPPAENAEDSYKPP 291

Query: 457 HEKSPPAS 480
            +  PP++
Sbjct: 292 RKIKPPST 299

 Score =  157 bits (396), Expect = 5e-37
 Identities = 84/174 (48%), Positives = 103/174 (59%), Gaps = 17/174 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVN------PPPQYQPPHEKPPHEHS 162
           P H KPP E PPPE++PP EKPPPE++PP  K P ++      PPP+++PP EKPP EH 
Sbjct: 145 PEH-KPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPLHKPPVEKPPPEHKPPVEKPPPEH- 202

Query: 163 PPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPP---HENPPPE 333
               +PP E PPPEH+PP EKP     PPE++PP E PPPE+ PP EKPP    E P PE
Sbjct: 203 ----KPPVEKPPPEHKPPVEKP-----PPEHKPPVEKPPPEHKPPVEKPPPEHKEKPLPE 253

Query: 334 YNPP--------HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           + PP         EKPPH   +P + P         PP K +PP+   P EK P
Sbjct: 254 HKPPTPVGKPPKGEKPPHCGHNPGHPPAENAEDSYKPPRKIKPPS--TPAEKQP 305

 Score =  146 bits (368), Expect = 8e-34
 Identities = 83/178 (46%), Positives = 97/178 (54%), Gaps = 20/178 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP------EYQPPHGKQPHVNPPPQYQPPHEKPPHEHS 162
           P H KPP E PPPE++PP EKPPP      E  PP  K P   PPP+++PP EKPP EH 
Sbjct: 156 PEH-KPPVEKPPPEHKPPVEKPPPLHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEH- 213

Query: 163 PPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEH---PPPEYLPPHE--KPPHENPP 327
               +PP E PPPEH+PP EKPP    PP  +PP EH   P PE+ PP    KPP    P
Sbjct: 214 ----KPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKEKPLPEHKPPTPVGKPPKGEKP 269

Query: 328 PE--YNPPHEKPPHEHPSPEYQPPHQ-KPP------HENPPPKFQPPNEKPPHEKSPP 474
           P   +NP H  PP E+    Y+PP + KPP         P  K   P  KPPH+   P
Sbjct: 270 PHCGHNPGH--PPAENAEDSYKPPRKIKPPSTPAEKQPGPGKKLPTPPHKPPHKPPTP 325

 Score =  127 bits (319), Expect = 4e-28
 Identities = 68/148 (45%), Positives = 86/148 (58%), Gaps = 8/148 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P H KPP E PPPE++PP EKPPPE++PP  K     PPP+++PP EKPP EH PP  +P
Sbjct: 189 PEH-KPPVEKPPPEHKPPVEKPPPEHKPPVEK-----PPPEHKPPVEKPPPEHKPPVEKP 242

Query: 181 P---HEIPPPEHQPPHE--KPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP 345
           P    E P PEH+PP    KPP  + PP       HPP E      KPP +  PP  + P
Sbjct: 243 PPEHKEKPLPEHKPPTPVGKPPKGEKPPHCGHNPGHPPAENAEDSYKPPRKIKPP--STP 300

Query: 346 HEKPP---HEHPSPEYQPPHQKPPHENP 420
            EK P    + P+P ++PPH+ P   +P
Sbjct: 301 AEKQPGPGKKLPTPPHKPPHKPPTPTHP 328

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 43/120 (35%), Positives = 54/120 (45%), Gaps = 42/120 (35%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQP----------HVNPPPQYQPPH-EKP 147
           P H KPP E PPPE++PP EKPPPE++PP  K P          H  P P  +PP  EKP
Sbjct: 211 PEH-KPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKEKPLPEHKPPTPVGKPPKGEKP 269

Query: 148 PH----------EHSPPGYQPPHEIPPPE---------------------HQPPHEKPPH 234
           PH          E++   Y+PP +I PP                      H+PP    P+
Sbjct: 270 PHCGHNPGHPPAENAEDSYKPPRKIKPPSTPAEKQPGPGKKLPTPPHKPPHKPPTPTHPN 329

[10][TOP]
>UniRef100_P16329 Early nodulin-75 (Fragment) n=1 Tax=Pisum sativum RepID=NO75_PEA
          Length = 112

 Score =  167 bits (424), Expect = 3e-40
 Identities = 76/122 (62%), Positives = 83/122 (68%), Gaps = 4/122 (3%)
 Frame = +1

Query: 82  PPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQP 261
           PPH K PH N PP+YQPPHEKPPHEH           PPPE+QPPHEKPPH K  P+YQP
Sbjct: 1   PPHEKPPHENTPPEYQPPHEKPPHEH-----------PPPEYQPPHEKPPHEKPSPKYQP 49

Query: 262 PHEHPPPEYLPPHEKPPHENPPPEYNPPHEK--PPHEHPSPEYQ-PPHQKPPHE-NPPPK 429
           PHEH PPEY PPHEKPPHENPPP Y PP+E   PPH +  P +Q PP  KP     P P 
Sbjct: 50  PHEHSPPEYQPPHEKPPHENPPPVYKPPYENSPPPHVYHRPLFQAPPPVKPSRPFGPFPA 109

Query: 430 FQ 435
           F+
Sbjct: 110 FK 111

 Score =  154 bits (389), Expect = 3e-36
 Identities = 62/99 (62%), Positives = 74/99 (74%)
 Frame = +1

Query: 34  PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQP 213
           PP  +PPHE  PPEYQPPH K PH +PPP+YQPPHEKPPHE   P YQPPHE  PPE+QP
Sbjct: 1   PPHEKPPHENTPPEYQPPHEKPPHEHPPPEYQPPHEKPPHEKPSPKYQPPHEHSPPEYQP 60

Query: 214 PHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP 330
           PHEKPPH   PP Y+PP+E+ PP ++  + +P  + PPP
Sbjct: 61  PHEKPPHENPPPVYKPPYENSPPPHV--YHRPLFQAPPP 97

 Score =  144 bits (363), Expect = 3e-33
 Identities = 67/113 (59%), Positives = 74/113 (65%), Gaps = 3/113 (2%)
 Frame = +1

Query: 130 PPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP 309
           PPHEKPPHE++P           PE+QPPHEKPPH           EHPPPEY PPHEKP
Sbjct: 1   PPHEKPPHENTP-----------PEYQPPHEKPPH-----------EHPPPEYQPPHEKP 38

Query: 310 PHENPPPEYNPPHE-KPPHEHPSPEYQPPHQKPPHENPPPKFQPP--NEKPPH 459
           PHE P P+Y PPHE  P      PEYQPPH+KPPHENPPP ++PP  N  PPH
Sbjct: 39  PHEKPSPKYQPPHEHSP------PEYQPPHEKPPHENPPPVYKPPYENSPPPH 85

 Score =  137 bits (345), Expect = 4e-31
 Identities = 55/77 (71%), Positives = 63/77 (81%)
 Frame = +1

Query: 244 PPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP 423
           PP  +PPHE+ PPEY PPHEKPPHE+PPPEY PPHEKPPHE PSP+YQ     PPHE+ P
Sbjct: 1   PPHEKPPHENTPPEYQPPHEKPPHEHPPPEYQPPHEKPPHEKPSPKYQ-----PPHEHSP 55

Query: 424 PKFQPPNEKPPHEKSPP 474
           P++QPP+EKPPHE  PP
Sbjct: 56  PEYQPPHEKPPHENPPP 72

[11][TOP]
>UniRef100_P11728 Early nodulin-75 (Fragment) n=1 Tax=Medicago sativa
           RepID=NO75_MEDSA
          Length = 97

 Score =  166 bits (420), Expect = 7e-40
 Identities = 68/102 (66%), Positives = 78/102 (76%)
 Frame = +1

Query: 148 PHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPP 327
           PH H PP +QPP E PPPE+QPPHEKPPH   PPEYQPP++ PP      HEK P+E PP
Sbjct: 2   PHVHPPPEHQPPLEHPPPEYQPPHEKPPHVHPPPEYQPPYQKPP------HEKSPYEPPP 55

Query: 328 PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKP 453
            EY PPHEKPP   P  EYQPPH+KPPHE+PPP++QPP+EKP
Sbjct: 56  QEYQPPHEKPPQVKPPSEYQPPHEKPPHEHPPPEYQPPHEKP 97

 Score =  166 bits (419), Expect = 1e-39
 Identities = 68/103 (66%), Positives = 79/103 (76%)
 Frame = +1

Query: 97  QPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP 276
           +PHV+PPP++QPP E PP E+ PP  +PPH  PPPE+QPP++KPPH KSP      +E P
Sbjct: 1   RPHVHPPPEHQPPLEHPPPEYQPPHEKPPHVHPPPEYQPPYQKPPHEKSP------YEPP 54

Query: 277 PPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKP 405
           P EY PPHEKPP   PP EY PPHEKPPHEHP PEYQPPH+KP
Sbjct: 55  PQEYQPPHEKPPQVKPPSEYQPPHEKPPHEHPPPEYQPPHEKP 97

 Score =  162 bits (410), Expect = 1e-38
 Identities = 73/113 (64%), Positives = 82/113 (72%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPP 198
           P+ +PPPE+QPP E PPPEYQPPH K PHV+PPP+YQPP++KPPHE SP  Y+PP    P
Sbjct: 2   PHVHPPPEHQPPLEHPPPEYQPPHEKPPHVHPPPEYQPPYQKPPHEKSP--YEPP----P 55

Query: 199 PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
            E+QPPHEKPP  K P EYQPPHE       PPHE P     PPEY PPHEKP
Sbjct: 56  QEYQPPHEKPPQVKPPSEYQPPHEK------PPHEHP-----PPEYQPPHEKP 97

 Score =  144 bits (362), Expect = 4e-33
 Identities = 58/87 (66%), Positives = 66/87 (75%), Gaps = 5/87 (5%)
 Frame = +1

Query: 229 PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEH-----PSPEYQPP 393
           PH   PPE+QPP EHPPPEY PPHEKPPH +PPPEY PP++KPPHE      P  EYQPP
Sbjct: 2   PHVHPPPEHQPPLEHPPPEYQPPHEKPPHVHPPPEYQPPYQKPPHEKSPYEPPPQEYQPP 61

Query: 394 HQKPPHENPPPKFQPPNEKPPHEKSPP 474
           H+KPP   PP ++QPP+EKPPHE  PP
Sbjct: 62  HEKPPQVKPPSEYQPPHEKPPHEHPPP 88

 Score =  123 bits (309), Expect = 6e-27
 Identities = 61/102 (59%), Positives = 64/102 (62%), Gaps = 10/102 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKP-----PPEYQPPHGKQPH----VNPPPQ-YQPPHEKPP 150
           P H +PP E+PPPEYQPPHEKP     PPEYQPP+ K PH      PPPQ YQPPHEKPP
Sbjct: 8   PEH-QPPLEHPPPEYQPPHEKPPHVHPPPEYQPPYQKPPHEKSPYEPPPQEYQPPHEKPP 66

Query: 151 HEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP 276
               P  YQPP           HEKPPH   PPEYQPPHE P
Sbjct: 67  QVKPPSEYQPP-----------HEKPPHEHPPPEYQPPHEKP 97

[12][TOP]
>UniRef100_A5GXP3 Glycoamidase (Fragment) n=1 Tax=Candida albicans RepID=A5GXP3_CANAL
          Length = 227

 Score =  149 bits (377), Expect = 7e-35
 Identities = 83/171 (48%), Positives = 102/171 (59%), Gaps = 13/171 (7%)
 Frame = +1

Query: 1   PHHAKPPYENP-PPEYQPPHEKP-PPEYQPPHGKQPHVNP-PPQYQPPHE---KPPHE-- 156
           PH  +PP+E+P  P ++PPHE P  P ++PPH + PH  P  P + PPHE   +PPHE  
Sbjct: 41  PH--EPPHESPHEPPHEPPHEPPHEPPHEPPH-EPPHEPPHEPPHHPPHESPHEPPHEPP 97

Query: 157 HSPPGYQPPHEIP-PPEHQPPHEKPPHAKSPPEYQPPHE---HPPPEYLPPHEKPPHENP 324
           H PP ++PPHE P  P H+PPHE P      P ++PPHE   HPP E  PPHE P H   
Sbjct: 98  HEPP-HEPPHEPPHKPPHEPPHEPPHEPPHEPPHKPPHEPPHHPPHE--PPHEPPHHPPH 154

Query: 325 PPEYNPPHEKPPHEHP-SPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            P + PPH KPPHE P  P ++PPH KPPH  P     PP   PPH+   P
Sbjct: 155 EPPHKPPH-KPPHEPPHHPPHEPPH-KPPHHPPHEPPHPPPHPPPHDPHDP 203

 Score =  141 bits (355), Expect = 3e-32
 Identities = 86/173 (49%), Positives = 103/173 (59%), Gaps = 16/173 (9%)
 Frame = +1

Query: 4   HH----AKPPYENPPPEYQPPHEKPPPE--YQPPHGKQPHVNP-PPQYQPPHEKPPHE-- 156
           HH     KP     PP ++PPHE PP E  ++PPH + PH  P  P ++PPHE PPHE  
Sbjct: 22  HHKDKDGKPKKPEHPP-HEPPHE-PPHESPHEPPH-EPPHEPPHEPPHEPPHE-PPHEPP 77

Query: 157 HSPPGYQPPHEIP-PPEHQPPHEKPPHAKSPPEYQPPHEHP-PPEYLPPHE---KPPHEN 321
           H PP + PPHE P  P H+PPHE P      P ++PPHE P  P + PPHE   KPPHE 
Sbjct: 78  HEPP-HHPPHESPHEPPHEPPHEPPHEPPHEPPHKPPHEPPHEPPHEPPHEPPHKPPHEP 136

Query: 322 P-PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP-PPKFQPPNEKPPHEKSPP 474
           P  P + PPHE P H    P ++PPH KPPHE P  P  +PP+ KPPH   PP
Sbjct: 137 PHHPPHEPPHEPPHHPPHEPPHKPPH-KPPHEPPHHPPHEPPH-KPPHH--PP 185

 Score =  127 bits (319), Expect = 4e-28
 Identities = 72/147 (48%), Positives = 86/147 (58%), Gaps = 7/147 (4%)
 Frame = +1

Query: 55  HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE--HSPPGYQPPHEIP-PPEHQPPHEK 225
           H K    ++   GK      PP ++PPHE PPHE  H PP ++PPHE P  P H+PPHE 
Sbjct: 16  HHKDDKHHKDKDGKPKKPEHPP-HEPPHE-PPHESPHEPP-HEPPHEPPHEPPHEPPHEP 72

Query: 226 PPHAKSPPEYQPPHEHP-PPEYLPPHEKPPHENP-PPEYNPPHEKPPHEHP-SPEYQPPH 396
           P      P + PPHE P  P + PPHE PPHE P  P + PPHE PPHE P  P ++PPH
Sbjct: 73  PHEPPHEPPHHPPHESPHEPPHEPPHE-PPHEPPHEPPHKPPHE-PPHEPPHEPPHEPPH 130

Query: 397 QKPPHENP-PPKFQPPNEKPPHEKSPP 474
            KPPHE P  P  +PP+E P H    P
Sbjct: 131 -KPPHEPPHHPPHEPPHEPPHHPPHEP 156

 Score =  111 bits (277), Expect = 3e-23
 Identities = 69/140 (49%), Positives = 86/140 (61%), Gaps = 3/140 (2%)
 Frame = +1

Query: 1   PHHAKPPYENP-PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE--HSPPG 171
           PH  +PP+E P  P ++PPH KPP  ++PPH + PH    P ++PPH KPPHE  H PP 
Sbjct: 93  PH--EPPHEPPHEPPHEPPH-KPP--HEPPH-EPPH---EPPHEPPH-KPPHEPPHHPP- 141

Query: 172 YQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHE 351
           ++PPHE   P H PPHE PPH    P ++PPHE   P + PPHE PPH+   P ++PPHE
Sbjct: 142 HEPPHE---PPHHPPHE-PPH---KPPHKPPHE---PPHHPPHE-PPHK---PPHHPPHE 187

Query: 352 KPPHEHPSPEYQPPHQKPPH 411
            PPH  P P    PH    H
Sbjct: 188 -PPHPPPHPPPHDPHDPNHH 206

 Score =  106 bits (264), Expect = 9e-22
 Identities = 64/128 (50%), Positives = 77/128 (60%), Gaps = 5/128 (3%)
 Frame = +1

Query: 1   PHHAKPPYENP-PPEYQPPHEKP-PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY 174
           PH  +PP+E P  P ++PPHE P  P ++PPH K PH    P + PPHE PPHE   P +
Sbjct: 101 PH--EPPHEPPHKPPHEPPHEPPHEPPHEPPH-KPPH---EPPHHPPHE-PPHE---PPH 150

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP-PPEYNPPHE 351
            PPHE   P H+PPH KPPH    P + PPHE   P + PPH  PPHE P PP + PPH+
Sbjct: 151 HPPHE---PPHKPPH-KPPH---EPPHHPPHE---PPHKPPHH-PPHEPPHPPPHPPPHD 199

Query: 352 --KPPHEH 369
              P H H
Sbjct: 200 PHDPNHHH 207

 Score =  103 bits (258), Expect = 5e-21
 Identities = 70/160 (43%), Positives = 82/160 (51%), Gaps = 16/160 (10%)
 Frame = +1

Query: 43  YQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHE 222
           ++  H K        H K     P     PPHE PPHE       PPHE P   H+PPHE
Sbjct: 7   HKDKHHKGKHHKDDKHHKDKDGKPKKPEHPPHE-PPHE-------PPHESP---HEPPHE 55

Query: 223 KPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP-----PPEYNPPHE---KPPHEHP-S 375
            PPH       +PPHE       PPHE PPHE P      P ++PPHE   +PPHE P  
Sbjct: 56  -PPH-------EPPHE-------PPHE-PPHEPPHEPPHEPPHHPPHESPHEPPHEPPHE 99

Query: 376 PEYQPPHQ---KPPHENP-PPKFQPPNE---KPPHEKSPP 474
           P ++PPH+   KPPHE P  P  +PP+E   KPPHE  PP
Sbjct: 100 PPHEPPHEPPHKPPHEPPHEPPHEPPHEPPHKPPHE--PP 137

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 42/86 (48%), Positives = 51/86 (59%), Gaps = 6/86 (6%)
 Frame = +1

Query: 1   PHHAKPPYENPP-PEYQPPHEKPP-PEYQPPHGKQPHVNP-PPQYQPPHEKPPHE--HSP 165
           PH  KPP+E P  P ++PPHE P  P ++PPH K PH  P  P + PPHE PPH+  H P
Sbjct: 129 PH--KPPHEPPHHPPHEPPHEPPHHPPHEPPH-KPPHKPPHEPPHHPPHE-PPHKPPHHP 184

Query: 166 PGYQPPHEIP-PPEHQPPHEKPPHAK 240
           P ++PPH  P PP H P      H K
Sbjct: 185 P-HEPPHPPPHPPPHDPHDPNHHHGK 209

[13][TOP]
>UniRef100_Q9S9A7 ENOD2 protein (Fragment) n=1 Tax=Vicia faba RepID=Q9S9A7_VICFA
          Length = 127

 Score =  147 bits (371), Expect = 4e-34
 Identities = 66/127 (51%), Positives = 74/127 (58%), Gaps = 3/127 (2%)
 Frame = +1

Query: 100 PHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP 279
           PH N    Y PPHEKPPHEH+PP Y  PHE           KP H   PP+YQPPHEHP 
Sbjct: 1   PHENSSSYYPPPHEKPPHEHTPPNYHKPHE-----------KPLHENPPPQYQPPHEHPS 49

Query: 280 PEYLPPHEKPPHENPPPEYNPPHE---KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEK 450
           PEY PPH +PPHE+PPP Y PP+E    PP  H    + PPH KPP   PPP  +P   K
Sbjct: 50  PEYQPPHVEPPHESPPPVYKPPYETSPPPPVYHHPIFHSPPHVKPPVYPPPPLVKPSQMK 109

Query: 451 PPHEKSP 471
            P   +P
Sbjct: 110 KPQHYNP 116

 Score =  139 bits (351), Expect = 7e-32
 Identities = 64/126 (50%), Positives = 75/126 (59%), Gaps = 1/126 (0%)
 Frame = +1

Query: 52  PHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPP 231
           PHE     Y PPH K PH + PP Y  PHEKP HE+ PP YQPPHE P PE+QPPH +PP
Sbjct: 1   PHENSSSYYPPPHEKPPHEHTPPNYHKPHEKPLHENPPPQYQPPHEHPSPEYQPPHVEPP 60

Query: 232 HAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPH-QKPP 408
           H   PP Y+PP+E  PP        PP  + P  ++PPH KPP   P P  +P   +KP 
Sbjct: 61  HESPPPVYKPPYETSPP--------PPVYHHPIFHSPPHVKPPVYPPPPLVKPSQMKKPQ 112

Query: 409 HENPPP 426
           H NP P
Sbjct: 113 HYNPRP 118

 Score =  120 bits (300), Expect = 6e-26
 Identities = 56/111 (50%), Positives = 66/111 (59%), Gaps = 1/111 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P H KPP+E+ PP Y  PHEKP  E  PP  + PH +P P+YQPPH +PPHE  PP Y+P
Sbjct: 11  PPHEKPPHEHTPPNYHKPHEKPLHENPPPQYQPPHEHPSPEYQPPHVEPPHESPPPVYKP 70

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPH-EKPPHENPPP 330
           P+E  PP   PP    P   SPP  +PP   PPP   P   +KP H NP P
Sbjct: 71  PYETSPP---PPVYHHPIFHSPPHVKPPVYPPPPLVKPSQMKKPQHYNPRP 118

 Score =  117 bits (294), Expect = 3e-25
 Identities = 54/106 (50%), Positives = 61/106 (57%), Gaps = 19/106 (17%)
 Frame = +1

Query: 214 PHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPP 393
           PHE       PP  +PPHEH PP Y  PHEKP HENPPP+Y     +PPHEHPSPEYQPP
Sbjct: 1   PHENSSSYYPPPHEKPPHEHTPPNYHKPHEKPLHENPPPQY-----QPPHEHPSPEYQPP 55

Query: 394 HQKPPHENPPPKFQPPNE-------------------KPPHEKSPP 474
           H +PPHE+PPP ++PP E                   KPP    PP
Sbjct: 56  HVEPPHESPPPVYKPPYETSPPPPVYHHPIFHSPPHVKPPVYPPPP 101

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 36/63 (57%), Positives = 42/63 (66%), Gaps = 6/63 (9%)
 Frame = +1

Query: 310 PHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE------KPPHEKSP 471
           PHEN    Y PPHEKPPHEH  P Y  PH+KP HENPPP++QPP+E      +PPH + P
Sbjct: 1   PHENSSSYYPPPHEKPPHEHTPPNYHKPHEKPLHENPPPQYQPPHEHPSPEYQPPHVEPP 60

Query: 472 PAS 480
             S
Sbjct: 61  HES 63

[14][TOP]
>UniRef100_Q2YHP5 Proline-rich protein (Fragment) n=1 Tax=Phaseolus vulgaris
           RepID=Q2YHP5_PHAVU
          Length = 264

 Score =  146 bits (369), Expect = 6e-34
 Identities = 89/180 (49%), Positives = 101/180 (56%), Gaps = 24/180 (13%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPP----HEHSPP 168
           KPP E PP  Y+PP EKPP  Y+PP  K P   PP    P Y+PP EKPP        PP
Sbjct: 88  KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 145

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENPP--- 327
            Y+PP E  PP ++PP EKPP  K     PP Y+PP E PP  Y PP EKPP   PP   
Sbjct: 146 VYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK 203

Query: 328 -PEYNPPHEKPPHEHPS----PEYQPPHQKPPHENPP----PKFQPPNEKPPHEKSPPAS 480
            P Y PP EKPP   P     P Y+PP +KPP   PP    P +QPP  KPPH K PP++
Sbjct: 204 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYQPPYGKPPHPKYPPST 263

 Score =  140 bits (352), Expect = 6e-32
 Identities = 87/180 (48%), Positives = 101/180 (56%), Gaps = 24/180 (13%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPHEKPPPEYQPPHGK----QPHVNPPPQYQPPHEKP----PHEH 159
           ++ KPP E PP  Y+PP EKPP  Y+PP  K    +P V  PP Y+PP EKP    P   
Sbjct: 25  NYDKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 82

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENP- 324
            PP Y+PP E  PP ++PP EKPP  K     PP Y+PP E  PP Y PP EKPP   P 
Sbjct: 83  KPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPP 140

Query: 325 ---PPEYNPPHEKPPHEHP----SPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
              PP Y PP EKPP   P     P Y+PP +KPP   P    PP ++PP EKPP  K P
Sbjct: 141 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 200

 Score =  139 bits (349), Expect = 1e-31
 Identities = 88/185 (47%), Positives = 100/185 (54%), Gaps = 28/185 (15%)
 Frame = +1

Query: 1   PHHAKPPYENP----PPEYQPPHEKPPPEYQPPHGK----QPHVNPPPQYQPPHEKP--- 147
           P   KPP   P    PP Y+PP EK PP Y+PP  K    +P V  PP Y+PP EKP   
Sbjct: 29  PPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 87

Query: 148 -PHEHSPPGYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPP 312
            P    PP Y+PP E  PP ++PP EKPP  K     PP Y+PP E  PP Y PP EKPP
Sbjct: 88  KPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPP 145

Query: 313 HENP----PPEYNPPHEKPPHEHP----SPEYQPPHQKPPHENP----PPKFQPPNEKPP 456
              P    PP Y PP EKPP   P     P Y+PP +KPP   P    PP ++PP EKPP
Sbjct: 146 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 205

Query: 457 HEKSP 471
             K P
Sbjct: 206 VYKPP 210

 Score =  103 bits (256), Expect = 8e-21
 Identities = 61/121 (50%), Positives = 69/121 (57%), Gaps = 12/121 (9%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPP----HEHSPP 168
           KPP E PP  Y+PP EKPP  Y+PP  K P   PP    P Y+PP EKPP        PP
Sbjct: 148 KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 205

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY 336
            Y+PP E  PP ++PP EKPP  K     PP Y+PP E PP  Y PP+ KPPH   PP  
Sbjct: 206 VYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YQPPYGKPPHPKYPPST 263

Query: 337 N 339
           N
Sbjct: 264 N 264

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 37/87 (42%), Positives = 42/87 (48%), Gaps = 4/87 (4%)
 Frame = +1

Query: 1   PHHAKPPYENP----PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P   KPP   P    PP Y+PP EK PP Y+PP      V  PP Y+PP EKP       
Sbjct: 199 PPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPP------VEKPPVYKPPVEKP------- 244

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPP 249
                     P +QPP+ KPPH K PP
Sbjct: 245 ----------PVYQPPYGKPPHPKYPP 261

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 33/69 (47%), Positives = 39/69 (56%), Gaps = 8/69 (11%)
 Frame = +1

Query: 289 LPPHEKPPHENPPPEYNPPHEKPPHEHP----SPEYQPPHQKPPHENP----PPKFQPPN 444
           L  ++KPP E  PP Y PP EKPP   P     P Y+PP +KPP   P    PP ++PP 
Sbjct: 23  LANYDKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 81

Query: 445 EKPPHEKSP 471
           EKPP  K P
Sbjct: 82  EKPPVYKPP 90

[15][TOP]
>UniRef100_C6TN18 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TN18_SOYBN
          Length = 143

 Score =  145 bits (365), Expect = 2e-33
 Identities = 74/145 (51%), Positives = 87/145 (60%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP   PPP  +PP  +PPP Y+PP    P  NPPP Y+PP       + PP YQPP+E P
Sbjct: 27  PPIYEPPPIEKPPIYEPPPSYEPP----PTENPPPLYKPPF------YPPPVYQPPYEKP 76

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
           PP +QPP+EKPP     P YQPP+E PPP Y PP+EK     PPP Y PP+EKPP     
Sbjct: 77  PPVYQPPYEKPP-----PVYQPPYEKPPPVYQPPYEK-----PPPVYQPPNEKPP----- 121

Query: 376 PEYQPPHQKPPHENPPPKFQPPNEK 450
           PEYQPP   P    PP    PP++K
Sbjct: 122 PEYQPPIYNP----PPYGHYPPSKK 142

 Score =  140 bits (352), Expect = 6e-32
 Identities = 70/127 (55%), Positives = 79/127 (62%), Gaps = 1/127 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPH-EKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           P   KPP   PPP Y+PP  E PPP Y+PP        PPP YQPP+EKPP     P YQ
Sbjct: 33  PPIEKPPIYEPPPSYEPPPTENPPPLYKPPF------YPPPVYQPPYEKPP-----PVYQ 81

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
           PP+E PPP +QPP+EKP     PP YQPP+E PPP Y PP+EKPP E  PP YNP    P
Sbjct: 82  PPYEKPPPVYQPPYEKP-----PPVYQPPYEKPPPVYQPPNEKPPPEYQPPIYNP----P 132

Query: 358 PHEHPSP 378
           P+ H  P
Sbjct: 133 PYGHYPP 139

 Score =  128 bits (321), Expect = 2e-28
 Identities = 66/121 (54%), Positives = 75/121 (61%), Gaps = 1/121 (0%)
 Frame = +1

Query: 115 PPQYQPPH-EKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYL 291
           PP Y+PP  EKPP    PP Y+PP    P E+ PP  KPP    PP YQPP+E PPP Y 
Sbjct: 27  PPIYEPPPIEKPPIYEPPPSYEPP----PTENPPPLYKPPFYP-PPVYQPPYEKPPPVYQ 81

Query: 292 PPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           PP+EKPP     P Y PP+EKPP     P YQPP++K     PPP +QPPNEKPP E  P
Sbjct: 82  PPYEKPP-----PVYQPPYEKPP-----PVYQPPYEK-----PPPVYQPPNEKPPPEYQP 126

Query: 472 P 474
           P
Sbjct: 127 P 127

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 46/78 (58%), Positives = 52/78 (66%), Gaps = 7/78 (8%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPP------HEHSPPGY 174
           +PPYE PPP YQPP+EKPPP YQPP+ K     PPP YQPP+EKPP      +E  PP Y
Sbjct: 70  QPPYEKPPPVYQPPYEKPPPVYQPPYEK-----PPPVYQPPYEKPPPVYQPPNEKPPPEY 124

Query: 175 QPPHEIPPP-EHQPPHEK 225
           QPP   PPP  H PP +K
Sbjct: 125 QPPIYNPPPYGHYPPSKK 142

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 33/70 (47%), Positives = 41/70 (58%), Gaps = 7/70 (10%)
 Frame = +1

Query: 286 YLPPHEKPPHENPPPEYNPP--HEKPPHEHPSPEYQPPH-----QKPPHENPPPKFQPPN 444
           + PP  +PP    PP Y PP  +E PP E+P P Y+PP       +PP+E PPP +QPP 
Sbjct: 25  FFPPIYEPPPIEKPPIYEPPPSYEPPPTENPPPLYKPPFYPPPVYQPPYEKPPPVYQPPY 84

Query: 445 EKPPHEKSPP 474
           EKPP    PP
Sbjct: 85  EKPPPVYQPP 94

[16][TOP]
>UniRef100_UPI0001983484 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983484
          Length = 306

 Score =  144 bits (362), Expect = 4e-33
 Identities = 82/173 (47%), Positives = 97/173 (56%), Gaps = 21/173 (12%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQ----PPHGKQP---HVNPPPQYQPPH-EKPPHEHSPPG 171
           PP + PPPE++P  EKPPPE++    PP G++P   H  P P  +PP  EKPP EH PP 
Sbjct: 28  PPTKKPPPEHKPSVEKPPPEHKSPTKPPKGEKPLPEHKPPTPIGKPPKGEKPPPEHKPPV 87

Query: 172 YQPPHEIPPP-EHQPPHEKPPHAKSPPEYQPPHEHPPPEYLP-PHEKPPH-ENPPPEYNP 342
            +PP E  PP E  PP  KPP  K PPE++PP E PPPE+ P P EKPP  E P PE+ P
Sbjct: 88  EKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPTPLEKPPKGEKPLPEHKP 147

Query: 343 PHE--KPPHEHPSPEYQPPHQKPPHENPPPKFQPP--------NEKPPHEKSP 471
           P    KPP     P Y      PP EN    ++PP         EKPP  KSP
Sbjct: 148 PTPVGKPPKGEKPPHYGHNPGHPPAENAEDSYKPPTPVGKPPKGEKPPEHKSP 200

 Score =  139 bits (350), Expect = 1e-31
 Identities = 81/175 (46%), Positives = 97/175 (55%), Gaps = 22/175 (12%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP-PGYQ 177
           P H KPP E PPPE++PP EKPPPE++PP  K     PPP+++PP EKPP EH P P  +
Sbjct: 81  PEH-KPPVEKPPPEHKPPVEKPPPEHKPPVEK-----PPPEHKPPVEKPPPEHKPTPLEK 134

Query: 178 PPH-EIPPPEHQPPHE--KPPHAKSPPEYQPPHEHPPPE-----YLPPHE--KPPHENPP 327
           PP  E P PEH+PP    KPP  + PP Y     HPP E     Y PP    KPP    P
Sbjct: 135 PPKGEKPLPEHKPPTPVGKPPKGEKPPHYGHNPGHPPAENAEDSYKPPTPVGKPPKGEKP 194

Query: 328 PEYNPPHEKPPHEHPSPEYQPP----------HQKPPHENPPPKFQPP-NEKPPH 459
           PE+  P + P  E P  E++PP           Q P H+ P P  +PP  EKPPH
Sbjct: 195 PEHKSPTKPPKGEKPLLEHKPPTPIGKPPKGEKQLPEHKPPTPVGKPPKGEKPPH 249

 Score =  103 bits (257), Expect = 6e-21
 Identities = 68/204 (33%), Positives = 85/204 (41%), Gaps = 64/204 (31%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQP------PHGKQP---HVNPPPQYQPPH-EKPP 150
           P H KPP E PPPE++PP EKPPPE++P      P G++P   H  P P  +PP  EKPP
Sbjct: 103 PEH-KPPVEKPPPEHKPPVEKPPPEHKPTPLEKPPKGEKPLPEHKPPTPVGKPPKGEKPP 161

Query: 151 H-------------------------------------------------EHSPP---GY 174
           H                                                 EH PP   G 
Sbjct: 162 HYGHNPGHPPAENAEDSYKPPTPVGKPPKGEKPPEHKSPTKPPKGEKPLLEHKPPTPIGK 221

Query: 175 QPPHEIPPPEHQPPHE--KPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
            P  E   PEH+PP    KPP  + PP Y     HPP E      KPPH+  PP      
Sbjct: 222 PPKGEKQLPEHKPPTPVGKPPKGEKPPHYGHNPGHPPVESKEDSYKPPHKIEPPSAPKKP 281

Query: 349 EKPPHEHPSPEYQPPHQKPPHENP 420
           + P  + P+P ++PPH+ P   +P
Sbjct: 282 QAPEKKPPTPPHKPPHKPPSPSHP 305

 Score =  102 bits (254), Expect = 1e-20
 Identities = 54/103 (52%), Positives = 63/103 (61%), Gaps = 4/103 (3%)
 Frame = +1

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHE--KPPH-ENPPPEYNPPH 348
           PP + PPPEH+P  EKPP     P   P  E P PE+ PP    KPP  E PPPE+ PP 
Sbjct: 28  PPTKKPPPEHKPSVEKPPPEHKSPTKPPKGEKPLPEHKPPTPIGKPPKGEKPPPEHKPPV 87

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-KPPHEKSPP 474
           EKPP     PE++PP +KPP E+ PP  +PP E KPP EK PP
Sbjct: 88  EKPP-----PEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPP 125

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/88 (40%), Positives = 41/88 (46%), Gaps = 26/88 (29%)
 Frame = +1

Query: 289 LPPHEKPPH-ENPPPEYNPPHEKPPHEHPSP-------------------------EYQP 390
           L  + KPP  + PPPE+ P  EKPP EH SP                         E  P
Sbjct: 21  LADYPKPPPTKKPPPEHKPSVEKPPPEHKSPTKPPKGEKPLPEHKPPTPIGKPPKGEKPP 80

Query: 391 PHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P  KPP E PPP+ +PP EKPP E  PP
Sbjct: 81  PEHKPPVEKPPPEHKPPVEKPPPEHKPP 108

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 46/123 (37%), Positives = 60/123 (48%), Gaps = 20/123 (16%)
 Frame = +1

Query: 13  KPPYENPPPEYQPP------------HEKPPPEYQPPHGKQP---HVNPPPQYQPPH-EK 144
           KPP    PPE++ P            H+ P P  +PP G++    H  P P  +PP  EK
Sbjct: 187 KPPKGEKPPEHKSPTKPPKGEKPLLEHKPPTPIGKPPKGEKQLPEHKPPTPVGKPPKGEK 246

Query: 145 PPHEHSPPGYQPPHEIPPPEHQPPHE-KPPHA-KSP--PEYQPPHEHPPPEYLPPHEKPP 312
           PPH    PG+ PP E     ++PPH+ +PP A K P  PE +PP     P + PP   P 
Sbjct: 247 PPHYGHNPGH-PPVESKEDSYKPPHKIEPPSAPKKPQAPEKKPPTPPHKPPHKPP--SPS 303

Query: 313 HEN 321
           H N
Sbjct: 304 HPN 306

[17][TOP]
>UniRef100_P13993 Repetitive proline-rich cell wall protein 2 n=2 Tax=Glycine max
           RepID=PRP2_SOYBN
          Length = 230

 Score =  144 bits (362), Expect = 4e-33
 Identities = 88/178 (49%), Positives = 100/178 (56%), Gaps = 24/178 (13%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPP----HEHSPP 168
           KPP ENPP  Y+PP EKPP  Y+PP  K P   PP    P Y+PP EKPP        PP
Sbjct: 51  KPPVENPPI-YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 108

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENPP--- 327
            Y+PP E  PP ++PP EKPP  K     PP Y+PP E PP  Y PP EKPP   PP   
Sbjct: 109 VYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK 166

Query: 328 -PEYNPPHEKPPHEHPS----PEYQPPHQKPPHENPP----PKFQPPNEKPPHEKSPP 474
            P Y PP EKPP   P     P Y+PP +KPP   PP    P ++PP  KPP+ K PP
Sbjct: 167 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPYGKPPYPKYPP 224

 Score =  137 bits (346), Expect = 3e-31
 Identities = 86/174 (49%), Positives = 97/174 (55%), Gaps = 24/174 (13%)
 Frame = +1

Query: 22  YENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKP----PHEHSPPGYQ 177
           YENPP  Y+PP EKPP  Y+PP  K P   PP    P Y+PP EKP    P    PP Y+
Sbjct: 24  YENPPV-YKPPTEKPPV-YKPPVEKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYK 81

Query: 178 PPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENP----PPE 333
           PP E  PP ++PP EKPP  K     PP Y+PP E  PP Y PP EKPP   P    PP 
Sbjct: 82  PPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPV 139

Query: 334 YNPPHEKPPHEHP----SPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
           Y PP EKPP   P     P Y+PP +KPP   P    PP ++PP EKPP  K P
Sbjct: 140 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 193

[18][TOP]
>UniRef100_UPI00006A2003 UPI00006A2003 related cluster n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI00006A2003
          Length = 430

 Score =  142 bits (359), Expect = 9e-33
 Identities = 70/174 (40%), Positives = 95/174 (54%), Gaps = 14/174 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQP-------PHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
           PH  +PP ++PP  + P       PH K PP   PPH + P  +PPP + P HE+PP +H
Sbjct: 256 PHREEPPTQHPPAGHSPTPSLPSPPHHKEPPTQHPPHEEPPTQHPPP-HCPHHEEPPTQH 314

Query: 160 SPPGYQP-----PHEIPPPEHQP-PHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHEN 321
            P G+ P     PHE PP +H P P +  P    P   +PP +HPPP + P  E+PP ++
Sbjct: 315 PPAGHSPTILPSPHEEPPTQHPPIPRQGIPQPHCPHREEPPTQHPPPPHCPHREEPPTQH 374

Query: 322 PPPEYNPPHEKPPHEHPSPEYQP-PHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
           PPP + P  E+PP +HP   + P P   PPH   P   +PP + PP   SP +S
Sbjct: 375 PPPPHCPHREEPPTQHPPAGHSPTPSLPPPH--CPHHEEPPTQHPPAGHSPTSS 426

 Score =  133 bits (335), Expect = 5e-30
 Identities = 71/186 (38%), Positives = 95/186 (51%), Gaps = 25/186 (13%)
 Frame = +1

Query: 1   PHHAKPPYENP-------PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
           PHH +PP + P       P  + PP EKPP ++ PP G   H  P      P +  P  H
Sbjct: 196 PHHEEPPTQLPNIPQQGIPQPHCPPREKPPTQH-PPGGIPQHYCPHHIKPLPRQGIPQPH 254

Query: 160 SPPGYQPPHEIPPPEHQPPHE--KPPHAKSPPEYQPPHEHPPPEYLPP----HEKPPHEN 321
            P   +PP + PP  H P      PPH K PP   PPHE PP ++ PP    HE+PP ++
Sbjct: 255 CPHREEPPTQHPPAGHSPTPSLPSPPHHKEPPTQHPPHEEPPTQHPPPHCPHHEEPPTQH 314

Query: 322 PPPEYNP-----PHEKPPHEHPS------PEYQPPH-QKPPHENPPPKFQPPNEKPPHEK 465
           PP  ++P     PHE+PP +HP       P+   PH ++PP ++PPP   P  E+PP + 
Sbjct: 315 PPAGHSPTILPSPHEEPPTQHPPIPRQGIPQPHCPHREEPPTQHPPPPHCPHREEPPTQH 374

Query: 466 SPPASC 483
            PP  C
Sbjct: 375 PPPPHC 380

 Score =  132 bits (333), Expect = 9e-30
 Identities = 67/177 (37%), Positives = 88/177 (49%), Gaps = 19/177 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQP--------HVNPPPQYQPPHEKPPHE 156
           PHH KP      P+   PH + PP   PP G  P        H   PP   PPHE+PP +
Sbjct: 239 PHHIKPLPRQGIPQPHCPHREEPPTQHPPAGHSPTPSLPSPPHHKEPPTQHPPHEEPPTQ 298

Query: 157 HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP-------PPEYLPPHEKPPH 315
           H PP + P HE PP +H P    P    SP E +PP +HP       P  + P  E+PP 
Sbjct: 299 HPPP-HCPHHEEPPTQHPPAGHSPTILPSPHE-EPPTQHPPIPRQGIPQPHCPHREEPPT 356

Query: 316 ENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKP----PHEKSPP 474
           ++PPP + P  E+PP +HP P + P  ++PP ++PP    P    P    PH + PP
Sbjct: 357 QHPPPPHCPHREEPPTQHPPPPHCPHREEPPTQHPPAGHSPTPSLPPPHCPHHEEPP 413

 Score =  121 bits (303), Expect = 3e-26
 Identities = 63/169 (37%), Positives = 83/169 (49%), Gaps = 21/169 (12%)
 Frame = +1

Query: 31  PPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP--PGYQPPHEIPPPE 204
           P P + P HE+PP ++ PP    P  + P + +PP + PP  HSP  P   PP+ IP P 
Sbjct: 134 PQPPHCPHHEEPPTQHPPPRQGIPQPHCPHREEPPTQHPPAGHSPTPPSLPPPNGIPQPP 193

Query: 205 HQPPHEKPP------------HAKSPPEYQPPHEHPP----PEYLPPHEKP-PHENPPPE 333
           H P HE+PP                PP  +PP +HPP      Y P H KP P +  P  
Sbjct: 194 HCPHHEEPPTQLPNIPQQGIPQPHCPPREKPPTQHPPGGIPQHYCPHHIKPLPRQGIPQP 253

Query: 334 YNPPHEKPPHEHPSPEYQPPHQ--KPPHENPPPKFQPPNEKPPHEKSPP 474
           + P  E+PP +HP   + P      PPH   PP   PP+E+PP +  PP
Sbjct: 254 HCPHREEPPTQHPPAGHSPTPSLPSPPHHKEPPTQHPPHEEPPTQHPPP 302

 Score =  112 bits (280), Expect = 1e-23
 Identities = 59/163 (36%), Positives = 85/163 (52%), Gaps = 12/163 (7%)
 Frame = +1

Query: 1   PHHAKPPYENPP---------PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKP-- 147
           PHH +PP ++PP         P + P HE+PP ++ PP G  P + P P  +PP + P  
Sbjct: 280 PHHKEPPTQHPPHEEPPTQHPPPHCPHHEEPPTQH-PPAGHSPTILPSPHEEPPTQHPPI 338

Query: 148 PHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPP 327
           P +  P  + P  E PP +H P    PPH   P   +PP +HPPP + P  E+PP ++PP
Sbjct: 339 PRQGIPQPHCPHREEPPTQHPP----PPHC--PHREEPPTQHPPPPHCPHREEPPTQHPP 392

Query: 328 PEYNP-PHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKP 453
             ++P P   PPH        P H++PP ++PP    P +  P
Sbjct: 393 AGHSPTPSLPPPH-------CPHHEEPPTQHPPAGHSPTSSLP 428

 Score =  107 bits (268), Expect = 3e-22
 Identities = 61/171 (35%), Positives = 79/171 (46%), Gaps = 13/171 (7%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP--GY 174
           PH  +PP ++PP  + P    P     P         P P + P HE+PP +H PP  G 
Sbjct: 97  PHREEPPTQHPPAGHSPTPSLPSSMRNPLPNIPRQGIPQPPHCPHHEEPPTQHPPPRQGI 156

Query: 175 QPPH----EIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP------ 324
             PH    E PP +H P      H+ +PP   PP+  P P + P HE+PP + P      
Sbjct: 157 PQPHCPHREEPPTQHPP----AGHSPTPPSLPPPNGIPQPPHCPHHEEPPTQLPNIPQQG 212

Query: 325 -PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            P  + PP EKPP +HP P   P H  P H  P P+   P    PH + PP
Sbjct: 213 IPQPHCPPREKPPTQHP-PGGIPQHYCPHHIKPLPRQGIPQPHCPHREEPP 262

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 62/181 (34%), Positives = 74/181 (40%), Gaps = 37/181 (20%)
 Frame = +1

Query: 43  YQPPHEKPPPEYQPPHGKQPHVN-PPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEH---- 207
           Y  PH + PP   PP G  P    P P   P  E+PP +H P G+ P   +P        
Sbjct: 24  YFDPHREEPPTQHPPAGHSPTPGIPQPPPCPHREEPPTQHPPTGHSPTPTLPSSMRNPLP 83

Query: 208 --------QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHEN------PPPEYNPP 345
                   QPPH   PH + PP   PP  H P   LP   + P  N      P P + P 
Sbjct: 84  NFPRQGIPQPPH--CPHREEPPTQHPPAGHSPTPSLPSSMRNPLPNIPRQGIPQPPHCPH 141

Query: 346 HEKPPHEHPSPEY-----------QPPHQKPP--HENPPPKFQPPNEKP-----PHEKSP 471
           HE+PP +HP P             +PP Q PP  H   PP   PPN  P     PH + P
Sbjct: 142 HEEPPTQHPPPRQGIPQPHCPHREEPPTQHPPAGHSPTPPSLPPPNGIPQPPHCPHHEEP 201

Query: 472 P 474
           P
Sbjct: 202 P 202

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 51/137 (37%), Positives = 61/137 (44%), Gaps = 11/137 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQP-----PHEKPPPEYQP------PHGKQPHVNPPPQYQPPHEKP 147
           PHH +PP ++PP  + P     PHE+PP ++ P      P    PH   PP   PP    
Sbjct: 305 PHHEEPPTQHPPAGHSPTILPSPHEEPPTQHPPIPRQGIPQPHCPHREEPPTQHPPPPHC 364

Query: 148 PHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPP 327
           PH   PP   PP         PPH   PH + PP   PP  H P   LPP   P HE PP
Sbjct: 365 PHREEPPTQHPP---------PPH--CPHREEPPTQHPPAGHSPTPSLPPPHCPHHEEPP 413

Query: 328 PEYNPPHEKPPHEHPSP 378
            ++ P    P    PSP
Sbjct: 414 TQHPPAGHSPTSSLPSP 430

[19][TOP]
>UniRef100_UPI0000EB0B28 Histidine-rich glycoprotein precursor (Histidine-proline-rich
           glycoprotein) (HPRG). n=1 Tax=Canis lupus familiaris
           RepID=UPI0000EB0B28
          Length = 551

 Score =  140 bits (352), Expect = 6e-32
 Identities = 77/174 (44%), Positives = 90/174 (51%), Gaps = 17/174 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQP----PHEKPP----PEYQPPHGKQPHVNPPPQYQPPHEKPPHE 156
           P H  PP+  PP  + P    PH +PP    P   PPHG  PH +PP  + P H  PPH+
Sbjct: 284 PPHGPPPHGPPPHGHHPHGPCPHGRPPFGPPPHGHPPHGHHPHGHPPHGHHP-HGHPPHK 342

Query: 157 HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY 336
           H P G+  PH  PP EH  PH  PPH   PP   PPHEH P  + PPH  PPH  PPP  
Sbjct: 343 HHPHGHH-PHGHPPHEHH-PHGHPPHG-PPPHGPPPHEHHPHGH-PPHGPPPH-GPPPHE 397

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQP---------PNEKPPHEKSP 471
           + PH  PPH  P P   PPH+  PH + P K  P         P + PPH +SP
Sbjct: 398 HHPHGHPPH-GPPPHGPPPHEHHPHGHHPHKHHPHDHDFHDHGPCDLPPHSQSP 450

 Score =  129 bits (323), Expect = 1e-28
 Identities = 71/167 (42%), Positives = 84/167 (50%), Gaps = 13/167 (7%)
 Frame = +1

Query: 7   HAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP---------PQYQPPHEKPPHEH 159
           H +PP+  PPP   PPH   P  + PPHG  PH +PP         P   PPHE  PH H
Sbjct: 306 HGRPPF-GPPPHGHPPHGHHPHGH-PPHGHHPHGHPPHKHHPHGHHPHGHPPHEHHPHGH 363

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN 339
            P G  PPH  PP EH  PH  PPH   PP   PPHEH P  + PPH  PPH  PP E++
Sbjct: 364 PPHG-PPPHGPPPHEHH-PHGHPPHG-PPPHGPPPHEHHPHGH-PPHGPPPHGPPPHEHH 419

Query: 340 P----PHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKS 468
           P    PH+  PH+H   ++  P   PPH   P       + PP + S
Sbjct: 420 PHGHHPHKHHPHDHDFHDH-GPCDLPPHSQSPQDHHRQGQGPPPQHS 465

 Score =  123 bits (309), Expect = 6e-27
 Identities = 70/152 (46%), Positives = 75/152 (49%), Gaps = 13/152 (8%)
 Frame = +1

Query: 55  HEKPPPEYQPPHGKQPHVNPP---------PQYQPPHEKPPHEHSPPGYQPPHEIPPPEH 207
           H    P   PPHG  PH  PP         P  +PP   PPH H P G+  PH  PP  H
Sbjct: 275 HHFGHPHGPPPHGPPPHGPPPHGHHPHGPCPHGRPPFGPPPHGHPPHGHH-PHGHPPHGH 333

Query: 208 QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQ 387
             PH  PPH K  P    PH HPP E+  PH  PPH  PPP   PPHE  PH HP P   
Sbjct: 334 H-PHGHPPH-KHHPHGHHPHGHPPHEH-HPHGHPPH-GPPPHGPPPHEHHPHGHP-PHGP 388

Query: 388 PPHQKPPHEN----PPPKFQPPNEKPPHEKSP 471
           PPH  PPHE+     PP   PP+  PPHE  P
Sbjct: 389 PPHGPPPHEHHPHGHPPHGPPPHGPPPHEHHP 420

 Score =  103 bits (258), Expect = 5e-21
 Identities = 56/129 (43%), Positives = 62/129 (48%), Gaps = 17/129 (13%)
 Frame = +1

Query: 136 HEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP----PEYLPPHE 303
           H    H H PP + PP   PPP    PH   PH + PP   PPH HPP    P   PPH 
Sbjct: 274 HHHFGHPHGPPPHGPPPHGPPPHGHHPHGPCPHGR-PPFGPPPHGHPPHGHHPHGHPPHG 332

Query: 304 KPPHENPP---------PEYNPPHEKPPHEHPSPEYQPPHQKPPHEN----PPPKFQPPN 444
             PH +PP         P  +PPHE  PH HP P   PPH  PPHE+     PP   PP+
Sbjct: 333 HHPHGHPPHKHHPHGHHPHGHPPHEHHPHGHP-PHGPPPHGPPPHEHHPHGHPPHGPPPH 391

Query: 445 EKPPHEKSP 471
             PPHE  P
Sbjct: 392 GPPPHEHHP 400

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 54/165 (32%), Positives = 68/165 (41%), Gaps = 35/165 (21%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQP---PHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPG 171
           P H  PP+  PP E+ P   P   PPP   PPH   PH +PP    PPH  PPHEH P G
Sbjct: 364 PPHGPPPHGPPPHEHHPHGHPPHGPPPHGPPPHEHHPHGHPP-HGPPPHGPPPHEHHPHG 422

Query: 172 YQPPHEIPPPEHQ---------PPHEKPPHAKSPPEYQPPHEHPPPEY------------ 288
           + P H+  P +H          PP     H++SP ++    + PPP++            
Sbjct: 423 HHP-HKHHPHDHDFHDHGPCDLPP-----HSQSPQDHHRQGQGPPPQHSEERGPVKSTFS 476

Query: 289 ----------LPPHEKPPHENPPPEYNPPHEKPPHEHP-SPEYQP 390
                     LPP +K      P    P      H HP  PE QP
Sbjct: 477 FTGENRICYRLPPLKKDEVLPLPKADFPSFSFFDHSHPLKPEIQP 521

[20][TOP]
>UniRef100_Q40375 Repetitive proline-rich cell wall protein 2 n=1 Tax=Medicago
           truncatula RepID=PRP2_MEDTR
          Length = 371

 Score =  139 bits (351), Expect = 7e-32
 Identities = 87/177 (49%), Positives = 99/177 (55%), Gaps = 24/177 (13%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGK----QPHVNPPPQYQPPHEKP----PHEHSPP 168
           KPP E PP  Y+PP EK PP Y+PP  K    +P V  PP Y+PP EKP    P    PP
Sbjct: 36  KPPVEKPPV-YKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 93

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENP---- 324
            Y+PP E  PP ++PP EKPP  K     PP Y+PP E  PP Y PP EKPP   P    
Sbjct: 94  VYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEK 151

Query: 325 PPEYNPPHEKPPHEHP----SPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
           PP Y PP EKPP   P     P Y+PP +KPP   P    PP ++PP EKPP  K P
Sbjct: 152 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 208

 Score =  139 bits (351), Expect = 7e-32
 Identities = 87/177 (49%), Positives = 98/177 (55%), Gaps = 24/177 (13%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPP----HEHSPP 168
           KPP E PP  Y+PP EKPP  Y+PP  K P   PP    P Y+PP EKPP        PP
Sbjct: 46  KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 103

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENP---- 324
            Y+PP E  PP ++PP EKPP  K     PP Y+PP E PP  Y PP EKPP   P    
Sbjct: 104 VYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK 161

Query: 325 PPEYNPPHEKPPHEHP----SPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
           PP Y PP EKPP   P     P Y+PP +KPP   P    PP ++PP EKPP  K P
Sbjct: 162 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 218

 Score =  139 bits (350), Expect = 1e-31
 Identities = 87/177 (49%), Positives = 98/177 (55%), Gaps = 24/177 (13%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPP----HEHSPP 168
           KPP E PP  Y+PP EKPP  Y+PP  K P   PP    P Y+PP EKPP        PP
Sbjct: 96  KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 153

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENP---- 324
            Y+PP E  PP ++PP EKPP  K     PP Y+PP E PP  Y PP EKPP   P    
Sbjct: 154 VYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK 211

Query: 325 PPEYNPPHEKPPHEHP----SPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
           PP Y PP EKPP   P     P Y+PP +KPP   P    PP ++PP EKPP  K P
Sbjct: 212 PPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPP 268

 Score =  139 bits (349), Expect = 1e-31
 Identities = 88/185 (47%), Positives = 100/185 (54%), Gaps = 28/185 (15%)
 Frame = +1

Query: 1   PHHAKPPYENP----PPEYQPPHEKPPPEYQPPHGK----QPHVNPPPQYQPPHEKP--- 147
           P   KPP   P    PP Y+PP EK PP Y+PP  K    +P V  PP Y+PP EKP   
Sbjct: 47  PPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 105

Query: 148 -PHEHSPPGYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPP 312
            P    PP Y+PP E  PP ++PP EKPP  K     PP Y+PP E  PP Y PP EKPP
Sbjct: 106 KPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPP 163

Query: 313 HENP----PPEYNPPHEKPPHEHP----SPEYQPPHQKPPHENP----PPKFQPPNEKPP 456
              P    PP Y PP EKPP   P     P Y+PP +KPP   P    PP ++PP EKPP
Sbjct: 164 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 223

Query: 457 HEKSP 471
             K P
Sbjct: 224 VYKPP 228

 Score =  139 bits (349), Expect = 1e-31
 Identities = 88/183 (48%), Positives = 98/183 (53%), Gaps = 30/183 (16%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPP----HEHSPP 168
           KPP E PP  Y+PP EKPP  Y+PP  K P   PP    P Y+PP EKPP        PP
Sbjct: 186 KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPP 243

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPP---------PEYLPPHEKP 309
            Y+PP E  PP ++PP EKPP  K     PP Y+PP E PP         P Y PP EKP
Sbjct: 244 VYKPPVE-KPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 302

Query: 310 PHENP---------PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHE 462
           P   P         PP Y PP  KPP E P P Y+PP  KPP E  PP ++PP  KPP E
Sbjct: 303 PVYKPPVEKPPVYKPPVYKPPVYKPPVEKP-PVYKPPVYKPPVEK-PPVYKPPVYKPPVE 360

Query: 463 KSP 471
           K P
Sbjct: 361 KPP 363

 Score =  129 bits (323), Expect = 1e-28
 Identities = 79/157 (50%), Positives = 88/157 (56%), Gaps = 20/157 (12%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPP----HEHSPP 168
           KPP E PP  Y+PP EKPP  Y+PP  K P   PP    P Y+PP EKPP        PP
Sbjct: 216 KPPVEKPPV-YKPPVEKPPI-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPP 273

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPP----PEYLPPHEKPPHENP 324
            Y+PP E  PP ++PP EKPP  K     PP Y+PP E PP    P Y PP  KPP E P
Sbjct: 274 VYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVEKP 332

Query: 325 P----PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP 423
           P    P Y PP EKPP   P P Y+PP +KPP   PP
Sbjct: 333 PVYKPPVYKPPVEKPPVYKP-PVYKPPVEKPPVYGPP 368

 Score =  127 bits (320), Expect = 3e-28
 Identities = 82/169 (48%), Positives = 92/169 (54%), Gaps = 20/169 (11%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPP----HEHSPP 168
           KPP E PP  Y+PP EKPP  Y+PP  K P   PP    P Y+PP EKPP        PP
Sbjct: 206 KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 263

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENPP--- 327
            Y+PP E  PP ++PP EKPP  K     PP Y+PP E PP  Y PP EKPP   PP   
Sbjct: 264 IYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVYK 321

Query: 328 -PEYNPPHEKPPHEHPS----PEYQPPHQKPPHENPPPKFQPPNEKPPH 459
            P Y PP EKPP   P     P  +PP  KPP   PP + +PP   PPH
Sbjct: 322 PPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPVE-KPPVYGPPH 369

 Score =  127 bits (318), Expect = 5e-28
 Identities = 80/170 (47%), Positives = 91/170 (53%), Gaps = 24/170 (14%)
 Frame = +1

Query: 34  PPEYQPPHEKPPPEYQPPHGK----QPHVNPPPQYQPPHEKP----PHEHSPPGYQPPHE 189
           PP YQPP       Y+PP  K    +P V  PP Y+PP EKP    P    PP Y+PP E
Sbjct: 27  PPVYQPP------VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 80

Query: 190 IPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENP----PPEYNPP 345
             PP ++PP EKPP  K     PP Y+PP E  PP Y PP EKPP   P    PP Y PP
Sbjct: 81  -KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPP 138

Query: 346 HEKPPHEHP----SPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
            EKPP   P     P Y+PP +KPP   P    PP ++PP EKPP  K P
Sbjct: 139 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 188

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 49/104 (47%), Positives = 56/104 (53%), Gaps = 16/104 (15%)
 Frame = +1

Query: 208 QPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENP----PPEYNPPHEKPPH 363
           +PP  +PP  K     PP Y+PP E  PP Y PP EKPP   P    PP Y PP EKPP 
Sbjct: 26  KPPVYQPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 84

Query: 364 EHP----SPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
             P     P Y+PP +KPP   P    PP ++PP EKPP  K P
Sbjct: 85  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 128

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 47/97 (48%), Positives = 54/97 (55%), Gaps = 12/97 (12%)
 Frame = +1

Query: 217 HEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP----PPEYNPPHEKPPHEHP---- 372
           ++KPP    PP Y+PP E PP  Y PP EKPP   P    PP Y PP EKPP   P    
Sbjct: 24  YDKPP-VYQPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 81

Query: 373 SPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
            P Y+PP +KPP   P    PP ++PP EKPP  K P
Sbjct: 82  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 118

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 46/92 (50%), Positives = 52/92 (56%), Gaps = 4/92 (4%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPP----PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           KPP E PP  Y+PP EKPP    P Y+PP  K P V  PP Y+PP  KPP E  PP Y+P
Sbjct: 296 KPPVEKPPV-YKPPVEKPPVYKPPVYKPPVYKPP-VEKPPVYKPPVYKPPVE-KPPVYKP 352

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP 276
                 P ++PP EK      PP Y PPH HP
Sbjct: 353 ------PVYKPPVEK------PPVYGPPH-HP 371

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 33/72 (45%), Positives = 39/72 (54%), Gaps = 8/72 (11%)
 Frame = +1

Query: 280 PEYLPPHEKPPHENPPPEYNPPHEKPPHEHP----SPEYQPPHQKPPHENP----PPKFQ 435
           P  L  ++KPP    PP Y PP EKPP   P     P Y+PP +KPP   P    PP ++
Sbjct: 18  PRGLANYDKPP-VYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 76

Query: 436 PPNEKPPHEKSP 471
           PP EKPP  K P
Sbjct: 77  PPVEKPPVYKPP 88

[21][TOP]
>UniRef100_B1YPT1 Type VI secretion system Vgr family protein n=1 Tax=Burkholderia
            ambifaria MC40-6 RepID=B1YPT1_BURA4
          Length = 1048

 Score =  139 bits (349), Expect = 1e-31
 Identities = 78/173 (45%), Positives = 92/173 (53%), Gaps = 13/173 (7%)
 Frame = +1

Query: 1    PHHAKPPYENPPP-EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
            P    PP E PPP E  PP E PPP   PP  + P   PP +  PP E PP   +PP  +
Sbjct: 835  PSETPPPSETPPPSETPPPSETPPPSETPPPSETP---PPSETPPPSETPPPSETPPPSE 891

Query: 178  --PPHEIPPP-EHQPPHEKPPHAKSPP--EYQPPHEHPPPEYLPPHEK--PPHENPPPEY 336
              PP E PPP E  PP E PP +++PP  E  PP E PPP   PP  +  PP E PPP  
Sbjct: 892  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSE 951

Query: 337  NPPHEK--PPHEHPSPEYQPPHQK--PPHENPPP-KFQPPNEKPPHEKSPPAS 480
             PP  +  PP E P P   PP  +  PP E PPP +  PP+E PP  ++PP S
Sbjct: 952  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPS 1004

 Score =  139 bits (349), Expect = 1e-31
 Identities = 78/173 (45%), Positives = 92/173 (53%), Gaps = 13/173 (7%)
 Frame = +1

Query: 1    PHHAKPPYENPPP-EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
            P    PP E PPP E  PP E PPP   PP  + P   PP +  PP E PP   +PP  +
Sbjct: 841  PSETPPPSETPPPSETPPPSETPPPSETPPPSETP---PPSETPPPSETPPPSETPPPSE 897

Query: 178  --PPHEIPPP-EHQPPHEKPPHAKSPP--EYQPPHEHPPPEYLPPHEK--PPHENPPPEY 336
              PP E PPP E  PP E PP +++PP  E  PP E PPP   PP  +  PP E PPP  
Sbjct: 898  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSE 957

Query: 337  NPPHEK--PPHEHPSPEYQPPHQK--PPHENPPP-KFQPPNEKPPHEKSPPAS 480
             PP  +  PP E P P   PP  +  PP E PPP +  PP+E PP  ++PP S
Sbjct: 958  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPS 1010

 Score =  139 bits (349), Expect = 1e-31
 Identities = 78/173 (45%), Positives = 92/173 (53%), Gaps = 13/173 (7%)
 Frame = +1

Query: 1    PHHAKPPYENPPP-EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
            P    PP E PPP E  PP E PPP   PP  + P   PP +  PP E PP   +PP  +
Sbjct: 847  PSETPPPSETPPPSETPPPSETPPPSETPPPSETP---PPSETPPPSETPPPSETPPPSE 903

Query: 178  --PPHEIPPP-EHQPPHEKPPHAKSPP--EYQPPHEHPPPEYLPPHEK--PPHENPPPEY 336
              PP E PPP E  PP E PP +++PP  E  PP E PPP   PP  +  PP E PPP  
Sbjct: 904  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSE 963

Query: 337  NPPHEK--PPHEHPSPEYQPPHQK--PPHENPPP-KFQPPNEKPPHEKSPPAS 480
             PP  +  PP E P P   PP  +  PP E PPP +  PP+E PP  ++PP S
Sbjct: 964  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPS 1016

 Score =  139 bits (349), Expect = 1e-31
 Identities = 78/173 (45%), Positives = 92/173 (53%), Gaps = 13/173 (7%)
 Frame = +1

Query: 1    PHHAKPPYENPPP-EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
            P    PP E PPP E  PP E PPP   PP  + P   PP +  PP E PP   +PP  +
Sbjct: 853  PSETPPPSETPPPSETPPPSETPPPSETPPPSETP---PPSETPPPSETPPPSETPPPSE 909

Query: 178  --PPHEIPPP-EHQPPHEKPPHAKSPP--EYQPPHEHPPPEYLPPHEK--PPHENPPPEY 336
              PP E PPP E  PP E PP +++PP  E  PP E PPP   PP  +  PP E PPP  
Sbjct: 910  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSE 969

Query: 337  NPPHEK--PPHEHPSPEYQPPHQK--PPHENPPP-KFQPPNEKPPHEKSPPAS 480
             PP  +  PP E P P   PP  +  PP E PPP +  PP+E PP  ++PP S
Sbjct: 970  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPS 1022

 Score =  139 bits (349), Expect = 1e-31
 Identities = 78/173 (45%), Positives = 92/173 (53%), Gaps = 13/173 (7%)
 Frame = +1

Query: 1    PHHAKPPYENPPP-EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
            P    PP E PPP E  PP E PPP   PP  + P   PP +  PP E PP   +PP  +
Sbjct: 859  PSETPPPSETPPPSETPPPSETPPPSETPPPSETP---PPSETPPPSETPPPSETPPPSE 915

Query: 178  --PPHEIPPP-EHQPPHEKPPHAKSPP--EYQPPHEHPPPEYLPPHEK--PPHENPPPEY 336
              PP E PPP E  PP E PP +++PP  E  PP E PPP   PP  +  PP E PPP  
Sbjct: 916  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSE 975

Query: 337  NPPHEK--PPHEHPSPEYQPPHQK--PPHENPPP-KFQPPNEKPPHEKSPPAS 480
             PP  +  PP E P P   PP  +  PP E PPP +  PP+E PP  ++PP S
Sbjct: 976  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPS 1028

 Score =  139 bits (349), Expect = 1e-31
 Identities = 78/173 (45%), Positives = 92/173 (53%), Gaps = 13/173 (7%)
 Frame = +1

Query: 1    PHHAKPPYENPPP-EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
            P    PP E PPP E  PP E PPP   PP  + P   PP +  PP E PP   +PP  +
Sbjct: 865  PSETPPPSETPPPSETPPPSETPPPSETPPPSETP---PPSETPPPSETPPPSETPPPSE 921

Query: 178  --PPHEIPPP-EHQPPHEKPPHAKSPP--EYQPPHEHPPPEYLPPHEK--PPHENPPPEY 336
              PP E PPP E  PP E PP +++PP  E  PP E PPP   PP  +  PP E PPP  
Sbjct: 922  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSE 981

Query: 337  NPPHEK--PPHEHPSPEYQPPHQK--PPHENPPP-KFQPPNEKPPHEKSPPAS 480
             PP  +  PP E P P   PP  +  PP E PPP +  PP+E PP  ++PP S
Sbjct: 982  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPS 1034

 Score =  139 bits (349), Expect = 1e-31
 Identities = 78/173 (45%), Positives = 92/173 (53%), Gaps = 13/173 (7%)
 Frame = +1

Query: 1    PHHAKPPYENPPP-EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
            P    PP E PPP E  PP E PPP   PP  + P   PP +  PP E PP   +PP  +
Sbjct: 871  PSETPPPSETPPPSETPPPSETPPPSETPPPSETP---PPSETPPPSETPPPSETPPPSE 927

Query: 178  --PPHEIPPP-EHQPPHEKPPHAKSPP--EYQPPHEHPPPEYLPPHEK--PPHENPPPEY 336
              PP E PPP E  PP E PP +++PP  E  PP E PPP   PP  +  PP E PPP  
Sbjct: 928  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSE 987

Query: 337  NPPHEK--PPHEHPSPEYQPPHQK--PPHENPPP-KFQPPNEKPPHEKSPPAS 480
             PP  +  PP E P P   PP  +  PP E PPP +  PP+E PP  ++PP S
Sbjct: 988  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPS 1040

 Score =  138 bits (348), Expect = 2e-31
 Identities = 78/173 (45%), Positives = 91/173 (52%), Gaps = 13/173 (7%)
 Frame = +1

Query: 1    PHHAKPPYENPPP-EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
            P    PP E PPP E  PP E PPP   PP  + P   PP +  PP E PP   +PP  +
Sbjct: 877  PSETPPPSETPPPSETPPPSETPPPSETPPPSETP---PPSETPPPSETPPPSETPPPSE 933

Query: 178  --PPHEIPPP-EHQPPHEKPPHAKSPP--EYQPPHEHPPPEYLPPHEK--PPHENPPPEY 336
              PP E PPP E  PP E PP +++PP  E  PP E PPP   PP  +  PP E PPP  
Sbjct: 934  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSE 993

Query: 337  NPPHEK--PPHEHPSPEYQPPHQK--PPHENPPP-KFQPPNEKPPHEKSPPAS 480
             PP  +  PP E P P   PP  +  PP E PPP +  PP+E PP  + PP S
Sbjct: 994  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSEEPPES 1046

 Score =  133 bits (335), Expect = 5e-30
 Identities = 75/168 (44%), Positives = 89/168 (52%), Gaps = 13/168 (7%)
 Frame = +1

Query: 1    PHHAKPPYENPPP-EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
            P    PP E PPP E  PP E PPP   PP  + P   PP +  PP E PP   +PP  +
Sbjct: 883  PSETPPPSETPPPSETPPPSETPPPSETPPPSETP---PPSETPPPSETPPPSETPPPSE 939

Query: 178  --PPHEIPPP-EHQPPHEKPPHAKSPP--EYQPPHEHPPPEYLPPHEK--PPHENPPPEY 336
              PP E PPP E  PP E PP +++PP  E  PP E PPP   PP  +  PP E PPP  
Sbjct: 940  TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSE 999

Query: 337  NPPHEK--PPHEHPSPEYQPPHQK--PPHENPPP-KFQPPNEKPPHEK 465
             PP  +  PP E P P   PP  +  PP E PPP +  PP+E+PP  +
Sbjct: 1000 TPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSEEPPESE 1047

 Score =  125 bits (314), Expect = 1e-27
 Identities = 74/171 (43%), Positives = 88/171 (51%), Gaps = 11/171 (6%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPG-YQ 177
            P    PP   PPP   P  E PPP   PP  + P   PP +  PP E P     PP    
Sbjct: 710  PPPPPPPTVVPPPPPPPSVEPPPPSEMPPPSEMP---PPSEMPPPSEMP-----PPSEMP 761

Query: 178  PPHEIPPP-EHQPPHEKPPHAKSPP--EYQPPHEHPPPEYLPPHEK--PPHENPPPEYNP 342
            PP E+PPP E  PP E PP +++PP  E  PP E PPP  +PP  +  PP E PPP   P
Sbjct: 762  PPSEMPPPSEMPPPSEMPPPSETPPPSEMPPPSEMPPPSEMPPPSEMPPPSEMPPPSEMP 821

Query: 343  PHEK--PPHEHPSPEYQPPHQK--PPHENPPP-KFQPPNEKPPHEKSPPAS 480
            P  +  PP E P P   PP  +  PP E PPP +  PP+E PP  ++PP S
Sbjct: 822  PPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPS 872

 Score =  113 bits (282), Expect = 7e-24
 Identities = 73/169 (43%), Positives = 85/169 (50%), Gaps = 13/169 (7%)
 Frame = +1

Query: 13   KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEK--PPHEHSPPG-YQPP 183
            KP    PPP   PP   PPP   PP        PP    PP  +  PP E  PP    PP
Sbjct: 706  KPTLPPPPP---PPTVVPPP---PP--------PPSVEPPPPSEMPPPSEMPPPSEMPPP 751

Query: 184  HEIPPP-EHQPPHEKPPHAKSPP--EYQPPHEHPPPEYLPPHEK--PPHENPPPEYNPPH 348
             E+PPP E  PP E PP ++ PP  E  PP E PPP  +PP  +  PP E PPP   PP 
Sbjct: 752  SEMPPPSEMPPPSEMPPPSEMPPPSEMPPPSETPPPSEMPPPSEMPPPSEMPPPSEMPPP 811

Query: 349  EK--PPHEHPSPEYQPPHQK--PPHENPPP-KFQPPNEKPPHEKSPPAS 480
             +  PP E P P   PP  +  PP E PPP +  PP+E PP  ++PP S
Sbjct: 812  SEMPPPSEMPPPSETPPPSETPPPSETPPPSETPPPSETPPPSETPPPS 860

 Score =  107 bits (268), Expect = 3e-22
 Identities = 64/154 (41%), Positives = 76/154 (49%), Gaps = 10/154 (6%)
 Frame = +1

Query: 49   PPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPP-EHQPPHEK 225
            PP   P   ++      P   PPP   PP   PP    PP    P E+PPP E  PP E 
Sbjct: 693  PPIPFPTFMFRMTKPTLPPPPPPPTVVPPPPPPPSVEPPP----PSEMPPPSEMPPPSEM 748

Query: 226  PPHAKSPP--EYQPPHEHPPPEYLPPHEK--PPHENPPPEYNPPHEK--PPHEHPSPEYQ 387
            PP ++ PP  E  PP E PPP  +PP  +  PP E PPP   PP  +  PP E P P   
Sbjct: 749  PPPSEMPPPSEMPPPSEMPPPSEMPPPSEMPPPSETPPPSEMPPPSEMPPPSEMPPPSEM 808

Query: 388  PP--HQKPPHENPPP-KFQPPNEKPPHEKSPPAS 480
            PP     PP E PPP +  PP+E PP  ++PP S
Sbjct: 809  PPPSEMPPPSEMPPPSETPPPSETPPPSETPPPS 842

[22][TOP]
>UniRef100_Q9SC42 Proline-rich protein n=1 Tax=Pisum sativum RepID=Q9SC42_PEA
          Length = 214

 Score =  138 bits (347), Expect = 2e-31
 Identities = 85/172 (49%), Positives = 98/172 (56%), Gaps = 16/172 (9%)
 Frame = +1

Query: 4   HHAKPPYENPP----PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPP----HEH 159
           ++ KPP   PP    P Y+PP EKPP  Y+PP  K P V  PP Y+PP EKPP       
Sbjct: 22  NYEKPPVYRPPVETPPIYKPPVEKPPV-YKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVK 79

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENPP 327
            PP Y+PP E  PP ++PP EKPP  K     PP Y+PP E PP  Y PP E+PP   PP
Sbjct: 80  KPPVYKPPVE-KPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPT-YKPPVERPPVYKPP 137

Query: 328 ----PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
               P Y PP EKPP   P P  +PP  KPP E  PP ++PP EKPP  K P
Sbjct: 138 VEKPPTYKPPVEKPPVYKP-PVEKPPTYKPPVEK-PPAYKPPVEKPPVYKPP 187

 Score =  102 bits (255), Expect = 1e-20
 Identities = 67/145 (46%), Positives = 76/145 (52%), Gaps = 4/145 (2%)
 Frame = +1

Query: 1   PHHAKPPYENP----PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P   KPP   P    PP Y+PP EK PP Y+PP      V  PP Y+PP EK      PP
Sbjct: 76  PPVKKPPVYKPPVEKPPVYKPPVEK-PPTYKPP------VEKPPVYKPPVEK------PP 122

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
            Y+PP E  PP ++PP EK      PP Y+PP E  PP Y PP EK      PP Y PP 
Sbjct: 123 TYKPPVE-RPPVYKPPVEK------PPTYKPPVE-KPPVYKPPVEK------PPTYKPPV 168

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPP 423
           EKP      P Y+PP +KPP   PP
Sbjct: 169 EKP------PAYKPPVEKPPVYKPP 187

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 33/72 (45%), Positives = 40/72 (55%), Gaps = 8/72 (11%)
 Frame = +1

Query: 280 PEYLPPHEKPPHENP----PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQ 435
           P+    +EKPP   P    PP Y PP EKPP   P P Y+PP +KPP   P    PP ++
Sbjct: 17  PQGFANYEKPPVYRPPVETPPIYKPPVEKPPVYKP-PVYKPPVEKPPVYKPPVEKPPVYK 75

Query: 436 PPNEKPPHEKSP 471
           PP +KPP  K P
Sbjct: 76  PPVKKPPVYKPP 87

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 30/57 (52%), Positives = 33/57 (57%), Gaps = 4/57 (7%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPPHEHSPPG 171
           KPP E PP  Y+PP EKPP  Y+PP  K P   PP    P Y+PP EKPP    P G
Sbjct: 135 KPPVEKPPT-YKPPVEKPPV-YKPPVEKPPTYKPPVEKPPAYKPPVEKPPVYKPPVG 189

[23][TOP]
>UniRef100_Q43414 Proline rich protein (Fragment) n=1 Tax=Cicer arietinum
           RepID=Q43414_CICAR
          Length = 227

 Score =  138 bits (347), Expect = 2e-31
 Identities = 87/177 (49%), Positives = 98/177 (55%), Gaps = 24/177 (13%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGK----QPHVNPPPQYQPPHEKP----PHEHSPP 168
           KPP E PP  Y+PP EK PP Y+PP  K    +P V  PP Y+PP EKP    P    PP
Sbjct: 4   KPPVEKPPV-YKPPIEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPP 61

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENP---- 324
            Y+PP E  PP ++PP EKPP  K     PP Y+PP E  PP Y PP EKPP   P    
Sbjct: 62  IYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEK 119

Query: 325 PPEYNPPHEKPPHEHP----SPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
           PP Y PP EKPP   P     P Y+PP +KPP   P    PP + PP EKPP  K P
Sbjct: 120 PPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPPVEKPPVYKPP 176

 Score =  137 bits (345), Expect = 4e-31
 Identities = 87/185 (47%), Positives = 99/185 (53%), Gaps = 28/185 (15%)
 Frame = +1

Query: 1   PHHAKPPYENP----PPEYQPPHEKPPPEYQPPHGKQPHVNP----PPQYQPPHEKP--- 147
           P   KPP   P    PP Y+PP EK PP Y+PP  K P   P    PP Y+PP EKP   
Sbjct: 5   PPVEKPPVYKPPIEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIY 63

Query: 148 -PHEHSPPGYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPP 312
            P    PP Y+PP E  PP ++PP EKPP  K     PP Y+PP E  PP Y PP EKPP
Sbjct: 64  KPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPP 121

Query: 313 HENP----PPEYNPPHEKPPHEHP----SPEYQPPHQKPPHENP----PPKFQPPNEKPP 456
              P    PP Y PP EKPP   P     P Y+PP +KPP   P    PP ++PP E+PP
Sbjct: 122 VYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPPVEKPPVYKPPIEEPP 181

Query: 457 HEKSP 471
             K P
Sbjct: 182 VYKPP 186

 Score =  137 bits (344), Expect = 5e-31
 Identities = 88/195 (45%), Positives = 100/195 (51%), Gaps = 37/195 (18%)
 Frame = +1

Query: 1   PHHAKPPYENP----PPEYQPPHEKP---------PPEYQPPHGK----QPHVNPPPQYQ 129
           P   KPP   P    PP Y+PP EKP         PP Y+PP  K    +P V  PP Y+
Sbjct: 15  PPIEKPPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVYK 74

Query: 130 PPHEKP----PHEHSPPGYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPE 285
           PP EKP    P    PP Y+PP E  PP ++PP EKPP  K     PP Y+PP E  PP 
Sbjct: 75  PPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPV 132

Query: 286 YLPPHEKPPHENP----PPEYNPPHEKPPHEHP----SPEYQPPHQKPPHENP----PPK 429
           Y PP EKPP   P    PP Y PP EKPP   P     P Y+PP ++PP   P    PP 
Sbjct: 133 YKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPPVEKPPVYKPPIEEPPVYKPPVEKPPV 192

Query: 430 FQPPNEKPPHEKSPP 474
           + PP EKPPH    P
Sbjct: 193 YGPPYEKPPHYPGYP 207

 Score =  135 bits (340), Expect = 1e-30
 Identities = 87/176 (49%), Positives = 98/176 (55%), Gaps = 21/176 (11%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPP----HEHSPP 168
           KPP E PP  Y+PP EKPP  Y+PP  K P   PP    P Y+PP EKPP        PP
Sbjct: 54  KPPVEKPPI-YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 111

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENPP--- 327
            Y+PP E  PP ++PP EKPP  K     PP Y+PP E PP  Y PP EKPP   PP   
Sbjct: 112 VYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPV-YKPPIEKPPVYTPPVEK 169

Query: 328 -PEYNPPHEKPPHEHP----SPEYQPPHQKPPHENPPPKFQPPNEKPPHEKS-PPA 477
            P Y PP E+PP   P     P Y PP++KPPH    P + PP EKPPH    PPA
Sbjct: 170 PPVYKPPIEEPPVYKPPVEKPPVYGPPYEKPPHY---PGY-PPYEKPPHHPGYPPA 221

 Score =  129 bits (323), Expect = 1e-28
 Identities = 79/165 (47%), Positives = 91/165 (55%), Gaps = 20/165 (12%)
 Frame = +1

Query: 37  PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKP----PHEHSPPGYQPPHEIPPPE 204
           P Y+PP EKPP  Y+PP      +  PP Y+PP EKP    P    PP Y+PP E  PP 
Sbjct: 1   PVYKPPVEKPPV-YKPP------IEKPPVYKPPVEKPPVYKPPVEKPPVYKPPIE-KPPV 52

Query: 205 HQPPHEKPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENP----PPEYNPPHEKPP 360
           ++PP EKPP  K     PP Y+PP E  PP Y PP EKPP   P    PP Y PP EKPP
Sbjct: 53  YKPPVEKPPIYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 111

Query: 361 HEHP----SPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
              P     P Y+PP +KPP   P    PP ++PP EKPP  K P
Sbjct: 112 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPP 156

 Score =  126 bits (316), Expect = 9e-28
 Identities = 79/170 (46%), Positives = 93/170 (54%), Gaps = 25/170 (14%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPP----HEHSPP 168
           KPP E PP  Y+PP EKPP  Y+PP  K P   PP    P Y+PP EKPP        PP
Sbjct: 64  KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 121

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPP---------PEYLPPHEKP 309
            Y+PP E  PP ++PP EKPP  K     PP Y+PP E PP         P Y PP E+P
Sbjct: 122 VYKPPVE-KPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPPVEKPPVYKPPIEEP 180

Query: 310 PHENPP----PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE 447
           P   PP    P Y PP+EKPPH    P Y PP++KPPH    P + P ++
Sbjct: 181 PVYKPPVEKPPVYGPPYEKPPHY---PGY-PPYEKPPHH---PGYPPADD 223

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 40/91 (43%), Positives = 45/91 (49%), Gaps = 4/91 (4%)
 Frame = +1

Query: 1   PHHAKPPYENP----PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P   KPP   P    PP Y+PP E+ PP Y+PP      V  PP Y PP+EKPPH    P
Sbjct: 155 PPIEKPPVYTPPVEKPPVYKPPIEE-PPVYKPP------VEKPPVYGPPYEKPPHY---P 204

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQP 261
           GY            PP+EKPPH    P Y P
Sbjct: 205 GY------------PPYEKPPH---HPGYPP 220

[24][TOP]
>UniRef100_Q40376 Nodulin n=1 Tax=Medicago truncatula RepID=Q40376_MEDTR
          Length = 549

 Score =  138 bits (347), Expect = 2e-31
 Identities = 87/194 (44%), Positives = 98/194 (50%), Gaps = 37/194 (19%)
 Frame = +1

Query: 1   PHHAKPPYENP----PPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPPHE 156
           PH  KPP   P    PP + PP EK PP Y+PP  K P   PP    P Y+P  EKPP  
Sbjct: 42  PHIEKPPVHKPLVEKPPTHHPPIEK-PPIYKPPVEKPPAYKPPVEHHPVYKPSVEKPP-V 99

Query: 157 HSPPGYQPP-HEIP---PPEHQPPHEKPPHAKSPPEYQPPHEHP-------------PPE 285
           H PP  +PP H+ P   PP H+PP EKPP  K P E  P H+ P             PP 
Sbjct: 100 HKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPV 159

Query: 286 YLPPHEKPPHENP----PPEYNPPHEKPPHEHPS----PEYQPPHQKP----PHENPPPK 429
           Y PP EKPP   P    PP + PP EKPP   P     P Y+PP +KP    PH   PP 
Sbjct: 160 YKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPV 219

Query: 430 FQPPNEKPPHEKSP 471
            +PP EKPP  K P
Sbjct: 220 NKPPVEKPPVHKPP 233

 Score =  134 bits (336), Expect = 4e-30
 Identities = 86/194 (44%), Positives = 100/194 (51%), Gaps = 37/194 (19%)
 Frame = +1

Query: 1   PHHAKPPYENP----PPEYQPPHEKPP----PEYQPPHGKQPHVNPP----PQYQPPHEK 144
           PH  KPP   P    PP ++PP EK P    P  +PP  K P   PP    P Y+PP EK
Sbjct: 252 PHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEK 311

Query: 145 PP----HEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSP----PEYQPPHEHPP------- 279
           PP    H   PP ++PP E  PP H+PP EKPP  K P    P Y+PP E PP       
Sbjct: 312 PPVYKPHVEKPPLHKPPVE-KPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVE 370

Query: 280 --PEYLPPHEKPPHENP----PPEYNPPHEKPPHEHPS----PEYQPPHQKPPHENPPPK 429
             P + PP EKPP   P    PP + PP EKPP   P     P Y+PP +KPP   PP +
Sbjct: 371 KPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPPVE 430

Query: 430 FQPPNEKPPHEKSP 471
            +PP  KPP EK P
Sbjct: 431 -KPPVHKPPVEKPP 443

 Score =  133 bits (334), Expect = 7e-30
 Identities = 84/178 (47%), Positives = 96/178 (53%), Gaps = 21/178 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPP----HEHSPP 168
           PH  KPP   PP E +PP  KPP E  P H  +P V   P Y+PP EKPP    H   PP
Sbjct: 317 PHVEKPPLHKPPVE-KPPVHKPPVEKPPVH--KPPVEKLPVYKPPVEKPPVYKPHVEKPP 373

Query: 169 GYQPPHEIPP---------PEHQPPHEKPPHAKSP----PEYQPPHEHPPPEYLPPHEKP 309
            ++PP E PP         P H+PP EKPP  K P    P Y+PP E PP  Y PP EKP
Sbjct: 374 LHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPV-YKPPVEKP 432

Query: 310 PHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPK----FQPPNEKPPHEKSP 471
           P   PP E  PP  KP  E P+ EY+PP +K P   PP +     +PP EKPP  KSP
Sbjct: 433 PVHKPPVE-KPPLHKPQVEKPT-EYKPPIEKFPVYKPPVEKPQVHKPPVEKPPVHKSP 488

 Score =  127 bits (320), Expect = 3e-28
 Identities = 79/183 (43%), Positives = 92/183 (50%), Gaps = 26/183 (14%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKP---PPEYQPPHGK----QPHVNPPPQYQPPHEKPP-HE 156
           P   KPP   PP E  P H+ P   PP ++PP  K    +P V  PP Y+PP EKPP H+
Sbjct: 112 PPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHK 171

Query: 157 ---HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQP---PHEHPPPEYLPPHEKPPHE 318
                PP ++PP E  PP H+PP EK P  K P E  P   PH   PP   PP EKPP  
Sbjct: 172 PLVEKPPVHKPPVE-KPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVH 230

Query: 319 NPPPEYNPPHEKP--------PHEHPSPEYQPPHQKPPHENPP----PKFQPPNEKPPHE 462
            PP E  P H+ P        PH    P Y+P  +KPP   PP    P  +PP EKPP  
Sbjct: 231 KPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVH 290

Query: 463 KSP 471
           K P
Sbjct: 291 KPP 293

 Score =  127 bits (318), Expect = 5e-28
 Identities = 82/183 (44%), Positives = 94/183 (51%), Gaps = 26/183 (14%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEK-----PPHEHSP 165
           PH  KPP   PP E +PP  KPP E  P H  +P V  PP ++PP EK     PP E  P
Sbjct: 367 PHVEKPPLHKPPVE-KPPVHKPPVEKPPVH--KPPVEKPPVHKPPVEKLPVYKPPVE-KP 422

Query: 166 PGYQPPHEIPPPEHQPPHEKPP----HAKSPPEYQPPHE----HPPPEYLPPHEKPPHEN 321
           P Y+PP E  PP H+PP EKPP      + P EY+PP E    + PP   P   KPP E 
Sbjct: 423 PVYKPPVE-KPPVHKPPVEKPPLHKPQVEKPTEYKPPIEKFPVYKPPVEKPQVHKPPVEK 481

Query: 322 PP---------PEYNPPHEKPPHEHPSPEYQPPH----QKPPHENPPPKFQPPNEKPPHE 462
           PP         P Y PP EKPP   P  E  P H    +KPP   PP + +PP  KPP E
Sbjct: 482 PPVHKSPVKKLPVYKPPAEKPPVYKPPVENPPVHKPLVEKPPVYKPPVE-KPPVHKPPFE 540

Query: 463 KSP 471
           K P
Sbjct: 541 KPP 543

 Score =  121 bits (303), Expect = 3e-26
 Identities = 80/186 (43%), Positives = 92/186 (49%), Gaps = 33/186 (17%)
 Frame = +1

Query: 13  KPPYENPP---------PEYQPPHEKPP---------PEYQPPHGKQPHVNPPPQYQPPH 138
           KPP E PP         P Y+P  EKPP         P ++PP      V  PP ++PP 
Sbjct: 71  KPPVEKPPAYKPPVEHHPVYKPSVEKPPVHKPPVEKPPVHKPP------VEKPPVHKPPV 124

Query: 139 EKPPHEHSPPGYQPPHEIPP----PEHQPPHEKPPHAKSPPEYQPPHE---HPPPEYLPP 297
           EKPP  H PP  +PP   PP    P ++P  EKPP  K P E  P H+     PP + PP
Sbjct: 125 EKPP-VHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPP 183

Query: 298 HEKPPHENPP----PEYNPPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKP 453
            EKPP   PP    P Y PP EKPP   P  E +PP  KPP E P    PP  +PP  KP
Sbjct: 184 VEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVE-KPPVNKPPVEKPPVHKPPVEKPPVHKP 242

Query: 454 PHEKSP 471
           P EK P
Sbjct: 243 PVEKLP 248

 Score =  115 bits (287), Expect = 2e-24
 Identities = 75/162 (46%), Positives = 86/162 (53%), Gaps = 21/162 (12%)
 Frame = +1

Query: 1   PHHAKPPYENPP----PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKP----PHE 156
           P   KPP   PP    P Y+PP EKPP  Y+PP  K P V+ PP  +PP  KP    P E
Sbjct: 397 PPVEKPPVHKPPVEKLPVYKPPVEKPPV-YKPPVEKPP-VHKPPVEKPPLHKPQVEKPTE 454

Query: 157 HSPP-----GYQPPHEIPPPEHQPPHEKPPHAKSP----PEYQPPHEHPPPEYLPPHEKP 309
           + PP      Y+PP E  P  H+PP EKPP  KSP    P Y+PP E PP  Y PP E P
Sbjct: 455 YKPPIEKFPVYKPPVE-KPQVHKPPVEKPPVHKSPVKKLPVYKPPAEKPPV-YKPPVENP 512

Query: 310 PHENP----PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP 423
           P   P    PP Y PP EKP      P ++PP +KPP   PP
Sbjct: 513 PVHKPLVEKPPVYKPPVEKP------PVHKPPFEKPPIYTPP 548

 Score =  112 bits (281), Expect = 1e-23
 Identities = 70/173 (40%), Positives = 85/173 (49%), Gaps = 27/173 (15%)
 Frame = +1

Query: 34  PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQP 213
           PPEY+PP E P  ++  PH ++P V+ P   +PP   PP E  PP Y+PP E  PP ++P
Sbjct: 27  PPEYKPPVENP--QFYKPHIEKPPVHKPLVEKPPTHHPPIE-KPPIYKPPVE-KPPAYKP 82

Query: 214 PHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP---------PPEYNPPHEKPPHE 366
           P E  P  K  P  + P  H PP   PP  KPP E P         PP + PP EKPP  
Sbjct: 83  PVEHHPVYK--PSVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVH 140

Query: 367 HP--------------SPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
            P               P Y+PP +KPP   P    PP  +PP EKPP  K P
Sbjct: 141 KPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPP 193

 Score =  110 bits (274), Expect = 6e-23
 Identities = 70/156 (44%), Positives = 85/156 (54%), Gaps = 11/156 (7%)
 Frame = +1

Query: 37  PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPP-HE---HSPPGYQPPHEIPPPE 204
           P+    +EKPP EY+PP      V  P  Y+P  EKPP H+     PP + PP E  PP 
Sbjct: 18  PQGLANYEKPP-EYKPP------VENPQFYKPHIEKPPVHKPLVEKPPTHHPPIE-KPPI 69

Query: 205 HQPPHEKPPHAKSPPEYQP---PHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
           ++PP EKPP  K P E+ P   P    PP + PP EKPP   PP E  PP  KPP E P 
Sbjct: 70  YKPPVEKPPAYKPPVEHHPVYKPSVEKPPVHKPPVEKPPVHKPPVE-KPPVHKPPVEKP- 127

Query: 376 PEYQPPHQKPPHENPP----PKFQPPNEKPPHEKSP 471
           P ++PP +KPP   PP    P ++P  EKPP  K P
Sbjct: 128 PVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPP 163

[25][TOP]
>UniRef100_Q40358 Repetitive proline-rich cell wall protein n=1 Tax=Medicago sativa
           RepID=PRP_MEDSA
          Length = 236

 Score =  138 bits (347), Expect = 2e-31
 Identities = 88/187 (47%), Positives = 99/187 (52%), Gaps = 34/187 (18%)
 Frame = +1

Query: 13  KPPYENPP----PEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPPHEHSPP 168
           KPP E PP    P Y+PP EKPP  Y+PP  K P   PP    P Y+PP EKPP  + PP
Sbjct: 46  KPPVEKPPVYKPPVYKPPVEKPPV-YKPPVVKPPVYKPPVYKPPVYKPPVEKPP-VYKPP 103

Query: 169 GYQPPHEIPP---------PEHQPPHEKPPHAK---------SPPEYQPPHEHPP----P 282
            Y+PP   PP         P ++PP EKPP  K          PP Y+PP E PP    P
Sbjct: 104 VYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 163

Query: 283 EYLPPHEKPPHENPP----PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEK 450
            Y PP  KPP   PP    P Y PP  KPP E P P Y+PP  KPP E PP  ++PP  K
Sbjct: 164 VYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKP-PVYKPPVYKPPVEKPPV-YKPPVYK 221

Query: 451 PPHEKSP 471
           PP EK P
Sbjct: 222 PPVEKPP 228

 Score =  137 bits (346), Expect = 3e-31
 Identities = 88/186 (47%), Positives = 99/186 (53%), Gaps = 29/186 (15%)
 Frame = +1

Query: 1   PHHAKPPYENP----PPEYQPPHEKP----PPEYQPPHGKQPHVNP----PPQYQPPHEK 144
           P   KPP   P    PP Y+PP  KP    PP Y+PP  K P   P    PP Y+PP EK
Sbjct: 37  PPVEKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEK 96

Query: 145 PPHEHSPPGYQPPHEIP---------PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPP 297
           PP  + PP Y+PP   P         PP ++PP EKPP  K PP Y+PP E  PP Y PP
Sbjct: 97  PP-VYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYK-PPVYKPPVE-KPPVYKPP 153

Query: 298 HEKPPHENP----PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKP 453
            EKPP   P    PP Y PP  KPP   P P Y+PP  KPP E P    PP ++PP EKP
Sbjct: 154 VEKPPVYKPPVYKPPVYKPPVVKPPVYKP-PVYKPPVYKPPVEKPPVYKPPVYKPPVEKP 212

Query: 454 PHEKSP 471
           P  K P
Sbjct: 213 PVYKPP 218

 Score =  135 bits (341), Expect = 1e-30
 Identities = 83/164 (50%), Positives = 96/164 (58%), Gaps = 12/164 (7%)
 Frame = +1

Query: 1   PHHAKPPYENPP----PEYQPPHEKPP----PEYQPPHGKQPHVNPP----PQYQPPHEK 144
           P   KPP   PP    P Y+PP EKPP    P Y+PP  K P V PP    P Y+PP EK
Sbjct: 72  PPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEK 131

Query: 145 PPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP 324
           PP  + PP Y+PP E  PP ++PP EKPP  K PP Y+PP  + PP   PP  KPP   P
Sbjct: 132 PP-VYKPPVYKPPVE-KPPVYKPPVEKPPVYK-PPVYKPP-VYKPPVVKPPVYKPPVYKP 187

Query: 325 PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPP 456
           P  Y PP EKPP   P P Y+PP +KPP    PP ++PP EKPP
Sbjct: 188 PV-YKPPVEKPPVYKP-PVYKPPVEKPP-VYKPPVYKPPVEKPP 228

 Score =  132 bits (333), Expect = 9e-30
 Identities = 83/168 (49%), Positives = 97/168 (57%), Gaps = 12/168 (7%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPP 183
           ++ KPP   PP  Y+PP EKPP  Y+PP  K P V  PP Y+PP EKPP  + PP  +PP
Sbjct: 23  NYDKPPVYQPPV-YKPPVEKPPV-YKPPVEKPP-VYKPPVYKPPVEKPP-VYKPPVVKPP 78

Query: 184 HEIP----PPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEYN 339
              P    PP ++PP EKPP  K PP Y+PP   P    PP Y PP  KPP E  PP Y 
Sbjct: 79  VYKPPVYKPPVYKPPVEKPPVYK-PPVYKPPVYKPPVVKPPVYKPPVYKPPVEK-PPVYK 136

Query: 340 PPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
           PP  KPP E P P Y+PP +KPP   P    PP ++PP  KPP  K P
Sbjct: 137 PPVYKPPVEKP-PVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPP 183

 Score =  113 bits (282), Expect = 7e-24
 Identities = 73/153 (47%), Positives = 80/153 (52%), Gaps = 25/153 (16%)
 Frame = +1

Query: 13  KPPYENPP----PEYQPPHEKPP----PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           KPP E PP    P Y+PP  KPP    P Y+PP  K P V  PP Y+PP  KPP E  PP
Sbjct: 91  KPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPP-VEKPPVYKPPVYKPPVE-KPP 148

Query: 169 GYQPPHEIPP----PEHQPPHEKPPHAK---------SPPEYQPPHEHPP----PEYLPP 297
            Y+PP E PP    P ++PP  KPP  K          PP Y+PP E PP    P Y PP
Sbjct: 149 VYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPP 208

Query: 298 HEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPH 396
            EKPP    PP Y PP EKP      P Y PPH
Sbjct: 209 VEKPP-VYKPPVYKPPVEKP------PVYGPPH 234

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 46/100 (46%), Positives = 52/100 (52%), Gaps = 12/100 (12%)
 Frame = +1

Query: 13  KPPYENPP----PEYQPPHEKPP----PEYQPPHGKQPHVNPP----PQYQPPHEKPPHE 156
           KPP E PP    P Y+PP  KPP    P Y+PP  K P   PP    P Y+PP  KPP E
Sbjct: 151 KPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVE 210

Query: 157 HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP 276
             PP Y+P      P ++PP EK      PP Y PPH HP
Sbjct: 211 -KPPVYKP------PVYKPPVEK------PPVYGPPH-HP 236

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 35/66 (53%), Positives = 38/66 (57%), Gaps = 4/66 (6%)
 Frame = +1

Query: 1   PHHAKPPYENPP----PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P   KPP   PP    P Y+PP EKPP  Y+PP  K P V  PP Y+PP  KPP E  PP
Sbjct: 172 PPVVKPPVYKPPVYKPPVYKPPVEKPPV-YKPPVYKPP-VEKPPVYKPPVYKPPVE-KPP 228

Query: 169 GYQPPH 186
            Y PPH
Sbjct: 229 VYGPPH 234

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 18/82 (21%)
 Frame = +1

Query: 280 PEYLPPHEKPPHENP---------PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP---- 420
           P+ L  ++KPP   P         PP Y PP EKPP   P P Y+PP +KPP   P    
Sbjct: 18  PQGLANYDKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKP-PVYKPPVEKPPVYKPPVVK 76

Query: 421 -----PPKFQPPNEKPPHEKSP 471
                PP ++PP  KPP EK P
Sbjct: 77  PPVYKPPVYKPPVYKPPVEKPP 98

[26][TOP]
>UniRef100_P08012 Repetitive proline-rich cell wall protein 1 n=1 Tax=Glycine max
           RepID=PRP1_SOYBN
          Length = 256

 Score =  138 bits (347), Expect = 2e-31
 Identities = 83/165 (50%), Positives = 97/165 (58%), Gaps = 12/165 (7%)
 Frame = +1

Query: 13  KPPYENPP----PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           KPP E PP    P Y+PP EKPP  Y+PP  K P +  PP Y+PP EKPP  + PP Y+P
Sbjct: 45  KPPVEKPPVYKPPVYKPPVEKPPV-YKPPVYKPP-IYKPPVYKPPVEKPP-VYKPPVYKP 101

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP----PPEYNPPH 348
           P    PP ++PP EKPP  K PP Y+PP  + PP Y PP  KPP   P    PP Y PP 
Sbjct: 102 P-VYKPPVYKPPIEKPPVYK-PPVYKPP-VYKPPVYKPPVYKPPVYKPPVEKPPVYKPPV 158

Query: 349 EKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
            KPP   P P Y+PP +KPP   P    PP ++PP  KPP EK P
Sbjct: 159 YKPPVYKP-PVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPP 202

 Score =  137 bits (346), Expect = 3e-31
 Identities = 88/197 (44%), Positives = 100/197 (50%), Gaps = 42/197 (21%)
 Frame = +1

Query: 7   HAKPPYENPP----PEYQPPHEKP----PPEYQPPHGKQPHVNP---------PPQYQPP 135
           + KPP   PP    P Y+PP EKP    PP Y+PP  K P   P         PP Y+PP
Sbjct: 28  YEKPPIYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPP 87

Query: 136 HEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHP----PPEYL 291
            EKPP  + PP Y+PP    PP ++PP EKPP  K     PP Y+PP   P    PP Y 
Sbjct: 88  VEKPP-VYKPPVYKPP-VYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYK 145

Query: 292 PPHEKPPHENP----PPEYNPPHEKPPHEHP---------SPEYQPPHQKPPHENP---- 420
           PP EKPP   P    PP Y PP  KPP E P          P Y+PP  KPP E P    
Sbjct: 146 PPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYK 205

Query: 421 PPKFQPPNEKPPHEKSP 471
           PP ++PP EKPP  K P
Sbjct: 206 PPVYKPPIEKPPVYKPP 222

 Score =  133 bits (335), Expect = 5e-30
 Identities = 83/172 (48%), Positives = 96/172 (55%), Gaps = 16/172 (9%)
 Frame = +1

Query: 13  KPPYENPP----PEYQPPHEKPP----PEYQPPHGKQPHVNPP----PQYQPPHEKPPHE 156
           KPP   PP    P Y+PP EKPP    P Y+PP  K P   PP    P Y+PP EKPP  
Sbjct: 95  KPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPP-V 153

Query: 157 HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY 336
           + PP Y+PP    PP ++PP EKPP  K PP Y+PP  + PP Y PP EKPP   PP  Y
Sbjct: 154 YKPPVYKPP-VYKPPVYKPPVEKPPVYK-PPVYKPP-VYKPPVYKPPVEKPPIYKPPV-Y 209

Query: 337 NPPHEKPPHEHPS----PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
            PP EKPP   P     P Y+PP  KPP +      +PP  KPP+ K PP S
Sbjct: 210 KPPIEKPPVYKPPVYKPPVYKPPVYKPPVK------KPPIYKPPYPKYPPGS 255

 Score =  121 bits (303), Expect = 3e-26
 Identities = 76/152 (50%), Positives = 87/152 (57%), Gaps = 17/152 (11%)
 Frame = +1

Query: 13  KPPYENPP----PEYQPPHEKPP----PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           KPP E PP    P Y+PP  KPP    P Y+PP  K P V  PP Y+PP  KPP  + PP
Sbjct: 110 KPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPP-VEKPPVYKPPVYKPP-VYKPP 167

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP----PEYLPPHEKPPHENPP--- 327
            Y+PP E  PP ++PP  KPP  K PP Y+PP E PP    P Y PP EKPP   PP   
Sbjct: 168 VYKPPVE-KPPVYKPPVYKPPVYK-PPVYKPPVEKPPIYKPPVYKPPIEKPPVYKPPVYK 225

Query: 328 -PEYNPPHEKPPHEHPSPEYQPPHQK-PPHEN 417
            P Y PP  KPP + P P Y+PP+ K PP  N
Sbjct: 226 PPVYKPPVYKPPVKKP-PIYKPPYPKYPPGSN 256

 Score =  120 bits (302), Expect = 4e-26
 Identities = 77/167 (46%), Positives = 89/167 (53%), Gaps = 22/167 (13%)
 Frame = +1

Query: 37  PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPP 216
           P+    +EKPP  Y+PP      V  PP Y+PP EKPP  + PP Y+PP E  PP ++PP
Sbjct: 22  PQVLADYEKPPI-YKPP------VYTPPVYKPPVEKPP-VYKPPVYKPPVE-KPPVYKPP 72

Query: 217 HEKPPHAKSPPEYQPPHEHP---------PPEYLPPHEKPPHENP----PPEYNPPHEKP 357
             KPP  K PP Y+PP E P         PP Y PP  KPP E P    PP Y PP  KP
Sbjct: 73  VYKPPIYK-PPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKP 131

Query: 358 PHEHPSPEYQPPHQKPPHENP---------PPKFQPPNEKPPHEKSP 471
           P   P P Y+PP  KPP E P         PP ++PP  KPP EK P
Sbjct: 132 PVYKP-PVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPP 177

[27][TOP]
>UniRef100_Q43564 Repetitive proline-rich cell wall protein 1 n=1 Tax=Medicago
           truncatula RepID=PRP1_MEDTR
          Length = 206

 Score =  135 bits (340), Expect = 1e-30
 Identities = 84/169 (49%), Positives = 95/169 (56%), Gaps = 16/169 (9%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPPHEHSPPGYQP 180
           KPP E PP  Y+PP EKPP  Y+PP  K P   PP    P Y+PP  KPP  + PP Y+P
Sbjct: 36  KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVYKPPVYKPPVVKPP-VYKPPVYKP 92

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP----PEYLPPHEKPPHENP----PPEY 336
           P    PP ++PP EKPP  K PP Y+PP   PP    P Y PP EKPP   P    PP Y
Sbjct: 93  P-VYKPPVYKPPVEKPPVYK-PPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVY 150

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
            PP  KPP   P P Y+PP  KPP   P    PP ++PP  KPP EK P
Sbjct: 151 KPPVYKPPVVKP-PVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPP 198

 Score =  130 bits (326), Expect = 6e-29
 Identities = 79/162 (48%), Positives = 90/162 (55%), Gaps = 16/162 (9%)
 Frame = +1

Query: 34  PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP----PP 201
           PP YQPP  KPP E  P +  +P V  PP Y+PP EKPP  + PP Y+PP   P    PP
Sbjct: 27  PPVYQPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPP-VYKPPVYKPPVYKPPVVKPP 83

Query: 202 EHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEYNPPHEKPPHEH 369
            ++PP  KPP  K PP Y+PP E P    PP Y PP  KPP    PP Y PP EKPP   
Sbjct: 84  VYKPPVYKPPVYK-PPVYKPPVEKPPVYKPPVYKPPVVKPP-VYKPPVYKPPVEKPPVYK 141

Query: 370 P----SPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
           P     P Y+PP  KPP   P    PP ++PP  KPP EK P
Sbjct: 142 PPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPP 183

 Score =  125 bits (314), Expect = 1e-27
 Identities = 76/153 (49%), Positives = 87/153 (56%), Gaps = 16/153 (10%)
 Frame = +1

Query: 13  KPPYENPP----PEYQPPHEKPP----PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           KPP E PP    P Y+PP  KPP    P Y+PP  K P V  PP Y+PP EKPP  + PP
Sbjct: 56  KPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPP-VYKPPVYKPPVEKPP-VYKPP 113

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP----PEYLPPHEKPPHENPP--- 327
            Y+PP  + PP ++PP  KPP  K PP Y+PP   PP    P Y PP  KPP   PP   
Sbjct: 114 VYKPP-VVKPPVYKPPVYKPPVEK-PPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYK 171

Query: 328 -PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP 423
            P Y PP EKPP   P P Y+PP +KPP   PP
Sbjct: 172 PPVYKPPVEKPPVYKP-PVYKPPVEKPPVYGPP 203

 Score =  123 bits (309), Expect = 6e-27
 Identities = 80/165 (48%), Positives = 91/165 (55%), Gaps = 16/165 (9%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPP----PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           KPP E PP  Y+PP EKPP    P Y+PP  K P V PP  Y+PP  KPP  + PP Y+P
Sbjct: 46  KPPVEKPPV-YKPPVEKPPVYKPPVYKPPVYKPPVVKPPV-YKPPVYKPP-VYKPPVYKP 102

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPP----PEYLPPHEKPPHENPP--- 327
           P E PP    P ++PP  KPP  K PP Y+PP E PP    P   PP  KPP   PP   
Sbjct: 103 PVEKPPVYKPPVYKPPVVKPPVYK-PPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVVK 161

Query: 328 -PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPH 459
            P Y PP  KPP   P P  +PP  KPP   PP + +PP   PPH
Sbjct: 162 PPVYKPPVYKPPVYKP-PVEKPPVYKPPVYKPPVE-KPPVYGPPH 204

 Score =  110 bits (275), Expect = 5e-23
 Identities = 72/149 (48%), Positives = 83/149 (55%), Gaps = 4/149 (2%)
 Frame = +1

Query: 37  PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPP 216
           P+    +EKPP  YQPP  K P V  PP Y+PP EKPP       Y+PP E  PP ++PP
Sbjct: 18  PQGLANYEKPPV-YQPPVYKPP-VEKPPVYKPPVEKPPV------YKPPVE-KPPVYKPP 68

Query: 217 HEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP----PPEYNPPHEKPPHEHPSPEY 384
             KPP  K PP  +PP  + PP Y PP  KPP   P    PP Y PP  KPP   P P Y
Sbjct: 69  VYKPPVYK-PPVVKPP-VYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKP-PVY 125

Query: 385 QPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           +PP  KPP E  PP ++PP  KPP  K P
Sbjct: 126 KPPVYKPPVEK-PPVYKPPVVKPPVYKPP 153

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 47/105 (44%), Positives = 53/105 (50%), Gaps = 17/105 (16%)
 Frame = +1

Query: 13  KPPYENPP----PEYQPPHEKPP---------PEYQPPHGKQPHVNPP----PQYQPPHE 141
           KPP   PP    P Y+PP EKPP         P Y+PP  K P V PP    P Y+PP  
Sbjct: 116 KPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVY 175

Query: 142 KPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP 276
           KPP E  PP Y+P      P ++PP EK      PP Y PPH HP
Sbjct: 176 KPPVE-KPPVYKP------PVYKPPVEK------PPVYGPPH-HP 206

[28][TOP]
>UniRef100_Q09083 Hydroxyproline-rich glycoprotein n=1 Tax=Phaseolus vulgaris
           RepID=Q09083_PHAVU
          Length = 580

 Score =  135 bits (339), Expect = 2e-30
 Identities = 69/182 (37%), Positives = 91/182 (50%), Gaps = 24/182 (13%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----H 138
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H  PPP++ PP     H
Sbjct: 50  PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 109

Query: 139 EKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHE 303
             PP +HSPP     H  PPP+H PP     H+  PP++ PP     H  PPP++ PP  
Sbjct: 110 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPP 169

Query: 304 KPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP-----NEKPPHEKS 468
              H  PPP+++PP     H  P P++ PP     H  PPPK  PP     +  PP + S
Sbjct: 170 YYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHS 229

Query: 469 PP 474
           PP
Sbjct: 230 PP 231

 Score =  135 bits (339), Expect = 2e-30
 Identities = 69/182 (37%), Positives = 91/182 (50%), Gaps = 24/182 (13%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----H 138
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H  PPP++ PP     H
Sbjct: 66  PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 125

Query: 139 EKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHE 303
             PP +HSPP     H  PPP+H PP     H+  PP++ PP     H  PPP++ PP  
Sbjct: 126 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPP 185

Query: 304 KPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP-----NEKPPHEKS 468
              H  PPP+++PP     H  P P++ PP     H  PPPK  PP     +  PP + S
Sbjct: 186 YYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHS 245

Query: 469 PP 474
           PP
Sbjct: 246 PP 247

 Score =  135 bits (339), Expect = 2e-30
 Identities = 69/182 (37%), Positives = 91/182 (50%), Gaps = 24/182 (13%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----H 138
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H  PPP++ PP     H
Sbjct: 82  PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 141

Query: 139 EKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHE 303
             PP +HSPP     H  PPP+H PP     H+  PP++ PP     H  PPP++ PP  
Sbjct: 142 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPP 201

Query: 304 KPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP-----NEKPPHEKS 468
              H  PPP+++PP     H  P P++ PP     H  PPPK  PP     +  PP + S
Sbjct: 202 YYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHS 261

Query: 469 PP 474
           PP
Sbjct: 262 PP 263

 Score =  133 bits (334), Expect = 7e-30
 Identities = 67/177 (37%), Positives = 87/177 (49%), Gaps = 19/177 (10%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----H 138
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H  PPP++ PP     H
Sbjct: 98  PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 157

Query: 139 EKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHE 303
             PP +HSPP     H  PPP+H PP     H+  PP++ PP     H  PPP++ PP  
Sbjct: 158 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPP 217

Query: 304 KPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              H  PPP+++PP     H  P P++ PP     H  PPPK  PP     H   PP
Sbjct: 218 YYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP 274

 Score =  131 bits (329), Expect = 3e-29
 Identities = 69/180 (38%), Positives = 89/180 (49%), Gaps = 22/180 (12%)
 Frame = +1

Query: 1   PHHAKPPYEN--PPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----HEK 144
           P   KP Y    PPP++ PP     H  PPP++ PP     H  PPP++ PP     H  
Sbjct: 36  PPPPKPYYYQSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSP 95

Query: 145 PPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHEKP 309
           PP +HSPP     H  PPP+H PP     H+  PP++ PP     H  PPP++ PP    
Sbjct: 96  PPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYY 155

Query: 310 PHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP-----NEKPPHEKSPP 474
            H  PPP+++PP     H  P P++ PP     H  PPPK  PP     +  PP + SPP
Sbjct: 156 YHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP 215

 Score =  125 bits (315), Expect = 1e-27
 Identities = 64/168 (38%), Positives = 86/168 (51%), Gaps = 17/168 (10%)
 Frame = +1

Query: 22  YENPPPEYQPPHEK--PPPEYQPPHGKQPHVNPPPQYQPP-----HEKPPHEHSPPGYQP 180
           Y +PPP  +P + +  PPP++ PP     H  PPP++ PP     H  PP +HSPP    
Sbjct: 32  YSSPPPPPKPYYYQSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYY 91

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHEKPPHENPPPEYNPP 345
            H  PPP+H PP     H+  PP++ PP     H  PPP++ PP     H  PPP+++PP
Sbjct: 92  YHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP 151

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP-----NEKPPHEKSPP 474
                H  P P++ PP     H  PPPK  PP     +  PP + SPP
Sbjct: 152 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP 199

 Score =  117 bits (292), Expect = 5e-25
 Identities = 68/192 (35%), Positives = 90/192 (46%), Gaps = 34/192 (17%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----H 138
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H  PPP++ PP     H
Sbjct: 162 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 221

Query: 139 EKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHE 303
             PP +HSPP     H  PPP+H PP     H+  PP++ PP     H  PPP+    + 
Sbjct: 222 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKNPYKYS 281

Query: 304 KPP-----HENPPPEYNPPHEKPP----HEHPSPEYQPPHQKPP---HENPPPKFQPPNE 447
            PP     +++PPP Y  P   PP       P P Y+     PP   +++PPP     N 
Sbjct: 282 SPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNS 341

Query: 448 KPP---HEKSPP 474
            PP     KSPP
Sbjct: 342 PPPPVYKYKSPP 353

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 69/213 (32%), Positives = 103/213 (48%), Gaps = 56/213 (26%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPP-----HGKQPHV-NPPPQY--- 126
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H   P   +PPP Y   
Sbjct: 210 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 269

Query: 127 QPPHEKPPHEHS---PPGYQPPHEIPPPEHQPPHEKPPHAK--SPP----EYQPP----- 264
            PP  K P+++S   PP Y+  ++ PPP ++ P   PP  K  SPP    +Y+ P     
Sbjct: 270 SPPPPKNPYKYSSPPPPVYK--YKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVY 327

Query: 265 -HEHPPPEYLPPHEKPP----HENPPP---EYNPPHEKPPHEHPS---PEYQPPHQKPP- 408
            ++ PPP     +  PP    +++PPP   +YN P   PP+++PS   P Y+ P   PP 
Sbjct: 328 KYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSP--PPPYKYPSPPPPPYKYPSPPPPV 385

Query: 409 ------------HENPPPKFQPPNEKPPHEKSP 471
                       +++PPP ++ P+  PP  K P
Sbjct: 386 YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYP 418

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 71/252 (28%), Positives = 95/252 (37%), Gaps = 94/252 (37%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----H 138
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H  PPP++ PP     H
Sbjct: 194 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 253

Query: 139 EKPPHEHSPPG----YQPP-----------------HEIPPPEHQPPHEKPPHAK----- 240
             PP +HSPP     + PP                 ++ PPP ++ P   PP  K     
Sbjct: 254 SPPPPKHSPPPPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPP 313

Query: 241 ---------------------------------------SPPEYQ-----PPHEHP---P 279
                                                   PP Y+     PP+++P   P
Sbjct: 314 PPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPP 373

Query: 280 PEYLPPHEKPP----HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE 447
           P Y  P   PP       PPP Y      PP+++PSP   PP++ P   +PPP     N 
Sbjct: 374 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPP-PPPYKYP---SPPPPVYKYNS 429

Query: 448 KPP---HEKSPP 474
            PP     KSPP
Sbjct: 430 PPPPVYKYKSPP 441

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 57/171 (33%), Positives = 79/171 (46%), Gaps = 20/171 (11%)
 Frame = +1

Query: 22  YENPPPEYQPPHEKPPPEYQ----PPHGKQPHVNPPPQYQPPHEKPPHEH-SPPGYQPPH 186
           Y +PPP        PPP Y+    PP  K P   PPP   P    P +++ SPP     +
Sbjct: 339 YNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 398

Query: 187 EIPPPEHQPPHEKPPHAKSPPEYQPPHEH---PPPEYLPPHEKPP---HENPPPEYNPPH 348
           + PPP ++ P   PP  K P    P +++   PPP Y      PP   +++PPP Y  P 
Sbjct: 399 KSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPS 458

Query: 349 EKPP----HEHPSPEYQPPHQKPP---HENPPPKFQPPNEKPPHEK--SPP 474
             PP       P P Y+     PP   +++PPP ++ P+  PP  K  SPP
Sbjct: 459 PPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPP 509

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 58/171 (33%), Positives = 77/171 (45%), Gaps = 20/171 (11%)
 Frame = +1

Query: 22  YENPPPEYQPPHEKPPPEYQPPHGKQP----HVNPPPQYQPPHEKPP---HEHSPPGYQP 180
           Y++PPP Y+ P   PPP Y+ P    P    +  PPP Y+     PP   ++  PP Y+ 
Sbjct: 398 YKSPPPPYKYP-SPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKY 456

Query: 181 PHEIPPP-EHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPP----HENPPPEYNPP 345
           P   PPP ++  P       KSPP     ++ PPP Y  P   PP       PPP Y   
Sbjct: 457 PSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYK 516

Query: 346 HEKPP---HEHPSPEYQPPHQKPP---HENPPPKFQPPNEKPP--HEKSPP 474
              PP   ++ P P Y+ P   PP   +++PPP     N  PP  H   PP
Sbjct: 517 SPPPPVYKYKSPPPPYKYPSPPPPVYKYKSPPPPVYKYNSPPPPVHSPPPP 567

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 61/186 (32%), Positives = 86/186 (46%), Gaps = 33/186 (17%)
 Frame = +1

Query: 16  PPYENP---PPEYQPPHEKPPPEYQ---PPHGKQPHVNPPPQYQPPHEKPP---HEHSPP 168
           PPY+ P   PP Y+ P   PPP Y+   PP     + +PPP Y+ P   PP   +   PP
Sbjct: 364 PPYKYPSPPPPPYKYP-SPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPP 422

Query: 169 GYQPPHEIPPPEHQPPHEKPP---HAKSPPEYQPPHEHPPP-EYLPP------HEKPP-- 312
                +  PPP ++     PP   +   PP Y+ P   PPP +Y  P      ++ PP  
Sbjct: 423 PVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPP 482

Query: 313 ---HENPPPEYNPPHEKPP----HEHPSPEYQPPHQKPP---HENPPPKFQPPNEKPP-- 456
              +++PPP Y  P   PP       P P Y+     PP   +++PPP ++ P+  PP  
Sbjct: 483 VYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPVY 542

Query: 457 HEKSPP 474
             KSPP
Sbjct: 543 KYKSPP 548

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 60/174 (34%), Positives = 79/174 (45%), Gaps = 16/174 (9%)
 Frame = +1

Query: 1   PHHAKPPYE--NPPPEYQPPHEKPPPEYQ---PPHGKQPHVNPPPQYQPPHEKPP--HEH 159
           P    PPY+  +PPP     +  PPP Y+   PP     + +PPP Y+ P   PP     
Sbjct: 408 PSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYS 467

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEH---PPPEYLPPHEKPP---HEN 321
           SPP     ++ PPP        PP  K P    PP+++   PPP Y      PP   +++
Sbjct: 468 SPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKS 527

Query: 322 PPPEYNPPHEKPP-HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPH--EKSPP 474
           PPP Y  P   PP +++ SP   PP     +  PPP   PP   PPH    SPP
Sbjct: 528 PPPPYKYPSPPPPVYKYKSP---PPPVYKYNSPPPPVHSPP---PPHYIYASPP 575

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 63/173 (36%), Positives = 84/173 (48%), Gaps = 20/173 (11%)
 Frame = +1

Query: 16  PPYENP---PPEYQPPHEKPPPEYQ----PPHGKQPHVNPPPQYQPPHEKPPHEH-SPPG 171
           PPY+ P   PP Y+ P   PPP Y+    PP   +    PPP Y+     PP+++ SPP 
Sbjct: 403 PPYKYPSPPPPPYKYP-SPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPP- 460

Query: 172 YQPPHEI---PPPEHQPPHEKPP--HAKSPPEYQPPHEH---PPPEYLPPHEKPP----H 315
             PP++    PPP ++     PP    KSPP   PP+++   PPP Y      PP     
Sbjct: 461 -PPPYKYSSPPPPVYKYKSPPPPVYKYKSPP---PPYKYPSPPPPPYKYSSPPPPVYKYK 516

Query: 316 ENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PPP Y      PP+++PSP   PP  K  +++PPP     N  PP   SPP
Sbjct: 517 SPPPPVYKYKSPPPPYKYPSP--PPPVYK--YKSPPPPVYKYNSPPPPVHSPP 565

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 47/142 (33%), Positives = 67/142 (47%), Gaps = 26/142 (18%)
 Frame = +1

Query: 22  YENPPPEYQ------PPHE---KPPPEYQ---PPHGKQPHVNPPPQYQ-PPHEKPPHEHS 162
           Y++PPP Y+      PP++    PPP Y+   PP     + +PPP Y+ P    PP+++S
Sbjct: 447 YKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYS 506

Query: 163 ---PPGYQ-----PP---HEIPPPEHQPPHEKPP--HAKSPPEYQPPHEHPPPEYLPPHE 303
              PP Y+     PP   ++ PPP ++ P   PP    KSPP     +  PPP       
Sbjct: 507 SPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPVYKYKSPPPPVYKYNSPPP------- 559

Query: 304 KPPHENPPPEYNPPHEKPPHEH 369
            P H  PPP Y      PP+ +
Sbjct: 560 -PVHSPPPPHYIYASPPPPYHY 580

[29][TOP]
>UniRef100_Q7M1W1 Putative uncharacterized protein 2 (Fragment) n=1 Tax=Glycine max
           RepID=Q7M1W1_SOYBN
          Length = 203

 Score =  134 bits (338), Expect = 2e-30
 Identities = 83/181 (45%), Positives = 105/181 (58%), Gaps = 23/181 (12%)
 Frame = +2

Query: 2   LIMQSLRMRTHHQSTNHLMKSHHRNTNHLTGSNLM*IHHHSINLHMKNHHMNIRRQDINL 181
           L+M++  MR HH+STNHLM+SH ++TNHL  S     HH S+N  M+NHH N      N 
Sbjct: 34  LLMRNHPMRIHHRSTNHLMRSH-QSTNHLMRS-----HHQSMNHLMRNHHQNT-----NH 82

Query: 182 PTKYHPQSTNLHMRNH------LMQSHHQSTNHHMNIR-----LQSIYRHTRNHRMRIHH 328
             + H Q+TN  MRNH      LM+SHHQSTNH M        L   +  + NH MR HH
Sbjct: 83  LMRSHHQNTNHLMRNHHQNTNHLMRSHHQSTNHLMRSHQSTSHLMRSHHQSINHLMRNHH 142

Query: 329 QNTTHLMKNHHMNIRHQSTNHLTRNHH------MRIHHQSSNLLMRNH------LMKSHH 472
           QNT  L K+HHM    Q+TN L ++HH      M+ HHQ ++ LMRNH      LM+SH 
Sbjct: 143 QNTNLLKKSHHMKNHRQNTNLLMKSHHQNTNLPMKSHHQCTHPLMRNHHQCMNPLMRSHP 202

Query: 473 Q 475
           Q
Sbjct: 203 Q 203

 Score =  131 bits (330), Expect = 2e-29
 Identities = 74/164 (45%), Positives = 97/164 (59%), Gaps = 11/164 (6%)
 Frame = +2

Query: 17  LRMRTHHQSTNHLMKSHHRNTNHLTGSNLM*IHHHSINLHMKNHHMNIRRQDINLPTKYH 196
           L MR HHQ+T  LM++ H+NTN L  ++ M IHH S N  M++H      Q  N   + H
Sbjct: 12  LLMRNHHQNTYLLMRNRHQNTNLLMRNHPMRIHHRSTNHLMRSH------QSTNHLMRSH 65

Query: 197 PQSTNLHMRNHLMQSHHQSTNHHMNIRLQSIYRHTRNHRMRIHHQNTTHLMKNHHMNIR- 373
            QS N     HLM++HHQ+TNH     L   +    NH MR HHQNT HLM++HH +   
Sbjct: 66  HQSMN-----HLMRNHHQNTNH-----LMRSHHQNTNHLMRNHHQNTNHLMRSHHQSTNH 115

Query: 374 ----HQSTNHLTRNHH------MRIHHQSSNLLMRNHLMKSHHQ 475
               HQST+HL R+HH      MR HHQ++NLL ++H MK+H Q
Sbjct: 116 LMRSHQSTSHLMRSHHQSINHLMRNHHQNTNLLKKSHHMKNHRQ 159

 Score =  131 bits (329), Expect = 3e-29
 Identities = 80/175 (45%), Positives = 102/175 (58%), Gaps = 22/175 (12%)
 Frame = +2

Query: 17  LRMRTHHQSTN-----HLMKSHHRNTNHLTGS-----NLM*IHHHSINLHMKNHHMNIRR 166
           L MR  HQ+TN     H M+ HHR+TNHL  S     +LM  HH S+N  M+NHH     
Sbjct: 23  LLMRNRHQNTNLLMRNHPMRIHHRSTNHLMRSHQSTNHLMRSHHQSMNHLMRNHH----- 77

Query: 167 QDINLPTKYHPQSTNLHMR------NHLMQSHHQSTNHHMNIRLQSIYRHTRNHRMRIHH 328
           Q+ N   + H Q+TN  MR      NHLM+SHHQSTNH M          + +H MR HH
Sbjct: 78  QNTNHLMRSHHQNTNHLMRNHHQNTNHLMRSHHQSTNHLMR------SHQSTSHLMRSHH 131

Query: 329 QNTTHLMKNHHMNIRHQSTNHLTRNHHMRIHHQSSNLLMRNH------LMKSHHQ 475
           Q+  HLM+NH     HQ+TN L ++HHM+ H Q++NLLM++H       MKSHHQ
Sbjct: 132 QSINHLMRNH-----HQNTNLLKKSHHMKNHRQNTNLLMKSHHQNTNLPMKSHHQ 181

 Score =  102 bits (255), Expect = 1e-20
 Identities = 60/127 (47%), Positives = 73/127 (57%), Gaps = 8/127 (6%)
 Frame = +2

Query: 113 HHHSINLH-MKNHHMNIRRQDINLPTKYHPQSTNLHMRNHLMQSHHQSTNHHMNIRLQSI 289
           HH SI L  M+NHH N       L  +   Q+TNL MRNH M+ HH+STNH M       
Sbjct: 5   HHLSIYLLLMRNHHQNTY-----LLMRNRHQNTNLLMRNHPMRIHHRSTNHLMRSH---- 55

Query: 290 YRHTRNHRMRIHHQNTTHLMKNHHMNIRH-QSTNHLTRNHHMRIHHQSSNLLMR------ 448
              + NH MR HHQ+  HLM+NHH N  H   ++H   NH MR HHQ++N LMR      
Sbjct: 56  --QSTNHLMRSHHQSMNHLMRNHHQNTNHLMRSHHQNTNHLMRNHHQNTNHLMRSHHQST 113

Query: 449 NHLMKSH 469
           NHLM+SH
Sbjct: 114 NHLMRSH 120

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 55/119 (46%), Positives = 65/119 (54%), Gaps = 6/119 (5%)
 Frame = +2

Query: 137 MKNHHMNIRRQDINLPTKYHPQSTNLHMRNHLMQSHHQSTNHHMNIRLQSIYRHTRNHRM 316
           MK HH++I      L  + H Q+T L MRN      HQ+TN  M           RNH M
Sbjct: 2   MKKHHLSIYL----LLMRNHHQNTYLLMRNR-----HQNTNLLM-----------RNHPM 41

Query: 317 RIHHQNTTHLMKNHHMNIRHQSTNHLTRNHHMRIHHQSSNLLMR------NHLMKSHHQ 475
           RIHH++T HLM++H      QSTNHL     MR HHQS N LMR      NHLM+SHHQ
Sbjct: 42  RIHHRSTNHLMRSH------QSTNHL-----MRSHHQSMNHLMRNHHQNTNHLMRSHHQ 89

[30][TOP]
>UniRef100_A7NX90 Chromosome chr5 scaffold_2, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7NX90_VITVI
          Length = 250

 Score =  134 bits (337), Expect = 3e-30
 Identities = 72/175 (41%), Positives = 95/175 (54%), Gaps = 20/175 (11%)
 Frame = -2

Query: 465 LFMRWFLIRRLELWWWILMWWFLVRWLVLW*RMFMWWF-------FMRWVVF-----WWW 322
           +F RW L RRL LWWW+L    ++ W +L  R+  WW+       F RW+++     WWW
Sbjct: 59  VFRRWLLHRRLMLWWWLLHRRLMLWWWLLHRRLMQWWWLLHRRLVFRRWLLYRRLMLWWW 118

Query: 321 ILMRWFLVWR*ILWRRM-FMWWLVLWW*LCMRWFLMWRLVLWGWYFVGRLISW------R 163
           +L R  ++W  +L RR+ F  WL+    +  RW L  RLVLW W    RL+ W      R
Sbjct: 119 LLHRRLMLWWWLLHRRLVFRRWLLHRRLVFRRWLLHRRLVLWWWLLHRRLMLWWWLLHRR 178

Query: 162 RMFMWWFFMWRLILWWW-IHMRLLPVRWLVFRWWLFMRWLVLWWWVLIRRLCMMR 1
            +F  W    RL+LWWW +H R      LVFR WL  R L+LWWW+L RRL   R
Sbjct: 179 LVFRRWLLHRRLMLWWWLLHRR------LVFRRWLLHRRLMLWWWLLHRRLVFRR 227

 Score =  130 bits (328), Expect = 3e-29
 Identities = 72/177 (40%), Positives = 95/177 (53%), Gaps = 21/177 (11%)
 Frame = -2

Query: 474 WW*LFMRWFLIRRLELWWWILMWWFLV---RWLVLW*RMFMWWFFMRWVVFWWWILMRWF 304
           WW L +RWF       WW +   W L    RWL+ W  +F  W   R +VF  W+L R  
Sbjct: 2   WWLLSLRWFANWG---WWLVFRKWLLFVFRRWLLHWRLVFRRWLLHRRLVFRRWLLHRRL 58

Query: 303 LVWR*ILWRRMFMWW------LVLWW*LCMRWFLMWRLVLWGWYFVGRLI-----SWRRM 157
           +  R +L RR+ +WW      L+LWW     W L  RL+ W W    RL+      +RR+
Sbjct: 59  VFRRWLLHRRLMLWWWLLHRRLMLWW-----WLLHRRLMQWWWLLHRRLVFRRWLLYRRL 113

Query: 156 FMWWFFMW-RLILWWW-IHMRLLPVRW-----LVFRWWLFMRWLVLWWWVLIRRLCM 7
            +WW+ +  RL+LWWW +H RL+  RW     LVFR WL  R LVLWWW+L RRL +
Sbjct: 114 MLWWWLLHRRLMLWWWLLHRRLVFRRWLLHRRLVFRRWLLHRRLVLWWWLLHRRLML 170

 Score =  106 bits (264), Expect = 9e-22
 Identities = 59/151 (39%), Positives = 77/151 (50%), Gaps = 29/151 (19%)
 Frame = -2

Query: 474 WW*L-----FMRWFLIRRLELWWWIL-----MWWFLV-------RWLVLW*RMFMWWFFM 346
           WW L     F RW L RRL LWWW+L     +WW+L+       RWL+    +F  W   
Sbjct: 95  WWLLHRRLVFRRWLLYRRLMLWWWLLHRRLMLWWWLLHRRLVFRRWLLHRRLVFRRWLLH 154

Query: 345 RWVVFWWWILMRWFLVWR*ILWRRM-FMWWLV-----LWW*LC------MRWFLMWRLVL 202
           R +V WWW+L R  ++W  +L RR+ F  WL+     LWW L        RW L  RL+L
Sbjct: 155 RRLVLWWWLLHRRLMLWWWLLHRRLVFRRWLLHRRLMLWWWLLHRRLVFRRWLLHRRLML 214

Query: 201 WGWYFVGRLISWRRMFMWWFFMWRLILWWWI 109
           W W     L+  R +F  W    RL+LWWW+
Sbjct: 215 WWW-----LLHRRLVFRRWLLHRRLMLWWWL 240

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 52/151 (34%), Positives = 69/151 (45%), Gaps = 30/151 (19%)
 Frame = -2

Query: 363 MWWFF-MRWVVFW-WWILMRWFLVWR*ILWRRMFMWWLVLWW*LCMRWFLMWRLVLWGWY 190
           MWW   +RW   W WW++ R +L++       +F  WL+ W  +  RW L  RLV   W 
Sbjct: 1   MWWLLSLRWFANWGWWLVFRKWLLF-------VFRRWLLHWRLVFRRWLLHRRLVFRRWL 53

Query: 189 FVGRLISWRRMFMWWFFMWRLILWWW-----------------------IHMRLLPVRWL 79
              RL+     F  W    RL+LWWW                       +H RL+  RWL
Sbjct: 54  LHRRLV-----FRRWLLHRRLMLWWWLLHRRLMLWWWLLHRRLMQWWWLLHRRLVFRRWL 108

Query: 78  VFR-----WWLFMRWLVLWWWVLIRRLCMMR 1
           ++R     WWL  R L+LWWW+L RRL   R
Sbjct: 109 LYRRLMLWWWLLHRRLMLWWWLLHRRLVFRR 139

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 38/98 (38%), Positives = 54/98 (55%), Gaps = 24/98 (24%)
 Frame = -2

Query: 465 LFMRWFLIRRLELWWWIL-----MWWFLV-------RWLVLW*RMFMWWF-------FMR 343
           +F RW L RRL LWWW+L     +WW+L+       RWL L  R+ +WW+       F R
Sbjct: 147 VFRRWLLHRRLVLWWWLLHRRLMLWWWLLHRRLVFRRWL-LHRRLMLWWWLLHRRLVFRR 205

Query: 342 WVV-----FWWWILMRWFLVWR*ILWRRMFMWWLVLWW 244
           W++      WWW+L R  +  R +L RR+ +WW +L W
Sbjct: 206 WLLHRRLMLWWWLLHRRLVFRRWLLHRRLMLWWWLLEW 243

[31][TOP]
>UniRef100_Q9MAW3 TrPRP2 n=1 Tax=Trifolium repens RepID=Q9MAW3_TRIRP
          Length = 343

 Score =  133 bits (335), Expect = 5e-30
 Identities = 85/179 (47%), Positives = 95/179 (53%), Gaps = 20/179 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPP----PEYQPPHEKPP----PEYQPPHGKQPHVNPP----PQYQPPHEK 144
           P   KPP   PP    P Y+PP  KPP    P Y+PP  K P V PP    P Y+PP  K
Sbjct: 167 PPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVK 226

Query: 145 PPHEH----SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP----PEYLPPH 300
           PP        PP Y+PP E  PP ++PP  KPP  K PP Y+PP   PP    P Y PP 
Sbjct: 227 PPIYKPPVVKPPVYKPPVE-KPPVYKPPVYKPPVVK-PPVYKPPVYKPPVVKPPVYKPPV 284

Query: 301 EKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           EKPP   PP E  PP  KPP E P P Y+PP +KPP   PP +  P  E P H K PPA
Sbjct: 285 EKPPVYKPPVE-KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYEPPHHPKYPPA 341

 Score =  129 bits (323), Expect = 1e-28
 Identities = 83/178 (46%), Positives = 94/178 (52%), Gaps = 25/178 (14%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPPHEHSPPGYQP 180
           KPP E PP  Y+PP EKPP  Y+PP  K P   PP    P Y+PP  KPP  + PP Y+P
Sbjct: 76  KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVVKPPVYKPPVVKPP-VYKPPVYKP 132

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPP----PEYLPPHEKPPHENP---- 324
           P  +PP    P ++PP  KPP  K PP Y+PP   PP    P Y PP  KPP   P    
Sbjct: 133 PVVMPPVYKPPVYKPPVYKPPVVK-PPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYK 191

Query: 325 -----PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
                PP Y PP  KPP   P P Y+PP  KPP   P    PP  +PP  KPP EK P
Sbjct: 192 PPVVKPPVYKPPVYKPPVVKP-PVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPP 248

 Score =  123 bits (309), Expect = 6e-27
 Identities = 81/180 (45%), Positives = 92/180 (51%), Gaps = 23/180 (12%)
 Frame = +1

Query: 1   PHHAKPPYENP---PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKP----PHEH 159
           P +  P Y  P   PP Y+PP EKPP  Y+PP      V  PP Y+PP EKP    P   
Sbjct: 28  PVYTPPVYTPPIVKPPVYKPPVEKPPV-YKPP------VEKPPVYKPPVEKPPVYKPPVE 80

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHP----PPEYLPPHEKPPH 315
            PP Y+PP E  PP ++PP EKPP  K     PP Y+PP   P    PP Y PP   PP 
Sbjct: 81  KPPVYKPPVE-KPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPV 139

Query: 316 ENP----PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
             P    PP Y PP  KPP   P P Y+PP  KPP   P    PP ++PP  KPP  K P
Sbjct: 140 YKPPVYKPPVYKPPVVKPPVYKP-PVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPP 198

 Score =  115 bits (289), Expect = 1e-24
 Identities = 74/155 (47%), Positives = 83/155 (53%), Gaps = 12/155 (7%)
 Frame = +1

Query: 43  YQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHE 222
           Y+ P    PP Y PP  K P V  PP  +PP  KPP E  PP Y+PP E  PP ++PP E
Sbjct: 24  YEKPPVYTPPVYTPPIVKPP-VYKPPVEKPPVYKPPVE-KPPVYKPPVE-KPPVYKPPVE 80

Query: 223 KPPHAK----SPPEYQPPHEHPPPEYLPPHEKPPHENP----PPEYNPPHEKPPHEHPSP 378
           KPP  K     PP Y+PP E  PP Y PP  KPP   P    PP Y PP  KPP   P P
Sbjct: 81  KPPVYKPPVEKPPVYKPPVE-KPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMP-P 138

Query: 379 EYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
            Y+PP  KPP   P    PP ++PP  KPP  K P
Sbjct: 139 VYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPP 173

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 63/134 (47%), Positives = 71/134 (52%), Gaps = 16/134 (11%)
 Frame = +1

Query: 118 PQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAK----SPPEYQPPHEHPPPE 285
           PQ    +EKPP  ++PP Y PP  + PP ++PP EKPP  K     PP Y+PP E  PP 
Sbjct: 18  PQGLANYEKPP-VYTPPVYTPPI-VKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPV 74

Query: 286 YLPPHEKPPHENP----PPEYNPPHEKPPHEHP----SPEYQPPHQKPPHENP----PPK 429
           Y PP EKPP   P    PP Y PP EKPP   P     P Y+PP  KPP   P    PP 
Sbjct: 75  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPV 134

Query: 430 FQPPNEKPPHEKSP 471
             PP  KPP  K P
Sbjct: 135 VMPPVYKPPVYKPP 148

[32][TOP]
>UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S9_EHV86
          Length = 621

 Score =  133 bits (334), Expect = 7e-30
 Identities = 67/158 (42%), Positives = 71/158 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   P
Sbjct: 288 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPP---SPPPPSP 344

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP +  PP   PP   PPP   PP   PP  +PPP   PP   PP
Sbjct: 345 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPS--PPPPSPPPPSPPPPSPPPPSPPP 402

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP+  PP   SPP
Sbjct: 403 PSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPP 440

 Score =  130 bits (327), Expect = 5e-29
 Identities = 68/160 (42%), Positives = 72/160 (45%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP   SPP   P
Sbjct: 268 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPPPSPPPSPP 325

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 326 PPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPP 382

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
              P P   PP   PP  +PPP   PP   PP    PP S
Sbjct: 383 PSPPPPS--PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPS 420

 Score =  130 bits (326), Expect = 6e-29
 Identities = 66/158 (41%), Positives = 70/158 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   P
Sbjct: 293 PPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSP 349

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP +  PP   PP   PPP   PP   PP  +PPP   PP   PP
Sbjct: 350 PPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSPPP 407

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP+   P   SPP
Sbjct: 408 PSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPP 445

 Score =  129 bits (324), Expect = 1e-28
 Identities = 66/154 (42%), Positives = 71/154 (46%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP    PP   PP   P
Sbjct: 263 PPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPPPSP 320

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
           PP   PP   PP   SPP   PP   PPP   PP   PP   PPP  +PP   PP   PS
Sbjct: 321 PPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPPPS 375

Query: 376 PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 376 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 409

 Score =  129 bits (323), Expect = 1e-28
 Identities = 66/158 (41%), Positives = 70/158 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   P
Sbjct: 334 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPP---SPPPPSP 390

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP +  PP   PP   PPP   PP   PP    PP  +PP   PP
Sbjct: 391 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPP 450

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP+  PP   SPP
Sbjct: 451 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPP 485

 Score =  128 bits (321), Expect = 2e-28
 Identities = 66/155 (42%), Positives = 71/155 (45%), Gaps = 1/155 (0%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP    PP   PP   P
Sbjct: 324 PPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPPPSPPPSPP 381

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
           PP   PP   PP   SPP   PP   PPP   PP   PP  +PPP   PP   PP   PS
Sbjct: 382 PPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPS 438

Query: 376 PEY-QPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           P    PP   PP  +PPP   PP   PP    PP+
Sbjct: 439 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 473

 Score =  128 bits (321), Expect = 2e-28
 Identities = 66/160 (41%), Positives = 72/160 (45%), Gaps = 1/160 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP   SPP   P
Sbjct: 339 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPP---SPPPPSP 395

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHE-KPPHENPPPEYNPPHEKP 357
           P   PPP   PP   PP +  PP   PP   PPP   PP    PP  +PPP   PP   P
Sbjct: 396 PPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPP 455

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           P   P P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 456 PPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 493

 Score =  127 bits (319), Expect = 4e-28
 Identities = 68/158 (43%), Positives = 73/158 (46%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP   SPP   P
Sbjct: 244 PPPPSPPPPSPPPPSPPP---PPPPPSPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSP 298

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP  +PPP   PP   PP
Sbjct: 299 PPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSPPP 356

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP  +PPP   PP+  PP   SPP
Sbjct: 357 PSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPP---SPP 391

 Score =  127 bits (318), Expect = 5e-28
 Identities = 68/159 (42%), Positives = 73/159 (45%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP   SPP   P
Sbjct: 204 PPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSP 259

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 260 PPPPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPP 314

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              PSP   PP   PP  +PPP   PP   PP    PP+
Sbjct: 315 PPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 353

 Score =  127 bits (318), Expect = 5e-28
 Identities = 67/160 (41%), Positives = 72/160 (45%), Gaps = 1/160 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP   SPP   P
Sbjct: 324 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPPPSPPPSPP 381

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP  +PPP   PP   P 
Sbjct: 382 PPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPS 438

Query: 361 HEHPS-PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              PS P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 439 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 478

 Score =  127 bits (318), Expect = 5e-28
 Identities = 64/159 (40%), Positives = 69/159 (43%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 349 PPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPP 406

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP +  PP   PP    PP   PP   PP  +PPP   PP   PP
Sbjct: 407 PPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 466

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              P P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 467 PSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 503

 Score =  127 bits (318), Expect = 5e-28
 Identities = 65/161 (40%), Positives = 69/161 (42%), Gaps = 2/161 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP    P   PPP   PP    P  +PPP   PP   PP    PP   P
Sbjct: 359 PPPPSPPPPSPPPPPPSPPPSPPPP-SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 417

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 418 PPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 477

Query: 361 HEHP--SPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              P   P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 478 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 518

 Score =  126 bits (317), Expect = 7e-28
 Identities = 66/160 (41%), Positives = 70/160 (43%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP    P    P   SPP   P
Sbjct: 224 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSP 283

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP +  PP   PP   PPP   PP   PP  +PPP   PP   PP
Sbjct: 284 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPP--SPPPPSPPPPSPPPPSPPP 341

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
              P P   PP   PP  +PPP   PP   PP   SPP S
Sbjct: 342 PSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPS 379

 Score =  126 bits (317), Expect = 7e-28
 Identities = 66/160 (41%), Positives = 70/160 (43%), Gaps = 1/160 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   P
Sbjct: 344 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPP---SPPPPSP 400

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEY-LPPHEKPPHENPPPEYNPPHEKP 357
           P   PPP   PP   PP    PP   PP   PPP    PP   PP  +PPP   PP   P
Sbjct: 401 PPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPP 460

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           P   P P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 461 PPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 498

 Score =  126 bits (317), Expect = 7e-28
 Identities = 68/167 (40%), Positives = 71/167 (42%), Gaps = 7/167 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P  +PPP   PP   PP    PP   P
Sbjct: 360 PPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP 417

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 418 PPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 477

Query: 361 HEHPS-------PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
              P        P   PP   PP  +PPP   PP   PP   SPP S
Sbjct: 478 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP--PSPPPS 522

 Score =  125 bits (315), Expect = 1e-27
 Identities = 68/161 (42%), Positives = 73/161 (45%), Gaps = 1/161 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP   SPP   P
Sbjct: 169 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPP--SPPPPSP 224

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP-PEYLPPHEKPPHENPPPEYNPPHEKP 357
           P   PPP   PP   PP +  PP   PP   PP P   PP   PP  +PPP   PP   P
Sbjct: 225 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPP 284

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
           P   P P   PP   PP  +PPP   PP   PP   SPP S
Sbjct: 285 PPSPPPPS--PPPPSPPPPSPPPPSPPPPSPPPPPPSPPPS 323

 Score =  125 bits (314), Expect = 1e-27
 Identities = 68/161 (42%), Positives = 71/161 (44%), Gaps = 1/161 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P  +PPP   PP   PP   SPP   P
Sbjct: 299 PPPSPPPPSPPPPSPPPPPPSPPP--SPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSP 354

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP  +PPP   PP   PP
Sbjct: 355 PPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSPPP 412

Query: 361 HEHPSPEYQPPHQKPPHENPPPK-FQPPNEKPPHEKSPPAS 480
              P P   PP   PP   PPP    PP   PP    PP S
Sbjct: 413 PSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPS 453

 Score =  125 bits (314), Expect = 1e-27
 Identities = 65/158 (41%), Positives = 69/158 (43%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PP    PP   PP   SPP   P
Sbjct: 329 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPP---SPPPPSP 385

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP +  PP   PP   PPP   PP   PP   PP   +PP   PP
Sbjct: 386 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPP 445

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP+  PP   SPP
Sbjct: 446 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPP 480

 Score =  125 bits (313), Expect = 2e-27
 Identities = 68/160 (42%), Positives = 72/160 (45%), Gaps = 1/160 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP   SPP   P
Sbjct: 139 PPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPP--SPPPPSPPPPSPPPP--SPPPPSP 194

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 195 PPPSPPPPSPPPPSPPP--PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 252

Query: 361 HEHP-SPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              P SP   PP   PP  +PPP   PP   PP    PP+
Sbjct: 253 SPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 292

 Score =  125 bits (313), Expect = 2e-27
 Identities = 65/160 (40%), Positives = 69/160 (43%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PP    PP    P   SPP   P
Sbjct: 219 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSP 278

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP +  PP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 279 PPPSPPPPSPPPPSPPPPSPPPPS-PPPPSPPPPSPPPPPPSPPPSPPPP--SPPPPSPP 335

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
              P P   PP   PP   PPP   PP+  PP    PP S
Sbjct: 336 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPS 375

 Score =  125 bits (313), Expect = 2e-27
 Identities = 66/163 (40%), Positives = 70/163 (42%), Gaps = 4/163 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHV---NPPPQYQPPHEKPPHEHSPPG 171
           P  + PP   PPP   PP   PPP   PP    P     +PPP   PP   PP    PP 
Sbjct: 304 PPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 363

Query: 172 YQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHE 351
             PP   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP   PP  
Sbjct: 364 PPPPSPPPPPPSPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPS 420

Query: 352 KPPHEHPSPEYQPPH-QKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP   P P   PP    PP  +PPP   PP   PP    PP+
Sbjct: 421 PPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPS 463

 Score =  125 bits (313), Expect = 2e-27
 Identities = 64/161 (39%), Positives = 68/161 (42%), Gaps = 2/161 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P  +PPP   PP   PP    PP   P
Sbjct: 355 PPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP 412

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    P    PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 413 PSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 472

Query: 361 HEHP--SPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              P   P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 473 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 513

 Score =  125 bits (313), Expect = 2e-27
 Identities = 65/158 (41%), Positives = 68/158 (43%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   P
Sbjct: 385 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSP 444

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 445 PPPSPPPPSPPPPSPPP--PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 502

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
                    PP   PP  +PPP   PP+  P H  S P
Sbjct: 503 --------SPPPPSPPPPSPPPPSPPPSPPPSHPPSHP 532

 Score =  124 bits (312), Expect = 2e-27
 Identities = 68/160 (42%), Positives = 71/160 (44%), Gaps = 1/160 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   P
Sbjct: 151 PPPSPPP---PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSP 204

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 205 PPPSPPPPSPPPPSPPP--PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 262

Query: 361 HEHPS-PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              PS P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 263 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 302

 Score =  124 bits (312), Expect = 2e-27
 Identities = 66/163 (40%), Positives = 70/163 (42%), Gaps = 3/163 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP    PP   P
Sbjct: 159 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP 216

Query: 181 PHEIP--PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP-PPEYNPPHE 351
           P   P  PP   PP   PP    PP   PP   PPP   PP   PP   P PP  +PP  
Sbjct: 217 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPP 276

Query: 352 KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
            PP   P P   PP   PP   PPP   PP+  PP    PP S
Sbjct: 277 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPS 319

 Score =  124 bits (312), Expect = 2e-27
 Identities = 67/159 (42%), Positives = 71/159 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP   SPP   P
Sbjct: 209 PPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPPP 264

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 265 PPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPP 321

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              P P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 322 PSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 358

 Score =  124 bits (311), Expect = 3e-27
 Identities = 67/159 (42%), Positives = 72/159 (45%), Gaps = 1/159 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP   SPP   P
Sbjct: 179 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPP--SPPPPSP 234

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP-PPEYLPPHEKPPHENPPPEYNPPHEKP 357
           P   PPP   PP   PP +  PP   PP   P PP   PP   PP  +PPP   PP   P
Sbjct: 235 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 294

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   P P   PP   PP   PPP   PP+  PP   SPP
Sbjct: 295 PPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPP---SPP 330

 Score =  124 bits (311), Expect = 3e-27
 Identities = 66/159 (41%), Positives = 71/159 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP    PP   P
Sbjct: 214 PPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP---PPPPPSP 268

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 269 PPPSPPPPSPPPPSPPP--PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPP 326

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              P P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 327 PSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 363

 Score =  123 bits (309), Expect = 6e-27
 Identities = 66/153 (43%), Positives = 68/153 (44%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP   PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   PP   P
Sbjct: 120 PPPSQPPPS--PPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPP---SPPPPSPPPPSP 174

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
           PP   PP   PP   SPP   PP   PPP   PP   PP   PPP  +PP   PP   P 
Sbjct: 175 PPPSPPPPSPPP--PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPP 230

Query: 376 PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   PP   PP   PPP   PP+  PP    PP
Sbjct: 231 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 263

 Score =  123 bits (309), Expect = 6e-27
 Identities = 66/160 (41%), Positives = 72/160 (45%), Gaps = 1/160 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP   SPP   P
Sbjct: 174 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPP--SPPPPSP 229

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEY-LPPHEKPPHENPPPEYNPPHEKP 357
           P   PPP   PP   PP +  PP   PP   PPP    PP   PP  +PPP  +PP   P
Sbjct: 230 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPP-SPPPPSP 288

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           P   P P   PP   PP   PPP   PP   PP    PP+
Sbjct: 289 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPS 328

 Score =  122 bits (307), Expect = 9e-27
 Identities = 68/159 (42%), Positives = 73/159 (45%), Gaps = 1/159 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  ++PP   PPP   PP   PPP   PP    P  +PPP   PP   PP   SPP   P
Sbjct: 120 PPPSQPPPSPPPP--SPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPP---SPPPPSP 174

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 175 PPPSPPPPSPPPPSPPP--PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPP 230

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPN-EKPPHEKSPP 474
              P P   PP   PP   PPP   PP+   PP   SPP
Sbjct: 231 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPP 269

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/154 (42%), Positives = 68/154 (44%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP  +PPP   PP   PPP   PP    P   PPP   PP   PP    PP   PP   P
Sbjct: 129 PPPPSPPPPSPPPPSPPPPSPPPPPSPPP---PPPPPSPPPPSPPPPSPPPPSPPPPSPP 185

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
           PP   PP   PP   SPP   PP   PPP   PP   PP   PPP  +PP   PP   P 
Sbjct: 186 PPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPP 240

Query: 376 PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           P   PP   PP   PPP   PP   PP    PP+
Sbjct: 241 PPSPPPPSPPPPSPPPP--SPPPPPPPPSPPPPS 272

 Score =  122 bits (306), Expect = 1e-26
 Identities = 66/160 (41%), Positives = 69/160 (43%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 376 PPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPP 433

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P    PP   PP   PP    PP   PP   PPP   PP   PP  +PPP   PP   PP
Sbjct: 434 PSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSPPP 491

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
              P P   PP   PP  +PPP   PP   PP   SPP S
Sbjct: 492 PSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP---SPPPS 526

 Score =  121 bits (303), Expect = 3e-26
 Identities = 66/161 (40%), Positives = 70/161 (43%), Gaps = 2/161 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   P
Sbjct: 125 PPPSPPPPSPPPP--SPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPP---SPPPPSP 179

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP--PPEYLPPHEKPPHENPPPEYNPPHEK 354
           P   PPP   PP   PP +  PP   PP   P  PP   PP   PP  +PPP   PP   
Sbjct: 180 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 239

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           PP   P P   PP   PP   PPP   PP   PP    PP+
Sbjct: 240 PPPSPPPPSPPPPSPPPPSPPPPP---PPPSPPPPSPPPPS 277

 Score =  119 bits (299), Expect = 8e-26
 Identities = 65/158 (41%), Positives = 69/158 (43%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP    P   SPP   P
Sbjct: 390 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSP 449

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 450 PPPSPPPPSPPPPSPPP--PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPP 505

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP  +PPP   PP+  P H    P
Sbjct: 506 PPSPPPPSPPPPSPPP--SPPPS-HPPSHPPMHPPMHP 540

 Score =  117 bits (292), Expect = 5e-25
 Identities = 65/155 (41%), Positives = 69/155 (44%), Gaps = 2/155 (1%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPP 198
           P   PPP   PP  +PPP   PP    P  +PPP   PP   PP   SPP   PP   PP
Sbjct: 112 PPTTPPPS--PPPSQPPP--SPPPPSPPPPSPPPP-SPPPPSPPPPPSPPPPPPPPSPPP 166

Query: 199 PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHP-- 372
           P   PP   PP   SPP   PP   PPP   PP   PP   PPP   PP   PP   P  
Sbjct: 167 PSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 223

Query: 373 SPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 224 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 258

 Score =  114 bits (286), Expect = 3e-24
 Identities = 60/151 (39%), Positives = 62/151 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P   PP    PP   PP    PP   P
Sbjct: 396 PPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPP 455

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 456 PPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPP 510

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKP 453
              P P   PP   P H    P   PP   P
Sbjct: 511 PPSPPPPSPPPSPPPSHPPSHPPMHPPMHPP 541

 Score =  113 bits (283), Expect = 6e-24
 Identities = 62/149 (41%), Positives = 63/149 (42%), Gaps = 2/149 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNP-PPQYQPPHEKPPHEHSPPGYQ 177
           P    PP  +PPP   PP   PPP   PP    P   P PP   PP   PP    PP   
Sbjct: 400 PPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSP 459

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
           PP   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP   PP   P
Sbjct: 460 PPPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 516

Query: 358 PHEHPS-PEYQPPHQKPPHENPPPKFQPP 441
           P   PS P   PP   P H    P F PP
Sbjct: 517 PSPPPSPPPSHPPSHPPMHPPMHPPFLPP 545

 Score =  104 bits (260), Expect = 3e-21
 Identities = 60/145 (41%), Positives = 64/145 (44%)
 Frame = +1

Query: 43  YQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHE 222
           Y PP   PP    PP  + P   PPP   PP   PP   SPP   PP   PPP   PP  
Sbjct: 110 YIPPTTPPP---SPPPSQPPPSPPPPSPPPPSPPPP---SPPPPSPP---PPPSPPPP-- 158

Query: 223 KPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQK 402
            PP    PP   PP   PPP   PP   PP  +PPP   PP   PP   P P   PP   
Sbjct: 159 -PPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPS 213

Query: 403 PPHENPPPKFQPPNEKPPHEKSPPA 477
           PP  +PPP   PP   PP    PP+
Sbjct: 214 PPPPSPPPPSPPPPSPPPPSPPPPS 238

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 32/76 (42%), Positives = 34/76 (44%)
 Frame = +1

Query: 253 YQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKF 432
           Y PP   PP    PP + PP  +PPP   PP   PP   P P   PP   PP   PPP  
Sbjct: 110 YIPPTTPPPSP--PPSQPPP--SPPPPSPPPPSPPPPSPPPPSPPPPPSPPP---PPPPP 162

Query: 433 QPPNEKPPHEKSPPAS 480
            PP   PP    PP S
Sbjct: 163 SPPPPSPPPPSPPPPS 178

[33][TOP]
>UniRef100_Q7DMV8 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q7DMV8_PHAVU
          Length = 230

 Score =  133 bits (334), Expect = 7e-30
 Identities = 67/177 (37%), Positives = 87/177 (49%), Gaps = 19/177 (10%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----H 138
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H  PPP++ PP     H
Sbjct: 51  PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 110

Query: 139 EKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHE 303
             PP +HSPP     H  PPP+H PP     H+  PP++ PP     H  PPP++ PP  
Sbjct: 111 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPP 170

Query: 304 KPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              H  PPP+++PP     H  P P++ PP     H  PPPK  PP     H   PP
Sbjct: 171 YYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP 227

 Score =  131 bits (329), Expect = 3e-29
 Identities = 69/180 (38%), Positives = 89/180 (49%), Gaps = 22/180 (12%)
 Frame = +1

Query: 1   PHHAKPPYEN--PPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----HEK 144
           P   KP Y    PPP++ PP     H  PPP++ PP     H  PPP++ PP     H  
Sbjct: 37  PPPPKPYYYQSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSP 96

Query: 145 PPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHEKP 309
           PP +HSPP     H  PPP+H PP     H+  PP++ PP     H  PPP++ PP    
Sbjct: 97  PPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYY 156

Query: 310 PHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP-----NEKPPHEKSPP 474
            H  PPP+++PP     H  P P++ PP     H  PPPK  PP     +  PP + SPP
Sbjct: 157 YHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP 216

 Score =  125 bits (315), Expect = 1e-27
 Identities = 64/168 (38%), Positives = 86/168 (51%), Gaps = 17/168 (10%)
 Frame = +1

Query: 22  YENPPPEYQPPHEK--PPPEYQPPHGKQPHVNPPPQYQPP-----HEKPPHEHSPPGYQP 180
           Y +PPP  +P + +  PPP++ PP     H  PPP++ PP     H  PP +HSPP    
Sbjct: 33  YSSPPPPPKPYYYQSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYY 92

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHEKPPHENPPPEYNPP 345
            H  PPP+H PP     H+  PP++ PP     H  PPP++ PP     H  PPP+++PP
Sbjct: 93  YHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP 152

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP-----NEKPPHEKSPP 474
                H  P P++ PP     H  PPPK  PP     +  PP + SPP
Sbjct: 153 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP 200

 Score =  124 bits (312), Expect = 2e-27
 Identities = 62/162 (38%), Positives = 82/162 (50%), Gaps = 19/162 (11%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----H 138
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H  PPP++ PP     H
Sbjct: 67  PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 126

Query: 139 EKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHE 303
             PP +HSPP     H  PPP+H PP     H+  PP++ PP     H  PPP++ PP  
Sbjct: 127 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPP 186

Query: 304 KPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPK 429
              H  PPP+++PP     H  P P++ PP     H  PPPK
Sbjct: 187 YYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPK 228

 Score =  101 bits (252), Expect = 2e-20
 Identities = 50/132 (37%), Positives = 68/132 (51%), Gaps = 19/132 (14%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----H 138
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H  PPP++ PP     H
Sbjct: 99  PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 158

Query: 139 EKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHE 303
             PP +HSPP     H  PPP+H PP     H+  PP++ PP     H  PPP++ PP  
Sbjct: 159 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPP 218

Query: 304 KPPHENPPPEYN 339
              H  PPP+++
Sbjct: 219 YYYHSPPPPKHS 230

[34][TOP]
>UniRef100_UPI00015B4AC1 PREDICTED: similar to conserved hypothetical protein n=1
           Tax=Nasonia vitripennis RepID=UPI00015B4AC1
          Length = 1110

 Score =  132 bits (331), Expect = 2e-29
 Identities = 74/161 (45%), Positives = 76/161 (47%), Gaps = 4/161 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P H  PPY  PPP     H  PPP   PPHG   H + PP   PPH   PH   PP   P
Sbjct: 539 PPHDGPPYGGPPPH----HGGPPPHGSPPHGGMSHGDYPPHRGPPHSGSPH-GGPPHGGP 593

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEYNPPH 348
           PH   PP   PPH  PPH   PP   PPH  P    PP   PPH  PPH   PP   PPH
Sbjct: 594 PHG-GPPHGGPPHGGPPHG-GPPHGGPPHGGPPHGGPPHGGPPHGGPPH-GGPPHGGPPH 650

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             PPH  P P   PPH  PPH   P    PP+  PPH   P
Sbjct: 651 GGPPHGGP-PHGGPPHGGPPHGGSPYGGPPPHGGPPHGGPP 690

 Score =  122 bits (306), Expect = 1e-26
 Identities = 77/191 (40%), Positives = 81/191 (42%), Gaps = 33/191 (17%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEY------QPPHEKPP----PEYQPPHGKQPHVNPP----PQYQPPH 138
            PHH  PP    PP         PPH  PP    P   PPHG  PH  PP    P   PPH
Sbjct: 551  PHHGGPPPHGSPPHGGMSHGDYPPHRGPPHSGSPHGGPPHGGPPHGGPPHGGPPHGGPPH 610

Query: 139  EKPPHEHSPPGYQPPHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPP----PEYLP 294
              PPH   PP   PPH  PP    P   PPH  PPH   PP   PPH  PP    P   P
Sbjct: 611  GGPPHG-GPPHGGPPHGGPPHGGPPHGGPPHGGPPHG-GPPHGGPPHGGPPHGGPPHGGP 668

Query: 295  PHEKPPHENPPPEYNPPHEKP----PHEHPSPEYQPPHQ-----KPPHENPPPKFQPPNE 447
            PH   P+  PPP   PPH  P    P +H  P + PP +      PPH   PP   P   
Sbjct: 669  PHGGSPYGGPPPHGGPPHGGPPLGGPMQHGGPPHGPPRELAAGMGPPHGGMPPHAGPMGH 728

Query: 448  --KPPHEKSPP 474
               PPH   PP
Sbjct: 729  GALPPHGGGPP 739

 Score =  114 bits (284), Expect = 4e-24
 Identities = 85/239 (35%), Positives = 89/239 (37%), Gaps = 82/239 (34%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPP--HEKPPPEYQ-------------PPH-------GKQPH--V 108
            PH   PP    PP   PP  H  PPP +              PPH       G  PH  V
Sbjct: 437  PHGGPPPQHGGPPHGGPPPQHGGPPPPHSGIGQQHGGHSLDGPPHDRGGPLYGGSPHDGV 496

Query: 109  NP----------------------PPQYQPPHE--------KPPHEHSPPGYQPPHEIPP 198
             P                      PP   PPHE         PPH+  P G  PPH   P
Sbjct: 497  PPFGGPPPHDGGPPYRGSHHDGGGPPYGGPPHEGGGQPYGGPPPHDGPPYGGPPPHHGGP 556

Query: 199  PEH------------QPPHEKPPHAKS----PPEYQPPHEHP----PPEYLPPHEKPPHE 318
            P H             PPH  PPH+ S    PP   PPH  P    PP   PPH  PPH 
Sbjct: 557  PPHGSPPHGGMSHGDYPPHRGPPHSGSPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHG 616

Query: 319  NP----PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
             P    PP   PPH  PPH  P P   PPH  PPH  P    PP   PP+  PPH  SP
Sbjct: 617  GPPHGGPPHGGPPHGGPPHGGP-PHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGSP 674

 Score =  109 bits (273), Expect = 8e-23
 Identities = 71/186 (38%), Positives = 86/186 (46%), Gaps = 32/186 (17%)
 Frame = +1

Query: 10  AKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQY---QPPH------------EK 144
           A PP  +   +  PPH  PPP+    HG  PH  PPPQ+    PPH            + 
Sbjct: 423 APPPPASMNQQNVPPHGGPPPQ----HGGPPHGGPPPQHGGPPPPHSGIGQQHGGHSLDG 478

Query: 145 PPHEHSPPGY-QPPHE-IPPPEHQPPHE-KPPHAKS------PPEYQPPHEHPPPEY--L 291
           PPH+   P Y   PH+ +PP    PPH+  PP+  S      PP   PPHE     Y   
Sbjct: 479 PPHDRGGPLYGGSPHDGVPPFGGPPPHDGGPPYRGSHHDGGGPPYGGPPHEGGGQPYGGP 538

Query: 292 PPHEKPPHENPPPEYN--PPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKP 453
           PPH+ PP+  PPP +   PPH  PPH   S    PPH+ PPH       PP   PP+  P
Sbjct: 539 PPHDGPPYGGPPPHHGGPPPHGSPPHGGMSHGDYPPHRGPPHSGSPHGGPPHGGPPHGGP 598

Query: 454 PHEKSP 471
           PH   P
Sbjct: 599 PHGGPP 604

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 62/179 (34%), Positives = 73/179 (40%), Gaps = 27/179 (15%)
 Frame = +1

Query: 1    PHHAKPPYENPP----PEYQPPHEKPP----PEYQPPHGKQPHVNPPPQYQPPHEKPP-- 150
            P H  PP+  PP    P   PPH  PP    P   PPHG  P+  PPP   PPH  PP  
Sbjct: 633  PPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGSPYGGPPPHGGPPHGGPPLG 692

Query: 151  --HEHSPPGYQPPHEI-----PPPEHQPPHEKP-------PHAKSPPEYQPPHEHPPPEY 288
               +H  P + PP E+     PP    PPH  P       PH   PP +      PPP +
Sbjct: 693  GPMQHGGPPHGPPRELAAGMGPPHGGMPPHAGPMGHGALPPHGGGPPPHDVNFSQPPPGW 752

Query: 289  LPPHEKPPHENPPPEYNP--PHEKPPHEH-PSPEYQPPHQKPPHENPPPKFQPPNEKPP 456
                      N PP   P  P    P  H P P++  P   PP   PPP    P ++PP
Sbjct: 753  ----------NGPPGTGPGGPLGADPFTHLPLPDFSRP---PPGFGPPP---APQQQPP 795

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 56/166 (33%), Positives = 67/166 (40%), Gaps = 40/166 (24%)
 Frame = +1

Query: 94  KQPHVNPPPQYQPPHEKPPHEHSPPGY-QPPHEIPPPEH---QPPH------------EK 225
           +Q    PPP        PPH   PP +  PPH  PPP+H    PPH            + 
Sbjct: 419 RQLKAPPPPASMNQQNVPPHGGPPPQHGGPPHGGPPPQHGGPPPPHSGIGQQHGGHSLDG 478

Query: 226 PPHAKSPPEY-------------QPPHEHPPPEY-------LPPHEKPPHENPPPEYN-- 339
           PPH +  P Y              PPH+  PP          PP+  PPHE     Y   
Sbjct: 479 PPHDRGGPLYGGSPHDGVPPFGGPPPHDGGPPYRGSHHDGGGPPYGGPPHEGGGQPYGGP 538

Query: 340 PPHEKPPHEHPSPEY--QPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           PPH+ PP+  P P +   PPH  PPH        PP+  PPH  SP
Sbjct: 539 PPHDGPPYGGPPPHHGGPPPHGSPPHGGMSHGDYPPHRGPPHSGSP 584

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 54/144 (37%), Positives = 64/144 (44%), Gaps = 7/144 (4%)
 Frame = +1

Query: 64  PPPEYQPPHGKQPHVNPPPQYQ-PPHEKPPHEHSPPGYQPPHEIPPPEHQPPH-EKPPHA 237
           PPP         PH  PPPQ+  PPH  PP +H  P   PPH     +H     + PPH 
Sbjct: 425 PPPASMNQQNVPPHGGPPPQHGGPPHGGPPPQHGGP--PPPHSGIGQQHGGHSLDGPPHD 482

Query: 238 KSPPEYQ-PPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQ-PPHQK--P 405
           +  P Y   PH+  PP   PP    PH+  PP Y   H    H+   P Y  PPH+    
Sbjct: 483 RGGPLYGGSPHDGVPPFGGPP----PHDGGPP-YRGSH----HDGGGPPYGGPPHEGGGQ 533

Query: 406 PHENPPPKFQPP-NEKPPHEKSPP 474
           P+  PPP   PP    PPH   PP
Sbjct: 534 PYGGPPPHDGPPYGGPPPHHGGPP 557

[35][TOP]
>UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK5_CHLRE
          Length = 853

 Score =  132 bits (331), Expect = 2e-29
 Identities = 67/159 (42%), Positives = 70/159 (44%), Gaps = 1/159 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 355 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 414

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 415 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 474

Query: 361 HEHPSPEYQPPHQKPPHENP-PPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   P PP   PP+  PP   SPP
Sbjct: 475 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 513

 Score =  130 bits (328), Expect = 3e-29
 Identities = 66/159 (41%), Positives = 68/159 (42%), Gaps = 1/159 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   P
Sbjct: 382 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 441

Query: 181 PHEIPPPEHQPPHEKPPH-AKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
           P   PPP   PP   PP     PP   PP   PPP   PP   PP   PPP  +PP   P
Sbjct: 442 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 501

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   P P   PP   PP  +PPP   PP   PP    PP
Sbjct: 502 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 540

 Score =  129 bits (324), Expect = 1e-28
 Identities = 66/159 (41%), Positives = 71/159 (44%), Gaps = 1/159 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 342 PPPSPPP---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 398

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP +  PP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 399 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 458

Query: 361 HEHPSPEYQPPHQKPPHENPPPKF-QPPNEKPPHEKSPP 474
              P P   PP   PP  +PPP    PP+  PP   SPP
Sbjct: 459 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 497

 Score =  127 bits (320), Expect = 3e-28
 Identities = 66/158 (41%), Positives = 69/158 (43%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 202 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP--PP 259

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP  +PPP   PP   PP
Sbjct: 260 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP--PPPSPPP 317

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP    PP   PP+  PP   SPP
Sbjct: 318 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 355

 Score =  127 bits (320), Expect = 3e-28
 Identities = 66/159 (41%), Positives = 70/159 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP    PP   P
Sbjct: 372 PSPPPPPPPSPPPP-PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 430

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P    PP   PP   PP   SPP   PP   PPP   PP   PP  +PPP   PP   PP
Sbjct: 431 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 490

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              PSP   PP   PP   PPP   PP   PP    PP+
Sbjct: 491 PPPPSPPPPPPPSPPP---PPPPSPPPPSPPPPSPPPPS 526

 Score =  126 bits (316), Expect = 9e-28
 Identities = 66/158 (41%), Positives = 67/158 (42%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 311 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 370

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 371 PPSPPPPP--PPSPPPPPPPSPPP--PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 426

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 427 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 464

 Score =  126 bits (316), Expect = 9e-28
 Identities = 66/160 (41%), Positives = 68/160 (42%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   P    PPP   PP    P   PPP   PP   PP   SPP   P
Sbjct: 328 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 387

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 388 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPP---PPPPPSPPPPPPP 442

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
              P P   PP   PP   PPP   PP   PP    PP S
Sbjct: 443 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPS 482

 Score =  125 bits (315), Expect = 1e-27
 Identities = 67/159 (42%), Positives = 70/159 (44%), Gaps = 1/159 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   P
Sbjct: 229 PPSPPPPSPPPPPPPSPPPPSPPPPSPPP--PPPPSPPPPSPPPPSPPPPPPPSPPPPPP 286

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 287 PSPPPPPPPSPPPPSPPPPSPPPP--PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 344

Query: 361 HEHPSPEYQPPHQKPPHENPPPKF-QPPNEKPPHEKSPP 474
              P P   PP   PP  +PPP    PP+  PP   SPP
Sbjct: 345 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 383

 Score =  125 bits (313), Expect = 2e-27
 Identities = 67/160 (41%), Positives = 70/160 (43%), Gaps = 1/160 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPH-EHSPPGYQ 177
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP     PP   
Sbjct: 258 PPPPSPPPPSPPPPSPPP--PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSP 315

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
           PP   PPP   PP   PP   SPP   PP   PPP   PP   PP  +PPP   PP   P
Sbjct: 316 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 375

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           P   PSP   PP   PP   PPP   PP   PP    PP+
Sbjct: 376 PPPPPSPPPPPPPSPPP---PPPPSPPPPSPPPPSPPPPS 412

 Score =  125 bits (313), Expect = 2e-27
 Identities = 66/164 (40%), Positives = 69/164 (42%), Gaps = 10/164 (6%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPG---YQPPH 186
           PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP      PP 
Sbjct: 259 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 318

Query: 187 EIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHE 366
             PPP   PP   PP   SPP   PP   PPP   PP   PP  +PPP   PP   PP  
Sbjct: 319 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 378

Query: 367 HPSPEYQPPHQ-------KPPHENPPPKFQPPNEKPPHEKSPPA 477
            PSP   PP          PP  +PPP   PP   PP    PP+
Sbjct: 379 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 422

 Score =  125 bits (313), Expect = 2e-27
 Identities = 67/158 (42%), Positives = 70/158 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   P
Sbjct: 287 PSPPPPPPPSPPPPSPPPPSPPPP---PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 343

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   P    PP  +PPP   PP   PP
Sbjct: 344 PSPPPPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP---PPPPSPP 399

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP+  PP   SPP
Sbjct: 400 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 437

 Score =  125 bits (313), Expect = 2e-27
 Identities = 65/158 (41%), Positives = 68/158 (43%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   P    PP    PP   P
Sbjct: 305 PSPPPPPPPSPPPPSPPPPSPPPPSPPPP----PPPSPPPPPPPSPPPPPPPSPPPPSPP 360

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP  +PPP   PP   PP
Sbjct: 361 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 420

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 421 PSPPPP--SPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 456

 Score =  124 bits (312), Expect = 2e-27
 Identities = 66/159 (41%), Positives = 70/159 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P  +PPP   PP   PP    PP   P
Sbjct: 218 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP--PPPSPPPPSPPPPSPPP 275

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P    PP   PP   PP   SPP   PP   PPP   PP   PP  +PPP   PP   PP
Sbjct: 276 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP---PPPPSPPPPSPPPPSPPPPSPPP 332

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              PSP   PP   PP   PPP   PP   PP    PP+
Sbjct: 333 PPPPSPPPPPPPSPPP---PPPPSPPPPSPPPPSPPPPS 368

 Score =  124 bits (312), Expect = 2e-27
 Identities = 65/160 (40%), Positives = 70/160 (43%), Gaps = 1/160 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP    PP   P
Sbjct: 271 PSPPPPPPPSPPPP-PPPSPPPPPPPSPPPPSPPPPSPPPP--PPPSPPPPSPPPPSPPP 327

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY-NPPHEKP 357
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   +PP   P
Sbjct: 328 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 387

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           P   P P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 388 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 427

 Score =  124 bits (310), Expect = 4e-27
 Identities = 66/158 (41%), Positives = 70/158 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP        PPP   PP   PP    PP   P
Sbjct: 192 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPS------PPPPSPPPPSPPPPSPPPPPPPSP 245

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP +  PP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 246 PPPSPPPPSPPP--PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 303

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PSP   PP   PP   PPP   PP+  PP   SPP
Sbjct: 304 --PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 339

 Score =  124 bits (310), Expect = 4e-27
 Identities = 67/160 (41%), Positives = 71/160 (44%), Gaps = 2/160 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP    P   SPP   P
Sbjct: 349 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 408

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 409 PPPSPPPPSPPPPSPPP--PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 466

Query: 361 HEHP--SPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P   P   PP   PP  +PPP   PP+  PP   SPP
Sbjct: 467 SPPPPSPPPPSPPPPSPPPPSPPPP-PPPSPPPPPPPSPP 505

 Score =  123 bits (309), Expect = 6e-27
 Identities = 66/158 (41%), Positives = 68/158 (43%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 297 PPPPSPPPPSPPPP--PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 354

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP  +PPP   PP   PP
Sbjct: 355 PPPSPPPPSPPPPSPPP--PSPPPPPPPSPPPPPPPSPP--PPPPPSPPPPSPPPPSPPP 410

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 411 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 448

 Score =  123 bits (309), Expect = 6e-27
 Identities = 64/161 (39%), Positives = 66/161 (40%), Gaps = 1/161 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PP    PP    P  +PPP   PP   PP    PP   P
Sbjct: 366 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 425

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHEN-PPPEYNPPHEKP 357
           P   PPP   PP   PP    PP   PP   PP    PP   PP  + PPP   PP   P
Sbjct: 426 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 485

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
           P   P P   PP   PP   PPP   PP   PP    PP S
Sbjct: 486 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPS 526

 Score =  122 bits (307), Expect = 9e-27
 Identities = 66/159 (41%), Positives = 69/159 (43%), Gaps = 1/159 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   P P   PP    P   PPP   PP   PP    PP   P
Sbjct: 315 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP---PPPPSPPPPSPPPPSPPPPSPPP 371

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP  +PPP   PP   PP
Sbjct: 372 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP-SPPPPSPPPPSPPPPSPPPPSPPP 430

Query: 361 HEHPSPEYQPPHQKPPHENP-PPKFQPPNEKPPHEKSPP 474
              PSP   PP   PP   P PP   PP+  PP   SPP
Sbjct: 431 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 469

 Score =  122 bits (307), Expect = 9e-27
 Identities = 66/161 (40%), Positives = 70/161 (43%), Gaps = 1/161 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P    PP   PP   PP   SPP   P
Sbjct: 398 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 457

Query: 181 PHEIPPPEHQPPHEKPPH-AKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
           P   PPP   PP   PP  +  PP   PP   PPP   PP   PP   PPP  +PP   P
Sbjct: 458 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 517

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
           P   P P   PP   PP  +PPP   PP   PP    PP S
Sbjct: 518 PPPSPPPP-SPPPPSPPPPSPPP---PPPPSPPPPSPPPPS 554

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/163 (39%), Positives = 68/163 (41%), Gaps = 2/163 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKP--PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY 174
           P  + PP   PPP   PP   P  PP   PP    P   PPP   PP   PP    PP  
Sbjct: 399 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 458

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
            PP   PPP   PP   PP +  PP   PP   PPP   PP   PP   PPP  +PP   
Sbjct: 459 SPPP--PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 516

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPASC 483
           PP   P P   PP   PP   PPP    P    P   SPP  C
Sbjct: 517 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPC 559

 Score =  122 bits (305), Expect = 2e-26
 Identities = 66/162 (40%), Positives = 70/162 (43%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 240 PPPPSPPPPSPPPPSPPP--PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 297

Query: 181 PHEIPPPEH---QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHE 351
           P   PPP      PP   PP +  PP   PP   PPP   PP   PP   PPP  +PP  
Sbjct: 298 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 357

Query: 352 KPPHEHPSPEYQPPHQKPPHENP-PPKFQPPNEKPPHEKSPP 474
            PP   P P   PP   PP   P PP   PP+  PP   SPP
Sbjct: 358 SPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 399

 Score =  122 bits (305), Expect = 2e-26
 Identities = 65/158 (41%), Positives = 68/158 (43%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 394 PPPSPPPPSPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 452

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PP    PP   PP    PP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 453 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPPPPSPPPPPPPSPP--PPP 508

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP+  PP   SPP
Sbjct: 509 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 546

 Score =  121 bits (304), Expect = 2e-26
 Identities = 67/170 (39%), Positives = 71/170 (41%), Gaps = 12/170 (7%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   P
Sbjct: 212 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP---PPPSPPPPSPPPPPPPSPPPPSP 268

Query: 181 PHEIPPPEHQP---------PHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPE 333
           P   PPP   P         P   PP +  PP   PP   PPP   PP   PP  +PPP 
Sbjct: 269 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328

Query: 334 Y---NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
                PP   PP   PSP   PP   PP   PPP   PP+  PP    PP
Sbjct: 329 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 378

 Score =  120 bits (301), Expect = 5e-26
 Identities = 65/162 (40%), Positives = 69/162 (42%), Gaps = 2/162 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 187 PGIPSPPPPSPPPPSPPPPSPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 245

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP +  PP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 246 PPPSPPPPSPPP--PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 303

Query: 361 HEHPSPEY--QPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
              P P     PP   PP  +PPP   PP   P     PP S
Sbjct: 304 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 345

 Score =  118 bits (296), Expect = 2e-25
 Identities = 64/157 (40%), Positives = 68/157 (43%), Gaps = 4/157 (2%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPP----HEKPPHEHSPPGYQPP 183
           PP   PPP   PP   PPP   PP    P  +PPP   PP       PP   SPP   PP
Sbjct: 293 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP--PPP 350

Query: 184 HEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPH 363
              PPP   PP   PP +  PP   PP    PP   PP   PP    PP  +PP   PP 
Sbjct: 351 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 410

Query: 364 EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             P P   PP   PP   PPP   PP+  PP   SPP
Sbjct: 411 PSPPPPSPPPPSPPPPSPPPP--PPPSPPPPPPPSPP 445

 Score =  114 bits (286), Expect = 3e-24
 Identities = 61/152 (40%), Positives = 65/152 (42%), Gaps = 7/152 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 409 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 468

Query: 181 PHEIPPPEHQPPHEKPPHAK------SPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNP 342
           P   PPP   PP   PP +       SPP   PP   PPP   PP   PP  +PPP   P
Sbjct: 469 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 528

Query: 343 PHEKPPHEHPSPEY-QPPHQKPPHENPPPKFQ 435
           P   PP   P P    PP   PP  +PPP  Q
Sbjct: 529 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPCQ 560

 Score =  110 bits (274), Expect = 6e-23
 Identities = 61/146 (41%), Positives = 63/146 (43%)
 Frame = +1

Query: 37  PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPP 216
           P   P    PPP   PP    P   PPP   PP   PP   SPP   PP   PPP   PP
Sbjct: 183 PISTPGIPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPP 239

Query: 217 HEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPH 396
              PP +  PP   PP   PPP   PP   PP  +PPP   PP   PP   PSP   PP 
Sbjct: 240 --PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP--PPPSPPPPPPPSPPPPPPP 295

Query: 397 QKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   PPP   PP    P   SPP
Sbjct: 296 SPPPPSPPPPSPPPPPPPSPPPPSPP 321

[36][TOP]
>UniRef100_UPI0000EB01D2 UPI0000EB01D2 related cluster n=1 Tax=Canis lupus familiaris
           RepID=UPI0000EB01D2
          Length = 232

 Score =  131 bits (329), Expect = 3e-29
 Identities = 78/172 (45%), Positives = 92/172 (53%), Gaps = 14/172 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEK-PPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP--G 171
           P H      NPP E+ PP E  PP E+ PP   Q H NPP ++ PP E  P + + P  G
Sbjct: 37  PEHGPSQDHNPPQEHGPPQEHGPPQEHGPP---QEH-NPPQEHDPPQEHDPPQGAQPSSG 92

Query: 172 YQP-PHEIPPPEHQPPHEK-PPHAKSPP-EYQPPHEH-PPPEYLPP--HEKPPHENPPPE 333
            QP P   P  +H PP E  PP   +PP EY PP EH PP E+ PP  H+ P   +PP E
Sbjct: 93  AQPSPEHDPSQDHNPPQEHGPPQEHNPPQEYGPPQEHGPPQEHNPPQEHDPPQEHDPPQE 152

Query: 334 YNPPHE-KPPHEH-PSPEYQPP--HQKPPHENPPPKFQPPNE-KPPHEKSPP 474
           +NPP E  PP EH P  E+ PP  H  P   NPP +  PP E  PP E  PP
Sbjct: 153 HNPPQEHNPPQEHGPPQEHNPPQEHNPPQEHNPPQEHGPPQEHNPPQEHGPP 204

 Score =  130 bits (327), Expect = 5e-29
 Identities = 72/166 (43%), Positives = 83/166 (50%), Gaps = 10/166 (6%)
 Frame = +1

Query: 7   HAKPPYENPPPEYQPPHEKPPP-EYQPPHGKQPH--VNPPPQYQPPHE-KPPHEHSPPG- 171
           H  P    PP E+ PP E  PP E+ PP G QP     P P++ P  +  PP EH PP  
Sbjct: 57  HGPPQEHGPPQEHNPPQEHDPPQEHDPPQGAQPSSGAQPSPEHDPSQDHNPPQEHGPPQE 116

Query: 172 YQPPHEI-PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           + PP E  PP EH PP E  P    P E+ PP EH PP+    H  P   NPP E+ PP 
Sbjct: 117 HNPPQEYGPPQEHGPPQEHNP----PQEHDPPQEHDPPQ---EHNPPQEHNPPQEHGPPQ 169

Query: 349 E-KPPHEH-PSPEYQPP--HQKPPHENPPPKFQPPNEKPPHEKSPP 474
           E  PP EH P  E+ PP  H  P   NPP +  PP E    E  PP
Sbjct: 170 EHNPPQEHNPPQEHNPPQEHGPPQEHNPPQEHGPPQEHGLQESRPP 215

 Score =  127 bits (318), Expect = 5e-28
 Identities = 78/165 (47%), Positives = 92/165 (55%), Gaps = 15/165 (9%)
 Frame = +1

Query: 7   HAKPPYENPPPEYQPPHEKPPPE-YQPPHGKQPHV--NPPPQYQPPHEK-PPHEHSPPG- 171
           H  P   NPP E+ PP E  PP+  QP  G QP    +P   + PP E  PP EH+PP  
Sbjct: 63  HGPPQEHNPPQEHDPPQEHDPPQGAQPSSGAQPSPEHDPSQDHNPPQEHGPPQEHNPPQE 122

Query: 172 YQPPHEI-PPPEHQPPHEK-PPHAKSPP-EYQPPHEH-PPPEYLPPHE-KPPHE-NPPPE 333
           Y PP E  PP EH PP E  PP    PP E+ PP EH PP E+ PP E  PP E NPP E
Sbjct: 123 YGPPQEHGPPQEHNPPQEHDPPQEHDPPQEHNPPQEHNPPQEHGPPQEHNPPQEHNPPQE 182

Query: 334 YNPPHEK-PPHEH-PSPEYQPPHQKPPHENPPPKFQP--PNEKPP 456
           +NPP E  PP EH P  E+ PP +    E+ PPK +   P++ PP
Sbjct: 183 HNPPQEHGPPQEHNPPQEHGPPQEHGLQESRPPKGRSRLPHKPPP 227

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 41/95 (43%), Positives = 51/95 (53%), Gaps = 7/95 (7%)
 Frame = +1

Query: 1   PHHAKPPYENPPP-EYQPPHE-KPPPEYQPP--HGKQPHVNPPPQYQPPHE-KPPHEHSP 165
           P    PP E+ PP E+ PP E  PP E+ PP  HG     NPP ++ PP E  PP EH P
Sbjct: 132 PQEHNPPQEHDPPQEHDPPQEHNPPQEHNPPQEHGPPQEHNPPQEHNPPQEHNPPQEHGP 191

Query: 166 P-GYQPPHEI-PPPEHQPPHEKPPHAKSPPEYQPP 264
           P  + PP E  PP EH     +PP  +S   ++PP
Sbjct: 192 PQEHNPPQEHGPPQEHGLQESRPPKGRSRLPHKPP 226

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 35/106 (33%), Positives = 46/106 (43%), Gaps = 2/106 (1%)
 Frame = +1

Query: 166 PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPH-EHPPPEYLPPHEKPPHENPPPEYNP 342
           PG +P    P  +  P     P A+S P  QP     P PE+ P  +     NPP E+ P
Sbjct: 1   PGARPS---PRAQPSPGARSSPGAQSSPGAQPSSGAQPSPEHGPSQD----HNPPQEHGP 53

Query: 343 PHEK-PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           P E  PP EH  P+    H  P   +PP +  PP    P   + P+
Sbjct: 54  PQEHGPPQEHGPPQ---EHNPPQEHDPPQEHDPPQGAQPSSGAQPS 96

[37][TOP]
>UniRef100_Q9ZQI0 Putative uncharacterized protein At2g27380 n=1 Tax=Arabidopsis
           thaliana RepID=Q9ZQI0_ARATH
          Length = 761

 Score =  131 bits (329), Expect = 3e-29
 Identities = 75/171 (43%), Positives = 91/171 (53%), Gaps = 15/171 (8%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPP-HEHSPP 168
           H   PP    PP Y  P   PPP Y PP    P   PP    P Y PP +KPP   +SPP
Sbjct: 42  HAHPPPIYGAPPSYTTP---PPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPP 98

Query: 169 GYQPPHEIP------PPEHQPPHEKPP-HAKSPPEYQPPHEHPP-PEYLPPHEKPPHENP 324
            Y PP + P      PP + PP +KPP    SPP Y PP + PP P Y PP + PP + P
Sbjct: 99  IYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMP 158

Query: 325 P-PEYNPPHEKPP-HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           P P Y+PP + PP H+ P+P Y PP + P H+ P P + PP + PP  K P
Sbjct: 159 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPP 209

 Score =  130 bits (328), Expect = 3e-29
 Identities = 75/174 (43%), Positives = 93/174 (53%), Gaps = 22/174 (12%)
 Frame = +1

Query: 16  PPYENPP----PEYQPPHEKPP-PEYQPPHGKQPHVNP------PPQYQPPHEKPP-HEH 159
           PP + PP    P Y PP +KPP P Y PP    P   P      PP Y PP +KPP   +
Sbjct: 70  PPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTY 129

Query: 160 SPPGYQPPHEIPP-PEHQPPHEKPPHAKSP-PEYQPP------HEHPPPEYLPPHEKPPH 315
           SPP Y PP + PP P + PP + PP    P P Y PP      H+ P P Y PP + P H
Sbjct: 130 SPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVH 189

Query: 316 ENPPPEYNPPHEKPP-HEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEKSP 471
           + P P Y+PP + PP H+ P+P Y PP + PP H+ P P + PP + PP  K P
Sbjct: 190 KPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPP 243

 Score =  130 bits (327), Expect = 5e-29
 Identities = 77/176 (43%), Positives = 93/176 (52%), Gaps = 22/176 (12%)
 Frame = +1

Query: 10  AKPPYENPPPE------YQPPHEKPP----PEYQPPHGKQPHVN-PPPQYQPPHEKPPHE 156
           A P Y  PPP       Y PP +KPP    P Y PP  K P     PP Y PP +KPP  
Sbjct: 51  APPSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP 110

Query: 157 -HSPPGYQPPHEIPP-PEHQPPHEKPPHAKSP-PEYQPPHEHPP------PEYLPPHEKP 309
            +SPP Y PP + PP P + PP   PP  K P P Y PP + PP      P Y PP + P
Sbjct: 111 TYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPP 170

Query: 310 P-HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEKSP 471
           P H+ P P Y+PP + P H+ P+P Y PP + PP H+ P P + PP + PP  K P
Sbjct: 171 PVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPP 226

 Score =  129 bits (324), Expect = 1e-28
 Identities = 79/177 (44%), Positives = 94/177 (53%), Gaps = 25/177 (14%)
 Frame = +1

Query: 16  PPYENPP-PEYQPPHEKPP------PEYQPPHGKQPHVNPP-PQYQPPHEKPPHEHSPPG 171
           PP + PP P Y PP + PP      P Y PP  K P V PP P Y PP  KPP  H PP 
Sbjct: 389 PPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPI-KLPPVKPPTPIYSPP-VKPPPVHKPPT 446

Query: 172 --YQPPHEIPPPEHQPPHE------KPPHAKSP-PEYQPPHEHPP------PEYLPPHEK 306
             Y PP + PPP H+PP        KPP  K P P Y PP + PP      P Y PP + 
Sbjct: 447 PIYSPPVK-PPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKP 505

Query: 307 PPHENPP-PEYNPPHEKPPHEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEKSP 471
           PP + PP P Y+PP + PP + P+P Y PP + PP H+ P P + PP + PP  K P
Sbjct: 506 PPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPP 562

 Score =  129 bits (323), Expect = 1e-28
 Identities = 76/176 (43%), Positives = 95/176 (53%), Gaps = 24/176 (13%)
 Frame = +1

Query: 16  PPYENPP------PEYQPPHEKPP-PEYQPPHGKQPHVNPP------PQYQPPHEKPP-H 153
           PP + PP      P Y PP +KPP P Y PP    P   PP      P Y PP +KPP  
Sbjct: 85  PPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP 144

Query: 154 EHSPPGYQPPHEIPP-PEHQPPHEKPPHAKSP-PEYQPP-----HEHPPPEYLPPHEKPP 312
            +SPP   PP ++PP P + PP + PP  K P P Y PP     H+ P P Y PP + PP
Sbjct: 145 SYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPP 204

Query: 313 -HENPPPEYNPPHEKPP-HEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEKSP 471
            H+ P P Y+PP + PP H+ P+P Y PP + PP H+ P P + PP + PP  K P
Sbjct: 205 VHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPP 260

 Score =  129 bits (323), Expect = 1e-28
 Identities = 72/174 (41%), Positives = 90/174 (51%), Gaps = 22/174 (12%)
 Frame = +1

Query: 16  PPYENPPPEYQPP------HEKPPPEYQPPHGKQP-HVNPPPQYQPPHEKPPHEHSPPGY 174
           PP + P P Y PP      H+ P P Y PP    P H  P P Y PP + PP +   P Y
Sbjct: 423 PPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTY 482

Query: 175 QPPHEIPP------PEHQPPHEKPPHAKSP-PEYQPPHEHPP-----PEYLPPHEKPP-H 315
            PP + PP      P + PP + PP  K P P Y PP + PP     P Y PP + PP H
Sbjct: 483 SPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVH 542

Query: 316 ENPPPEYNPPHEKPP-HEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEKSP 471
           + P P Y+PP + PP H+ P+P Y PP + PP H+ P P + PP + PP  K P
Sbjct: 543 KPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 596

 Score =  129 bits (323), Expect = 1e-28
 Identities = 73/175 (41%), Positives = 92/175 (52%), Gaps = 18/175 (10%)
 Frame = +1

Query: 1   PHHAKP-PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP-PQYQPPHEKPPHEHSP-PG 171
           P H  P P  +PP +  P H+ P P Y PP  K P V PP P Y PP + PP +  P P 
Sbjct: 440 PVHKPPTPIYSPPVKPPPVHKPPTPTYSPPI-KPPPVKPPTPTYSPPVQPPPVQKPPTPT 498

Query: 172 YQPPHEIPP------PEHQPPHEKPPHAKSPPEYQPP------HEHPPPEYLPPHEKPP- 312
           Y PP + PP      P + PP + PP     P Y PP      H+ P P Y PP + PP 
Sbjct: 499 YSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPI 558

Query: 313 HENPPPEYNPPHEKPP-HEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEKSP 471
           H+ P P Y+PP + PP H+ P+P Y PP + PP H+ P P + PP + PP  K P
Sbjct: 559 HKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 613

 Score =  128 bits (322), Expect = 2e-28
 Identities = 73/176 (41%), Positives = 92/176 (52%), Gaps = 24/176 (13%)
 Frame = +1

Query: 16  PPYENPP-PEYQPP------HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPP-HEHSPPG 171
           PP + PP P Y PP      H+ P P Y PP     H  P P Y PP + PP H+   P 
Sbjct: 153 PPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPI 212

Query: 172 YQPP------HEIPPPEHQPPHEKPPHAKSP-PEYQPP------HEHPPPEYLPPHEKPP 312
           Y PP      H+ P P + PP + PP  K P P Y PP      H+ P P Y PP + PP
Sbjct: 213 YSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPP 272

Query: 313 HENPP-PEYNPPHEKPP-HEHPSPEYQPPHQKPPHENPP-PKFQPPNEKPPHEKSP 471
            + PP P Y+PP + PP H+ P+P Y PP + PP + PP P + PP + PP +K P
Sbjct: 273 VQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPP 328

 Score =  127 bits (320), Expect = 3e-28
 Identities = 71/174 (40%), Positives = 89/174 (51%), Gaps = 22/174 (12%)
 Frame = +1

Query: 16  PPYENPPPEYQPP------HEKPPPEYQPPHGKQP-HVNPPPQYQPPHEKPPHEHSP-PG 171
           PP + P P Y PP      H+ P P Y PP    P H  P P Y PP + PP +  P P 
Sbjct: 339 PPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPT 398

Query: 172 YQPPHEIPP------PEHQPPHEKPPHAKSPPEYQPP------HEHPPPEYLPPHEKPP- 312
           Y PP + PP      P + PP + PP     P Y PP      H+ P P Y PP + PP 
Sbjct: 399 YSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPV 458

Query: 313 HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP-PKFQPPNEKPPHEKSP 471
           H+ P P Y+PP + PP + P+P Y PP Q PP + PP P + PP + PP +K P
Sbjct: 459 HKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPP 512

 Score =  127 bits (320), Expect = 3e-28
 Identities = 74/175 (42%), Positives = 91/175 (52%), Gaps = 23/175 (13%)
 Frame = +1

Query: 16  PPYENPP-PEYQPPHEKPP-----PEYQPPHGKQPHVNPP-PQYQPPHEKPPHEHSP-PG 171
           PP   PP P Y PP + PP     P Y PP    P   PP P Y PP + PP +  P P 
Sbjct: 456 PPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPT 515

Query: 172 YQPPHEIPP-----PEHQPPHEKPPHAKSP-PEYQPP------HEHPPPEYLPPHEKPP- 312
           Y PP + PP     P + PP + PP  K P P Y PP      H+ P P Y PP + PP 
Sbjct: 516 YSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPV 575

Query: 313 HENPPPEYNPPHEKPP-HEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEKSP 471
           H+ P P Y+PP + PP H+ P+P Y PP + PP H+ P P + PP + PP  K P
Sbjct: 576 HKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 630

 Score =  127 bits (319), Expect = 4e-28
 Identities = 72/176 (40%), Positives = 89/176 (50%), Gaps = 23/176 (13%)
 Frame = +1

Query: 16  PPYENPP------PEYQPPHEKPP-PEYQPPHGKQPHVNPP-PQYQPPHEKPPHEHSP-P 168
           PP + PP      P Y PP +KPP P Y PP    P   PP P Y PP + PP +  P P
Sbjct: 102 PPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTP 161

Query: 169 GYQPP------HEIPPPEHQPPHEKPPHAKSPPEYQPP------HEHPPPEYLPPHEKPP 312
            Y PP      H+ P P + PP + P H    P Y PP      H+ P P Y PP + PP
Sbjct: 162 TYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPP 221

Query: 313 -HENPPPEYNPPHEKPP-HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            H+ P P Y+PP + PP H+ P+P Y PP + PP   PP     P  KPP  ++PP
Sbjct: 222 VHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPP 277

 Score =  127 bits (319), Expect = 4e-28
 Identities = 73/174 (41%), Positives = 91/174 (52%), Gaps = 22/174 (12%)
 Frame = +1

Query: 16  PPYENPP-PEYQPPHEKPP-----PEYQPPHGKQP-HVNPPPQYQPPHEKPP-HEHSPPG 171
           PP + PP P Y PP + PP     P Y PP    P H  P P Y PP + PP H+   P 
Sbjct: 406 PPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPT 465

Query: 172 YQPPHEIPP-----PEHQPPHEKPPHAKSP-PEYQPPHEHPP------PEYLPPHEKPPH 315
           Y PP + PP     P + PP + PP  K P P Y PP + PP      P Y PP + PP 
Sbjct: 466 YSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPV 525

Query: 316 ENPPPEYNPPHEKPP-HEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEKSP 471
           + P P Y+PP + PP H+ P+P Y PP + PP H+ P P + PP + PP  K P
Sbjct: 526 KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPP 579

 Score =  127 bits (318), Expect = 5e-28
 Identities = 75/176 (42%), Positives = 93/176 (52%), Gaps = 24/176 (13%)
 Frame = +1

Query: 16  PPYENPP------PEYQPPHEKPP-PEYQPPHGKQPHVNPP-PQYQPPHEKPP-HEHSPP 168
           PP + PP      P Y PP +KPP P Y PP    P   PP P Y PP + PP H+   P
Sbjct: 119 PPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTP 178

Query: 169 GYQPP-----HEIPPPEHQPPHEKPPHAKSP-PEYQPP------HEHPPPEYLPPHEKPP 312
            Y PP     H+ P P + PP + PP  K P P Y PP      H+ P P Y PP + PP
Sbjct: 179 TYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPP 238

Query: 313 -HENPPPEYNPPHEKPP-HEHPSPEYQPPHQKPPHENPP-PKFQPPNEKPPHEKSP 471
            H+ P P Y+PP + PP H+ P+P Y PP + PP + PP P + PP + PP  K P
Sbjct: 239 VHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPP 294

 Score =  126 bits (317), Expect = 7e-28
 Identities = 76/179 (42%), Positives = 92/179 (51%), Gaps = 26/179 (14%)
 Frame = +1

Query: 13  KPPYENPP-PEYQPP------HEKPPPEYQPPHGKQP-HVNPPPQYQPPHEKPPHEHSPP 168
           KPP   PP P Y PP      H+ P P Y PP    P H  P P Y PP  KPP  H PP
Sbjct: 185 KPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPP-VKPPPVHKPP 243

Query: 169 G--YQPPHEIPPPEHQPPHE------KPPHAKSPPE--YQPP------HEHPPPEYLPPH 300
              Y PP + PPP H+PP        KPP  ++PP   Y PP      H+ P P Y PP 
Sbjct: 244 TPIYSPPIK-PPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPV 302

Query: 301 EKPPHENPP-PEYNPPHEKPP-HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           + PP + PP P Y+PP + PP  + P+P Y PP + PP + P P + PP + PP  K P
Sbjct: 303 KSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPP 361

 Score =  125 bits (315), Expect = 1e-27
 Identities = 72/175 (41%), Positives = 89/175 (50%), Gaps = 18/175 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPP-PEYQPPHGKQPHVNPP-PQYQPPHEKPPHEHSPPGY 174
           P H  P     PP   PP +KPP P Y PP    P   PP P Y PP + PP +   P Y
Sbjct: 289 PVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIY 348

Query: 175 QPPHEIPPPEHQPP-------------HEKPPHAKSPPEYQPPHEHPP-PEYLPPHEKPP 312
            PP + PPP H+PP             H+ P    SPP   PP + PP P Y PP + PP
Sbjct: 349 SPPVK-PPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPP 407

Query: 313 HENPP-PEYNPPHEKPPHEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEKSP 471
            + PP P Y+PP + PP + P+P Y PP + PP H+ P P + PP + PP  K P
Sbjct: 408 LQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPP 462

 Score =  125 bits (314), Expect = 1e-27
 Identities = 73/176 (41%), Positives = 91/176 (51%), Gaps = 24/176 (13%)
 Frame = +1

Query: 16  PPYENPP-PEYQPP------HEKPPPEYQPPHGKQP-HVNPPPQYQPPHEKPPHEHSP-P 168
           PP   PP P Y PP      H+ P P Y PP    P H  P P Y PP + PP +  P P
Sbjct: 220 PPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTP 279

Query: 169 GYQPP------HEIPPPEHQPPHEKPPHAKSP-PEYQPPHEHPP------PEYLPPHEKP 309
            Y PP      H+ P P + PP + PP  K P P Y PP + PP      P Y PP + P
Sbjct: 280 IYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPP 339

Query: 310 PHENPPPEYNPPHEKPP-HEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEKSP 471
           P + P P Y+PP + PP H+ P+P Y PP + PP H+ P P + PP + PP +K P
Sbjct: 340 PVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPP 395

 Score =  125 bits (313), Expect = 2e-27
 Identities = 71/176 (40%), Positives = 90/176 (51%), Gaps = 24/176 (13%)
 Frame = +1

Query: 16   PPYENPPPEYQPP------HEKPPPEYQPPHGKQP-HVNPPPQYQPPHEKPP-HEHSPPG 171
            PP + P P Y PP      H+ P P Y PP    P H  P P Y PP + PP H+   P 
Sbjct: 523  PPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPT 582

Query: 172  YQPP------HEIPPPEHQPPHEKPPHAKSP-PEYQPP------HEHPPPEYLPPHEKPP 312
            Y PP      H+ P P + PP + PP  K P P Y PP      H+ P P Y PP + PP
Sbjct: 583  YSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 642

Query: 313  -HENPPPEYNPPHEKPP-HEHPSPEYQPPHQKPPHENPP-PKFQPPNEKPPHEKSP 471
             H+ P P Y+PP + PP  + P+P Y PP + PP + PP P + PP + PP +  P
Sbjct: 643  VHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPP 698

 Score =  124 bits (312), Expect = 2e-27
 Identities = 75/177 (42%), Positives = 93/177 (52%), Gaps = 25/177 (14%)
 Frame = +1

Query: 16  PPYENPP-PEYQPPHEKPPPEYQPPHGK-QPHVNPPPQYQPPHE------KPPHEHSPPG 171
           PP   PP P Y PP  KPPP ++PP     P V PPP ++PP        KPP  H PP 
Sbjct: 203 PPVHKPPTPIYSPPI-KPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPT 261

Query: 172 --YQPPHEIPP------PEHQPPHEKPPHAKSP-PEYQPPHEHPP------PEYLPPHEK 306
             Y PP + PP      P + PP + PP  K P P Y PP + PP      P Y PP + 
Sbjct: 262 PIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKP 321

Query: 307 PPHENPP-PEYNPPHEKPPHEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEKSP 471
           PP + PP P Y+PP + PP + P+P Y PP + PP H+ P P + PP + PP  K P
Sbjct: 322 PPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPP 378

 Score =  124 bits (312), Expect = 2e-27
 Identities = 74/176 (42%), Positives = 92/176 (52%), Gaps = 24/176 (13%)
 Frame = +1

Query: 16  PPYENPP-PEYQPP------HEKPPPEYQPPHGKQPHVNPP-PQYQPPHEKPP-HEHSPP 168
           PP   PP P Y PP      H+ P P Y PP    P   PP P Y PP + PP H+   P
Sbjct: 237 PPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTP 296

Query: 169 GYQPPHEIPP------PEHQPPHEKPPHAKSP-PEYQPPHEHPP-----PEYLPPHEKPP 312
            Y PP + PP      P + PP + PP  K P P Y PP + PP     P Y PP + PP
Sbjct: 297 TYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPP 356

Query: 313 -HENPPPEYNPPHEKPP-HEHPSPEYQPPHQKPPHENPP-PKFQPPNEKPPHEKSP 471
            H+ P P Y+PP + PP H+ P+P Y PP + PP + PP P + PP + PP +K P
Sbjct: 357 VHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPP 412

 Score =  124 bits (311), Expect = 3e-27
 Identities = 77/183 (42%), Positives = 94/183 (51%), Gaps = 25/183 (13%)
 Frame = +1

Query: 1   PHHAKPPYENPP-PEYQPPHEKPP------PEYQPPHGKQPHVNPP-PQYQPPHEKPPHE 156
           P    PP + PP P Y PP + PP      P Y PP  K P V PP P Y PP  KPP  
Sbjct: 300 PPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPI-KPPPVKPPTPIYSPP-VKPPPV 357

Query: 157 HSPPG--YQPP------HEIPPPEHQPPHEKPPHAKSP-PEYQPPHEHPP------PEYL 291
           H PP   Y PP      H+ P P + PP + PP  K P P Y PP + PP      P Y 
Sbjct: 358 HKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYS 417

Query: 292 PPHEKPPHENPPPEYNPPHEKPP-HEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEK 465
           PP + PP + P P Y+PP + PP H+ P+P Y PP + PP H+ P P + PP + PP + 
Sbjct: 418 PPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKP 477

Query: 466 SPP 474
             P
Sbjct: 478 PTP 480

 Score =  124 bits (311), Expect = 3e-27
 Identities = 70/174 (40%), Positives = 87/174 (50%), Gaps = 17/174 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPP-PEYQPPHGKQPHVNPP-PQYQPPHEKPPHEHSPPGY 174
           P H  P     PP   PP +KPP P Y PP    P   PP P Y PP + PP +   P Y
Sbjct: 373 PVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIY 432

Query: 175 QPPHEIPPPEHQPP-------------HEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH 315
            PP + PPP H+PP             H+ P    SPP   PP + P P Y PP + PP 
Sbjct: 433 SPPVK-PPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPV 491

Query: 316 ENPP-PEYNPPHEKPP-HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           + PP P Y+PP + PP  + P+P Y PP + PP + P P + PP + PP  K P
Sbjct: 492 QKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPP 545

 Score =  123 bits (308), Expect = 7e-27
 Identities = 70/175 (40%), Positives = 91/175 (52%), Gaps = 17/175 (9%)
 Frame = +1

Query: 1   PHHAKP-PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP-PQYQPPHEKPPHEHSP-PG 171
           P H  P P  +PP +  P H+ P P Y PP    P   PP P Y PP + PP +  P P 
Sbjct: 356 PVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPT 415

Query: 172 YQPPHEIPP-----PEHQPPHEKPPHAKSP-PEYQPP------HEHPPPEYLPPHEKPPH 315
           Y PP ++PP     P + PP + PP  K P P Y PP      H+ P P Y PP + PP 
Sbjct: 416 YSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPV 475

Query: 316 ENPPPEYNPPHEKPP-HEHPSPEYQPPHQKPPHENPP-PKFQPPNEKPPHEKSPP 474
           + P P Y+PP + PP  + P+P Y PP + PP + PP P + PP + PP +   P
Sbjct: 476 KPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTP 530

 Score =  123 bits (308), Expect = 7e-27
 Identities = 72/177 (40%), Positives = 90/177 (50%), Gaps = 25/177 (14%)
 Frame = +1

Query: 16   PPYENPP-PEYQPP------HEKPPPEYQPPHGKQP-HVNPPPQYQPPHEKPP-HEHSPP 168
            PP   PP P Y PP      H+ P P Y PP    P H  P P Y PP + PP H+   P
Sbjct: 539  PPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 598

Query: 169  GYQPP------HEIPPPEHQPPHEKPPHAKSP-PEYQPP------HEHPPPEYLPPHEKP 309
             Y PP      H+ P P + PP + PP  K P P Y PP      H+ P P Y PP + P
Sbjct: 599  TYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 658

Query: 310  PHENPP-PEYNPPHEKPPHE-HPSPEYQPPHQKPPHENPP-PKFQPPNEKPPHEKSP 471
            P + PP P Y+PP + PP +  P+P Y PP + PP + PP P + PP + PP +  P
Sbjct: 659  PVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPP 715

 Score =  122 bits (307), Expect = 9e-27
 Identities = 72/175 (41%), Positives = 90/175 (51%), Gaps = 23/175 (13%)
 Frame = +1

Query: 16  PPYENPP-PEYQPP------HEKPPPEYQPPHGKQPHVNPP-PQYQPPHEKPPHEHSP-P 168
           PP + PP P Y PP      H+ P P Y PP    P   PP P Y PP + PP +  P P
Sbjct: 271 PPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTP 330

Query: 169 GYQPPHEIPP-----PEHQPPHEKPPHAKSP-PEYQPP------HEHPPPEYLPPHEKPP 312
            Y PP + PP     P + PP + PP  K P P Y PP      H+ P P Y PP + PP
Sbjct: 331 TYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPP 390

Query: 313 HENPP-PEYNPPHEKPP-HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
            + PP P Y+PP + PP  + P+P Y PP + PP + P P + PP + PP  K P
Sbjct: 391 IQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPP 445

 Score =  120 bits (302), Expect = 4e-26
 Identities = 72/177 (40%), Positives = 90/177 (50%), Gaps = 25/177 (14%)
 Frame = +1

Query: 16   PPYENPP-PEYQPP------HEKPPPEYQPPHGKQP-HVNPPPQYQPPHEKPP-HEHSPP 168
            PP   PP P Y PP      H+ P P Y PP    P H  P P Y PP + PP H+   P
Sbjct: 556  PPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 615

Query: 169  GYQPP------HEIPPPEHQPPHEKPPHAKSP-PEYQPPHEHPP------PEYLPPHEKP 309
             Y PP      H+ P P + PP + PP  K P P Y PP + PP      P Y PP + P
Sbjct: 616  TYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPP 675

Query: 310  PHENPP-PEYNPPHEKPPHE-HPSPEYQPPHQKPPHENPP-PKFQPPNEKPPHEKSP 471
            P + PP P Y+PP + PP +  P+P Y PP + PP + PP P + PP + PP +  P
Sbjct: 676  PVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPP 732

 Score =  106 bits (264), Expect = 9e-22
 Identities = 67/164 (40%), Positives = 83/164 (50%), Gaps = 6/164 (3%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPP-PEYQPPHGKQP-HVNPPPQYQPPHEKPP-HEHSPPG 171
            P H  P     PP   PP  KPP P Y PP    P H  P P Y PP + PP H+   P 
Sbjct: 591  PVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPT 650

Query: 172  YQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP-PEYLPPHEKPPHENPP-PEYNPP 345
            Y PP + PPP  +PP   P +  SPP   PP + PP P Y PP + PP + PP P Y+PP
Sbjct: 651  YSPPIK-PPPVQKPP--TPTY--SPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPP 705

Query: 346  HEKPPHE-HPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             + PP +  P+P Y PP + PP + PP    P   +  +   PP
Sbjct: 706  VKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYGTPPP 749

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 54/135 (40%), Positives = 65/135 (48%), Gaps = 11/135 (8%)
 Frame = +1

Query: 103 HVNPPPQYQPPHEKPPHEHSPPGYQ--PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP 276
           H +PPP Y           +PP Y   PP    PP + PP +KPP   SPP Y PP + P
Sbjct: 42  HAHPPPIYG----------APPSYTTPPPPIYSPPIYPPPIQKPP-TYSPPIYPPPIQKP 90

Query: 277 P-PEYLPPHEKPPHENPP-PEYNPPHEKPP-HEHPSPEYQPPHQKPPHENPPPKFQPPNE 447
           P P Y PP   PP + PP P Y+PP   PP  + P+P Y PP        PPP  +PP  
Sbjct: 91  PTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIY------PPPIQKPPTP 144

Query: 448 ------KPPHEKSPP 474
                 KPP  + PP
Sbjct: 145 SYSPPVKPPPVQMPP 159

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 47/123 (38%), Positives = 58/123 (47%), Gaps = 3/123 (2%)
 Frame = +1

Query: 16  PPYENPP-PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEI 192
           PP   PP P Y PP + PP +  P     P V PPP   P    P   +SPP   PP ++
Sbjct: 641 PPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLP----PTPTYSPPVKPPPVQV 696

Query: 193 PP-PEHQPPHEKPPHAKSP-PEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHE 366
           PP P + PP + PP    P P Y PP + PPP  +PP    P   P   Y  P   PP+ 
Sbjct: 697 PPTPTYSPPVKPPPVQVPPTPTYSPPIK-PPPVQVPPTPTTP-SPPQGGYGTP---PPYA 751

Query: 367 HPS 375
           + S
Sbjct: 752 YLS 754

[38][TOP]
>UniRef100_UPI0000DA1DB7 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA1DB7
          Length = 387

 Score =  130 bits (328), Expect = 3e-29
 Identities = 74/168 (44%), Positives = 84/168 (50%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-----KPPHEHSP 165
           P   +PP + PP E QPP E P P  QPP   QP + PP + QPP E     +PP E  P
Sbjct: 92  PQEPQPPLQ-PPQEPQPPQE-PQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQP 149

Query: 166 PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP 345
           P  QPP E P P  QPP E  P  +  P  QPP E P P   PP E  P + P P   PP
Sbjct: 150 P-LQPPQE-PQPPLQPPQEPQPPQEPQPPLQPPQE-PQPPLQPPQEPQPPQEPQPPLQPP 206

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPP----PKFQPPNE-KPPHEKSPP 474
            E  P + P P  QPP +  P   PP    P  QPP E +PP E  PP
Sbjct: 207 QEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQEPQPP 254

 Score =  129 bits (324), Expect = 1e-28
 Identities = 75/177 (42%), Positives = 86/177 (48%), Gaps = 19/177 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-----KPPHEHSP 165
           P   +PP E P P  QPP E  PP  QPP   QP + PP + QPP E     +PP E  P
Sbjct: 66  PQEPQPPQE-PQPPLQPPQEPQPP-LQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQP 123

Query: 166 PGYQPPHEIPPPEH-----QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPP- 327
           P  QPP E  PP+      QPP E  P  + P E QPP + PP E  PP E  P   PP 
Sbjct: 124 P-LQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPLQ-PPQEPQPPQEPQPPLQPPQ 181

Query: 328 ---PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-----KPPHEKSPP 474
              P   PP E  P + P P  QPP +  P + P P  QPP E     +PP E  PP
Sbjct: 182 EPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPP 238

 Score =  129 bits (323), Expect = 1e-28
 Identities = 76/178 (42%), Positives = 88/178 (49%), Gaps = 20/178 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHE-----KPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           P   +PP E P P  QPP E     +PP E QPP   QP + PP + QPP + PP E  P
Sbjct: 102 PQEPQPPQE-PQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQ-PPQEPQP 159

Query: 166 PGYQPPHEIPPPEH-----QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP 330
           P  QPP E  PP+      QPP E  P  + P E QPP E P P   PP E  P + P P
Sbjct: 160 P-LQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQE-PQPPLQPPQEPQPPQEPQP 217

Query: 331 EYNPPHE-----KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-----KPPHEKSPP 474
              PP E     +PP E P P  QPP +  P + P P  QPP E     +PP E  PP
Sbjct: 218 PLQPPQEPQPPLQPPQE-PQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPP 274

 Score =  127 bits (320), Expect = 3e-28
 Identities = 76/178 (42%), Positives = 86/178 (48%), Gaps = 20/178 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-----KPPHEHSP 165
           P   +PP E P P  QPP E  PP  QPP   QP + PP + QPP E     +PP E  P
Sbjct: 128 PQEPQPPQE-PQPPLQPPQEPQPP-LQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQP 185

Query: 166 PGYQPPHEIPPPEH-----QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP 330
           P  QPP E  PP+      QPP E  P  +  P  QPP E P P   PP E  P   PP 
Sbjct: 186 P-LQPPQEPQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQE-PQPPLQPPQEPQPPLQPPQ 243

Query: 331 EYNPPHE-----KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-----KPPHEKSPP 474
           E  PP E     +PP E P P  QPP +  P + P P  QPP E     +PP E  PP
Sbjct: 244 EPQPPQEPQPPLQPPQE-PQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPP 300

 Score =  122 bits (305), Expect = 2e-26
 Identities = 69/162 (42%), Positives = 81/162 (50%), Gaps = 5/162 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-----KPPHEHSP 165
           P   +PP + PP E QPP E  PP  QPP   QP + PP + QPP E     +PP E  P
Sbjct: 154 PQEPQPPLQ-PPQEPQPPQEPQPP-LQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQP 211

Query: 166 PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP 345
           P    P   PP E QPP + PP    PP  QPP E  PP+   P  +PP E P P   PP
Sbjct: 212 PQEPQPPLQPPQEPQPPLQ-PPQEPQPP-LQPPQEPQPPQEPQPPLQPPQE-PQPPLQPP 268

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
            E  P + P P  QPP +  P   PP + QPP E  P  + P
Sbjct: 269 QEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPP 310

 Score =  120 bits (302), Expect = 4e-26
 Identities = 70/159 (44%), Positives = 83/159 (52%), Gaps = 5/159 (3%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEI 192
           +PP + PP E QPP E  PP  QPP   QP + PP + QPP + PP E  PP    P   
Sbjct: 60  QPPLQ-PPQEPQPPQEPQPP-LQPPQEPQPPLQPPQEPQPPLQ-PPQEPQPPQEPQPPLQ 116

Query: 193 PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHP 372
           PP E QPP + P   + P E QPP + PP E  PP + PP E  PP   PP E  P + P
Sbjct: 117 PPQEPQPPLQPPQEPQPPQEPQPPLQ-PPQEPQPPLQ-PPQEPQPP-LQPPQEPQPPQEP 173

Query: 373 SPEYQPPHQKPPHENPPPKFQPPNE-----KPPHEKSPP 474
            P  QPP +  P   PP + QPP E     +PP E  PP
Sbjct: 174 QPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPP 212

 Score =  117 bits (294), Expect = 3e-25
 Identities = 70/161 (43%), Positives = 78/161 (48%), Gaps = 15/161 (9%)
 Frame = +1

Query: 37  PEYQPPHE-KPPPE----YQPPHGKQPHVNPP----PQYQPPHEKPPHEHSPPGYQPPHE 189
           P  QPP E +PP E     QPP   QP + PP    P  QPP E  P +   P  QPP E
Sbjct: 61  PPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQE 120

Query: 190 IPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHE-----K 354
            P P  QPP E  P  +  P  QPP E P P   PP E  P   PP E  PP E     +
Sbjct: 121 -PQPPLQPPQEPQPPQEPQPPLQPPQE-PQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQ 178

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-KPPHEKSPP 474
           PP E P P  QPP +  P + P P  QPP E +PP E  PP
Sbjct: 179 PPQE-PQPPLQPPQEPQPPQEPQPPLQPPQEPQPPQEPQPP 218

 Score =  112 bits (281), Expect = 1e-23
 Identities = 71/173 (41%), Positives = 79/173 (45%), Gaps = 15/173 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHE-----KPPPEYQPPHGKQPHVNPPPQYQPPHE-----KPP 150
           P   +PP E P P  QPP E     +PP E QPP   QP + PP + QPP E     +PP
Sbjct: 164 PQEPQPPQE-PQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPQEPQPPLQPP 222

Query: 151 HEHSPPGYQPPHEIPPP-----EHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH 315
            E  PP  QPP E  PP     E QPP E  P  + P E QPP + PP E  PP E  P 
Sbjct: 223 QEPQPP-LQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQ-PPQEPQPPQEPQPP 280

Query: 316 ENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP E  PP + P    P  E QPP Q P  E      Q        E  PP
Sbjct: 281 LQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQLEQEQTGTQQHTGLQQQEPQPP 333

 Score =  107 bits (266), Expect = 5e-22
 Identities = 70/181 (38%), Positives = 85/181 (46%), Gaps = 23/181 (12%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHE-----KPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           P   +PP + PP E QPP E     +PP E QPP   QP + PP + QPP + PP E  P
Sbjct: 180 PQEPQPPLQ-PPQEPQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQ-PPQEPQP 237

Query: 166 PGYQPPHEIPPPEH-----QPPHEKPPHAKSPPEYQPPHE-----HPPPEYLPPHEKPPH 315
           P  QPP E  PP+      QPP E  P  + P E QPP E      PP E  PP + P  
Sbjct: 238 P-LQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQE 296

Query: 316 ENPPPEYNPPHEKP--------PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             PP E  PP + P          +H   + Q P Q P  E  PP+ +P  + P  E  P
Sbjct: 297 PQPPQEPQPPLQPPQLEQEQTGTQQHTGLQQQEP-QPPQLEPQPPQLEP--QPPQLEPQP 353

Query: 472 P 474
           P
Sbjct: 354 P 354

 Score =  101 bits (252), Expect = 2e-20
 Identities = 70/186 (37%), Positives = 80/186 (43%), Gaps = 35/186 (18%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPPHEHSPP 168
           P   +PP + PP E QPP E  PP  QPP   QP + PP    P  QPP E  P +   P
Sbjct: 196 PQEPQPPLQ-PPQEPQPPQEPQPP-LQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQEPQP 253

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP------ 330
             QPP E P P  QPP E  P  +  P  QPP E  PP   P   +PP E  PP      
Sbjct: 254 PLQPPQE-PQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQL 312

Query: 331 ----------------EYNPPH--EKPPHEHPSP---EYQPPH---QKPPHENPPPKFQP 438
                           E  PP    +PP   P P   E QPP    Q P  E  PP+ +P
Sbjct: 313 EQEQTGTQQHTGLQQQEPQPPQLEPQPPQLEPQPPQLEPQPPQLEPQPPQLEPQPPQLEP 372

Query: 439 -PNEKP 453
            P E+P
Sbjct: 373 QPPEQP 378

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/117 (40%), Positives = 52/117 (44%), Gaps = 11/117 (9%)
 Frame = +1

Query: 157 HSPPGYQPPHEI-PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPE 333
           HSP      H     P  QPP E  P  +  P  QPP E P P   PP E  P   PP E
Sbjct: 46  HSPQSSNSLHSSWTQPPLQPPQEPQPPQEPQPPLQPPQE-PQPPLQPPQEPQPPLQPPQE 104

Query: 334 YNPPHE-----KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-----KPPHEKSPP 474
             PP E     +PP E P P  QPP +  P + P P  QPP E     +PP E  PP
Sbjct: 105 PQPPQEPQPPLQPPQE-PQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPP 160

[39][TOP]
>UniRef100_UPI0000DA1AD6 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA1AD6
          Length = 438

 Score =  130 bits (328), Expect = 3e-29
 Identities = 74/168 (44%), Positives = 84/168 (50%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-----KPPHEHSP 165
           P   +PP + PP E QPP E P P  QPP   QP + PP + QPP E     +PP E  P
Sbjct: 143 PQEPQPPLQ-PPQEPQPPQE-PQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQP 200

Query: 166 PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP 345
           P  QPP E P P  QPP E  P  +  P  QPP E P P   PP E  P + P P   PP
Sbjct: 201 P-LQPPQE-PQPPLQPPQEPQPPQEPQPPLQPPQE-PQPPLQPPQEPQPPQEPQPPLQPP 257

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPP----PKFQPPNE-KPPHEKSPP 474
            E  P + P P  QPP +  P   PP    P  QPP E +PP E  PP
Sbjct: 258 QEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQEPQPP 305

 Score =  129 bits (324), Expect = 1e-28
 Identities = 75/177 (42%), Positives = 86/177 (48%), Gaps = 19/177 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-----KPPHEHSP 165
           P   +PP E P P  QPP E  PP  QPP   QP + PP + QPP E     +PP E  P
Sbjct: 117 PQEPQPPQE-PQPPLQPPQEPQPP-LQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQP 174

Query: 166 PGYQPPHEIPPPEH-----QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPP- 327
           P  QPP E  PP+      QPP E  P  + P E QPP + PP E  PP E  P   PP 
Sbjct: 175 P-LQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPLQ-PPQEPQPPQEPQPPLQPPQ 232

Query: 328 ---PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-----KPPHEKSPP 474
              P   PP E  P + P P  QPP +  P + P P  QPP E     +PP E  PP
Sbjct: 233 EPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPP 289

 Score =  129 bits (323), Expect = 1e-28
 Identities = 76/178 (42%), Positives = 88/178 (49%), Gaps = 20/178 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHE-----KPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           P   +PP E P P  QPP E     +PP E QPP   QP + PP + QPP + PP E  P
Sbjct: 153 PQEPQPPQE-PQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQ-PPQEPQP 210

Query: 166 PGYQPPHEIPPPEH-----QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP 330
           P  QPP E  PP+      QPP E  P  + P E QPP E P P   PP E  P + P P
Sbjct: 211 P-LQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQE-PQPPLQPPQEPQPPQEPQP 268

Query: 331 EYNPPHE-----KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-----KPPHEKSPP 474
              PP E     +PP E P P  QPP +  P + P P  QPP E     +PP E  PP
Sbjct: 269 PLQPPQEPQPPLQPPQE-PQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPP 325

 Score =  127 bits (320), Expect = 3e-28
 Identities = 76/178 (42%), Positives = 86/178 (48%), Gaps = 20/178 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-----KPPHEHSP 165
           P   +PP E P P  QPP E  PP  QPP   QP + PP + QPP E     +PP E  P
Sbjct: 179 PQEPQPPQE-PQPPLQPPQEPQPP-LQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQP 236

Query: 166 PGYQPPHEIPPPEH-----QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP 330
           P  QPP E  PP+      QPP E  P  +  P  QPP E P P   PP E  P   PP 
Sbjct: 237 P-LQPPQEPQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQE-PQPPLQPPQEPQPPLQPPQ 294

Query: 331 EYNPPHE-----KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-----KPPHEKSPP 474
           E  PP E     +PP E P P  QPP +  P + P P  QPP E     +PP E  PP
Sbjct: 295 EPQPPQEPQPPLQPPQE-PQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPP 351

 Score =  124 bits (312), Expect = 2e-27
 Identities = 72/169 (42%), Positives = 84/169 (49%), Gaps = 16/169 (9%)
 Frame = +1

Query: 16  PPYENPPPEYQP-PHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-----KPPHEHSPPGYQ 177
           P  E  PP+ +P P E+P  E QPP   QP + PP + QPP E     +PP E  PP  Q
Sbjct: 83  PQLEPQPPQLEPQPPEQPQQEPQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPP-LQ 141

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHE-- 351
           PP E P P  QPP E  P  +  P  QPP E P P   PP E  P + P P   PP E  
Sbjct: 142 PPQE-PQPPLQPPQEPQPPQEPQPPLQPPQE-PQPPLQPPQEPQPPQEPQPPLQPPQEPQ 199

Query: 352 ---KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-----KPPHEKSPP 474
              +PP E P P  QPP +  P + P P  QPP E     +PP E  PP
Sbjct: 200 PPLQPPQE-PQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPP 247

 Score =  124 bits (310), Expect = 4e-27
 Identities = 73/173 (42%), Positives = 82/173 (47%), Gaps = 15/173 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHE-KPPPE----YQPPHGKQPHVNPP----PQYQPPHEKPPH 153
           P     P + P P  QPP E +PP E     QPP   QP + PP    P  QPP E  P 
Sbjct: 100 PQQEPQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPLQPPQEPQPP 159

Query: 154 EHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPE 333
           +   P  QPP E P P  QPP E  P  +  P  QPP E P P   PP E  P   PP E
Sbjct: 160 QEPQPPLQPPQE-PQPPLQPPQEPQPPQEPQPPLQPPQE-PQPPLQPPQEPQPPLQPPQE 217

Query: 334 YNPPHE-----KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-KPPHEKSPP 474
             PP E     +PP E P P  QPP +  P + P P  QPP E +PP E  PP
Sbjct: 218 PQPPQEPQPPLQPPQE-PQPPLQPPQEPQPPQEPQPPLQPPQEPQPPQEPQPP 269

 Score =  123 bits (309), Expect = 6e-27
 Identities = 72/176 (40%), Positives = 81/176 (46%), Gaps = 18/176 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-----KPPHEHSP 165
           P     P E P  E QPP E  PP  QPP   QP   P P  QPP E     +PP E  P
Sbjct: 90  PQLEPQPPEQPQQEPQPPQEPQPP-LQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQP 148

Query: 166 PGYQPPHEIPPPEH-----QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP---PHEN 321
           P  QPP E  PP+      QPP E  P  + P E QPP E  PP   P   +P   P + 
Sbjct: 149 P-LQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQE 207

Query: 322 PPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-----KPPHEKSPP 474
           P P   PP E  P + P P  QPP +  P   PP + QPP E     +PP E  PP
Sbjct: 208 PQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPP 263

 Score =  122 bits (305), Expect = 2e-26
 Identities = 69/162 (42%), Positives = 81/162 (50%), Gaps = 5/162 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-----KPPHEHSP 165
           P   +PP + PP E QPP E  PP  QPP   QP + PP + QPP E     +PP E  P
Sbjct: 205 PQEPQPPLQ-PPQEPQPPQEPQPP-LQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQP 262

Query: 166 PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP 345
           P    P   PP E QPP + PP    PP  QPP E  PP+   P  +PP E P P   PP
Sbjct: 263 PQEPQPPLQPPQEPQPPLQ-PPQEPQPP-LQPPQEPQPPQEPQPPLQPPQE-PQPPLQPP 319

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
            E  P + P P  QPP +  P   PP + QPP E  P  + P
Sbjct: 320 QEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPP 361

 Score =  120 bits (302), Expect = 4e-26
 Identities = 67/151 (44%), Positives = 74/151 (49%), Gaps = 1/151 (0%)
 Frame = +1

Query: 25  ENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPE 204
           ++P  E QPP  +P P  QP    QP   P P  QPP E  P +   P  QPP E P P 
Sbjct: 81  QSPQLEPQPPQLEPQPPEQPQQEPQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQE-PQPP 139

Query: 205 HQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEY 384
            QPP E  P  + P E QPP E P P   PP E  P   PP E  PP E  P   P  E 
Sbjct: 140 LQPPQEPQPPLQPPQEPQPPQE-PQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEP 198

Query: 385 QPPHQKPPHENPPPKFQPPNE-KPPHEKSPP 474
           QPP Q P  + P P  QPP E +PP E  PP
Sbjct: 199 QPPLQPP--QEPQPPLQPPQEPQPPQEPQPP 227

 Score =  112 bits (281), Expect = 1e-23
 Identities = 71/173 (41%), Positives = 79/173 (45%), Gaps = 15/173 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHE-----KPPPEYQPPHGKQPHVNPPPQYQPPHE-----KPP 150
           P   +PP E P P  QPP E     +PP E QPP   QP + PP + QPP E     +PP
Sbjct: 215 PQEPQPPQE-PQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPQEPQPPLQPP 273

Query: 151 HEHSPPGYQPPHEIPPP-----EHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH 315
            E  PP  QPP E  PP     E QPP E  P  + P E QPP + PP E  PP E  P 
Sbjct: 274 QEPQPP-LQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQ-PPQEPQPPQEPQPP 331

Query: 316 ENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP E  PP + P    P  E QPP Q P  E      Q        E  PP
Sbjct: 332 LQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQLEQEQTGTQQHTGLQQQEPQPP 384

 Score =  110 bits (275), Expect = 5e-23
 Identities = 65/162 (40%), Positives = 80/162 (49%), Gaps = 9/162 (5%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPP--HGKQPHVNP-PPQYQP-PHEKPPHEHSPPGYQPP 183
           P  E  PP+ +P  + P  E QPP    + P + P PPQ +P P E+P  E  PP    P
Sbjct: 55  PQLEPQPPQLEP--QSPQLEPQPPQLEPQSPQLEPQPPQLEPQPPEQPQQEPQPPQEPQP 112

Query: 184 HEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPH 363
              PP E QPP E  P  + P E QPP + PP E  PP + P    PP E  PP + P  
Sbjct: 113 PLQPPQEPQPPQEPQPPLQPPQEPQPPLQ-PPQEPQPPLQPPQEPQPPQEPQPPLQPP-- 169

Query: 364 EHPSPEYQPPHQKPPHENPPPKFQPPNE-----KPPHEKSPP 474
           + P P  QPP +  P + P P  QPP E     +PP E  PP
Sbjct: 170 QEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPP 211

 Score =  107 bits (266), Expect = 5e-22
 Identities = 70/181 (38%), Positives = 85/181 (46%), Gaps = 23/181 (12%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHE-----KPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           P   +PP + PP E QPP E     +PP E QPP   QP + PP + QPP + PP E  P
Sbjct: 231 PQEPQPPLQ-PPQEPQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQ-PPQEPQP 288

Query: 166 PGYQPPHEIPPPEH-----QPPHEKPPHAKSPPEYQPPHE-----HPPPEYLPPHEKPPH 315
           P  QPP E  PP+      QPP E  P  + P E QPP E      PP E  PP + P  
Sbjct: 289 P-LQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQE 347

Query: 316 ENPPPEYNPPHEKP--------PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             PP E  PP + P          +H   + Q P Q P  E  PP+ +P  + P  E  P
Sbjct: 348 PQPPQEPQPPLQPPQLEQEQTGTQQHTGLQQQEP-QPPQLEPQPPQLEP--QPPQLEPQP 404

Query: 472 P 474
           P
Sbjct: 405 P 405

 Score =  105 bits (263), Expect = 1e-21
 Identities = 68/163 (41%), Positives = 80/163 (49%), Gaps = 6/163 (3%)
 Frame = +1

Query: 4   HHAKPPYENPPP--EYQPPHEKP-PPEYQPPHGKQPHVNP-PPQYQPPHEKPPHEHSPPG 171
           H      E  PP  E QPP  +P PP+ +P   + P + P PPQ +P  + P  E  PP 
Sbjct: 37  HTGLQQQEPQPPQLEPQPPQLEPQPPQLEP---QSPQLEPQPPQLEP--QSPQLEPQPPQ 91

Query: 172 YQP-PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
            +P P E P  E QPP E  P  + P E QPP E P P   PP E  P   PP E  PP 
Sbjct: 92  LEPQPPEQPQQEPQPPQEPQPPLQPPQEPQPPQE-PQPPLQPPQEPQPPLQPPQEPQPPL 150

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-KPPHEKSPP 474
           + P    P  E QPP Q P  + P P  QPP E +PP E  PP
Sbjct: 151 QPPQEPQPPQEPQPPLQPP--QEPQPPLQPPQEPQPPQEPQPP 191

 Score =  101 bits (252), Expect = 2e-20
 Identities = 70/186 (37%), Positives = 80/186 (43%), Gaps = 35/186 (18%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPPHEHSPP 168
           P   +PP + PP E QPP E  PP  QPP   QP + PP    P  QPP E  P +   P
Sbjct: 247 PQEPQPPLQ-PPQEPQPPQEPQPP-LQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQEPQP 304

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP------ 330
             QPP E P P  QPP E  P  +  P  QPP E  PP   P   +PP E  PP      
Sbjct: 305 PLQPPQE-PQPPLQPPQEPQPPQEPQPPLQPPQEPQPPLQPPQEPQPPQEPQPPLQPPQL 363

Query: 331 ----------------EYNPPH--EKPPHEHPSP---EYQPPH---QKPPHENPPPKFQP 438
                           E  PP    +PP   P P   E QPP    Q P  E  PP+ +P
Sbjct: 364 EQEQTGTQQHTGLQQQEPQPPQLEPQPPQLEPQPPQLEPQPPQLEPQPPQLEPQPPQLEP 423

Query: 439 -PNEKP 453
            P E+P
Sbjct: 424 QPPEQP 429

[40][TOP]
>UniRef100_Q39835 Extensin n=1 Tax=Glycine max RepID=Q39835_SOYBN
          Length = 432

 Score =  130 bits (328), Expect = 3e-29
 Identities = 66/168 (39%), Positives = 85/168 (50%), Gaps = 15/168 (8%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPP-----HEKPPHEHSPPGYQP 180
           PP  +PPP Y   H  PPP++ PP     H  PPP++ PP     H  PP +HSPP    
Sbjct: 37  PPKHSPPPPYYY-HSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYY 95

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHEKPPHENPPPEYNPP 345
            H  PPP+H PP     H+  PP++ PP     H  PPP++ PP     H  PPP+++PP
Sbjct: 96  YHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP 155

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP-----NEKPPHEKSPP 474
                H  P P++ PP     H  PPPK  PP     +  PP + SPP
Sbjct: 156 PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP 203

 Score =  129 bits (324), Expect = 1e-28
 Identities = 72/183 (39%), Positives = 92/183 (50%), Gaps = 25/183 (13%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----H 138
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H  PPP++ PP     H
Sbjct: 38  PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 97

Query: 139 EKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHE 303
             PP +HSPP     H  PPP+H PP     H+  PP++ PP     H  PPP++ PP  
Sbjct: 98  SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP-- 155

Query: 304 KPPH--ENPPPEYNPPHEKPP----HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEK 465
            PP+   +PPP   P H  PP    H  P P++ PP     H  PPPK  PP   P + K
Sbjct: 156 -PPYYYHSPPP---PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP--PPYYYK 209

Query: 466 SPP 474
           SPP
Sbjct: 210 SPP 212

 Score =  126 bits (316), Expect = 9e-28
 Identities = 72/186 (38%), Positives = 92/186 (49%), Gaps = 29/186 (15%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----H 138
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H  PPP++ PP     H
Sbjct: 70  PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 129

Query: 139 EKPPHEHSPPGYQPPHEIPPPEHQPP-----HEKPP--HAKSPPEYQ-----PPHEHPPP 282
             PP +HSPP     H  PPP+H PP     H  PP  H+  PP Y      P H  PPP
Sbjct: 130 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPP 189

Query: 283 EYLPPHEKPPHENPPPEY---NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKP 453
            Y      P H  PPP Y    PP  K P+++PSP   PP  K  +++PPP ++ P+  P
Sbjct: 190 YYYHSPPPPKHSPPPPYYYKSPPPPPKKPYKYPSP--PPPVYK--YKSPPPPYKYPSPPP 245

Query: 454 PHEKSP 471
           P  K P
Sbjct: 246 PPYKYP 251

 Score =  121 bits (304), Expect = 2e-26
 Identities = 64/166 (38%), Positives = 81/166 (48%), Gaps = 15/166 (9%)
 Frame = +1

Query: 22  YENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPP-----HEKPPHEHSPPGYQPPH 186
           Y +PPP   P H  PPP Y        H  PPP++ PP     H  PP +HSPP     H
Sbjct: 32  YSSPPP---PKHSPPPPYYY-------HSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 81

Query: 187 EIPPPEHQPPHEKPPHAKSPPEYQPP-----HEHPPPEYLPPHEKPPHENPPPEYNPPHE 351
             PPP+H PP     H+  PP++ PP     H  PPP++ PP     H  PPP+++PP  
Sbjct: 82  SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPP 141

Query: 352 KPPHEHPSPEYQPPHQKPPHENPPPKFQPP-----NEKPPHEKSPP 474
              H  P P++ PP     H  PPPK  PP     +  PP + SPP
Sbjct: 142 YYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP 187

 Score =  120 bits (300), Expect = 6e-26
 Identities = 69/191 (36%), Positives = 98/191 (51%), Gaps = 34/191 (17%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----H 138
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H  PPP++ PP     H
Sbjct: 102 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 161

Query: 139 EKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPP----HEHPPP----EYLP 294
             PP +HSPP     H  PPP+H PP     H+  PP++ PP    ++ PPP     Y  
Sbjct: 162 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYKSPPPPPKKPYKY 221

Query: 295 PHEKPP---HENPPPEYN-PPHEKPPHEHPSPEYQPP---HQKPP-----HENPPPKFQP 438
           P   PP   +++PPP Y  P    PP+++PSP   PP   ++ PP     +++PPP ++ 
Sbjct: 222 PSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSP--PPPVYKYKSPPPPVYKYKSPPPPYKY 279

Query: 439 PNEKPPHEKSP 471
           P+  PP  K P
Sbjct: 280 PSPPPPPYKYP 290

 Score =  112 bits (279), Expect = 2e-23
 Identities = 69/199 (34%), Positives = 90/199 (45%), Gaps = 41/199 (20%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----H 138
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H  PPP++ PP     H
Sbjct: 118 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 177

Query: 139 EKPPHEHSPPGYQPPHEIPPPEHQPP-----HEKPPHAKSPPEYQPP------HEHPPPE 285
             PP +HSPP     H  PPP+H PP        PP  K P +Y  P      ++ PPP 
Sbjct: 178 SPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPP 237

Query: 286 YLPPHEKPP--------------HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP 423
           Y  P   PP                 PPP Y      PP+++PSP   PP++ P    PP
Sbjct: 238 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPP-PPPYKYP--SPPP 294

Query: 424 PKFQPPNEKPP--HEKSPP 474
           P ++  +  PP    KSPP
Sbjct: 295 PVYKYKSPPPPVYKYKSPP 313

 Score =  108 bits (271), Expect = 1e-22
 Identities = 68/201 (33%), Positives = 97/201 (48%), Gaps = 44/201 (21%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP-----H 138
           P H+ PP    +  PPP++ PP     H  PPP++ PP     H  PPP++ PP     H
Sbjct: 134 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYH 193

Query: 139 EKPPHEHSPPGYQPP--HEIPPPEHQPPHEKPPHAKSPPEYQ-----PPHEH---PPPEY 288
             PP +HSPP   PP  ++ PPP  + P++ P  +  PP Y+     PP+++   PPP Y
Sbjct: 194 SPPPPKHSPP---PPYYYKSPPPPPKKPYKYP--SPPPPVYKYKSPPPPYKYPSPPPPPY 248

Query: 289 LPPHEKPP----HENPPPEYNPPHEKPPHEHPS---PEYQPPHQKPP------------- 408
             P   PP       PPP Y      PP+++PS   P Y+ P   PP             
Sbjct: 249 KYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 308

Query: 409 HENPPPKFQPPNEKPPHEKSP 471
           +++PPP ++ P+  PP  K P
Sbjct: 309 YKSPPPPYKYPSPPPPPYKYP 329

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 68/204 (33%), Positives = 96/204 (47%), Gaps = 47/204 (23%)
 Frame = +1

Query: 1   PHHAKPP---YENPPPEYQPPHE---KPPPEYQ----PPHGKQPHVNPPPQYQPPHEKPP 150
           P H+ PP   Y++PPP  + P++    PPP Y+    PP  K P   PPP Y+ P   PP
Sbjct: 198 PKHSPPPPYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSP-PPPPYKYPSPPPP 256

Query: 151 -------------HEHSPPGYQ------PPHEIP-PPEHQPPHEKPP----HAKSPPEYQ 258
                        ++  PP Y+      PP++ P PP     ++ PP      KSPP   
Sbjct: 257 VYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPP--- 313

Query: 259 PPHEH---PPPEYLPPHEKPP----HENPPPEYNPPHEKPPHEHPS---PEYQPPHQKPP 408
           PP+++   PPP Y  P   PP       PPP Y      PP+++PS   P Y+ P   PP
Sbjct: 314 PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPP 373

Query: 409 ---HENPPPKFQPPNEKPPHEKSP 471
              +++PPP ++ P+  PP  K P
Sbjct: 374 VYKYKSPPPPYKYPSPPPPPYKYP 397

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 61/169 (36%), Positives = 76/169 (44%), Gaps = 18/169 (10%)
 Frame = +1

Query: 22  YENPPPEYQPPHEKPPP-EYQPPHGKQPHVNPPPQYQPPHEKPP---HEHSPPGYQPPHE 189
           Y++PPP Y+ P   PPP +Y  P        PPP Y+     PP   ++  PP Y+ P  
Sbjct: 270 YKSPPPPYKYPSPPPPPYKYPSP--------PPPVYKYKSPPPPVYKYKSPPPPYKYPSP 321

Query: 190 IPPPEHQPPHEKPPHA-KSPPEYQPPHEHPPPEYLPPHEKPPHEN----PPPEYNPPHEK 354
            PPP   P    P +  KSPP     ++ PPP Y  P   PP       PPP Y      
Sbjct: 322 PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 381

Query: 355 PPHEHPSPE---YQPPHQKPP----HENPPPKFQPPNEKPPH--EKSPP 474
           PP+++PSP    Y+ P   PP       PPP   PP   PPH    SPP
Sbjct: 382 PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVHSPP---PPHYIYASPP 427

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 56/163 (34%), Positives = 74/163 (45%), Gaps = 10/163 (6%)
 Frame = +1

Query: 1   PHHAKPPYE--NPPPEYQPPHEKPPPEYQ----PPHGKQPHVNPPPQYQPPHEKPPHEH- 159
           P    PPY+  +PPP        PPP Y+    PP  K P   PPP   P    P +++ 
Sbjct: 280 PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYK 339

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAK--SPPEYQPPHEHPPPEYLPPHEKPPHENPPPE 333
           SPP     ++ PPP ++ P   PP  K  SPP     ++ PPP Y  P        PPP 
Sbjct: 340 SPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYP------SPPPPP 393

Query: 334 YNPPHEKPP-HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPH 459
           Y  P   PP +++ SP   PP   P H  PPP +   +  PP+
Sbjct: 394 YKYPSPPPPVYKYKSP---PP---PVHSPPPPHYIYASPPPPY 430

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 46/135 (34%), Positives = 60/135 (44%), Gaps = 19/135 (14%)
 Frame = +1

Query: 22  YENPPPEYQPPHEKPPP-EYQPPHGKQPHVNPPPQYQPPHEKPP---HEHSPPGYQPPHE 189
           Y++PPP Y+ P   PPP +Y  P        PPP Y+     PP   ++  PP Y+ P  
Sbjct: 309 YKSPPPPYKYPSPPPPPYKYPSP--------PPPVYKYKSPPPPVYKYKSPPPPYKYPSP 360

Query: 190 IPPPEHQPPHEKPPHA-KSPPEYQPPHEHP---PPEYLPPHEKPP-----------HENP 324
            PPP   P    P +  KSPP   PP+++P   PP Y  P   PP           H  P
Sbjct: 361 PPPPYKYPSPPPPVYKYKSPP---PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVHSPP 417

Query: 325 PPEYNPPHEKPPHEH 369
           PP Y      PP+ +
Sbjct: 418 PPHYIYASPPPPYHY 432

[41][TOP]
>UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis
            thaliana RepID=Q9XIL9_ARATH
          Length = 727

 Score =  130 bits (326), Expect = 6e-29
 Identities = 77/185 (41%), Positives = 86/185 (46%), Gaps = 27/185 (14%)
 Frame = +1

Query: 1    PHHAKPPYEN-----PPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
            P H+ PP        PPP Y PP   PPP Y PP        PPP Y PP   P H   P
Sbjct: 497  PVHSPPPPSPIHSPPPPPVYSPP--PPPPVYSPPP-------PPPVYSPPPPPPVHSPPP 547

Query: 166  PGYQPP---HEIPPPEHQPP---HEKPP--HAKSPPEYQPP----HEHPPPEYLPPHEKP 309
            P + PP   H  PPP H PP   H  PP  H+  PP Y PP    H  PPP + PP   P
Sbjct: 548  PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPP--PP 605

Query: 310  PHENPPPEYNPPHEKPPHEHPSPEYQPP---HQKPP--HENPPPKFQPP-----NEKPPH 459
             H  PPP Y+PP   P H  P P + PP   H  PP  +  PPP + PP     +  PP 
Sbjct: 606  VHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPP 665

Query: 460  EKSPP 474
              SPP
Sbjct: 666  VYSPP 670

 Score =  124 bits (312), Expect = 2e-27
 Identities = 77/175 (44%), Positives = 85/175 (48%), Gaps = 17/175 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPP---HEKPPHE 156
           P ++ PP   PPP Y PP     H  PPP + PP     H  PPP + PP   H  PP  
Sbjct: 523 PVYSPPP---PPPVYSPPPPPPVHSPPPPVHSPP--PPVHSPPPPVHSPPPPVHSPPPPV 577

Query: 157 HSPPG--YQPP----HEIPPPEHQPP---HEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP 309
           HSPP   Y PP    H  PPP H PP   H  PP   SPP   P H  PPP + PP   P
Sbjct: 578 HSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPP--PP 635

Query: 310 PHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            H  PPP Y+PP   PP   P P   PP + PP   PPP + PP   PP   SPP
Sbjct: 636 VHSPPPPVYSPP---PPVYSPPP---PPVKSPP---PPPVYSPP-LLPPKMSSPP 680

 Score =  118 bits (296), Expect = 2e-25
 Identities = 73/173 (42%), Positives = 84/173 (48%), Gaps = 13/173 (7%)
 Frame = +1

Query: 1    PHHAKPP--YENPPPEYQPP---HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
            P H+ PP  +  PPP + PP   H  PPP + PP    P  +PPP   P H  PP  HSP
Sbjct: 548  PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP---PPVYSPPP--PPVHSPPPPVHSP 602

Query: 166  PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPP---HEHPPPEYLPPHEKPPHENPPPEY 336
            P   P H  PPP + PP   P H+  PP + PP   H  PPP Y PP   PP  +PPP  
Sbjct: 603  P--PPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPP---PPVYSPPP-- 655

Query: 337  NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKS-----PPAS 480
             PP + PP   P P Y PP   PP  + PP   P N  PP   S     PP S
Sbjct: 656  -PPVKSPP---PPPVYSPP-LLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPS 703

 Score =  111 bits (277), Expect = 3e-23
 Identities = 71/192 (36%), Positives = 83/192 (43%), Gaps = 34/192 (17%)
 Frame = +1

Query: 1    PHHA---KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEK----PPHE 156
            PHH     PP  + PP   P H  P P ++P P  + P  N P    P   +    PP  
Sbjct: 439  PHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPV 498

Query: 157  HSPPGYQPPHEIPPPE-HQPPHEKPPHAKSPPE--YQPP-----HEHPPPEYLPP---HE 303
            HSPP   P H  PPP  + PP   P ++  PP   Y PP     H  PPP + PP   H 
Sbjct: 499  HSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHS 558

Query: 304  KPP--HENPPPEYNPPHEKPPHEHPSPEYQPP----HQKPP---------HENPPPKFQP 438
             PP  H  PPP ++PP   P H  P P Y PP    H  PP         H  PPP + P
Sbjct: 559  PPPPVHSPPPPVHSPP--PPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSP 616

Query: 439  PNEKPPHEKSPP 474
            P   P H   PP
Sbjct: 617  PPPPPVHSPPPP 628

 Score =  110 bits (275), Expect = 5e-23
 Identities = 71/173 (41%), Positives = 83/173 (47%), Gaps = 24/173 (13%)
 Frame = +1

Query: 28  NPPPEYQPPHE---KPPPEYQPPHGKQPHVNPPPQY--QPPHEKP----PHEHSPPGYQ- 177
           +PPP  QP H     PPP   PP     H  P P +  QPP E P    P++ SP  ++ 
Sbjct: 432 SPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRR 491

Query: 178 -PPHEIPPPEHQPPHEKPPHAKSPPE-YQPPHEHPPPEYLPPHEKPPHENPPPE--YNPP 345
            PP   PPP H PP   P H+  PP  Y PP   PPP Y PP   P +  PPP   ++PP
Sbjct: 492 SPP---PPPVHSPPPPSPIHSPPPPPVYSPPP--PPPVYSPPPPPPVYSPPPPPPVHSPP 546

Query: 346 ---HEKPP--HEHPSPEYQPP---HQKPP--HENPPPKFQPPNEKPPHEKSPP 474
              H  PP  H  P P + PP   H  PP  H  PPP + PP   PP   SPP
Sbjct: 547 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPP---PPPVHSPP 596

 Score =  110 bits (275), Expect = 5e-23
 Identities = 66/173 (38%), Positives = 76/173 (43%), Gaps = 19/173 (10%)
 Frame = +1

Query: 4    HHAKPPYENPPPEYQPPHEKPPPEYQPP---HGKQP--HVNPPPQYQPP----HEKPPHE 156
            H   PP  +PPP   P H  PPP + PP   H   P  H  PPP Y PP    H  PP  
Sbjct: 543  HSPPPPVHSPPP---PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPV 599

Query: 157  HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPP----------HEHPPPEYLPPHEK 306
            HSPP   P H  PPP + PP   P H+  PP + PP          +  PPP Y PP   
Sbjct: 600  HSPP--PPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657

Query: 307  PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEK 465
                 PPP Y+PP    P +  SP  Q P   PP   P    + P   PP E+
Sbjct: 658  VKSPPPPPVYSPP--LLPPKMSSPPTQTPVNSPPPRTPSQTVEAP---PPSEE 705

 Score =  102 bits (255), Expect = 1e-20
 Identities = 66/177 (37%), Positives = 80/177 (45%), Gaps = 25/177 (14%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPPPEYQPPHGKQPHV--------NPPPQYQPPHE---KPPHEHSP 165
           P ++P P    P  KP P  + P    P+         +PPP  QP H     PP   SP
Sbjct: 394 PSKSPSPVPTRPVHKPQPPKESPQPNDPYNQSPVKFRRSPPPPQQPHHHVVHSPPPASSP 453

Query: 166 PGYQPPHEIPPPEH--QPPHEKP----PHAKSPPEYQ--PPHEHPPPEYLPPHEKPPHEN 321
           P   P H  P P H  QPP E P    P+ +SP +++  PP   PPP + PP   P H  
Sbjct: 454 PTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPP---PPPVHSPPPPSPIHSP 510

Query: 322 PPP-EYNPPHEKPPHEHPSPE--YQPPHQKPPHENPPPKFQPP---NEKPPHEKSPP 474
           PPP  Y+PP   P +  P P   Y PP   P H  PPP   PP   +  PP   SPP
Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 567

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 68/174 (39%), Positives = 77/174 (44%), Gaps = 29/174 (16%)
 Frame = +1

Query: 1    PHHAKPP--YENPPPEYQPP---HEKPPPEYQPPHGKQPHVNPPPQYQPP---HEKPPHE 156
            P H+ PP  +  PPP + PP   H  PPP Y PP     H  PPP + PP   H  PP  
Sbjct: 555  PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPP-PPVHSPPPPVHSPPPPVHSPPPPV 613

Query: 157  HSPPGYQPPHEIPPPEHQPP---HEKPPHAKSPPE--YQPP-----HEHPPPEYLPPHEK 306
            +SPP   P H  PPP   PP   H  PP   SPP   Y PP        PPP Y PP   
Sbjct: 614  YSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLP 673

Query: 307  PPHENPPPEYNPPHEKPPHEHPSP--EYQPPHQK---PPH------ENPPPKFQ 435
            P   +PP +   P   PP   PS   E  PP ++   PP         PPP FQ
Sbjct: 674  PKMSSPPTQ--TPVNSPPPRTPSQTVEAPPPSEEFIIPPFIGHQYASPPPPMFQ 725

[42][TOP]
>UniRef100_Q6VEQ6 Putative ripening-induced protein 1 n=1 Tax=Vitis vinifera
           RepID=Q6VEQ6_VITVI
          Length = 268

 Score =  129 bits (324), Expect = 1e-28
 Identities = 83/192 (43%), Positives = 105/192 (54%), Gaps = 34/192 (17%)
 Frame = +1

Query: 4   HHAKPP-YENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPP--------HEKPPHE 156
           H+ KPP ++ PPPE++PP EKP PE++PP        P P+++PP         EKPP E
Sbjct: 24  HYPKPPPFQKPPPEHKPPGEKPSPEHKPPTKPPKGEKPLPEHKPPTPIGKPPKGEKPPPE 83

Query: 157 HSPP---GYQPPHEIPPPEHQPPHE--KPPHA-KSPPEYQPP--------HEHPPPEYLP 294
           H PP   G  P  + P PEH+PP    KPP   K PPE++PP         E P PE+ P
Sbjct: 84  HKPPTPIGKPPKGKKPLPEHKPPTPIGKPPKGEKPPPEHKPPTPIGKPPKGEKPLPEHKP 143

Query: 295 PHE--KPPH-ENPPPEYNPPH--EKPPH-EHPSPEYQPPHQ--KPPH-ENPPPKFQPPNE 447
           P    KPP  E PPPE+ PP    KPP  E P PE++PP    KP   E P P+ +PP  
Sbjct: 144 PTPIGKPPKGEKPPPEHKPPTPISKPPKGEKPLPEHKPPTPIGKPTKGEKPLPEHKPPTP 203

Query: 448 --KPPHEKSPPA 477
             KPP  + PP+
Sbjct: 204 IGKPPKGEKPPS 215

 Score =  122 bits (305), Expect = 2e-26
 Identities = 88/199 (44%), Positives = 104/199 (52%), Gaps = 41/199 (20%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPP-----HEKPPPEYQPPH--GKQPH-VNPPPQYQPP------- 135
           P H KPP E P PE++PP      EKP PE++PP   GK P    PPP+++PP       
Sbjct: 36  PEH-KPPGEKPSPEHKPPTKPPKGEKPLPEHKPPTPIGKPPKGEKPPPEHKPPTPIGKPP 94

Query: 136 -HEKPPHEHSPP---GYQPPHEIPPPEHQPPHE--KPPHAKSP-PEYQPP--------HE 270
             +KP  EH PP   G  P  E PPPEH+PP    KPP  + P PE++PP         E
Sbjct: 95  KGKKPLPEHKPPTPIGKPPKGEKPPPEHKPPTPIGKPPKGEKPLPEHKPPTPIGKPPKGE 154

Query: 271 HPPPEYLPPH--EKPPH-ENPPPEYNPPHE--KPPH-EHPSPEYQPPHQ--KPPH-ENPP 423
            PPPE+ PP    KPP  E P PE+ PP    KP   E P PE++PP    KPP  E PP
Sbjct: 155 KPPPEHKPPTPISKPPKGEKPLPEHKPPTPIGKPTKGEKPLPEHKPPTPIGKPPKGEKPP 214

Query: 424 PKF--QPPNEKPPHEKSPP 474
             F   P  EKPPH    P
Sbjct: 215 SPFGKPPTGEKPPHYGHTP 233

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 67/165 (40%), Positives = 80/165 (48%), Gaps = 25/165 (15%)
 Frame = +1

Query: 13  KPPY-ENPPPEYQPPH--------EKPPPEYQPPH--GKQPH-VNPPPQYQPPH------ 138
           KPP  E PPPE++PP         EKP PE++PP   GK P    PPP+++PP       
Sbjct: 111 KPPKGEKPPPEHKPPTPIGKPPKGEKPLPEHKPPTPIGKPPKGEKPPPEHKPPTPISKPP 170

Query: 139 --EKPPHEHSPP---GYQPPHEIPPPEHQPPHE--KPPHAKSPPEYQPPHEHPPPEYLPP 297
             EKP  EH PP   G     E P PEH+PP    KPP  + PP    P   P     P 
Sbjct: 171 KGEKPLPEHKPPTPIGKPTKGEKPLPEHKPPTPIGKPPKGEKPPS---PFGKP-----PT 222

Query: 298 HEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKF 432
            EKPPH    P + P H   P +   P   PPH KPPH+ P P +
Sbjct: 223 GEKPPHYGHTPGHPPAHSYKPPQKIKPPPTPPH-KPPHKPPSPTY 266

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 48/108 (44%), Positives = 58/108 (53%), Gaps = 14/108 (12%)
 Frame = +1

Query: 193 PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP--------H 348
           P   H P  + PP  K PPE++PP E P PE+ PP + P  E P PE+ PP         
Sbjct: 20  PSLAHYP--KPPPFQKPPPEHKPPGEKPSPEHKPPTKPPKGEKPLPEHKPPTPIGKPPKG 77

Query: 349 EKPPHEH--PSPEYQPPHQK---PPHENPPPKFQPP-NEKPPHEKSPP 474
           EKPP EH  P+P  +PP  K   P H+ P P  +PP  EKPP E  PP
Sbjct: 78  EKPPPEHKPPTPIGKPPKGKKPLPEHKPPTPIGKPPKGEKPPPEHKPP 125

[43][TOP]
>UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK6_CHLRE
          Length = 738

 Score =  128 bits (322), Expect = 2e-28
 Identities = 67/158 (42%), Positives = 71/158 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PP    PP    P  +PPP   PP   PP    PP   P
Sbjct: 260 PPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---P 316

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP  +PPP   PP   PP
Sbjct: 317 PPRPPPPSPPPPSPPPPPPPSPPP--PPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPP 374

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PSP   PP + PP   PPP   PP+  PP   SPP
Sbjct: 375 PPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPP 412

 Score =  127 bits (320), Expect = 3e-28
 Identities = 66/158 (41%), Positives = 69/158 (43%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   P
Sbjct: 225 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP---PPSPPPPPPPSPPPPPP 281

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP    P
Sbjct: 282 PRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---PPPRPPPPSPPPPSPPPPPPPSP 338

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PSP   PP + PP   PPP   PP+  PP    PP
Sbjct: 339 PPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPP 376

 Score =  127 bits (318), Expect = 5e-28
 Identities = 69/168 (41%), Positives = 76/168 (45%), Gaps = 7/168 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP+  PP   PP    PP   P
Sbjct: 282 PRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---PPPRPPPPSPPPPSPPPPPPPSP 338

Query: 181 P----HEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYL---PPHEKPPHENPPPEYN 339
           P       PPP   PP   PP +  PP   PP   PPP      PP  +PP  +PPP   
Sbjct: 339 PPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSP 398

Query: 340 PPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPASC 483
           PP   PP   PSP   PP + PP   PPP   PP+  PP   SPPA C
Sbjct: 399 PPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPP---SPPARC 443

 Score =  124 bits (311), Expect = 3e-27
 Identities = 66/155 (42%), Positives = 69/155 (44%), Gaps = 2/155 (1%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNP--PPQYQPPHEKPPHEHSPPGYQPPHE 189
           PP  +PPP   PP   PPP   PP    P   P  PP   PP   PP    PP   PP  
Sbjct: 190 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 249

Query: 190 IPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEH 369
            PPP   PP   PP   SPP   PP   PPP   PP   PP  +PPP   PP   PP   
Sbjct: 250 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPP--PPPPPSPPPPSPPPPSPPPPSP 307

Query: 370 PSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P P   PP   PP   PPP   PP+  PP   SPP
Sbjct: 308 PPPSPPPP---PPPRPPPPSPPPPSPPPPPPPSPP 339

 Score =  123 bits (309), Expect = 6e-27
 Identities = 66/158 (41%), Positives = 70/158 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP    PP   P
Sbjct: 200 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP 257

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP  +PPP   PP   PP
Sbjct: 258 PSPPPPPPPSPPPPPPP---SPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 314

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP+  PP    PP
Sbjct: 315 ---PPPPRPPPPSPPPPSPPPP--PPPSPPPPPSPPPP 347

 Score =  123 bits (309), Expect = 6e-27
 Identities = 67/161 (41%), Positives = 69/161 (42%), Gaps = 2/161 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   P
Sbjct: 216 PPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 273

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHE--KPPHENPPPEYNPPHEK 354
           P   PPP   PP   PP   SPP   PP   PPP   PP     PP   PPP   PP   
Sbjct: 274 PSPPPPP---PPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSP 330

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           PP   PSP   P    PP   PPP   PP   PP    PP+
Sbjct: 331 PPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPS 371

 Score =  121 bits (303), Expect = 3e-26
 Identities = 66/164 (40%), Positives = 69/164 (42%), Gaps = 4/164 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE---HSPPG 171
           P    PP  +PPP   PP   PPP   PP    P  +PPP   PP   PP      SPP 
Sbjct: 205 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP 262

Query: 172 YQPPHEIPPPEHQPPHEKPPH-AKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
             PP   PPP   PP   PP     PP   PP   PPP   PP   PP   PPP   PP 
Sbjct: 263 PPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPP 322

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
             PP   P P   P    PP   PPP  +PP   PP    PP S
Sbjct: 323 PSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPS 366

 Score =  120 bits (300), Expect = 6e-26
 Identities = 63/151 (41%), Positives = 67/151 (44%), Gaps = 2/151 (1%)
 Frame = +1

Query: 28  NPPPEYQPPHEKPPPEYQPPHGKQPHVNP--PPQYQPPHEKPPHEHSPPGYQPPHEIPPP 201
           +PPP   PP   PPP   PP    P   P  PP   PP   PP    PP   PP   PPP
Sbjct: 189 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 248

Query: 202 EHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPE 381
              PP   PP   SPP   PP   PPP   PP   PP   PPP  +PP   PP   P P 
Sbjct: 249 SPPPPSPPPP---SPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPP 305

Query: 382 YQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   PP   PPP+  PP+  PP    PP
Sbjct: 306 SPPPPSPPP--PPPPRPPPPSPPPPSPPPPP 334

 Score =  108 bits (270), Expect = 2e-22
 Identities = 59/141 (41%), Positives = 62/141 (43%), Gaps = 2/141 (1%)
 Frame = +1

Query: 64  PPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKS 243
           PPP   PP    P   PPP   PP   PP   SPP   PP   PPP   PP   PP    
Sbjct: 190 PPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPP-SPPPPSPPPPSP 245

Query: 244 PPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP 423
           PP   PP   PPP   PP   PP   PPP  +PP   PP   P P   PP   PP  +PP
Sbjct: 246 PPPSPPPPSPPPPS--PPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPP 303

Query: 424 PKFQPPNE--KPPHEKSPPAS 480
           P   PP     PP  + PP S
Sbjct: 304 PPSPPPPSPPPPPPPRPPPPS 324

 Score =  103 bits (256), Expect = 8e-21
 Identities = 54/128 (42%), Positives = 56/128 (43%)
 Frame = +1

Query: 97  QPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP 276
           Q +V  PP   PP   PP    PP   PP   PPP   PP   PP   SPP   PP   P
Sbjct: 184 QANVPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSPPPPSP 240

Query: 277 PPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPP 456
           PP   PP   PP   PPP  +PP   PP   P P   PP   PP   PPP   PP   PP
Sbjct: 241 PPPSPPPPSPPPPSPPPP--SPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPP 298

Query: 457 HEKSPPAS 480
               PP S
Sbjct: 299 PPSPPPPS 306

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 50/119 (42%), Positives = 50/119 (42%)
 Frame = +1

Query: 118 PQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPP 297
           P  Q     PP    PP   PP   PPP   PP   PP   SPP   PP   PPP   PP
Sbjct: 181 PLSQANVPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPP 237

Query: 298 HEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP   PPP   PP   PP   P P   PP   PP   PPP   PP   PP   SPP
Sbjct: 238 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP---PPRPPPPPPPSPP 293

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 31/80 (38%), Positives = 34/80 (42%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP  +PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 370 PSPPPPPPPSPPP---PPPPRPPPPSPPPPSPPPPSPPPPP--PPSPPPPPPPRPPPPSP 424

Query: 181 PHEIPPPEHQPPHEKPPHAK 240
           P   PPP   PP   P   +
Sbjct: 425 PPPSPPPPSPPPPSPPARCR 444

[44][TOP]
>UniRef100_P18165 Loricrin n=1 Tax=Mus musculus RepID=LORI_MOUSE
          Length = 486

 Score =  127 bits (320), Expect = 3e-28
 Identities = 90/181 (49%), Positives = 95/181 (52%), Gaps = 27/181 (14%)
 Frame = -3

Query: 476 AGGDFS*GGFSLGG-WNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GG----------LYS 330
           +GG  S GG S GG ++ GGG SCGG   GG+  G G SCGG S GG            S
Sbjct: 222 SGGGGSSGGSSCGGGYSGGGGSSCGGG--GGYSGGGGSSCGGGSSGGGGGGSSQQYQCQS 279

Query: 329 GGGFSCGGFSCGGRYS-GGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWGG*YPGGECS 153
            GG S GG SCGGRYS GGG SCGG YSGG    GG SCGG  SGGG S GG   GG   
Sbjct: 280 YGGGSSGGSSCGGRYSGGGGSSCGGGYSGG----GGSSCGGGSSGGGSSCGGSGGGGYSG 335

Query: 152 CGGFSCGG*YCGGGFT*GCFP*GGWYS---------------GGGFS*GGWYSGGGFSYG 18
            GG SCGG   GGG        GG+YS               GGG S GG   GGG S G
Sbjct: 336 GGGGSCGGGSSGGG--------GGYYSSQQTSQTSCAPQQSYGGGSSGGGGSCGGGSSGG 387

Query: 17  G 15
           G
Sbjct: 388 G 388

 Score =  125 bits (315), Expect = 1e-27
 Identities = 89/169 (52%), Positives = 93/169 (55%), Gaps = 16/169 (9%)
 Frame = -3

Query: 473 GGDFS*GGFSLGGWNFGGGFS-------CGGFW*GGWYSGDGCSCGGFS*GGLYSGGGFS 315
           GG  S GG S GG ++ GG S       CGG   GG YSG G   GG S GG YSGGG S
Sbjct: 171 GGGSSCGGGSGGGGSYCGGSSGGGSSGGCGGGSGGGKYSGGG---GGSSCGGGYSGGGGS 227

Query: 314 CGGFSCGGRYSGGG---CSCGGWYSGGDFA*GGFSCGGWCSGGGISWGG*YPGGEC---- 156
            GG SCGG YSGGG   C  GG YSGG    GG SCGG  SGGG   GG     +C    
Sbjct: 228 SGGSSCGGGYSGGGGSSCGGGGGYSGG----GGSSCGGGSSGGG--GGGSSQQYQCQSYG 281

Query: 155 --SCGGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFSYGG 15
             S GG SCGG Y GGG   G    GG+  GGG S GG  SGGG S GG
Sbjct: 282 GGSSGGSSCGGRYSGGG---GSSCGGGYSGGGGSSCGGGSSGGGSSCGG 327

 Score =  122 bits (305), Expect = 2e-26
 Identities = 94/205 (45%), Positives = 99/205 (48%), Gaps = 52/205 (25%)
 Frame = -3

Query: 473 GGDFS*GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GGL-YSGGGFSCGGFSC 297
           GG +S GG   GG + GGG SCGG   G +  G  C  GG S GG+ YSGGG   GG SC
Sbjct: 32  GGYYSGGGSGCGGGSSGGGSSCGGGGGGSYGGGSSCGGGGGSGGGVKYSGGG---GGSSC 88

Query: 296 GGRYSGGG--CSCGGWYSGGDFA*GGFSCGGWCSGGG---ISWGG*YPGGECSC------ 150
           GG YSGGG   SCGG YSGG    GG SCGG  SGGG      GG Y GG  SC      
Sbjct: 89  GGGYSGGGGGSSCGGGYSGGG---GGSSCGGGYSGGGGGSSCGGGSYSGGGSSCGGGGGS 145

Query: 149 ------------GGFSC--------------------GG*YC----GGGFT*GC--FP*G 84
                       GG SC                    GG YC    GGG + GC     G
Sbjct: 146 GGGVKYSGGGGGGGSSCGGGSSGGGGGGSSCGGGSGGGGSYCGGSSGGGSSGGCGGGSGG 205

Query: 83  GWYS--GGGFS*GGWYSGGGFSYGG 15
           G YS  GGG S GG YSGGG S GG
Sbjct: 206 GKYSGGGGGSSCGGGYSGGGGSSGG 230

 Score =  118 bits (295), Expect = 2e-25
 Identities = 88/190 (46%), Positives = 92/190 (48%), Gaps = 37/190 (19%)
 Frame = -3

Query: 473 GGDFS*GGFSL----GGWNFGGGFSCGGFW*GGWYSGD----------GCSCGGFS*GGL 336
           GG +S GG S     GG++ GGG SCGG   GG   G           G S GG S GG 
Sbjct: 234 GGGYSGGGGSSCGGGGGYSGGGGSSCGGGSSGGGGGGSSQQYQCQSYGGGSSGGSSCGGR 293

Query: 335 YSGGGFSC--------GGFSCGGRYSGGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWG 180
           YSGGG S         GG SCGG  SGGG SCGG   GG    GG SCGG  SGGG   G
Sbjct: 294 YSGGGGSSCGGGYSGGGGSSCGGGSSGGGSSCGGSGGGGYSGGGGGSCGGGSSGGG---G 350

Query: 179 G*YP---------------GGECSCGGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGW 45
           G Y                GG  S GG SCGG   GGG   GC+  GG  S GG   GG 
Sbjct: 351 GYYSSQQTSQTSCAPQQSYGGGSSGGGGSCGGGSSGGGGGGGCYSSGGGGSSGGC--GGG 408

Query: 44  YSGGGFSYGG 15
           YSGGG   GG
Sbjct: 409 YSGGGGGCGG 418

 Score =  115 bits (287), Expect = 2e-24
 Identities = 84/165 (50%), Positives = 86/165 (52%), Gaps = 12/165 (7%)
 Frame = -3

Query: 473 GGDFS*GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GGLYSGGGFSCGGFSCG 294
           GG  S GG   GG   GGG SCGG + GG   G G SCGG    G YSGGG SCGG    
Sbjct: 96  GGGSSCGGGYSGG---GGGSSCGGGYSGG---GGGSSCGG----GSYSGGGSSCGG---- 141

Query: 293 GRYSG-----------GGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWGG*YPGGEC-SC 150
           G  SG           GG SCGG  SGG    GG SCGG   GGG   GG   GG    C
Sbjct: 142 GGGSGGGVKYSGGGGGGGSSCGGGSSGG--GGGGSSCGGGSGGGGSYCGGSSGGGSSGGC 199

Query: 149 GGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFSYGG 15
           GG S GG Y GGG    C   GG YSGGG S GG   GGG+S GG
Sbjct: 200 GGGSGGGKYSGGGGGSSC---GGGYSGGGGSSGGSSCGGGYSGGG 241

 Score =  111 bits (278), Expect = 2e-23
 Identities = 84/160 (52%), Positives = 87/160 (54%), Gaps = 8/160 (5%)
 Frame = -3

Query: 470 GDFS*GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GGLYSGGGFSCGGFSCGG 291
           G  S GG   GG   GG +S GG   GG  SG G SCGG   GG Y GGG SCGG    G
Sbjct: 17  GKTSGGGGGGGGGGGGGYYSGGGSGCGGGSSGGGSSCGGGG-GGSY-GGGSSCGGGGGSG 74

Query: 290 ---RYSGGG--CSCGGWYSGGDFA*GGFSCGGWCS--GGGISWGG*YPGGECSCGGFSC- 135
              +YSGGG   SCGG YSGG    GG SCGG  S  GGG S GG Y GG    GG SC 
Sbjct: 75  GGVKYSGGGGGSSCGGGYSGGG---GGSSCGGGYSGGGGGSSCGGGYSGGG---GGSSCG 128

Query: 134 GG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFSYGG 15
           GG Y GGG + G    GG  SGGG    G   GGG S GG
Sbjct: 129 GGSYSGGGSSCG----GGGGSGGGVKYSGGGGGGGSSCGG 164

 Score =  111 bits (277), Expect = 3e-23
 Identities = 83/163 (50%), Positives = 87/163 (53%), Gaps = 18/163 (11%)
 Frame = -3

Query: 455 GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GGLYSG-GGFSCGGFSCGGRYS- 282
           GG S GG   GGG   GG   GG YSG G S GG S GG YSG GG SCGG   GG YS 
Sbjct: 200 GGGSGGGKYSGGG---GGSSCGGGYSGGGGSSGGSSCGGGYSGGGGSSCGG---GGGYSG 253

Query: 281 GGGCSCGGWYSG---------------GDFA*GGFSCGG-WCSGGGISWGG*YPGGECSC 150
           GGG SCGG  SG               G  + GG SCGG +  GGG S GG Y GG    
Sbjct: 254 GGGSSCGGGSSGGGGGGSSQQYQCQSYGGGSSGGSSCGGRYSGGGGSSCGGGYSGG---- 309

Query: 149 GGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFSY 21
           GG SCGG   GGG + G    GG+  GGG S GG  SGGG  Y
Sbjct: 310 GGSSCGGGSSGGGSSCGGSGGGGYSGGGGGSCGGGSSGGGGGY 352

 Score =  108 bits (271), Expect = 1e-22
 Identities = 83/169 (49%), Positives = 88/169 (52%), Gaps = 16/169 (9%)
 Frame = -3

Query: 473 GGDFS*GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GGLYSGGGF-------- 318
           GG    GG S GG + GGG SCGG   GG+  G G SCGG S GG   GGG+        
Sbjct: 304 GGYSGGGGSSCGGGSSGGGSSCGGSGGGGYSGGGGGSCGGGSSGG---GGGYYSSQQTSQ 360

Query: 317 -SCGGF-SCGGRYSGGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWGG*YPGGECSCGG 144
            SC    S GG  SGGG SCGG  SGG    G +S GG  S GG   GG Y GG   CGG
Sbjct: 361 TSCAPQQSYGGGSSGGGGSCGGGSSGGGGGGGCYSSGGGGSSGGC--GGGYSGGGGGCGG 418

Query: 143 FSCG--G*YCGGGFT----*GCFP*GGWYSGGGFS*GGWYSGGGFSYGG 15
            S G  G  CGGG +     GC   GG YSGGG   GG   GGG S GG
Sbjct: 419 GSSGGSGGGCGGGSSGGSGGGC---GGGYSGGGG--GGSSCGGGSSGGG 462

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 56/98 (57%), Positives = 58/98 (59%)
 Frame = -3

Query: 473 GGDFS*GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GGLYSGGGFSCGGFSCG 294
           GG  S GG   G ++ GGG S GG   GG YSG G  CGG S GG  SGGG  CGG S G
Sbjct: 381 GGGSSGGGGGGGCYSSGGGGSSGGC--GGGYSGGGGGCGGGSSGG--SGGG--CGGGSSG 434

Query: 293 GRYSGGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWG 180
           G  SGGG  CGG YSGG    GG SCGG  SGGG   G
Sbjct: 435 G--SGGG--CGGGYSGG--GGGGSSCGGGSSGGGSGGG 466

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 55/116 (47%), Positives = 58/116 (50%), Gaps = 16/116 (13%)
 Frame = -3

Query: 314 CGGFSCGGR----------YSGGGCSCGGWYSGGDFA*GG-----FSCGGWCSGGGISWG 180
           CG  S GG           YSGGG  CGG  SGG  + GG     +  G  C GGG S G
Sbjct: 16  CGKTSGGGGGGGGGGGGGYYSGGGSGCGGGSSGGGSSCGGGGGGSYGGGSSCGGGGGSGG 75

Query: 179 G-*YPGGECSCGGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFSYGG 15
           G  Y GG    GG SCGG Y GGG    C   GG YSGGG   GG   GGG+S GG
Sbjct: 76  GVKYSGGG---GGSSCGGGYSGGGGGSSC---GGGYSGGG---GGSSCGGGYSGGG 122

[45][TOP]
>UniRef100_A2W6K8 Putative uncharacterized protein n=1 Tax=Burkholderia dolosa AUO158
            RepID=A2W6K8_9BURK
          Length = 871

 Score =  126 bits (317), Expect = 7e-28
 Identities = 69/149 (46%), Positives = 77/149 (51%), Gaps = 8/149 (5%)
 Frame = +1

Query: 16   PPYENPPP--EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
            PP  NPPP  E  PP E+PPP   PP  + P   PP +  PP E+PP    PP   P  E
Sbjct: 728  PPTVNPPPPSEVPPPSEEPPPSETPPPSETP---PPSEAPPPSEEPPPSEEPP---PSEE 781

Query: 190  IPPPEHQPPHEKPPHAKSPP--EYQPPHEHPPPEYLPP--HEKPPHENPPPEYNPP--HE 351
             PP E  PP E+PP ++ PP  E  PP E PPP   PP   E PP E PPP   PP   E
Sbjct: 782  PPPSEEPPPSEEPPPSEEPPPSETPPPSETPPPSEAPPPSEEPPPSEEPPPSETPPPSEE 841

Query: 352  KPPHEHPSPEYQPPHQKPPHENPPPKFQP 438
             PP E P P   P    PP E PPP  +P
Sbjct: 842  PPPSETPPPSETP----PPSETPPPSEEP 866

 Score =  119 bits (298), Expect = 1e-25
 Identities = 66/159 (41%), Positives = 77/159 (48%), Gaps = 4/159 (2%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP   PP    PP  + PP  + P        PP +  PP E PP   +PP   P  E P
Sbjct: 723  PPVPPPPTVNPPPPSEVPPPSEEP--------PPSETPPPSETPPPSEAPP---PSEEPP 771

Query: 196  PPEHQPPHEKPPHAKSPP--EYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP--HEKPPH 363
            P E  PP E+PP ++ PP  E  PP E PPP   P    PP E PPP   PP   E PP 
Sbjct: 772  PSEEPPPSEEPPPSEEPPPSEEPPPSEEPPPSETP----PPSETPPPSEAPPPSEEPPPS 827

Query: 364  EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
            E P P   PP   P  E PP +  PP+E PP  ++PP S
Sbjct: 828  EEPPPSETPP---PSEEPPPSETPPPSETPPPSETPPPS 863

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 30/66 (45%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
 Frame = +1

Query: 289 LPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQ-KPPHENPPP-KFQPPNEKPPHE 462
           LPP   PP  NPPP   P    PP E P     PP +  PP E PPP +  PP+E+PP  
Sbjct: 722 LPPVPPPPTVNPPP---PSEVPPPSEEP-----PPSETPPPSETPPPSEAPPPSEEPPPS 773

Query: 463 KSPPAS 480
           + PP S
Sbjct: 774 EEPPPS 779

[46][TOP]
>UniRef100_UPI00006A19C1 UPI00006A19C1 related cluster n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI00006A19C1
          Length = 338

 Score =  126 bits (316), Expect = 9e-28
 Identities = 62/158 (39%), Positives = 77/158 (48%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P +  PP E  PP   PP E  PP   PP    P+  PP +  PP   PP E +PP   P
Sbjct: 172 PPYTVPPIETAPPYTAPPIETAPPYTAPPIEPPPYTVPPIETVPPKTVPPIETAPPKTVP 231

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P E  PP++  P + PP+   P E  PP+  PP E  PP+  PP E  PP ++ P+   P
Sbjct: 232 PIETVPPKNSAPKQSPPYTVPPIETAPPYTVPPIETAPPYTVPPIETAPPIHSAPNRDSP 291

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             H +P   PP+  PP E  PP   PP E  P    PP
Sbjct: 292 PIHSAPRQPPPYTVPPIETAPPYTAPPIETAPPYTVPP 329

 Score =  122 bits (305), Expect = 2e-26
 Identities = 67/169 (39%), Positives = 79/169 (46%), Gaps = 11/169 (6%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPH-----EHSP 165
           P    PPY  PP E  PP+  PP E  PP+   P    PP   PP E PP+     E  P
Sbjct: 156 PIETAPPYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPIEPPPYTVPPIETVP 215

Query: 166 PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP 345
           P   PP E  PP+  PP E  P   S P+  PP+  PP E  PP+  PP E  PP   PP
Sbjct: 216 PKTVPPIETAPPKTVPPIETVPPKNSAPKQSPPYTVPPIETAPPYTVPPIETAPPYTVPP 275

Query: 346 HEKPPHEHPSPE------YQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            E  P  H +P       +  P Q PP+  PP +  PP   PP E +PP
Sbjct: 276 IETAPPIHSAPNRDSPPIHSAPRQPPPYTVPPIETAPPYTAPPIETAPP 324

 Score =  118 bits (296), Expect = 2e-25
 Identities = 64/164 (39%), Positives = 79/164 (48%), Gaps = 11/164 (6%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PPY  PP E  PP+  PP E  PP+   P    PP   PP E  P   +PP   PP+ +P
Sbjct: 150 PPYTVPPIETAPPYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPIEPPPYTVP 209

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
           P E  PP   PP   +PP+  PP E  PP+   P + PP+  PP E  PP+  PP E   
Sbjct: 210 PIETVPPKTVPPIETAPPKTVPPIETVPPKNSAPKQSPPYTVPPIETAPPYTVPPIETAP 269

Query: 376 PEYQPP-------HQKPPHENPP----PKFQPPNEKPPHEKSPP 474
           P   PP       H  P  ++PP    P+  PP   PP E +PP
Sbjct: 270 PYTVPPIETAPPIHSAPNRDSPPIHSAPRQPPPYTVPPIETAPP 313

 Score =  116 bits (290), Expect = 9e-25
 Identities = 64/159 (40%), Positives = 80/159 (50%), Gaps = 6/159 (3%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPP----PEYQPPHGKQ--PHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           PPY  PP E  PP + P     P+ Q P  +Q  P+  PP +  PP+  PP E +PP   
Sbjct: 117 PPYTVPPIETVPPKQCPQLRQSPQKQCPQLRQSPPYTVPPIETAPPYTVPPIETAPPYTV 176

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
           PP E  PP   PP E  P   +PP   PP+  PP E +PP   PP E  PP+  PP E  
Sbjct: 177 PPIETAPPYTAPPIETAPPYTAPPIEPPPYTVPPIETVPPKTVPPIETAPPKTVPPIETV 236

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P ++ +P+  PP+  PP E  PP   PP E  P    PP
Sbjct: 237 PPKNSAPKQSPPYTVPPIETAPPYTVPPIETAPPYTVPP 275

 Score =  114 bits (285), Expect = 3e-24
 Identities = 65/170 (38%), Positives = 80/170 (47%), Gaps = 12/170 (7%)
 Frame = +1

Query: 1   PHHAKPPYENPP----------PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPH--EK 144
           P    PPY  PP          P+  PP+  PP E  PP  + P +   PQ Q P   + 
Sbjct: 91  PIETAPPYTVPPIETVPPIHSAPKQSPPYTVPPIETVPPK-QCPQLRQSPQKQCPQLRQS 149

Query: 145 PPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP 324
           PP+   P    PP+ +PP E  PP+  PP   +PP   PP E  PP   PP E PP+  P
Sbjct: 150 PPYTVPPIETAPPYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPIEPPPYTVP 209

Query: 325 PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P E  PP   PP E   P+  PP +  P +N  PK  PP   PP E +PP
Sbjct: 210 PIETVPPKTVPPIETAPPKTVPPIETVPPKNSAPKQSPPYTVPPIETAPP 259

 Score =  111 bits (277), Expect = 3e-23
 Identities = 64/162 (39%), Positives = 73/162 (45%), Gaps = 2/162 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP E  PP   PP E  PP +  P    P+  PP +  PP + P    SP    P
Sbjct: 85  PPFTVPPIETAPPYTVPPIETVPPIHSAPKQSPPYTVPPIETVPPKQCPQLRQSPQKQCP 144

Query: 181 PHEIPPPEHQPPHEK-PPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
                PP   PP E  PP+   P E  PP+  PP E  PP+  PP E  PP   PP E P
Sbjct: 145 QLRQSPPYTVPPIETAPPYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPIEPP 204

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEK-PPHEKSPPAS 480
           P+  P  E  PP   PP E  PPK  PP E  PP   +P  S
Sbjct: 205 PYTVPPIETVPPKTVPPIETAPPKTVPPIETVPPKNSAPKQS 246

 Score =  109 bits (273), Expect = 8e-23
 Identities = 68/195 (34%), Positives = 78/195 (40%), Gaps = 37/195 (18%)
 Frame = +1

Query: 1   PHHAKPPYENPP----------PEYQPPHEKPPPEYQPPHGKQPHVNPP----------P 120
           PH   PPY  PP          P+  PP   PP E  PP    P  +PP          P
Sbjct: 38  PHRKCPPYTVPPIETVPPIHSAPKQSPPFTVPPIETVPPIHSAPKQSPPFTVPPIETAPP 97

Query: 121 QYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPP-----------------HEKPPHAKSPP 249
              PP E  P  HS P   PP+ +PP E  PP                  + PP+   P 
Sbjct: 98  YTVPPIETVPPIHSAPKQSPPYTVPPIETVPPKQCPQLRQSPQKQCPQLRQSPPYTVPPI 157

Query: 250 EYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPK 429
           E  PP+  PP E  PP+  PP E  PP   PP E  P     P   PP+  PP E  PPK
Sbjct: 158 ETAPPYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPIEPPPYTVPPIETVPPK 217

Query: 430 FQPPNEKPPHEKSPP 474
             PP E  P +  PP
Sbjct: 218 TVPPIETAPPKTVPP 232

 Score =  105 bits (262), Expect = 2e-21
 Identities = 58/151 (38%), Positives = 74/151 (49%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P +  PP E PPP   PP E  PP+  P     P    PP+  PP E  P ++S P   P
Sbjct: 194 PPYTAPPIE-PPPYTVPPIETVPPKTVP-----PIETAPPKTVPPIETVPPKNSAPKQSP 247

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P+ +PP E  PP+  P     P E  PP+  PP E  PP    P+ + PP ++ P + PP
Sbjct: 248 PYTVPPIETAPPYTVP-----PIETAPPYTVPPIETAPPIHSAPNRDSPPIHSAPRQPPP 302

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKP 453
           +  P  E  PP+  PP E  PP   PP E P
Sbjct: 303 YTVPPIETAPPYTAPPIETAPPYTVPPIETP 333

 Score =  101 bits (252), Expect = 2e-20
 Identities = 64/189 (33%), Positives = 80/189 (42%), Gaps = 35/189 (18%)
 Frame = +1

Query: 10  AKPPYE--NPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE-----HSPP 168
           A P Y+  +  P +  PH K PP   PP    P ++  P+  PP   PP E     HS P
Sbjct: 22  ATPTYKIIHSAPIHNAPHRKCPPYTVPPIETVPPIHSAPKQSPPFTVPPIETVPPIHSAP 81

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSP-----PEYQPPHEHPPPEYLPP------------ 297
              PP  +PP E  PP+  PP    P     P+  PP+  PP E +PP            
Sbjct: 82  KQSPPFTVPPIETAPPYTVPPIETVPPIHSAPKQSPPYTVPPIETVPPKQCPQLRQSPQK 141

Query: 298 -----HEKPPHENPPPEYNPPHEKPPHEHPSP------EYQPPHQKPPHENPPPKFQPPN 444
                 + PP+  PP E  PP+  PP E   P      E  PP+  PP E  PP   PP 
Sbjct: 142 QCPQLRQSPPYTVPPIETAPPYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPI 201

Query: 445 EKPPHEKSP 471
           E PP+   P
Sbjct: 202 EPPPYTVPP 210

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 52/132 (39%), Positives = 67/132 (50%), Gaps = 7/132 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP---- 168
           P +  PP E  PP+  PP E  PP+  PP    P  N  P+  PP+  PP E +PP    
Sbjct: 204 PPYTVPPIETVPPKTVPPIETAPPKTVPPIETVPPKNSAPKQSPPYTVPPIETAPPYTVP 263

Query: 169 --GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEK-PPHENPPPEYN 339
                PP+ +PP E  PP    P+  SPP +  P + PPP  +PP E  PP+  PP E  
Sbjct: 264 PIETAPPYTVPPIETAPPIHSAPNRDSPPIHSAPRQ-PPPYTVPPIETAPPYTAPPIETA 322

Query: 340 PPHEKPPHEHPS 375
           PP+  PP E P+
Sbjct: 323 PPYTVPPIETPT 334

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 61/166 (36%), Positives = 76/166 (45%), Gaps = 8/166 (4%)
 Frame = +1

Query: 1   PHHAKPPYEN-PPPEYQPPHEKPPPEYQPPHGK-QPHVNPPPQYQPPHEKPPHEHSPPGY 174
           PH   P   N   P Y+  H  P   +  PH K  P+  PP +  PP    P + SPP  
Sbjct: 11  PHTVLPKENNIATPTYKIIHSAPI--HNAPHRKCPPYTVPPIETVPPIHSAPKQ-SPPFT 67

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
            PP E  PP H  P + PP    P E  PP+  PP E +PP    P ++PP    P    
Sbjct: 68  VPPIETVPPIHSAPKQSPPFTVPPIETAPPYTVPPIETVPPIHSAPKQSPPYTVPPIETV 127

Query: 355 PPHEHP----SPEYQPP--HQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP + P    SP+ Q P   Q PP+  PP +  PP   PP E +PP
Sbjct: 128 PPKQCPQLRQSPQKQCPQLRQSPPYTVPPIETAPPYTVPPIETAPP 173

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 50/135 (37%), Positives = 64/135 (47%), Gaps = 2/135 (1%)
 Frame = +1

Query: 85  PHGKQPHVN--PPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQ 258
           PH   P  N    P Y+  H  P H ++P    PP+ +PP E  PP    P  +SPP   
Sbjct: 11  PHTVLPKENNIATPTYKIIHSAPIH-NAPHRKCPPYTVPPIETVPPIHSAPK-QSPPFTV 68

Query: 259 PPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQP 438
           PP E  PP +  P + PP   PP E  PP+  PP E   P +  P Q PP+  PP +  P
Sbjct: 69  PPIETVPPIHSAPKQSPPFTVPPIETAPPYTVPPIETVPPIHSAPKQSPPYTVPPIETVP 128

Query: 439 PNEKPPHEKSPPASC 483
           P + P   +SP   C
Sbjct: 129 PKQCPQLRQSPQKQC 143

[47][TOP]
>UniRef100_A5B1L6 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5B1L6_VITVI
          Length = 287

 Score =  126 bits (316), Expect = 9e-28
 Identities = 84/197 (42%), Positives = 104/197 (52%), Gaps = 40/197 (20%)
 Frame = +1

Query: 4   HHAKPP-YENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPP--------HEKPPHE 156
           H+ KPP ++ PPPE++PP EKP PE++PP        P P+++PP         EKPP E
Sbjct: 24  HYPKPPPFQKPPPEHKPPGEKPSPEHKPPTKPPKGEKPLPEHKPPTPIGKPPKGEKPPPE 83

Query: 157 HSPP---GYQPPHEIPPPEHQPPHE--KPPHA-KSPPEYQPP--------HEHPPPEYLP 294
           H PP   G  P  + P PEH+PP    KPP   K PPE++PP         E P PE+ P
Sbjct: 84  HKPPTPIGKPPKGKKPLPEHKPPTPIGKPPKGEKPPPEHKPPTXIGKPPKGEKPLPEHKP 143

Query: 295 PHE--KPPH-ENPPPEYNPPH--EKPPH-EHPSPEYQPPHQ--KP-PHENPPPKFQPP-- 441
           P    KPP  E PPPE+ PP    KPP  E P PE++PP    KP   E P P+ +PP  
Sbjct: 144 PTPIGKPPKGEKPPPEHKPPTPISKPPKGEKPLPEHKPPTPIGKPLKGEKPLPEHKPPTP 203

Query: 442 ------NEKPPHEKSPP 474
                  EKP  E  PP
Sbjct: 204 IGKPXKGEKPLPEHKPP 220

 Score =  119 bits (298), Expect = 1e-25
 Identities = 90/218 (41%), Positives = 106/218 (48%), Gaps = 60/218 (27%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPP-----HEKPPPEYQPPH--GKQPH-VNPPPQYQPP------- 135
           P H KPP E P PE++PP      EKP PE++PP   GK P    PPP+++PP       
Sbjct: 36  PEH-KPPGEKPSPEHKPPTKPPKGEKPLPEHKPPTPIGKPPKGEKPPPEHKPPTPIGKPP 94

Query: 136 -HEKPPHEHSPP---GYQPPHEIPPPEHQPPHE--KPPHAKSP-PEYQPP--------HE 270
             +KP  EH PP   G  P  E PPPEH+PP    KPP  + P PE++PP         E
Sbjct: 95  KGKKPLPEHKPPTPIGKPPKGEKPPPEHKPPTXIGKPPKGEKPLPEHKPPTPIGKPPKGE 154

Query: 271 HPPPEYLPPH--EKPPH-ENPPPEYNPP--------HEKPPHEH--------------PS 375
            PPPE+ PP    KPP  E P PE+ PP         EKP  EH              P 
Sbjct: 155 KPPPEHKPPTPISKPPKGEKPLPEHKPPTPIGKPLKGEKPLPEHKPPTPIGKPXKGEKPL 214

Query: 376 PEYQPPHQ--KPPH-ENPPPKF--QPPNEKPPHEKSPP 474
           PE++PP    KPP  E PP  F   P  EKPPH    P
Sbjct: 215 PEHKPPTPIGKPPKGEKPPSPFGKPPTGEKPPHYGHTP 252

 Score =  100 bits (249), Expect = 5e-20
 Identities = 78/213 (36%), Positives = 97/213 (45%), Gaps = 73/213 (34%)
 Frame = +1

Query: 13  KPPY-ENPPPEYQPPH--------EKPPPEYQPPH--GKQPH-VNPPPQYQPPH------ 138
           KPP  E PPPE++PP         +KP PE++PP   GK P    PPP+++PP       
Sbjct: 73  KPPKGEKPPPEHKPPTPIGKPPKGKKPLPEHKPPTPIGKPPKGEKPPPEHKPPTXIGKPP 132

Query: 139 --EKPPHEHSPP---GYQPPHEIPPPEHQPPH--EKPPHAKSP-PEYQPPH--------E 270
             EKP  EH PP   G  P  E PPPEH+PP    KPP  + P PE++PP         E
Sbjct: 133 KGEKPLPEHKPPTPIGKPPKGEKPPPEHKPPTPISKPPKGEKPLPEHKPPTPIGKPLKGE 192

Query: 271 HPPPEYLPPHE--KPPH-ENPPPEYNPPH---------------------EKPPH----- 363
            P PE+ PP    KP   E P PE+ PP                      EKPPH     
Sbjct: 193 KPLPEHKPPTPIGKPXKGEKPLPEHKPPTPIGKPPKGEKPPSPFGKPPTGEKPPHYGHTP 252

Query: 364 -EHPSPEYQPPHQ---------KPPHENPPPKF 432
              P+  Y+PP +         KPPH+ P P +
Sbjct: 253 GHPPAHSYKPPQKIKPPPTPPHKPPHKPPSPTY 285

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 48/108 (44%), Positives = 58/108 (53%), Gaps = 14/108 (12%)
 Frame = +1

Query: 193 PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP--------H 348
           P   H P  + PP  K PPE++PP E P PE+ PP + P  E P PE+ PP         
Sbjct: 20  PSLAHYP--KPPPFQKPPPEHKPPGEKPSPEHKPPTKPPKGEKPLPEHKPPTPIGKPPKG 77

Query: 349 EKPPHEH--PSPEYQPPHQK---PPHENPPPKFQPP-NEKPPHEKSPP 474
           EKPP EH  P+P  +PP  K   P H+ P P  +PP  EKPP E  PP
Sbjct: 78  EKPPPEHKPPTPIGKPPKGKKPLPEHKPPTPIGKPPKGEKPPPEHKPP 125

[48][TOP]
>UniRef100_Q39005 Cell wall protein n=1 Tax=Arabidopsis thaliana RepID=Q39005_ARATH
          Length = 305

 Score =  125 bits (315), Expect = 1e-27
 Identities = 81/194 (41%), Positives = 103/194 (53%), Gaps = 41/194 (21%)
 Frame = +1

Query: 16  PPYENPPPEYQPP---HEKPPPEYQPPHGKQPHVN---PPPQYQPPHEK--PPHEHSPP- 168
           PPYE+PP +Y PP   +  PP +Y PP    P +    PP QY PP +K  PP ++SPP 
Sbjct: 78  PPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPF 137

Query: 169 -GYQPPHEIPPP-------EHQPPHEK--PPHAKSPP---EYQPPHEHPPP--EYLPPHE 303
             Y PP + PPP       EH PP  K  PP  + PP   +Y PP ++PPP  +Y PP +
Sbjct: 138 KKYPPPEQYPPPVKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQ 197

Query: 304 KPP--HENPPP--EYNPPHEKPP----HEHPSPEYQPPHQK----PPHEN-PPPKFQPPN 444
            PP   + PPP  +Y PP E PP    + HP  +Y PP  K    PP +  PPPK  PP 
Sbjct: 198 YPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPP 257

Query: 445 EK----PPHEKSPP 474
            +    PP +K PP
Sbjct: 258 PEHYPWPPKKKYPP 271

 Score =  114 bits (284), Expect = 4e-24
 Identities = 74/189 (39%), Positives = 94/189 (49%), Gaps = 32/189 (16%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVN--PPPQYQ-PPHEKPP----HEHS 162
           HH  P    P   Y PP   P  +Y PP    P +   PPP Y+ PP + PP    + H 
Sbjct: 38  HHWPPFKWGPKFPYSPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHP 97

Query: 163 PPGYQPPHEIPPP--EHQPPHEKPPHAKS---PPEYQPP-HEHPPPEYLPPHEK---PPH 315
           P  Y PP + PPP  ++ PP + PP  K    P +Y PP  ++PPPE  PP  K   PP 
Sbjct: 98  PVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPVKKYPPPE 157

Query: 316 ENPPP--------EYNPPHEK--PPHEHPSP--EYQPPHQKPP--HENPPP--KFQPPNE 447
             PPP        +Y PP +K  PP ++P P  +Y PP Q PP   + PPP  K+ PP E
Sbjct: 158 HYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEE 217

Query: 448 KPPHEKSPP 474
            PP  K+ P
Sbjct: 218 YPPPIKTYP 226

 Score =  108 bits (269), Expect = 2e-22
 Identities = 75/185 (40%), Positives = 92/185 (49%), Gaps = 35/185 (18%)
 Frame = +1

Query: 16  PPYENPPP--EYQPPHEKPPP--------EYQPPHGKQPHVNPPPQYQPPHEK-PPHEHS 162
           PP + PPP  +Y PP + PPP        +Y PP  K P   PP QY PP +K PP EH 
Sbjct: 103 PPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYP---PPEQYPPPVKKYPPPEHY 159

Query: 163 PPG---YQPPHEIPPP--EHQPPHEKPPHAKS--PPEYQPP---------HEHPPP-EYL 291
           PP    Y P  + PPP  ++ PP + PP  K   PPE  PP          ++PPP EY 
Sbjct: 160 PPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYP 219

Query: 292 PPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPP---HENPPP--KFQPPNE--K 450
           PP +  PH  PP +Y PP  K     P   Y PP + PP   H   PP  K+ PP E   
Sbjct: 220 PPIKTYPH--PPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPPPVEYPS 277

Query: 451 PPHEK 465
           PP++K
Sbjct: 278 PPYKK 282

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 64/157 (40%), Positives = 74/157 (47%), Gaps = 15/157 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPE--YQPPHEK-PPPE-YQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P H  PP +  PP+  Y PP +K PPPE Y PP  K P   PP QY PP +K P    PP
Sbjct: 156 PEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYP---PPEQYPPPIKKYP----PP 208

Query: 169 --GYQPPHEIPPP----EHQPPHEKPPHAKSPPE-----YQPPHEHPPPEYLPPHEKPPH 315
              Y PP E PPP     H P    PP  K+ P      Y PP E PPP        P H
Sbjct: 209 IKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPP--------PEH 260

Query: 316 ENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPP 426
              PP+   P   PP E+PSP Y+  + +  H N  P
Sbjct: 261 YPWPPKKKYP---PPVEYPSPPYK-KYLRLIHSNSKP 293

[49][TOP]
>UniRef100_Q9M4H9 Putative proline-rich cell wall protein n=1 Tax=Vitis vinifera
           RepID=Q9M4H9_VITVI
          Length = 287

 Score =  125 bits (314), Expect = 1e-27
 Identities = 87/211 (41%), Positives = 110/211 (52%), Gaps = 53/211 (25%)
 Frame = +1

Query: 4   HHAKPP-YENPPPEYQPPHEKPPPEYQPPH------------------GKQPH-VNPPPQ 123
           H+ KPP ++ PPPE++PP EKP PE++PP                   GK P    PPP+
Sbjct: 24  HYPKPPPFQKPPPEHKPPGEKPSPEHKPPTKPPKGEKPLPEHKPLTPIGKPPKGEKPPPE 83

Query: 124 YQPPH--EKPPH------EHSPP---GYQPPHEIPPPEHQPPHE--KPPHAKSP-PEYQP 261
           ++PP   +KPP       EH PP   G  P  E PPPEH+PP    KP   + P PE++P
Sbjct: 84  HKPPTPIDKPPKGKKPLPEHKPPTPIGKPPKGEKPPPEHKPPTPIGKPSKGEKPLPEHKP 143

Query: 262 P--------HEHPPPEYLPPH--EKPPH-ENPPPEYNPPHE--KPPH-EHPSPEYQPPHQ 399
           P         E PPPE+ PP    KPP  E P PE+ PP    KPP  E P PE++PP  
Sbjct: 144 PTPIGKLPKGEKPPPEHKPPTPISKPPKGEKPLPEHKPPTPIGKPPKGEKPLPEHKPPTP 203

Query: 400 --KPPH-ENPPPKFQPPNE--KPPHEKSPPA 477
             KPP  E P P+ +PP    KPP  + PP+
Sbjct: 204 IGKPPKGEKPLPEHKPPTPIGKPPKGEKPPS 234

 Score =  113 bits (282), Expect = 7e-24
 Identities = 86/211 (40%), Positives = 105/211 (49%), Gaps = 57/211 (27%)
 Frame = +1

Query: 13  KPPY-ENPPPEYQPPH--------EKPPPEYQPPH--GKQPH-VNPPPQYQPPH------ 138
           KPP  E PPPE++PP         +KP PE++PP   GK P    PPP+++PP       
Sbjct: 73  KPPKGEKPPPEHKPPTPIDKPPKGKKPLPEHKPPTPIGKPPKGEKPPPEHKPPTPIGKPS 132

Query: 139 --EKPPHEHSPP---GYQPPHEIPPPEHQPPH--EKPPHAKSP-PEYQPPH--------E 270
             EKP  EH PP   G  P  E PPPEH+PP    KPP  + P PE++PP         E
Sbjct: 133 KGEKPLPEHKPPTPIGKLPKGEKPPPEHKPPTPISKPPKGEKPLPEHKPPTPIGKPPKGE 192

Query: 271 HPPPEYLPPHE--KPPH-ENPPPEYNPPHE--KPP--HEHPSPEYQPPH-QKPPHEN--- 417
            P PE+ PP    KPP  E P PE+ PP    KPP   + PSP  +PP  +KPPH     
Sbjct: 193 KPLPEHKPPTPIGKPPKGEKPLPEHKPPTPIGKPPKGEKPPSPFGKPPTGEKPPHYGHTP 252

Query: 418 ---------PPPKFQP---PNEKPPHEKSPP 474
                    PP K +P   P  KPPH+   P
Sbjct: 253 GHPPAHSYKPPQKIKPPPTPPHKPPHKPPSP 283

 Score =  106 bits (265), Expect = 7e-22
 Identities = 72/176 (40%), Positives = 88/176 (50%), Gaps = 36/176 (20%)
 Frame = +1

Query: 13  KPPY-ENPPPEYQPPH--------EKPPPEYQPPH--GKQPH-VNPPPQYQPPH------ 138
           KPP  E PPPE++PP         EKP PE++PP   GK P    PPP+++PP       
Sbjct: 111 KPPKGEKPPPEHKPPTPIGKPSKGEKPLPEHKPPTPIGKLPKGEKPPPEHKPPTPISKPP 170

Query: 139 --EKPPHEHSPP---GYQPPHEIPPPEHQPPHE--KPPHAKSP-PEYQPPH--------E 270
             EKP  EH PP   G  P  E P PEH+PP    KPP  + P PE++PP         E
Sbjct: 171 KGEKPLPEHKPPTPIGKPPKGEKPLPEHKPPTPIGKPPKGEKPLPEHKPPTPIGKPPKGE 230

Query: 271 HPPPEY--LPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKF 432
            PP  +   P  EKPPH    P + P H   P +   P   PPH KPPH+ P P +
Sbjct: 231 KPPSPFGKPPTGEKPPHYGHTPGHPPAHSYKPPQKIKPPPTPPH-KPPHKPPSPTY 285

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 48/108 (44%), Positives = 58/108 (53%), Gaps = 14/108 (12%)
 Frame = +1

Query: 193 PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNP--PHEKPPH- 363
           P   H P  + PP  K PPE++PP E P PE+ PP + P  E P PE+ P  P  KPP  
Sbjct: 20  PSLAHYP--KPPPFQKPPPEHKPPGEKPSPEHKPPTKPPKGEKPLPEHKPLTPIGKPPKG 77

Query: 364 EHPSPEYQPPH--QKPP--------HENPPPKFQPP-NEKPPHEKSPP 474
           E P PE++PP    KPP        H+ P P  +PP  EKPP E  PP
Sbjct: 78  EKPPPEHKPPTPIDKPPKGKKPLPEHKPPTPIGKPPKGEKPPPEHKPP 125

[50][TOP]
>UniRef100_Q9LJ64 Extensin protein-like n=1 Tax=Arabidopsis thaliana RepID=Q9LJ64_ARATH
          Length = 956

 Score =  125 bits (313), Expect = 2e-27
 Identities = 79/193 (40%), Positives = 90/193 (46%), Gaps = 33/193 (17%)
 Frame = +1

Query: 1    PHHAKPP----YENPPPEYQPP---HEKPPPEYQPP---HGKQP---HVNPPPQYQPP-- 135
            P H+ PP    +  PPP + PP   H  PPP Y PP   H   P   H  PPP + PP  
Sbjct: 643  PVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702

Query: 136  -HEKPPHEHSPPGYQPPHEIPPPEHQPP----HEKPPHAKSPPE----YQPP----HEHP 276
             H  PP  HSPP   P H  PPP H PP       PP   SPP     Y PP    H  P
Sbjct: 703  VHSPPPPVHSPP--PPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPP 760

Query: 277  PPEYLPPHEKPPHENPPPEYNPP---HEKPP--HEHPSPEYQPPHQKPPHENPPPKFQPP 441
            PP + PP   P H  PPP ++PP   H  PP  H  P P + PP   P +  PPP F PP
Sbjct: 761  PPVHSPP-PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPP 819

Query: 442  NEKPPHEKSPPAS 480
             +  P    PPA+
Sbjct: 820  PK--PVTPLPPAT 830

 Score =  107 bits (266), Expect = 5e-22
 Identities = 68/187 (36%), Positives = 82/187 (43%), Gaps = 28/187 (14%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQP----PHEKPPHEHSPP 168
            P    P  E P PE + P  +PP + QPP  + P +  PP   P    P++  P +   P
Sbjct: 566  PKPQPPKQETPKPE-ESPKPQPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRP 624

Query: 169  GYQPPHEIP----------PPEHQPPHEKPPHAKSPPEYQPP---HEHPPPEYLPP---H 300
              QPP              PP H PP   P H+  PP + PP   H  PPP Y PP   H
Sbjct: 625  --QPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVH 682

Query: 301  EKPP---HENPPPEYNPP---HEKPP--HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPP 456
              PP   H  PPP ++PP   H  PP  H  P P + PP   PP  +PPP  Q P   P 
Sbjct: 683  SPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP---PPVHSPPPPVQSPPPPPV 739

Query: 457  HEKSPPA 477
                PPA
Sbjct: 740  FSPPPPA 746

 Score =  102 bits (253), Expect = 2e-20
 Identities = 65/165 (39%), Positives = 73/165 (44%), Gaps = 7/165 (4%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKP-------PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
            P+ A P  +  P    P  E+        PP + PP     H  PPP + PP   P H  
Sbjct: 613  PYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPP--PPMHSP 670

Query: 160  SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN 339
             PP Y PP    PP H PP   PP   SPP   P H  PPP + PP   PP  +PPP   
Sbjct: 671  PPPVYSPP----PPVHSPP---PPPVHSPPP--PVHSPPPPVHSPP---PPVHSPPP--- 715

Query: 340  PPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            P H  PP  H  P   PP Q PP   PPP F PP   P +   PP
Sbjct: 716  PVHSPPPPVHSPP---PPVQSPP---PPPVFSPPPPAPIYSPPPP 754

 Score =  101 bits (252), Expect = 2e-20
 Identities = 56/162 (34%), Positives = 73/162 (45%), Gaps = 7/162 (4%)
 Frame = +1

Query: 10  AKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKP-PHEHSPPGYQPPH 186
           +KP  E  P   QP  +   P ++P + K+P    P Q  P  E+P P   SP    P  
Sbjct: 433 SKPKPEESPKPQQPSPKPETPSHEPSNPKEPKPESPKQESPKTEQPKPKPESPKQESPKQ 492

Query: 187 EIPPPEHQPPHEKPPHAKSP------PEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           E P PE   P  + P  +S       PE  P  E P PE  P  + P  E P PE +P  
Sbjct: 493 EAPKPEQPKPKPESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKP 552

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           + P  E P PE  P  Q P  E P P+ + P  +PP ++ PP
Sbjct: 553 QPPKQETPKPEESPKPQPPKQETPKPE-ESPKPQPPKQEQPP 593

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 66/191 (34%), Positives = 79/191 (41%), Gaps = 39/191 (20%)
 Frame = +1

Query: 19   PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPP-HEIP 195
            P E+P PE   P E P P  QPP  + P     P+ QPP ++ P     P  QPP  E P
Sbjct: 519  PEESPKPEPPKPEESPKP--QPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETP 576

Query: 196  PPEH----QPP-HEKPPHAKSPPEYQPPHEHP---------------------------- 276
             PE     QPP  E+PP  ++P    PP E P                            
Sbjct: 577  KPEESPKPQPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQPPSPSTEETKT 636

Query: 277  -----PPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP 441
                 PP + PP   P H  PPP ++PP   P H  P P Y PP   PP  +PPP   P 
Sbjct: 637  TSPQSPPVHSPPPPPPVHSPPPPVFSPP--PPMHSPPPPVYSPP---PPVHSPPP--PPV 689

Query: 442  NEKPPHEKSPP 474
            +  PP   SPP
Sbjct: 690  HSPPPPVHSPP 700

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 66/189 (34%), Positives = 79/189 (41%), Gaps = 31/189 (16%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    P  E P PE + P  +PP +  P   + P   PP Q QPP  + P   SPP   P
Sbjct: 550  PKPQPPKQETPKPE-ESPKPQPPKQETPKPEESPKPQPPKQEQPPKTEAPKMGSPPLESP 608

Query: 181  ----PHEIPPPEH---QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPP--------- 312
                P++  P +    QPP       K+     PP   PPP   PP   PP         
Sbjct: 609  VPNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPP--PPVHSPPPPVFSPPPP 666

Query: 313  -HENPPPEYNPP---HEKPP---HEHPSPEYQPP---HQKPP--HENPPPKFQPP---NE 447
             H  PPP Y+PP   H  PP   H  P P + PP   H  PP  H  PPP   PP   + 
Sbjct: 667  MHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS 726

Query: 448  KPPHEKSPP 474
             PP  +SPP
Sbjct: 727  PPPPVQSPP 735

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 56/159 (35%), Positives = 63/159 (39%), Gaps = 1/159 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKP-PHEHSPPGYQ 177
           P H     + P PE  P  E P  E   P  + P    P Q  P  E+P P   SP    
Sbjct: 453 PSHEPSNPKEPKPE-SPKQESPKTEQPKPKPESPKQESPKQEAPKPEQPKPKPESPKQES 511

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
              E P PE  P  E P   +SP    P  E P PE  P  + P  E P PE +P  + P
Sbjct: 512 SKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPP 571

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             E P PE  P  Q P  E PP    P    PP E   P
Sbjct: 572 KQETPKPEESPKPQPPKQEQPPKTEAPKMGSPPLESPVP 610

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 72/250 (28%), Positives = 90/250 (36%), Gaps = 90/250 (36%)
 Frame = +1

Query: 1    PHHAKPP--YENPPPEYQPP----HEKPPPEYQPP---HGKQP--HVNPPPQYQPP---H 138
            P H+ PP  Y  PPP + PP    H  PPP + PP   H   P  H  PPP + PP   H
Sbjct: 666  PMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVH 725

Query: 139  EKPPHEHSPPG------------YQPP----HEIPPPEHQPP----HEKPP--HAKSPPE 252
              PP   SPP             Y PP    H  PPP H PP    H  PP  H+  PP 
Sbjct: 726  SPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPV 785

Query: 253  YQPP---HEHPPPEYLPPHEKPPHENPPPEYNP--------------------------- 342
            + PP   H  PPP + PP   P +  PPP ++P                           
Sbjct: 786  HSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAPTPSSSESG 845

Query: 343  ----PHEKPPHEH--------------------PSPEYQPPHQKPPHENPPPKFQPPNEK 450
                P + P  +                     PSP+ +P  + P   + P    P   +
Sbjct: 846  EISTPVQAPTPDSEDIEAPSDSNHSPVFKSSPAPSPDSEPEVEAPVPSSEPEVEAPKQSE 905

Query: 451  PPHEKSPPAS 480
                 SPP+S
Sbjct: 906  ATPSSSPPSS 915

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 70/232 (30%), Positives = 87/232 (37%), Gaps = 73/232 (31%)
 Frame = +1

Query: 1    PHHAKPP--YENPPPEYQPP---HEKPPPEYQPPHGKQ-----PHVNPPPQ---YQPP-- 135
            P H+ PP  +  PPP + PP   H  PPP + PP   Q     P  +PPP    Y PP  
Sbjct: 695  PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPP 754

Query: 136  --HEKPPHEHSPPG---YQPP---HEIPPPEHQPP---HEKPPHAKSPPEYQPPHEHPPP 282
              H  PP  HSPP    + PP   H  PPP H PP   H  PP   SPP   P +  PPP
Sbjct: 755  PVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPP 814

Query: 283  EYLPPHEK----PPHENP-------------------------------PPEYN------ 339
             + PP +     PP  +P                               P + N      
Sbjct: 815  VFSPPPKPVTPLPPATSPMANAPTPSSSESGEISTPVQAPTPDSEDIEAPSDSNHSPVFK 874

Query: 340  -----PPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKP-PHEKSPPA 477
                  P  +P  E P P  +P  + P      P   PP+  P P   +PP+
Sbjct: 875  SSPAPSPDSEPEVEAPVPSSEPEVEAPKQSEATPSSSPPSSNPSPDVTAPPS 926

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 59/202 (29%), Positives = 78/202 (38%), Gaps = 44/202 (21%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP----- 165
            P    P  E P P+ + P ++   +  P   + P   PP   + P  +PP + +P     
Sbjct: 490  PKQEAPKPEQPKPKPESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEES 549

Query: 166  PGYQPP-HEIPPPEH----QPPHEKPPHAKSPPEYQPP-HEHPPPEYLPPHEKPPHENP- 324
            P  QPP  E P PE     QPP ++ P  +  P+ QPP  E PP    P    PP E+P 
Sbjct: 550  PKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQEQPPKTEAPKMGSPPLESPV 609

Query: 325  --------------------------------PPEYNPPHEKPPHEHPSPEYQPPHQKPP 408
                                            PP ++PP   P H  P P + PP   P 
Sbjct: 610  PNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPP--PPM 667

Query: 409  HENPPPKFQPPNEKPPHEKSPP 474
            H  PPP + PP   P H   PP
Sbjct: 668  HSPPPPVYSPP--PPVHSPPPP 687

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 50/160 (31%), Positives = 73/160 (45%), Gaps = 2/160 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP-PQYQPPHEKPPHEHSPPGYQ 177
           P    P  E P P+ + P ++ P + + P  +QP   P  P+ +   ++PP     P  +
Sbjct: 468 PKQESPKTEQPKPKPESPKQESPKQ-EAPKPEQPKPKPESPKQESSKQEPPKPEESPKPE 526

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPP-HEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
           PP     P+ QPP ++ P  +  P+ QPP  E P PE  P  + P  E P PE +P  + 
Sbjct: 527 PPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQP 586

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P  E P     P    PP E+P P    P +  P +K  P
Sbjct: 587 PKQEQPPKTEAPKMGSPPLESPVP--NDPYDASPIKKRRP 624

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 50/159 (31%), Positives = 69/159 (43%), Gaps = 7/159 (4%)
 Frame = +1

Query: 19  PYENPPPEY-QPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           P   P P+  +P  E  PP  + P   +P  +P PQ   P  + P  H P   + P    
Sbjct: 409 PKPTPTPKAPEPKKEINPPNLEEPSKPKPEESPKPQQPSPKPETP-SHEPSNPKEPKPES 467

Query: 196 PPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPP-----HENPPPEYNPPHEKP 357
           P +  P  E+P P  +SP +  P  E P PE   P  + P      + PP     P  +P
Sbjct: 468 PKQESPKTEQPKPKPESPKQESPKQEAPKPEQPKPKPESPKQESSKQEPPKPEESPKPEP 527

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P    SP+ QPP Q+ P     PK QPP ++ P  +  P
Sbjct: 528 PKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESP 566

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 51/164 (31%), Positives = 71/164 (43%), Gaps = 7/164 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQP--HVNPPPQYQPPHEKPPHEHSPPGY 174
           P + K P    P +  P  E+P P+ + P  + P      P Q +P  E P  E S    
Sbjct: 457 PSNPKEPKPESPKQESPKTEQPKPKPESPKQESPKQEAPKPEQPKPKPESPKQESSKQEP 516

Query: 175 QPPHEIPPPEHQPPHE----KPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNP 342
             P E P PE   P E    +PP  ++P   + P   PP +  P  E+ P   PP +  P
Sbjct: 517 PKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETP 576

Query: 343 PHEKPPHEHPSPEYQPPHQKPPHENPPPKFQP-PNEKPPHEKSP 471
             E+ P   P  + QPP  + P    PP   P PN+  P++ SP
Sbjct: 577 KPEESPKPQPPKQEQPPKTEAPKMGSPPLESPVPND--PYDASP 618

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 49/147 (33%), Positives = 67/147 (45%), Gaps = 6/147 (4%)
 Frame = +1

Query: 52  PHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPP 231
           P  KP P  + P  K+  +NPP   +P   KP  E SP   QP  +   P H+P + K P
Sbjct: 407 PSPKPTPTPKAPEPKK-EINPPNLEEPSKPKP--EESPKPQQPSPKPETPSHEPSNPKEP 463

Query: 232 HAKSPPEYQPPHEHPPPE-YLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPP 408
             +SP +  P  E P P+   P  E P  E P PE   P  + P +  S +  P  ++ P
Sbjct: 464 KPESPKQESPKTEQPKPKPESPKQESPKQEAPKPEQPKPKPESPKQESSKQEPPKPEESP 523

Query: 409 HENPP-----PKFQPPNEKPPHEKSPP 474
              PP     PK QPP ++ P  +  P
Sbjct: 524 KPEPPKPEESPKPQPPKQETPKPEESP 550

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 46/157 (29%), Positives = 58/157 (36%), Gaps = 8/157 (5%)
 Frame = +1

Query: 1    PHHAKPP--YENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY 174
            P H+ PP  +  PPP + P    PPP + PP     +  PPP + PP +  P    PP  
Sbjct: 777  PVHSPPPPVHSPPPPVHSP----PPPVHSPPPPSPIYSPPPPVFSPPPK--PVTPLPPAT 830

Query: 175  QPPHEIPPPEHQPPHE--KPPHAKSPPEYQ---PPHEHPPPEYLPPHEKPPHENPPPEYN 339
             P    P P      E   P  A +P       P   +  P +       P   P  E  
Sbjct: 831  SPMANAPTPSSSESGEISTPVQAPTPDSEDIEAPSDSNHSPVFKSSPAPSPDSEPEVEAP 890

Query: 340  PPHEKPPHEHPSPEYQPPHQKPPHENPPPKF-QPPNE 447
             P  +P  E P      P   PP  NP P    PP+E
Sbjct: 891  VPSSEPEVEAPKQSEATPSSSPPSSNPSPDVTAPPSE 927

[51][TOP]
>UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO
          Length = 1765

 Score =  125 bits (313), Expect = 2e-27
 Identities = 65/160 (40%), Positives = 69/160 (43%), Gaps = 2/160 (1%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ- 177
            P    PP   PPP   PP   PPP   PP    P   PPP ++PP   PP    PP    
Sbjct: 1086 PSPPSPPSPPPPPPPSPP-PPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPD 1144

Query: 178  -PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
             PP   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP + PP   
Sbjct: 1145 APPPSPPPPPPSPPPSPPPSPPPPPSPMPP---PPPSPPPPRPPPPPSPPPPVHEPPPSP 1201

Query: 355  PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            PP  +PSP    P   PP   PPP   PP   PP    PP
Sbjct: 1202 PPPPNPSPPPPSPMPPPPSPMPPPPSPPPPSPPPPSPMPP 1241

 Score =  123 bits (309), Expect = 6e-27
 Identities = 66/161 (40%), Positives = 73/161 (45%), Gaps = 8/161 (4%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQ--PPHEKPPHEHSPPGYQPPHE 189
            PP   PPP   PP   PPP ++PP    P  +PPP     PP   PP   SPP   PP  
Sbjct: 1106 PPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPDAPPPSPPPPPPSPPPSPPPSP 1165

Query: 190  IPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHEN---PPPEYNPPHEK-- 354
             PPP   PP   PP +  PP   PP   PPP + PP   PP  N   PPP   PP     
Sbjct: 1166 PPPPSPMPP---PPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPSPM 1222

Query: 355  -PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P   PP   PP  +PPP    P   PP  +SPP
Sbjct: 1223 PPPPSPPPPSPPPPSPMPPPPSPPPPIPSPPPPPPTPRSPP 1263

 Score =  114 bits (284), Expect = 4e-24
 Identities = 62/163 (38%), Positives = 67/163 (41%), Gaps = 3/163 (1%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEK---PPHEHSPPG 171
            P H  PP   PPP   PP    PP   PP    P  +PPP   PP      PP    PP 
Sbjct: 1124 PVHEPPPSPPPPPSPPPPTPDAPPPSPPPPPPSPPPSPPPSPPPPPSPMPPPPPSPPPPR 1183

Query: 172  YQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHE 351
              PP   PPP H+PP   PP     P    P   PP    PP   PP   PPP   PP  
Sbjct: 1184 PPPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPSPMPPPPSPPPPSPPPPSPMPPPP 1243

Query: 352  KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
             PP   PSP   PP  + P   PPP    P +  P   SPP +
Sbjct: 1244 SPPPPIPSPPPPPPTPRSPPPAPPPL---PGDVDPTPASPPVT 1283

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 54/126 (42%), Positives = 58/126 (46%)
 Frame = +1

Query: 97   QPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP 276
            +P   PPP   P    PP   SPP   PP   PPP   PP  +PP   SPP   P HE P
Sbjct: 1075 RPCEKPPPPSPPSPPSPP---SPPPPPPPSPPPPPPPSPPPPRPPPPPSPPP--PVHEPP 1129

Query: 277  PPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPP 456
            P    PP   PP  + PP   PP   PP   PSP   PP   PP   PPP   PP  +PP
Sbjct: 1130 PSPPPPPSPPPPTPDAPPPSPPP--PPPSPPPSPPPSPP--PPPSPMPPPPPSPPPPRPP 1185

Query: 457  HEKSPP 474
               SPP
Sbjct: 1186 PPPSPP 1191

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 39/91 (42%), Positives = 42/91 (46%), Gaps = 2/91 (2%)
 Frame = +1

Query: 214  PHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPP 393
            P EKPP    P    PP   PPP   PP   PP   PPP   PP   PP   P P ++PP
Sbjct: 1076 PCEKPPPPSPPSPPSPPSPPPPP---PPSPPPP---PPPSPPPPRPPPPPSPPPPVHEPP 1129

Query: 394  HQKPPHENPPPKF--QPPNEKPPHEKSPPAS 480
               PP  +PPP     PP   PP   SPP S
Sbjct: 1130 PSPPPPPSPPPPTPDAPPPSPPPPPPSPPPS 1160

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 40/99 (40%), Positives = 43/99 (43%), Gaps = 6/99 (6%)
 Frame = +1

Query: 199  PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYL--PPHEKPPHENPPPEYNPP---HEKPPH 363
            P  +PP   PP   SPP   PP    PP     PP   PP   PPP  +PP   HE PP 
Sbjct: 1076 PCEKPPPPSPPSPPSPPSPPPP----PPPSPPPPPPPSPPPPRPPPPPSPPPPVHEPPPS 1131

Query: 364  EHPSPEYQPP-HQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              P P   PP    PP   PPP   PP   PP    PP+
Sbjct: 1132 PPPPPSPPPPTPDAPPPSPPPPPPSPPPSPPPSPPPPPS 1170

[52][TOP]
>UniRef100_UPI0000DA1F7B PREDICTED: similar to Loricrin n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA1F7B
          Length = 496

 Score =  125 bits (313), Expect = 2e-27
 Identities = 88/163 (53%), Positives = 92/163 (56%), Gaps = 11/163 (6%)
 Frame = -3

Query: 470 GDFS*GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGF--S*GGL-YSGGGFSCGGFS 300
           G  S GG S GG + GGG  CGG   GG   G G SCGG   S GG+ YSGG  S GG S
Sbjct: 33  GGGSGGGSSCGGGSSGGGSGCGGGGGGGGSYGGGSSCGGGGGSGGGVKYSGG--SSGGSS 90

Query: 299 CGGRYS--GGGCSCGGWYSGGDFA*GGFSCGGWCS---GGGISWGG*YPGG---ECSCGG 144
           CGG YS  GGG SCGG YSGG    GG SCGG  S   GGG S GG Y GG    C  GG
Sbjct: 91  CGGGYSGGGGGSSCGGGYSGGG---GGSSCGGGYSGGGGGGSSCGGGYSGGGGSSCGGGG 147

Query: 143 FSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFSYGG 15
           +S GG  CGGG   G    G  YSGG    GG   GGG+S GG
Sbjct: 148 YSGGGSSCGGG---GGSGGGVKYSGGSGGGGGSSCGGGYSGGG 187

 Score =  125 bits (313), Expect = 2e-27
 Identities = 89/184 (48%), Positives = 94/184 (51%), Gaps = 30/184 (16%)
 Frame = -3

Query: 476 AGGDFS*GGFSLGG-WNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GG------------- 339
           +GG  S GG S GG ++ GGG SCGG   GG+  G G SCGG S GG             
Sbjct: 240 SGGGGSGGGSSCGGGYSGGGGSSCGG---GGYSGGGGSSCGGGSSGGGGGGSSGSSQQYQ 296

Query: 338 LYSGGGFSCGGFSCGGRYS-GGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWGG*YPGG 162
             S GG S GG SCGG YS GGG SCGG YSGG    GG SCGG  SGGG S GG   GG
Sbjct: 297 CQSYGGGSSGGSSCGGGYSGGGGSSCGGGYSGG----GGSSCGGGSSGGGSSCGGGSGGG 352

Query: 161 ECSCGGFSCGG*YCGGGFT*GCFP*GGWYS---------------GGGFS*GGWYSGGGF 27
               GG SCGG   GGG        GG+YS               GGG S GG   GGG 
Sbjct: 353 YSGGGGGSCGGGSSGGG--------GGYYSSQQSSQTSCAPQQSYGGGSSGGGGSCGGGS 404

Query: 26  SYGG 15
           S GG
Sbjct: 405 SGGG 408

 Score =  121 bits (303), Expect = 3e-26
 Identities = 89/180 (49%), Positives = 94/180 (52%), Gaps = 27/180 (15%)
 Frame = -3

Query: 473 GGDFS*GG--FSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GGLYSGGGFSCGGFS 300
           GG +S GG   S GG + GGG  CGG   GG   G    CGG S GG YSGGG   GG S
Sbjct: 180 GGGYSGGGGGSSCGGGSGGGGSYCGGSSGGGSSGG----CGGGSGGGKYSGGGGG-GGSS 234

Query: 299 CGGRYSGGG-----CSCGGWYSGGDFA*GGFSC--GGWCSGGGISWGG*YPGG------- 162
           CGG YSGGG      SCGG YSGG    GG SC  GG+  GGG S GG   GG       
Sbjct: 235 CGGGYSGGGGSGGGSSCGGGYSGG----GGSSCGGGGYSGGGGSSCGGGSSGGGGGGSSG 290

Query: 161 -----EC------SCGGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFSYGG 15
                +C      S GG SCGG Y GGG   G    GG+  GGG S GG  SGGG S GG
Sbjct: 291 SSQQYQCQSYGGGSSGGSSCGGGYSGGG---GSSCGGGYSGGGGSSCGGGSSGGGSSCGG 347

 Score =  120 bits (302), Expect = 4e-26
 Identities = 84/152 (55%), Positives = 87/152 (57%), Gaps = 3/152 (1%)
 Frame = -3

Query: 476 AGGDFS*GGFSLGGWNFGGGFSCGGFW*-GGWYSGDGCSCGGFS*GGLYSGGGFSCGGFS 300
           +GG    GG   GG ++GGG SCGG    GG     G S GG S GG YSGGG   GG S
Sbjct: 47  SGGGSGCGGGGGGGGSYGGGSSCGGGGGSGGGVKYSGGSSGGSSCGGGYSGGG---GGSS 103

Query: 299 CGGRYS--GGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWGG*YPGGECSCGGFSCGG* 126
           CGG YS  GGG SCGG YSGG    GG SCGG  SGGG S  G   GG  S GG SCGG 
Sbjct: 104 CGGGYSGGGGGSSCGGGYSGG--GGGGSSCGGGYSGGGGSSCG---GGGYSGGGSSCGG- 157

Query: 125 YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGG 30
             GGG   G    GG   GGG S GG YSGGG
Sbjct: 158 --GGGSGGGVKYSGGSGGGGGSSCGGGYSGGG 187

 Score =  120 bits (301), Expect = 5e-26
 Identities = 87/173 (50%), Positives = 95/173 (54%), Gaps = 20/173 (11%)
 Frame = -3

Query: 473 GGDFS*GGFSL---GGWNFG-GGFSCGGFW*GGWYSGDGCSCGGFS*GGLYS--GGGFSC 312
           GG +S GG      GG++ G GG SCGG + GG   G  C  GG+S GG  S  GGG+S 
Sbjct: 92  GGGYSGGGGGSSCGGGYSGGGGGSSCGGGYSGGGGGGSSCG-GGYSGGGGSSCGGGGYSG 150

Query: 311 GGFSCGG--------RYS-----GGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWGG*Y 171
           GG SCGG        +YS     GGG SCGG YSGG    GG SCGG   GGG   GG  
Sbjct: 151 GGSSCGGGGGSGGGVKYSGGSGGGGGSSCGGGYSGGG---GGSSCGGGSGGGGSYCGGSS 207

Query: 170 PGGEC-SCGGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFSYGG 15
            GG    CGG S GG Y GGG   G    GG YSGGG S GG   GGG+S GG
Sbjct: 208 GGGSSGGCGGGSGGGKYSGGGGG-GGSSCGGGYSGGGGSGGGSSCGGGYSGGG 259

 Score =  120 bits (300), Expect = 6e-26
 Identities = 84/166 (50%), Positives = 87/166 (52%), Gaps = 13/166 (7%)
 Frame = -3

Query: 473 GGDFS*GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GGLYSGGGFSCGGFS-- 300
           GG    GG+S GG   GGG SCGG    G+  G G SCGG    G YSGGG SCGG    
Sbjct: 113 GGSSCGGGYSGGG---GGGSSCGG----GYSGGGGSSCGG----GGYSGGGSSCGGGGGS 161

Query: 299 ------CGGRYSGGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWGG*YPGGECS-CGGF 141
                  GG   GGG SCGG YSGG    GG SCGG   GGG   GG   GG    CGG 
Sbjct: 162 GGGVKYSGGSGGGGGSSCGGGYSGGG---GGSSCGGGSGGGGSYCGGSSGGGSSGGCGGG 218

Query: 140 SCGG*YCGGGFT*GCFP*GGWY----SGGGFS*GGWYSGGGFSYGG 15
           S GG Y GGG   G    GG+     SGGG S GG YSGGG S  G
Sbjct: 219 SGGGKYSGGGGGGGSSCGGGYSGGGGSGGGSSCGGGYSGGGGSSCG 264

 Score =  119 bits (299), Expect = 8e-26
 Identities = 85/161 (52%), Positives = 87/161 (54%), Gaps = 9/161 (5%)
 Frame = -3

Query: 470 GDFS*GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GGLYSGGGFSCGGFSCGG 291
           G  S GG   GG  + GG S GG   GG  SG G  CGG   GG   GGG SCGG    G
Sbjct: 17  GKTSGGGGGGGGGYYSGGGSGGGSSCGGGSSGGGSGCGGGGGGGGSYGGGSSCGGGGGSG 76

Query: 290 ---RYSG---GGCSCGGWYSGGDFA*GGFSCGGWCS--GGGISWGG*YPGGECSCGGFSC 135
              +YSG   GG SCGG YSGG    GG SCGG  S  GGG S GG Y GG    GG SC
Sbjct: 77  GGVKYSGGSSGGSSCGGGYSGGG---GGSSCGGGYSGGGGGSSCGGGYSGG--GGGGSSC 131

Query: 134 GG*YCGGGFT*GCFP*GGWYSGGGFS-*GGWYSGGGFSYGG 15
           GG Y GGG   G    GG YSGGG S  GG  SGGG  Y G
Sbjct: 132 GGGYSGGG---GSSCGGGGYSGGGSSCGGGGGSGGGVKYSG 169

 Score =  119 bits (298), Expect = 1e-25
 Identities = 89/174 (51%), Positives = 94/174 (54%), Gaps = 21/174 (12%)
 Frame = -3

Query: 473 GGDFS*GGFSL-GGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GGLY-----SGGGFS- 315
           GG  S GG    GG   GGG SCGG + GG   G G SCGG S GG       SGGG S 
Sbjct: 157 GGGGSGGGVKYSGGSGGGGGSSCGGGYSGG---GGGSSCGGGSGGGGSYCGGSSGGGSSG 213

Query: 314 -CGGFSCGGRYS----GGGCSCGGWYSGGDFA*GGFSCGGWCSGGGIS---WGG*YPGGE 159
            CGG S GG+YS    GGG SCGG YSGG  + GG SCGG  SGGG S    GG   GG 
Sbjct: 214 GCGGGSGGGKYSGGGGGGGSSCGGGYSGGGGSGGGSSCGGGYSGGGGSSCGGGGYSGGGG 273

Query: 158 CSCGGFSCGG*YCGGGFT*G------CFP*GGWYSGGGFS*GGWYSGGGFSYGG 15
            SCGG S GG   GGG + G      C   GG  SGG    GG+  GGG S GG
Sbjct: 274 SSCGGGSSGG---GGGGSSGSSQQYQCQSYGGGSSGGSSCGGGYSGGGGSSCGG 324

 Score =  117 bits (293), Expect = 4e-25
 Identities = 91/179 (50%), Positives = 96/179 (53%), Gaps = 24/179 (13%)
 Frame = -3

Query: 473 GGDFS*GGFSLGGWNFGGGFS-------CGGFW*GGWYSGDGCSCGGFS*GGLYSGGGFS 315
           GG  S GG S GG ++ GG S       CGG   GG YSG G   GG S GG YSGGG S
Sbjct: 187 GGGSSCGGGSGGGGSYCGGSSGGGSSGGCGGGSGGGKYSGGGGG-GGSSCGGGYSGGGGS 245

Query: 314 CGGFSCGGRYSGGG-CSCGGW-YSGGDFA*GGFSCGGWCSGGGISWGG*YPG-------- 165
            GG SCGG YSGGG  SCGG  YSGG    GG SCGG  SGGG   GG   G        
Sbjct: 246 GGGSSCGGGYSGGGGSSCGGGGYSGG----GGSSCGGGSSGGG---GGGSSGSSQQYQCQ 298

Query: 164 --GECSCGGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFS-----YGGFA 9
             G  S GG SCGG Y GGG   G    GG+  GGG S GG  SGGG S      GG++
Sbjct: 299 SYGGGSSGGSSCGGGYSGGG---GSSCGGGYSGGGGSSCGGGSSGGGSSCGGGSGGGYS 354

 Score =  116 bits (291), Expect = 7e-25
 Identities = 87/194 (44%), Positives = 93/194 (47%), Gaps = 41/194 (21%)
 Frame = -3

Query: 473 GGDFS*GGFSL---GGWNFGGGFSCGGFW*GGWYSGD-------------GCSCGGFS*G 342
           GG +S GG S    GG++ GGG SCGG   GG   G              G S GG S G
Sbjct: 252 GGGYSGGGGSSCGGGGYSGGGGSSCGGGSSGGGGGGSSGSSQQYQCQSYGGGSSGGSSCG 311

Query: 341 GLYSGGGFSC--------GGFSCGGRYSGGGCSCGGWYSGGDFA*GGFSCGGWCSGGG-- 192
           G YSGGG S         GG SCGG  SGGG SCGG   GG    GG SCGG  SGGG  
Sbjct: 312 GGYSGGGGSSCGGGYSGGGGSSCGGGSSGGGSSCGGGSGGGYSGGGGGSCGGGSSGGGGG 371

Query: 191 ---------------ISWGG*YPGGECSCGGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS 57
                           S+GG   GG  SCGG S GG   GGG + GC+  GG   GG   
Sbjct: 372 YYSSQQSSQTSCAPQQSYGGGSSGGGGSCGGGSSGG---GGGGSGGCYSSGG--GGGSGG 426

Query: 56  *GGWYSGGGFSYGG 15
            GG YSGGG   GG
Sbjct: 427 CGGGYSGGGGGCGG 440

 Score =  110 bits (274), Expect = 6e-23
 Identities = 89/177 (50%), Positives = 93/177 (52%), Gaps = 29/177 (16%)
 Frame = -3

Query: 473 GGDFS*GGFSL----GGWNFGGGFSCGGFW*GGWYSGDGCSCGGF--S*GGL-YSGGGFS 315
           GG +S GG       GG++ GGG SCGG    G YSG G SCGG   S GG+ YSGG   
Sbjct: 118 GGGYSGGGGGGSSCGGGYSGGGGSSCGG----GGYSGGGSSCGGGGGSGGGVKYSGGSGG 173

Query: 314 CGGFSCGGRYSGGG---------------C--SCGGWYSGGDFA*GGFSCGGWCS----G 198
            GG SCGG YSGGG               C  S GG  SGG    GG S GG  S    G
Sbjct: 174 GGGSSCGGGYSGGGGGSSCGGGSGGGGSYCGGSSGGGSSGGC---GGGSGGGKYSGGGGG 230

Query: 197 GGISWGG*YPGGECSCGGFSCGG*YCGGGFT*GCFP*GGWYS-GGGFS*GGWYSGGG 30
           GG S GG Y GG  S GG SCGG Y GGG   G    GG YS GGG S GG  SGGG
Sbjct: 231 GGSSCGGGYSGGGGSGGGSSCGGGYSGGG---GSSCGGGGYSGGGGSSCGGGSSGGG 284

 Score =  101 bits (251), Expect = 3e-20
 Identities = 74/170 (43%), Positives = 78/170 (45%), Gaps = 18/170 (10%)
 Frame = -3

Query: 473 GGDFS*GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GG---LYS--------- 330
           GG    GG S GG + GGG SCGG   GG+  G G SCGG S GG    YS         
Sbjct: 324 GGYSGGGGSSCGGGSSGGGSSCGGGSGGGYSGGGGGSCGGGSSGGGGGYYSSQQSSQTSC 383

Query: 329 ------GGGFSCGGFSCGGRYSGGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWGG*YP 168
                 GGG S GG SCGG  SGG    GG  SGG ++ GG    G C GG    GG   
Sbjct: 384 APQQSYGGGSSGGGGSCGGGSSGG----GGGGSGGCYSSGGGGGSGGCGGGYSGGGGGCG 439

Query: 167 GGECSCGGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFSYG 18
           GG     G  CGG Y GGG             GGG S GG  SGGG   G
Sbjct: 440 GGSSGGSGGGCGGGYSGGG-------------GGGSSCGGGSSGGGSGGG 476

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 52/99 (52%), Positives = 54/99 (54%)
 Frame = -3

Query: 476 AGGDFS*GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GGLYSGGGFSCGGFSC 297
           +GG  S GG S GG   GGG S G +  GG     GC       GG YSGGG  CGG S 
Sbjct: 394 SGGGGSCGGGSSGG---GGGGSGGCYSSGGGGGSGGC-------GGGYSGGGGGCGGGSS 443

Query: 296 GGRYSGGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWG 180
           GG  SGGG  CGG YSGG    GG SCGG  SGGG   G
Sbjct: 444 GG--SGGG--CGGGYSGG--GGGGSSCGGGSSGGGSGGG 476

[53][TOP]
>UniRef100_UPI0000DC09EF UPI0000DC09EF related cluster n=1 Tax=Rattus norvegicus
           RepID=UPI0000DC09EF
          Length = 483

 Score =  125 bits (313), Expect = 2e-27
 Identities = 89/184 (48%), Positives = 94/184 (51%), Gaps = 30/184 (16%)
 Frame = -3

Query: 476 AGGDFS*GGFSLGG-WNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GG------------- 339
           +GG  S GG S GG ++ GGG SCGG   GG+  G G SCGG S GG             
Sbjct: 227 SGGGGSGGGSSCGGGYSGGGGSSCGG---GGYSGGGGSSCGGGSSGGGGGGSSGSSQQYQ 283

Query: 338 LYSGGGFSCGGFSCGGRYS-GGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWGG*YPGG 162
             S GG S GG SCGG YS GGG SCGG YSGG    GG SCGG  SGGG S GG   GG
Sbjct: 284 CQSYGGGSSGGSSCGGGYSGGGGSSCGGGYSGG----GGSSCGGGSSGGGSSCGGGSGGG 339

Query: 161 ECSCGGFSCGG*YCGGGFT*GCFP*GGWYS---------------GGGFS*GGWYSGGGF 27
               GG SCGG   GGG        GG+YS               GGG S GG   GGG 
Sbjct: 340 YSGGGGGSCGGGSSGGG--------GGYYSSQQSSQTSCAPQQSYGGGSSGGGGSCGGGS 391

Query: 26  SYGG 15
           S GG
Sbjct: 392 SGGG 395

 Score =  122 bits (307), Expect = 9e-27
 Identities = 86/152 (56%), Positives = 88/152 (57%), Gaps = 5/152 (3%)
 Frame = -3

Query: 470 GDFS*GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGF--S*GGL-YSGGGFSCGGFS 300
           G  S GG S GG + GGG  CGG   GG   G G SCGG   S GG+ YSGG  S GG S
Sbjct: 33  GGGSGGGSSCGGGSSGGGSGCGGGGGGGGSYGGGSSCGGGGGSGGGVKYSGG--SSGGSS 90

Query: 299 CGGRYS--GGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWGG*YPGGECSCGGFSCGG* 126
           CGG YS  GGG SCGG YSGG    GG SCGG  SGGG   GG   GG  S GG SCGG 
Sbjct: 91  CGGGYSGGGGGSSCGGGYSGGG---GGSSCGGGYSGGG--GGGSSCGGGYSGGGSSCGG- 144

Query: 125 YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGG 30
             GGG   G    GG   GGG S GG YSGGG
Sbjct: 145 --GGGSGGGVKYSGGSGGGGGSSCGGGYSGGG 174

 Score =  122 bits (307), Expect = 9e-27
 Identities = 86/164 (52%), Positives = 89/164 (54%), Gaps = 11/164 (6%)
 Frame = -3

Query: 476 AGGDFS*GGFSLGGWNFGGGFSCGGFW*-GGWYSGDGCSCGGFS*GGLYSGGGFSCGGFS 300
           +GG    GG   GG ++GGG SCGG    GG     G S GG S GG YSGGG   GG S
Sbjct: 47  SGGGSGCGGGGGGGGSYGGGSSCGGGGGSGGGVKYSGGSSGGSSCGGGYSGGG---GGSS 103

Query: 299 CGGRYS--GGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWGG--------*YPGGECSC 150
           CGG YS  GGG SCGG YSGG    GG SCGG  SGGG S GG         Y GG    
Sbjct: 104 CGGGYSGGGGGSSCGGGYSGG--GGGGSSCGGGYSGGGSSCGGGGGSGGGVKYSGGSGGG 161

Query: 149 GGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFSYG 18
           GG SCGG Y GGG    C    G  SGGG S  G  SGGG S G
Sbjct: 162 GGSSCGGGYSGGGGGSSC----GGGSGGGGSYCGGSSGGGSSGG 201

 Score =  122 bits (305), Expect = 2e-26
 Identities = 86/172 (50%), Positives = 90/172 (52%), Gaps = 18/172 (10%)
 Frame = -3

Query: 476 AGGDFS*GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGG---------FS*GGLYSGG 324
           +GG    GG+S GG    GG SCGG + GG   G G SCGG          S GG YSGG
Sbjct: 86  SGGSSCGGGYSGGG----GGSSCGGGYSGG---GGGSSCGGGYSGGGGGGSSCGGGYSGG 138

Query: 323 GFSCGGFS--------CGGRYSGGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWGG*YP 168
           G SCGG           GG   GGG SCGG YSGG    GG SCGG   GGG   GG   
Sbjct: 139 GSSCGGGGGSGGGVKYSGGSGGGGGSSCGGGYSGGG---GGSSCGGGSGGGGSYCGGSSG 195

Query: 167 GGEC-SCGGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFSYGG 15
           GG    CGG S GG Y GGG   G    GG YSGGG S GG   GGG+S GG
Sbjct: 196 GGSSGGCGGGSGGGKYSGGGGG-GGSSCGGGYSGGGGSGGGSSCGGGYSGGG 246

 Score =  121 bits (303), Expect = 3e-26
 Identities = 89/180 (49%), Positives = 94/180 (52%), Gaps = 27/180 (15%)
 Frame = -3

Query: 473 GGDFS*GG--FSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GGLYSGGGFSCGGFS 300
           GG +S GG   S GG + GGG  CGG   GG   G    CGG S GG YSGGG   GG S
Sbjct: 167 GGGYSGGGGGSSCGGGSGGGGSYCGGSSGGGSSGG----CGGGSGGGKYSGGGGG-GGSS 221

Query: 299 CGGRYSGGG-----CSCGGWYSGGDFA*GGFSC--GGWCSGGGISWGG*YPGG------- 162
           CGG YSGGG      SCGG YSGG    GG SC  GG+  GGG S GG   GG       
Sbjct: 222 CGGGYSGGGGSGGGSSCGGGYSGG----GGSSCGGGGYSGGGGSSCGGGSSGGGGGGSSG 277

Query: 161 -----EC------SCGGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFSYGG 15
                +C      S GG SCGG Y GGG   G    GG+  GGG S GG  SGGG S GG
Sbjct: 278 SSQQYQCQSYGGGSSGGSSCGGGYSGGG---GSSCGGGYSGGGGSSCGGGSSGGGSSCGG 334

 Score =  119 bits (298), Expect = 1e-25
 Identities = 89/174 (51%), Positives = 94/174 (54%), Gaps = 21/174 (12%)
 Frame = -3

Query: 473 GGDFS*GGFSL-GGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GGLY-----SGGGFS- 315
           GG  S GG    GG   GGG SCGG + GG   G G SCGG S GG       SGGG S 
Sbjct: 144 GGGGSGGGVKYSGGSGGGGGSSCGGGYSGG---GGGSSCGGGSGGGGSYCGGSSGGGSSG 200

Query: 314 -CGGFSCGGRYS----GGGCSCGGWYSGGDFA*GGFSCGGWCSGGGIS---WGG*YPGGE 159
            CGG S GG+YS    GGG SCGG YSGG  + GG SCGG  SGGG S    GG   GG 
Sbjct: 201 GCGGGSGGGKYSGGGGGGGSSCGGGYSGGGGSGGGSSCGGGYSGGGGSSCGGGGYSGGGG 260

Query: 158 CSCGGFSCGG*YCGGGFT*G------CFP*GGWYSGGGFS*GGWYSGGGFSYGG 15
            SCGG S GG   GGG + G      C   GG  SGG    GG+  GGG S GG
Sbjct: 261 SSCGGGSSGG---GGGGSSGSSQQYQCQSYGGGSSGGSSCGGGYSGGGGSSCGG 311

 Score =  117 bits (293), Expect = 4e-25
 Identities = 91/179 (50%), Positives = 96/179 (53%), Gaps = 24/179 (13%)
 Frame = -3

Query: 473 GGDFS*GGFSLGGWNFGGGFS-------CGGFW*GGWYSGDGCSCGGFS*GGLYSGGGFS 315
           GG  S GG S GG ++ GG S       CGG   GG YSG G   GG S GG YSGGG S
Sbjct: 174 GGGSSCGGGSGGGGSYCGGSSGGGSSGGCGGGSGGGKYSGGGGG-GGSSCGGGYSGGGGS 232

Query: 314 CGGFSCGGRYSGGG-CSCGGW-YSGGDFA*GGFSCGGWCSGGGISWGG*YPG-------- 165
            GG SCGG YSGGG  SCGG  YSGG    GG SCGG  SGGG   GG   G        
Sbjct: 233 GGGSSCGGGYSGGGGSSCGGGGYSGG----GGSSCGGGSSGGG---GGGSSGSSQQYQCQ 285

Query: 164 --GECSCGGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFS-----YGGFA 9
             G  S GG SCGG Y GGG   G    GG+  GGG S GG  SGGG S      GG++
Sbjct: 286 SYGGGSSGGSSCGGGYSGGG---GSSCGGGYSGGGGSSCGGGSSGGGSSCGGGSGGGYS 341

 Score =  116 bits (291), Expect = 7e-25
 Identities = 88/172 (51%), Positives = 93/172 (54%), Gaps = 18/172 (10%)
 Frame = -3

Query: 476 AGGDFS*GGFSLGGWNFGGGFSCGGFW*--GGWYSGDGCSCGGFS*GGLYSGGGFSCGGF 303
           +GG     G S GG + GGG+S GG     GG YSG G   GG S GG YSGGG   GG 
Sbjct: 75  SGGGVKYSGGSSGGSSCGGGYSGGGGGSSCGGGYSGGG---GGSSCGGGYSGGGG--GGS 129

Query: 302 SCGGRYSGGGCSCGGW--------YSGGDFA*GGFSCGGWCSGGG--ISWGG*YPGGECS 153
           SCGG YSGGG SCGG         YSGG    GG SCGG  SGGG   S GG   GG   
Sbjct: 130 SCGGGYSGGGSSCGGGGGSGGGVKYSGGSGGGGGSSCGGGYSGGGGGSSCGGGSGGGGSY 189

Query: 152 CGGFSCGG*Y--CGGGFT*GCFP*GGWYSG----GGFS*GGWYSGGGFSYGG 15
           CGG S GG    CGGG   G +  GG   G    GG+S GG  SGGG S GG
Sbjct: 190 CGGSSGGGSSGGCGGGSGGGKYSGGGGGGGSSCGGGYSGGGG-SGGGSSCGG 240

 Score =  116 bits (291), Expect = 7e-25
 Identities = 87/194 (44%), Positives = 93/194 (47%), Gaps = 41/194 (21%)
 Frame = -3

Query: 473 GGDFS*GGFSL---GGWNFGGGFSCGGFW*GGWYSGD-------------GCSCGGFS*G 342
           GG +S GG S    GG++ GGG SCGG   GG   G              G S GG S G
Sbjct: 239 GGGYSGGGGSSCGGGGYSGGGGSSCGGGSSGGGGGGSSGSSQQYQCQSYGGGSSGGSSCG 298

Query: 341 GLYSGGGFSC--------GGFSCGGRYSGGGCSCGGWYSGGDFA*GGFSCGGWCSGGG-- 192
           G YSGGG S         GG SCGG  SGGG SCGG   GG    GG SCGG  SGGG  
Sbjct: 299 GGYSGGGGSSCGGGYSGGGGSSCGGGSSGGGSSCGGGSGGGYSGGGGGSCGGGSSGGGGG 358

Query: 191 ---------------ISWGG*YPGGECSCGGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS 57
                           S+GG   GG  SCGG S GG   GGG + GC+  GG   GG   
Sbjct: 359 YYSSQQSSQTSCAPQQSYGGGSSGGGGSCGGGSSGG---GGGGSGGCYSSGG--GGGSGG 413

Query: 56  *GGWYSGGGFSYGG 15
            GG YSGGG   GG
Sbjct: 414 CGGGYSGGGGGCGG 427

 Score =  114 bits (286), Expect = 3e-24
 Identities = 85/160 (53%), Positives = 89/160 (55%), Gaps = 7/160 (4%)
 Frame = -3

Query: 473 GGDFS*GGFSLGGWNFGGGFSCGG-FW*GGWYSGDGCSCGGFS*GGL-YSGGGFSCGGFS 300
           GG    GG+S GG   GGG SCGG +  G    G  C  GG S GG+ YSGG    GG S
Sbjct: 113 GGSSCGGGYSGGG---GGGSSCGGGYSGG----GSSCGGGGGSGGGVKYSGGSGGGGGSS 165

Query: 299 CGGRYS--GGGCSCGGWYSGGDFA*GGFSCGGWCSG-GGISWGG*YPGGECSCGGFSCGG 129
           CGG YS  GGG SCGG   GG    GG S GG   G GG S GG Y GG    GG SCGG
Sbjct: 166 CGGGYSGGGGGSSCGGGSGGGGSYCGGSSGGGSSGGCGGGSGGGKYSGGG-GGGGSSCGG 224

Query: 128 *YCGGGFT*GCFP*GGWYSGGGFS--*GGWYSGGGFSYGG 15
            Y GGG + G    GG YSGGG S   GG YSGGG S  G
Sbjct: 225 GYSGGGGSGGGSSCGGGYSGGGGSSCGGGGYSGGGGSSCG 264

 Score =  107 bits (268), Expect = 3e-22
 Identities = 78/148 (52%), Positives = 80/148 (54%), Gaps = 11/148 (7%)
 Frame = -3

Query: 425 GGGFSCGGFW*GGWYSGDGCSCGGFS*GGLYSGGGFSCGGFSCGGRYSGGGCSCGGW--- 255
           GGG   GG++ GG  SG G SCGG S     SGGG  CGG   GG   GGG SCGG    
Sbjct: 22  GGGGGGGGYYSGGG-SGGGSSCGGGS-----SGGGSGCGGGGGGGGSYGGGSSCGGGGGS 75

Query: 254 -----YSGGDFA*GGFSCGGWCS--GGGISWGG*YPGGECSCGGFSCGG*YCGGGFT*GC 96
                YSGG    GG SCGG  S  GGG S GG Y GG    GG SCGG Y GGG   G 
Sbjct: 76  GGGVKYSGGSS--GGSSCGGGYSGGGGGSSCGGGYSGGG---GGSSCGGGYSGGGG--GG 128

Query: 95  FP*GGWYSGGGFS-*GGWYSGGGFSYGG 15
              GG YSGGG S  GG  SGGG  Y G
Sbjct: 129 SSCGGGYSGGGSSCGGGGGSGGGVKYSG 156

 Score =  101 bits (251), Expect = 3e-20
 Identities = 74/170 (43%), Positives = 78/170 (45%), Gaps = 18/170 (10%)
 Frame = -3

Query: 473 GGDFS*GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GG---LYS--------- 330
           GG    GG S GG + GGG SCGG   GG+  G G SCGG S GG    YS         
Sbjct: 311 GGYSGGGGSSCGGGSSGGGSSCGGGSGGGYSGGGGGSCGGGSSGGGGGYYSSQQSSQTSC 370

Query: 329 ------GGGFSCGGFSCGGRYSGGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWGG*YP 168
                 GGG S GG SCGG  SGG    GG  SGG ++ GG    G C GG    GG   
Sbjct: 371 APQQSYGGGSSGGGGSCGGGSSGG----GGGGSGGCYSSGGGGGSGGCGGGYSGGGGGCG 426

Query: 167 GGECSCGGFSCGG*YCGGGFT*GCFP*GGWYSGGGFS*GGWYSGGGFSYG 18
           GG     G  CGG Y GGG             GGG S GG  SGGG   G
Sbjct: 427 GGSSGGSGGGCGGGYSGGG-------------GGGSSCGGGSSGGGSGGG 463

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 52/99 (52%), Positives = 54/99 (54%)
 Frame = -3

Query: 476 AGGDFS*GGFSLGGWNFGGGFSCGGFW*GGWYSGDGCSCGGFS*GGLYSGGGFSCGGFSC 297
           +GG  S GG S GG   GGG S G +  GG     GC       GG YSGGG  CGG S 
Sbjct: 381 SGGGGSCGGGSSGG---GGGGSGGCYSSGGGGGSGGC-------GGGYSGGGGGCGGGSS 430

Query: 296 GGRYSGGGCSCGGWYSGGDFA*GGFSCGGWCSGGGISWG 180
           GG  SGGG  CGG YSGG    GG SCGG  SGGG   G
Sbjct: 431 GG--SGGG--CGGGYSGG--GGGGSSCGGGSSGGGSGGG 463

[54][TOP]
>UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q8L685_VOLCA
          Length = 1009

 Score =  124 bits (312), Expect = 2e-27
 Identities = 65/158 (41%), Positives = 66/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

 Score =  124 bits (310), Expect = 4e-27
 Identities = 66/158 (41%), Positives = 66/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP   SPP
Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680

 Score =  124 bits (310), Expect = 4e-27
 Identities = 66/158 (41%), Positives = 66/158 (41%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 554  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 614  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               PSP   PP   PP   PPP   PP   PP    PP
Sbjct: 674  PLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711

 Score =  123 bits (309), Expect = 6e-27
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

 Score =  123 bits (309), Expect = 6e-27
 Identities = 65/157 (41%), Positives = 65/157 (41%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 551  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 611  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
               P P   PP   PP   PPP   PP   PPH   P
Sbjct: 671  PPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707

 Score =  123 bits (308), Expect = 7e-27
 Identities = 65/158 (41%), Positives = 66/158 (41%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 531  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 591  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               P P   PP   PP   PPP   PP+  PP    PP
Sbjct: 651  PPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688

 Score =  122 bits (307), Expect = 9e-27
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 221 PPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 66/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/159 (40%), Positives = 66/159 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              P P   PP   PP   PPP   PP   PP    PP+
Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683

 Score =  122 bits (306), Expect = 1e-26
 Identities = 65/158 (41%), Positives = 65/158 (41%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 542  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 602  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               P P   PP   PP   PPP   PP   PP    PP
Sbjct: 662  PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699

 Score =  121 bits (303), Expect = 3e-26
 Identities = 63/153 (41%), Positives = 64/153 (41%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP   PPP   PP   PP    PP    P + PPP   PP   PP    PP   PP   P
Sbjct: 210 PPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
           PP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP   P 
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 376 PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   PP   PP   PPP   PP   PP    PP
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

 Score =  121 bits (303), Expect = 3e-26
 Identities = 66/161 (40%), Positives = 67/161 (41%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 563  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 623  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPASC 483
               P P   PP   PP   PPP   PP   PP   + P SC
Sbjct: 683  PPPPPPPPPPPPPPPP---PPPPHPPPPSPPPLVPALPPSC 720

 Score =  120 bits (301), Expect = 5e-26
 Identities = 62/149 (41%), Positives = 63/149 (42%)
 Frame = +1

Query: 28  NPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEH 207
           NPPP   PP    PP   PP    P  +PPP   PP   PP    PP   PP   PPP  
Sbjct: 208 NPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267

Query: 208 QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQ 387
            PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP   P P   
Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

Query: 388 PPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP   PP   PPP   PP   PP    PP
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

 Score =  120 bits (300), Expect = 6e-26
 Identities = 63/153 (41%), Positives = 64/153 (41%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP  +PPP    P   PPP   PP    P   PPP   PP   PP    PP   PP   P
Sbjct: 209 PPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
           PP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP   P 
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

Query: 376 PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   PP   PP   PPP   PP   PP    PP
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

 Score =  120 bits (300), Expect = 6e-26
 Identities = 64/158 (40%), Positives = 64/158 (40%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 548  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 608  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               P P   P    PP   PPP   PP   PP    PP
Sbjct: 668  PPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705

 Score =  119 bits (299), Expect = 8e-26
 Identities = 64/158 (40%), Positives = 64/158 (40%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   P P   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 209 PPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

 Score =  119 bits (299), Expect = 8e-26
 Identities = 64/158 (40%), Positives = 65/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP    PP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 210 PPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

 Score =  119 bits (299), Expect = 8e-26
 Identities = 65/158 (41%), Positives = 66/158 (41%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 219 PLPPSPPPPSPPP---PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP   PPP   PP   PP    PP
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

 Score =  119 bits (299), Expect = 8e-26
 Identities = 64/158 (40%), Positives = 65/158 (41%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 540  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 600  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               P P   PP   P   +PPP   PP   PP    PP
Sbjct: 660  PPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697

 Score =  119 bits (299), Expect = 8e-26
 Identities = 65/160 (40%), Positives = 65/160 (40%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 549  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 609  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
               P P    P   PP   PPP   PP   PP    PP S
Sbjct: 669  PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPS 708

 Score =  119 bits (297), Expect = 1e-25
 Identities = 64/158 (40%), Positives = 64/158 (40%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 530  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 590  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               P P   PP   PP   PPP    P   PP    PP
Sbjct: 650  PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687

 Score =  119 bits (297), Expect = 1e-25
 Identities = 64/158 (40%), Positives = 64/158 (40%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 536  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 596  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               P P   PP   PP    PP   PP   PP    PP
Sbjct: 656  PPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693

 Score =  119 bits (297), Expect = 1e-25
 Identities = 64/158 (40%), Positives = 64/158 (40%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 537  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 597  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               P P   PP   PP   PP    PP   PP    PP
Sbjct: 657  PPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694

 Score =  119 bits (297), Expect = 1e-25
 Identities = 64/158 (40%), Positives = 64/158 (40%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 539  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 599  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               P P   PP   PP    PP   PP   PP    PP
Sbjct: 659  PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696

 Score =  119 bits (297), Expect = 1e-25
 Identities = 64/158 (40%), Positives = 64/158 (40%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 541  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 601  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               P P   PP    P   PPP   PP   PP    PP
Sbjct: 661  PPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698

 Score =  119 bits (297), Expect = 1e-25
 Identities = 64/158 (40%), Positives = 64/158 (40%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 545  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 605  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               P P   P    PP   PPP   PP   PP    PP
Sbjct: 665  PPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702

 Score =  118 bits (296), Expect = 2e-25
 Identities = 64/158 (40%), Positives = 64/158 (40%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 538  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 598  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               P P   PP   PP   P P   PP   PP    PP
Sbjct: 658  PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695

 Score =  116 bits (290), Expect = 9e-25
 Identities = 63/153 (41%), Positives = 63/153 (41%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP    PP   PP   PPP   PP    P   PPP   PP   PP    PP   PP   P
Sbjct: 218 PPLPPSPPPPSPP--PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
           PP   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP   P 
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

Query: 376 PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   PP   PP   PPP   PP   PP    PP
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

 Score =  112 bits (281), Expect = 1e-23
 Identities = 59/144 (40%), Positives = 59/144 (40%)
 Frame = +1

Query: 43  YQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHE 222
           Y PP   PPP    P    P   PPP   PP   PP    PP   PP   PPP   PP  
Sbjct: 207 YNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 266

Query: 223 KPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQK 402
            PP    PP   PP   PPP   PP   PP   PPP   PP   PP   P P   PP   
Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

Query: 403 PPHENPPPKFQPPNEKPPHEKSPP 474
           PP   PPP   PP   PP    PP
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPP 350

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/102 (42%), Positives = 44/102 (43%)
 Frame = +1

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           GY PP   PPP    P   PP +  PP   PP   PPP   PP   PP   PPP   PP 
Sbjct: 206 GYNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P   PP   PP   PPP   PP   PP    PP
Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 27/74 (36%), Positives = 30/74 (40%)
 Frame = +1

Query: 253 YQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKF 432
           Y  P +  P   +  +  PP   PPP   PP   PP   P P   PP   PP   PPP  
Sbjct: 192 YDTPCQCCPVSTVIGYNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPP 251

Query: 433 QPPNEKPPHEKSPP 474
            PP   PP    PP
Sbjct: 252 PPPPPPPPPPPPPP 265

[55][TOP]
>UniRef100_C1PGW1 Tracheary element differentiation-related 7A n=1 Tax=Zinnia
           violacea RepID=C1PGW1_ZINEL
          Length = 300

 Score =  124 bits (312), Expect = 2e-27
 Identities = 71/164 (43%), Positives = 75/164 (45%), Gaps = 5/164 (3%)
 Frame = +1

Query: 1   PHHAKP-PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           PH   P P   PPP    P   PP    PP    PH  PPP   PPH  PP  H  P   
Sbjct: 11  PHFPPPSPAATPPPAPTTPSTPPPHFISPP----PHSVPPPS--PPHSVPPPLHPVPPPS 64

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQ-PPHEHPPPEYLPPHEKP---PHENPPPEYNPP 345
           PPH + PP H  P   PPH  SPP +  PP   P P + PPH  P   PH  PPP    P
Sbjct: 65  PPHPVSPPPHTVPPPSPPHPVSPPPHTVPPPSPPHPVFPPPHTVPPPSPHFVPPPPNMVP 124

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              PPH +P P   PPH  P    PPP   PP   PPH   PPA
Sbjct: 125 PPSPPHANPPPP-PPPHSVP----PPPHTVPPPPPPPHIIPPPA 163

 Score =  124 bits (312), Expect = 2e-27
 Identities = 70/166 (42%), Positives = 77/166 (46%), Gaps = 8/166 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEY--QPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY 174
           P  A      PPP +   PPH  PPP   PPH   P ++P P   PPH   P  H+ P  
Sbjct: 22  PPPAPTTPSTPPPHFISPPPHSVPPPS--PPHSVPPPLHPVPPPSPPHPVSPPPHTVPPP 79

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQ--PPHEH--PPPEYLPPHEKPPHENPPPEYNP 342
            PPH + PP H  P   PPH   PP +   PP  H  PPP  + P   PPH NPPP   P
Sbjct: 80  SPPHPVSPPPHTVPPPSPPHPVFPPPHTVPPPSPHFVPPPPNMVPPPSPPHANPPPP-PP 138

Query: 343 PHEKPPHEHPSPEYQPPHQKPPHENPPP--KFQPPNEKPPHEKSPP 474
           PH  PP  H  P    P   PPH  PPP     PP   PPH   PP
Sbjct: 139 PHSVPPPPHTVP----PPPPPPHIIPPPAHALSPP---PPHIIPPP 177

 Score =  110 bits (276), Expect = 4e-23
 Identities = 65/148 (43%), Positives = 68/148 (45%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P H  PP   P P   PPH  PPP    P    PH  PPP    P   PPH   PP    
Sbjct: 56  PLHPVPPPSPPHPVSPPPHTVPPPSPPHPVSPPPHTVPPPSPPHPVFPPPHTVPPPS--- 112

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           PH +PPP +  P   PPHA  PP   PPH  PP    PPH  PP   PPP   PPH  PP
Sbjct: 113 PHFVPPPPNMVPPPSPPHANPPPP-PPPHSVPP----PPHTVPP---PPP---PPHIIPP 161

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPN 444
              P+    PP   PPH  PPP   P N
Sbjct: 162 ---PAHALSPP---PPHIIPPPPPSPSN 183

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 48/110 (43%), Positives = 50/110 (45%), Gaps = 2/110 (1%)
 Frame = +1

Query: 157 HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY 336
           H PP    P   PPP    P   PPH  SPP    PH  PPP   PPH  PP  +P P  
Sbjct: 12  HFPP--PSPAATPPPAPTTPSTPPPHFISPP----PHSVPPPS--PPHSVPPPLHPVPPP 63

Query: 337 NPPHEKPPHEHPSPEYQPPH--QKPPHENPPPKFQPPNEKPPHEKSPPAS 480
           +PPH   P  H  P   PPH    PPH  PPP    P   PPH   PP S
Sbjct: 64  SPPHPVSPPPHTVPPPSPPHPVSPPPHTVPPPSPPHPVFPPPHT-VPPPS 112

[56][TOP]
>UniRef100_Q84JV0 Putative cell wall protein n=1 Tax=Arabidopsis thaliana
           RepID=Q84JV0_ARATH
          Length = 288

 Score =  124 bits (311), Expect = 3e-27
 Identities = 76/179 (42%), Positives = 97/179 (54%), Gaps = 23/179 (12%)
 Frame = +1

Query: 16  PPYENPPPEYQPP---HEKPPPEYQPPHGKQPHVN---PPPQYQPPHEK--PPHEHSPP- 168
           PPYE+PP +Y PP   +  PP +Y PP    P +    PP QY PP +K  PP ++SPP 
Sbjct: 78  PPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPF 137

Query: 169 -GYQPPHEIPPP--EHQPP-HEKPPHAKSPPE--YQPP-HEHPPPEYLPPHEK---PPHE 318
             Y PP + PPP  ++ PP H  PP  K PP+  Y PP  ++PPPE  PP  K   PP +
Sbjct: 138 KKYPPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQ 197

Query: 319 NPPP--EYNPPHEK--PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPASC 483
            PPP  +Y PP +K  PP E+P P    PH  PP + PPP ++     P     PP  C
Sbjct: 198 YPPPIKKYPPPIKKYPPPEEYPPPIKTYPH--PPVKYPPPPYKTYPHPPIKTYPPPKEC 254

 Score =  124 bits (310), Expect = 4e-27
 Identities = 83/212 (39%), Positives = 104/212 (49%), Gaps = 53/212 (25%)
 Frame = +1

Query: 1   PHHAKPPYENPPP---------EYQPPHEKPPP--EYQPPHGKQPHVN---PPPQYQPPH 138
           P +  PP + PPP         +Y PP + PPP  +Y PP    P +    PP QY PP 
Sbjct: 78  PPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPF 137

Query: 139 EK-PPHEHSPPGYQPPHEIPPPEHQPPHEK--PPHAKSPP---EYQPPHEHPPP--EYLP 294
           +K PP E  PP   P  + PPPEH PP  K  PP  + PP   +Y PP ++PPP  +Y P
Sbjct: 138 KKYPPPEQYPP---PIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPP 194

Query: 295 PHEKPP--HENPPP--EYNPPHEKPP----HEHPSPEYQPPHQK-----------PPHEN 417
           P + PP   + PPP  +Y PP E PP    + HP  +Y PP  K           PP E 
Sbjct: 195 PEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKEC 254

Query: 418 PPP----------KFQPPNE--KPPHEKSPPA 477
           PPP          K+ PP E   PP++K PPA
Sbjct: 255 PPPPEHYPWPPKKKYPPPVEYPSPPYKKYPPA 286

 Score =  113 bits (283), Expect = 6e-24
 Identities = 74/189 (39%), Positives = 94/189 (49%), Gaps = 32/189 (16%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVN--PPPQYQ-PPHEKPP----HEHS 162
           HH  P    P   Y PP   P  +Y PP    P +   PPP Y+ PP + PP    + H 
Sbjct: 38  HHWPPFKWGPKFPYSPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHP 97

Query: 163 PPGYQPPHEIPPP--EHQPPHEKPPHAKS---PPEYQPP-HEHPPPEYLPPHEK---PPH 315
           P  Y PP + PPP  ++ PP + PP  K    P +Y PP  ++PPPE  PP  K   PP 
Sbjct: 98  PVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPE 157

Query: 316 ENPPP--------EYNPPHEK--PPHEHPSP--EYQPPHQKPP--HENPPP--KFQPPNE 447
             PPP        +Y PP +K  PP ++P P  +Y PP Q PP   + PPP  K+ PP E
Sbjct: 158 HYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEE 217

Query: 448 KPPHEKSPP 474
            PP  K+ P
Sbjct: 218 YPPPIKTYP 226

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 64/155 (41%), Positives = 74/155 (47%), Gaps = 15/155 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPE--YQPPHEK-PPPE-YQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P H  PP +  PP+  Y PP +K PPPE Y PP  K P   PP QY PP +K P    PP
Sbjct: 156 PEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYP---PPEQYPPPIKKYP----PP 208

Query: 169 --GYQPPHEIPPP----EHQPPHEKPPHAKSPPE-----YQPPHEHPPPEYLPPHEKPPH 315
              Y PP E PPP     H P    PP  K+ P      Y PP E PPP        P H
Sbjct: 209 IKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPP--------PEH 260

Query: 316 ENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP 420
              PP+   P   PP E+PS    PP++K P  +P
Sbjct: 261 YPWPPKKKYP---PPVEYPS----PPYKKYPPADP 288

[57][TOP]
>UniRef100_A4R5L4 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea
           RepID=A4R5L4_MAGGR
          Length = 737

 Score =  124 bits (311), Expect = 3e-27
 Identities = 71/171 (41%), Positives = 81/171 (47%), Gaps = 16/171 (9%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHV--NPPPQYQPPHE-KPPHEHSPPGYQ-- 177
           KPP   PPP  +PP   PPP  +PP   +P +  NPPP  +PP   KPP    PP     
Sbjct: 320 KPPPNKPPPGGRPPPSNPPPPVRPPPPGEPPLPDNPPPPDEPPVSGKPPPGDEPPASARP 379

Query: 178 -------PPHEIPPPEHQPPHEKPPHAKSPP----EYQPPHEHPPPEYLPPHEKPPHENP 324
                  PP   PPP+  PP ++PP    PP    E  PP E PPP   PP + PP  N 
Sbjct: 380 PPPDRPPPPDRPPPPDEPPPPDEPPPPSEPPPPPNEPPPPDEPPPPNESPPPDAPPPPNE 439

Query: 325 PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           PP   PP   PP + P P   PP   PP E PPP   P  E PP    PPA
Sbjct: 440 PP---PPDAPPPPDAPPPPDAPP---PPDEPPPPGEPPALEGPPAGGKPPA 484

 Score =  117 bits (292), Expect = 5e-25
 Identities = 68/175 (38%), Positives = 87/175 (49%), Gaps = 16/175 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPP------HGKQPHVNPPPQYQP-PHEKPPHEH 159
           P  A PP   PPP  +PP + PPP  +PP       GK P  + PP  +P P  +PP ++
Sbjct: 28  PAPASPPPNRPPPPVRPPADNPPPPGKPPPNKLEGFGKPPAPDSPPPNRPLPPVRPPADN 87

Query: 160 -SPPGYQPPHEI-----PPPEHQPPHEKPPHAKSPPEYQPP-HEHPPPEYLPPHEKPPHE 318
             PPG  PP+++     PP    PP  KPP  K     +PP    PPP   PP  +PP +
Sbjct: 88  PPPPGKPPPNKLEGFGKPPAPASPPPGKPPPNKLEGFGKPPAPASPPPNRPPPPVRPPAD 147

Query: 319 NPPPEYNPPHEKPP--HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           NPPP   PP  K       P+P+  PP++ PP   PP   +PP  KPP    PPA
Sbjct: 148 NPPPPGKPPPNKLEGFGRPPAPDSPPPNRPPPPVRPPGLGRPPPNKPPPPVEPPA 202

 Score =  115 bits (288), Expect = 2e-24
 Identities = 69/197 (35%), Positives = 83/197 (42%), Gaps = 39/197 (19%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEK-------PPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
           P   +PP +NPPP  +PP  K       P P+  PP+   P V PP    PP  KPP   
Sbjct: 39  PPPVRPPADNPPPPGKPPPNKLEGFGKPPAPDSPPPNRPLPPVRPPADNPPPPGKPPPNK 98

Query: 160 SPPGYQPPHEIPPPEHQPPHEK------------PPHAKSPPEYQPPHEHPPPEYLPPHE 303
                +PP    PP  +PP  K            PP  + PP  +PP ++PPP   PP  
Sbjct: 99  LEGFGKPPAPASPPPGKPPPNKLEGFGKPPAPASPPPNRPPPPVRPPADNPPPPGKPPPN 158

Query: 304 K------------PPHENPPPEYNPP--------HEKPPHEHPSPEYQPPHQKPPHENPP 423
           K            PP   PPP   PP           PP E P+PE  P   KPP   PP
Sbjct: 159 KLEGFGRPPAPDSPPPNRPPPPVRPPGLGRPPPNKPPPPVEPPAPERAPAPGKPPPSKPP 218

Query: 424 PKFQPPNEKPPHEKSPP 474
           P  +PP  +PP  K PP
Sbjct: 219 PPARPPG-RPPASKPPP 234

 Score =  114 bits (286), Expect = 3e-24
 Identities = 64/164 (39%), Positives = 79/164 (48%), Gaps = 6/164 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHE------KPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHS 162
           P   +PP   PPP  +PP        KPPP      GK P   PPP  +PP   PP    
Sbjct: 283 PAPGRPPPNKPPPPDRPPPSRLAGSGKPPPSKLAGSGKPPPNKPPPGGRPPPSNPPPPVR 342

Query: 163 PPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNP 342
           PP   PP E P P++ PP ++PP +  PP    P + PP    PP   PP   PPP+  P
Sbjct: 343 PP---PPGEPPLPDNPPPPDEPPVSGKPP----PGDEPPASARPP---PPDRPPPPDRPP 392

Query: 343 PHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P ++PP         PP + PP   PPP   PPNE PP ++ PP
Sbjct: 393 PPDEPP---------PPDEPPPPSEPPP---PPNEPPPPDEPPP 424

 Score =  109 bits (273), Expect = 8e-23
 Identities = 63/169 (37%), Positives = 77/169 (45%), Gaps = 21/169 (12%)
 Frame = +1

Query: 31  PPPEYQPPHEKPPPEYQPPHGKQP-HVNPPPQYQPPHEKPPHEH-SPPGYQPPHEI---- 192
           PPP   PP  KPPP      GK P   +PPP   PP  +PP ++  PPG  PP+++    
Sbjct: 5   PPPNRPPPPGKPPPSKLEGFGKPPAPASPPPNRPPPPVRPPADNPPPPGKPPPNKLEGFG 64

Query: 193 --PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK---- 354
             P P+  PP+   P  + P +  PP   PPP  L    KPP    PP   PP  K    
Sbjct: 65  KPPAPDSPPPNRPLPPVRPPADNPPPPGKPPPNKLEGFGKPPAPASPPPGKPPPNKLEGF 124

Query: 355 ---PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEK------PPHEKSPP 474
              P    P P   PP  +PP +NPPP  +PP  K      PP   SPP
Sbjct: 125 GKPPAPASPPPNRPPPPVRPPADNPPPPGKPPPNKLEGFGRPPAPDSPP 173

 Score =  109 bits (273), Expect = 8e-23
 Identities = 70/204 (34%), Positives = 85/204 (41%), Gaps = 44/204 (21%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPH-------GKQPHVNPPPQYQPPHEKPPHEH 159
           P +  PP   PP   +PP  KPPP  +PP        GK P   PPP  +PP   P  + 
Sbjct: 173 PPNRPPPPVRPPGLGRPPPNKPPPPVEPPAPERAPAPGKPPPSKPPPPARPPGRPPASKP 232

Query: 160 SPPGYQPPHEI-----PPPEH----------------QPPHEK-------PPHAKSPPEY 255
            PPG  PP  +     PPP                   PP  K       P   + PP  
Sbjct: 233 PPPGRPPPSRLAGSGRPPPNKLAGSGSPSPNKLAGSGSPPPSKLAGSGKAPAPGRPPPNK 292

Query: 256 QPPHEHPPPEYLPPHEKPPHE------NPPPEYNPPHEKPPHEHPSPEYQ--PPHQKPPH 411
            PP + PPP  L    KPP         PPP   PP  +PP  +P P  +  PP + P  
Sbjct: 293 PPPPDRPPPSRLAGSGKPPPSKLAGSGKPPPNKPPPGGRPPPSNPPPPVRPPPPGEPPLP 352

Query: 412 ENPPPKFQPP-NEKPPHEKSPPAS 480
           +NPPP  +PP + KPP    PPAS
Sbjct: 353 DNPPPPDEPPVSGKPPPGDEPPAS 376

 Score =  105 bits (263), Expect = 1e-21
 Identities = 74/222 (33%), Positives = 95/222 (42%), Gaps = 64/222 (28%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEY-----QPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEK------- 144
           P+   PP E P PE      +PP  KPPP  +PP G+ P   PPP  +PP  +       
Sbjct: 191 PNKPPPPVEPPAPERAPAPGKPPPSKPPPPARPP-GRPPASKPPPPGRPPPSRLAGSGRP 249

Query: 145 PPHE---------------HSPP-------------GYQPPHEIPPPEHQPPHE------ 222
           PP++                SPP             G  PP++ PPP+  PP        
Sbjct: 250 PPNKLAGSGSPSPNKLAGSGSPPPSKLAGSGKAPAPGRPPPNKPPPPDRPPPSRLAGSGK 309

Query: 223 ----------KPPHAKSPPEYQPPHEHPPPEYLPPH--EKPPHENPPPEYNPP--HEKPP 360
                     KPP  K PP  +PP  +PPP   PP   E P  +NPPP   PP   + PP
Sbjct: 310 PPPSKLAGSGKPPPNKPPPGGRPPPSNPPPPVRPPPPGEPPLPDNPPPPDEPPVSGKPPP 369

Query: 361 HEHP--SPEYQPPHQKPPHENPPPKFQ--PPNEKPPHEKSPP 474
            + P  S    PP + PP + PPP  +  PP+E PP  + PP
Sbjct: 370 GDEPPASARPPPPDRPPPPDRPPPPDEPPPPDEPPPPSEPPP 411

 Score =  103 bits (256), Expect = 8e-21
 Identities = 60/175 (34%), Positives = 76/175 (43%), Gaps = 16/175 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGK-QPHVNPPPQYQPPHEKPPHEHSPPGY- 174
           P  A PP   PPP  +PP + PPP  +PP  K +    PP    PP  +PP    PPG  
Sbjct: 128 PAPASPPPNRPPPPVRPPADNPPPPGKPPPNKLEGFGRPPAPDSPPPNRPPPPVRPPGLG 187

Query: 175 -QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPE------ 333
             PP++ PPP   P  E+ P    PP  +PP    PP   P  + PP   PPP       
Sbjct: 188 RPPPNKPPPPVEPPAPERAPAPGKPPPSKPPPPARPPGRPPASKPPPPGRPPPSRLAGSG 247

Query: 334 YNPPHEKPPHEHPSPEYQPPHQKPPHEN-------PPPKFQPPNEKPPHEKSPPA 477
             PP++      PSP        PP          P P   PPN+ PP ++ PP+
Sbjct: 248 RPPPNKLAGSGSPSPNKLAGSGSPPPSKLAGSGKAPAPGRPPPNKPPPPDRPPPS 302

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 69/218 (31%), Positives = 85/218 (38%), Gaps = 64/218 (29%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP   PPP+  PP ++PPP  +PP   +P   PPP  +PP   PP E  PP   PP + P
Sbjct: 381  PPDRPPPPDRPPPPDEPPPPDEPPPPSEP---PPPPNEPP---PPDEPPPPNESPPPDAP 434

Query: 196  PPEHQPPHEK---PPHAKSPPEYQPPHEHPPPEYLPPH-EKPPHENPPPEYN-------- 339
            PP ++PP      PP A  PP+  PP + PPP   PP  E PP    PP +         
Sbjct: 435  PPPNEPPPPDAPPPPDAPPPPDAPPPPDEPPPPGEPPALEGPPAGGKPPAFGRPPGFGGP 494

Query: 340  ------------PPHEKPPH--------------------------EHPSPEYQPPHQKP 405
                        PP  +PP                           E P+P   PP  +P
Sbjct: 495  PAPGRPPGFGGPPPLGRPPAFGGPPDLGGPPRPGNPPALGGPPRRGEPPAPPKPPPFGEP 554

Query: 406  PHE-------------NPPPKFQPPNE-KPPHEKSPPA 477
            P                PPP  +PP   KPP    PPA
Sbjct: 555  PAPPRPPAPPRPPAPPKPPPFGKPPAPPKPPAPPKPPA 592

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 56/163 (34%), Positives = 67/163 (41%), Gaps = 25/163 (15%)
 Frame = +1

Query: 61  KPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAK 240
           +PPP   PP GK     PPP       KPP   SPP  +PP     P  +PP + PP   
Sbjct: 4   RPPPNRPPPPGK-----PPPSKLEGFGKPPAPASPPPNRPP-----PPVRPPADNPPPPG 53

Query: 241 SPPEYQ-------PPHEHPPPEYLPPHEKPPHENPPPEYNPPHE------KPPHEHPSPE 381
            PP  +       P  + PPP    P  +PP +NPPP   PP        KPP     P 
Sbjct: 54  KPPPNKLEGFGKPPAPDSPPPNRPLPPVRPPADNPPPPGKPPPNKLEGFGKPPAPASPPP 113

Query: 382 YQPPHQK------------PPHENPPPKFQPPNEKPPHEKSPP 474
            +PP  K            PP   PPP  +PP + PP    PP
Sbjct: 114 GKPPPNKLEGFGKPPAPASPPPNRPPPPVRPPADNPPPPGKPP 156

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 59/198 (29%), Positives = 71/198 (35%), Gaps = 40/198 (20%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ- 177
            P    PP E+PPP+  PP  +PPP   PP    P   PPP   PP ++PP    PP  + 
Sbjct: 419  PDEPPPPNESPPPDAPPPPNEPPPPDAPP---PPDAPPPPDAPPPPDEPPPPGEPPALEG 475

Query: 178  PPHEIPPPEH--------------------QPPHEKPPHAKSPPEY-------------- 255
            PP    PP                       PP  +PP    PP+               
Sbjct: 476  PPAGGKPPAFGRPPGFGGPPAPGRPPGFGGPPPLGRPPAFGGPPDLGGPPRPGNPPALGG 535

Query: 256  -----QPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP 420
                 +PP    PP +  P   P    PP    PP   P  + P+P   P   KPP    
Sbjct: 536  PPRRGEPPAPPKPPPFGEPPAPPRPPAPPRPPAPPKPPPFGKPPAPPKPPAPPKPPAPPK 595

Query: 421  PPKFQPPNEKPPHEKSPP 474
            PP F  P   P   K PP
Sbjct: 596  PPPFGKPPGPPEPGKPPP 613

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 48/133 (36%), Positives = 62/133 (46%), Gaps = 19/133 (14%)
 Frame = +1

Query: 133 PHEKPPHEHSPPGYQPPHEI------PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLP 294
           P   PP+   PPG  PP ++      P P   PP+  PP  + P +  PP   PPP  L 
Sbjct: 2   PGRPPPNRPPPPGKPPPSKLEGFGKPPAPASPPPNRPPPPVRPPADNPPPPGKPPPNKLE 61

Query: 295 PHEKPP-HENPPPEYNPPHEKPPHEHPSPEYQPPHQK-------PPHENPPPKFQPPNE- 447
              KPP  ++PPP    P  +PP ++P P  +PP  K       P   +PPP   PPN+ 
Sbjct: 62  GFGKPPAPDSPPPNRPLPPVRPPADNPPPPGKPPPNKLEGFGKPPAPASPPPGKPPPNKL 121

Query: 448 ----KPPHEKSPP 474
               KPP   SPP
Sbjct: 122 EGFGKPPAPASPP 134

[58][TOP]
>UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f.
           nagariensis RepID=Q9SBM1_VOLCA
          Length = 409

 Score =  124 bits (310), Expect = 4e-27
 Identities = 68/169 (40%), Positives = 73/169 (43%), Gaps = 11/169 (6%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPP-------HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
           P H  PP   PPP  QPP          PPP   PP    P   PPP   PP   PP   
Sbjct: 63  PEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPP 122

Query: 160 -SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY 336
            SPP   PP   PPP   PP   PP + SPP   PP   P P   PP   PP   P P  
Sbjct: 123 PSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 182

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENP---PPKFQPPNEKPPHEKSPP 474
           +PP   PP   PSP   PP   PP   P   PP  +PP+  PP  + PP
Sbjct: 183 SPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPP 231

 Score =  121 bits (303), Expect = 3e-26
 Identities = 64/161 (39%), Positives = 70/161 (43%), Gaps = 4/161 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP        PPP   PP   PP    PP   P
Sbjct: 77  PQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPP 136

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P+  PPP   PP   PP   SPP   PP   P P   PP   PP   P P   PP   PP
Sbjct: 137 PNPPPPPPPPPPSPSPP--PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPP 194

Query: 361 HEHPSPEYQPPHQKPPHENPP----PKFQPPNEKPPHEKSP 471
              PSP   PP + PP  NPP    P   PP+ +PP  + P
Sbjct: 195 SPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPP 235

 Score =  119 bits (298), Expect = 1e-25
 Identities = 66/160 (41%), Positives = 69/160 (43%), Gaps = 3/160 (1%)
 Frame = +1

Query: 10  AKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQ---PPHEKPPHEHSPPGYQP 180
           A PP  +PPP   PP   PP    P H   P   PPP  Q   PP   PP    PP   P
Sbjct: 39  AAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPP 98

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   P    PP    PP   PP   PPP   PP+  PP   PPP  +PP   PP
Sbjct: 99  PPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPP 158

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
              PSP   PP   PP   P P   PP   PP   SPP S
Sbjct: 159 SPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPP---SPPPS 195

 Score =  119 bits (298), Expect = 1e-25
 Identities = 67/161 (41%), Positives = 74/161 (45%), Gaps = 1/161 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP+   P   PPP   PP   PP   SPP   P
Sbjct: 109 PSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPP---SPPPSPP 165

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   P P   PP   PP   SPP   PP   P P   PP   PP   PPP  NPP  +PP
Sbjct: 166 PSPPPSPPPSPPPSPPP---SPPPRPPPSPPPSPPPSPPPSPPPR--PPPSPNPPSPRPP 220

Query: 361 HEHPSPEYQPPHQKPPHENP-PPKFQPPNEKPPHEKSPPAS 480
              P P  +PP ++PP   P PP  +PP   PP  + PP S
Sbjct: 221 SPSP-PSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPS 260

 Score =  118 bits (295), Expect = 2e-25
 Identities = 63/160 (39%), Positives = 70/160 (43%), Gaps = 2/160 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P   +PP  +PP    PP   P P   PP  + P   PPP   PP   PP    PP   P
Sbjct: 214 PPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPS--P 271

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P  +PPP   PP   PP +  PP  +PP   PP     P  +PP  NPPP   PP    P
Sbjct: 272 PPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNN---PFPRPPPPNPPPPRPPPPSPNP 328

Query: 361 HEHPSPEYQPPHQKPPHENP--PPKFQPPNEKPPHEKSPP 474
              P P   PP   PP  NP  PP   P   KPP   SPP
Sbjct: 329 PRPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSPP 368

 Score =  117 bits (293), Expect = 4e-25
 Identities = 67/175 (38%), Positives = 78/175 (44%), Gaps = 17/175 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPH-EHSPPGYQ 177
           P  + PP   P P   PP  +PPP   PP  + P  +PP   +PP  +PP    SPP  +
Sbjct: 188 PPPSPPPSPPPSPPPSPP-PRPPPSPNPPSPRPPSPSPPSP-RPPPRRPPFPPPSPPPPR 245

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPE---------YQPPHEHPPPEYLPPHEKPPHENP-- 324
           PP   PPP   PP   PP    PP            PP   PPP  LPP  +PP  +P  
Sbjct: 246 PPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPN 305

Query: 325 -----PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
                PP  NPP  +PP   P+P   PP   PP   PPP   PP   PP   SPP
Sbjct: 306 NPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPPP-SPSPP 359

 Score =  117 bits (293), Expect = 4e-25
 Identities = 63/166 (37%), Positives = 72/166 (43%), Gaps = 6/166 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQP-PHEKPPHEHSPPGYQ 177
           P  + PP   P P  +PP    PP  +PP    P   PPP+  P P   PP    PP   
Sbjct: 192 PPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAP 251

Query: 178 PPHEIPPPEHQPPHEKPPHAKSP---PEYQPPHEHPPPEYLPPHEKPPHENPP--PEYNP 342
           PP   PPP   PP   PP    P   P   PP   PPP  LPP  +PP  +PP  P   P
Sbjct: 252 PPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRP 311

Query: 343 PHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
           P   PP   P P    P + PP   PPP+  PP+  PP    P  S
Sbjct: 312 PPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPSPS 357

 Score =  115 bits (288), Expect = 2e-24
 Identities = 63/163 (38%), Positives = 69/163 (42%), Gaps = 6/163 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   P P   PP    P  +PPP   PP   PP+   PP   P
Sbjct: 88  PPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPP 147

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   P    SPP   PP   P P   PP   PP   P P  +PP   PP
Sbjct: 148 PSPSPPPS-PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPP 206

Query: 361 HEHPSPEY---QPPHQKPPHENPPPK---FQPPNEKPPHEKSP 471
              PSP     +PP   PP   PPP+   F PP+  PP    P
Sbjct: 207 RPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPP 249

 Score =  114 bits (285), Expect = 3e-24
 Identities = 63/164 (38%), Positives = 71/164 (43%), Gaps = 4/164 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPP-PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           P  + PP   P P   PP   PP P   PP    P   P P  +PP    P    PP   
Sbjct: 164 PPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPS 223

Query: 178 PPHEIPPPEHQP-PHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
           PP   PPP   P P   PP  + PP   PP   PPP   PP   PP  +PPP   PP   
Sbjct: 224 PPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPS--PPPPLPPPPSPPPPLPPPPSP 281

Query: 355 PPHEHPSPEYQPPHQKPPHENPP--PKFQPPNEKPPHEKSPPAS 480
           PP   P P   PP  +PP  +PP  P  +PP   PP  + PP S
Sbjct: 282 PPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPS 325

 Score =  113 bits (283), Expect = 6e-24
 Identities = 63/164 (38%), Positives = 70/164 (42%), Gaps = 5/164 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH-SPPGYQ 177
           P    PP  NPPP   PP   P P   PP    P   P P   PP   PP    SPP   
Sbjct: 129 PPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRP 188

Query: 178 PPHEIPPPEHQPPHE---KPPHAKSPPEYQPPHEHPPPEYLPPHEKP-PHENPPPEYNPP 345
           PP   P P   PP     +PP + +PP  +PP   PP    PP   P P  +PPP   PP
Sbjct: 189 PPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPP 248

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              PP   P P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 249 PAPPPPRPPPP--SPPPPLPPPPSPPPPLPPPPSPPPPSPPPPS 290

 Score =  112 bits (281), Expect = 1e-23
 Identities = 62/162 (38%), Positives = 67/162 (41%), Gaps = 3/162 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNP--PPQYQPPHEKPPHEHSPPGY 174
           P    PP   PPP   PP+  PPP   PP    P   P  PP   PP   P    SPP  
Sbjct: 120 PPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPS 179

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNP-PHE 351
            PP   P P   PP   PP     P  +PP    PP   PP   PP   PPP   P P  
Sbjct: 180 PPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPP 239

Query: 352 KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP   P P   PP  +PP  +PPP   PP   PP    PP+
Sbjct: 240 SPPPPRPPPP-APPPPRPPPPSPPPPLPPPPSPPPPLPPPPS 280

 Score =  112 bits (279), Expect = 2e-23
 Identities = 62/160 (38%), Positives = 70/160 (43%), Gaps = 2/160 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPP-PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           P  + PP   P P   PP   PP P   PP    P   P P   PP   PP     P  +
Sbjct: 148 PSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPR 207

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQP-PHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
           PP    PP  +PP   PP  + PP   P P   PPP   PP   PP   PPP  +PP   
Sbjct: 208 PPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPP--SPPPPL 265

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP   P P   PP   PP   PPP   PP+ +PP + SPP
Sbjct: 266 PPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPP-KPSPP 304

 Score =  112 bits (279), Expect = 2e-23
 Identities = 65/163 (39%), Positives = 73/163 (44%), Gaps = 5/163 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   P P  +PP   PPP   P     P   PPP   PP  +PP   SPP  +P
Sbjct: 172 PPPSPPPSPPPSPPPRPP-PSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSP-SPPSPRP 229

Query: 181 PHEIPP--PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
           P   PP  P   PP   PP A  PP  +PP   PPP   PP   PP   PPP   PP   
Sbjct: 230 PPRRPPFPPPSPPPPRPPPPAPPPP--RPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPP 287

Query: 355 PPHEHPSPEYQPPHQKPPHE---NPPPKFQPPNEKPPHEKSPP 474
           PP   P P  +PP   PP+     PPP   PP   PP   +PP
Sbjct: 288 PPSPLP-PSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPP 329

 Score =  111 bits (278), Expect = 2e-23
 Identities = 63/162 (38%), Positives = 67/162 (41%), Gaps = 3/162 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPP-PEYQPPHGKQPHVNPPPQYQPPHEKPPHEH-SPPGY 174
           P +  PP   PPP   PP   PP P   PP    P   P P   PP   PP    SPP  
Sbjct: 136 PPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPS 195

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLP-PHEKPPHENPPPEYNPPHE 351
            PP   P P  +PP    P +  PP   PP   PPP   P P   PP   PPP   PP  
Sbjct: 196 PPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPR 255

Query: 352 KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP   P P   PP   PP   PPP   PP   PP    PP+
Sbjct: 256 PPPPSPPPP--LPPPPSPPPPLPPPPSPPPPSPPPPSPLPPS 295

 Score =  111 bits (277), Expect = 3e-23
 Identities = 64/165 (38%), Positives = 78/165 (47%), Gaps = 5/165 (3%)
 Frame = +1

Query: 1   PHHAKPPYENP-PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           P   +PP+  P PP  +PP   PPP   PP    P + PPP   PP   PP   SPP   
Sbjct: 229 PPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPP---SPPPPS 285

Query: 178 PPHEIP-PPEHQPPHEKPPH---AKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP 345
           PP   P PP  +PP   PP+    + PP   PP   PPP   PP  +PP  +PPP   PP
Sbjct: 286 PPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPP--RPPPPSPPPPRPPP 343

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
               P   P P   PP + PP  +PPP+  PP   P   + PP +
Sbjct: 344 PSPNPPRPPPPSPSPP-KPPPPPSPPPR--PPRRPPRPPRRPPTA 385

 Score =  110 bits (275), Expect = 5e-23
 Identities = 64/168 (38%), Positives = 68/168 (40%), Gaps = 8/168 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQP------PHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHS 162
           PH    P   PPP   P          PPP   PP    P V PP    P H  PP    
Sbjct: 14  PHALGAPARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPP 73

Query: 163 PPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNP 342
           PP  QPP  +PP    PP   PP    PP   PP   P P   PP   PP  +PPP   P
Sbjct: 74  PPPPQPP--LPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPP 131

Query: 343 PHEKPPHEHPSPEYQPPHQKPPHENPP--PKFQPPNEKPPHEKSPPAS 480
           P   PP+  P P   PP   PP   PP  P   PP+  P    SPP S
Sbjct: 132 PPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPS 179

 Score =  107 bits (266), Expect = 5e-22
 Identities = 66/171 (38%), Positives = 72/171 (42%), Gaps = 13/171 (7%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPP-PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           P  + PP   P P   PP   PP P   PP    P   P P   PP   PP   SPP   
Sbjct: 152 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPP---SPPPRP 208

Query: 178 PPHEIPP----PEHQPPHEKPPHAKSP-PEYQPPHEHPPPEYLPPHEKPPHENPPPEYNP 342
           PP   PP    P   PP  +PP  + P P   PP   PPP   PP  +PP  +PPP   P
Sbjct: 209 PPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPP-APPPPRPPPPSPPPPLPP 267

Query: 343 PHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNE---KPPHEKSPP 474
           P   PP   P P   PP   PP   P    PPK  PPN    +PP    PP
Sbjct: 268 PPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPP 318

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 47/131 (35%), Positives = 49/131 (37%), Gaps = 26/131 (19%)
 Frame = +1

Query: 160 SPPGYQPPHEIPPPEHQ-----------PPHEKPPHAKSPPEYQPP----HEHPPP---- 282
           SP     P   PPP              PP   PP    PP   PP     EHPPP    
Sbjct: 13  SPHALGAPARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPP 72

Query: 283 ------EYLPPHEKPPHENPPP-EYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP 441
                   LPP   PP   PPP    PP   PP   PSP   PP   PP  +PPP   PP
Sbjct: 73  PPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPP 132

Query: 442 NEKPPHEKSPP 474
              PP+   PP
Sbjct: 133 PPPPPNPPPPP 143

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 34/89 (38%), Positives = 40/89 (44%), Gaps = 3/89 (3%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEI 192
           +PP  NPPP   PP    PP  +PP    P   PPP    P   PP   SPP   PP   
Sbjct: 310 RPPPPNPPPPRPPPPSPNPP--RPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSP 367

Query: 193 PP-PEHQPPH--EKPPHAKSPPEYQPPHE 270
           PP P  +PP    +PP A     + P +E
Sbjct: 368 PPRPPRRPPRPPRRPPTAPGVVGFFPDYE 396

[59][TOP]
>UniRef100_Q6PZE9 Putative uncharacterized protein (Fragment) n=1 Tax=Brassica napus
           var. napus RepID=Q6PZE9_BRANA
          Length = 225

 Score =  124 bits (310), Expect = 4e-27
 Identities = 72/176 (40%), Positives = 91/176 (51%), Gaps = 23/176 (13%)
 Frame = +1

Query: 16  PPYENPP-PEYQPPHEKPP-----PEYQPPHGKQPHVNPP-PQYQPPHEKPPHEHSP-PG 171
           PP + PP P Y PP + PP     P Y PP    P   PP P Y PP + PP +  P P 
Sbjct: 29  PPVQKPPTPTYSPPVKPPPVKPPTPIYSPPVMPPPVQQPPTPSYSPPVKPPPVQKPPTPT 88

Query: 172 YQPPHEIPP------PEHQPPHEKPPHAKSP-PEYQPPHEHPP------PEYLPPHEKPP 312
           Y PP + PP      P + PP + PP  K P P Y PP + PP      P Y PP + PP
Sbjct: 89  YSPPVKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPP 148

Query: 313 HENPP-PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP-PKFQPPNEKPPHEKSPP 474
            + PP P Y+PP + PP + P+P Y PP + PP + PP P + PP + PP +   P
Sbjct: 149 VQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVQKPPTPTYSPPIKPPPVKPPTP 204

 Score =  123 bits (309), Expect = 6e-27
 Identities = 70/174 (40%), Positives = 88/174 (50%), Gaps = 22/174 (12%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPP------PEYQPPHGKQPHVNPP-PQYQPPHEKPPHEHSP-PG 171
           PP + P P Y PP   PP      P Y PP    P   PP P Y PP + PP +  P P 
Sbjct: 46  PPVKPPTPIYSPPVMPPPVQQPPTPSYSPPVKPPPVQKPPTPTYSPPVKPPPVQKPPTPT 105

Query: 172 YQPPHEIPP------PEHQPPHEKPPHAKSP-PEYQPPHEHPP------PEYLPPHEKPP 312
           Y PP + PP      P + PP + PP  K P P Y PP + PP      P Y PP + PP
Sbjct: 106 YSPPIKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPP 165

Query: 313 HENPPPEYNPPHEKPP-HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
            + P P Y+PP + PP  + P+P Y PP + PP + P P + PP + PP +K P
Sbjct: 166 VKPPTPIYSPPVKPPPVQKPPTPTYSPPIKPPPVKPPTPTYSPPVKPPPVQKPP 219

 Score =  122 bits (307), Expect = 9e-27
 Identities = 76/177 (42%), Positives = 93/177 (52%), Gaps = 21/177 (11%)
 Frame = +1

Query: 4   HHA--KPPYEN-PPPEYQPPHEKPP-PEYQPPHGKQPHVNPP-PQYQPPHEKPPHEHSP- 165
           HH   KPP     PP   PP +KPP P Y PP  K P V PP P Y PP   PP +  P 
Sbjct: 11  HHPVQKPPTPTYSPPIKPPPVQKPPTPTYSPP-VKPPPVKPPTPIYSPPVMPPPVQQPPT 69

Query: 166 PGYQPPHEIPP------PEHQPPHEKPPHAKSP-PEYQPPHEHPP------PEYLPPHEK 306
           P Y PP + PP      P + PP + PP  K P P Y PP + PP      P Y PP + 
Sbjct: 70  PSYSPPVKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKP 129

Query: 307 PPHENPP-PEYNPPHEKPP-HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           PP + PP P Y+PP + PP  + P+P Y PP + PP + P P + PP + PP +K P
Sbjct: 130 PPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVQKPP 186

 Score =  106 bits (264), Expect = 9e-22
 Identities = 62/145 (42%), Positives = 79/145 (54%), Gaps = 4/145 (2%)
 Frame = +1

Query: 16  PPYENPP-PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP-PGYQPPHE 189
           PP + PP P Y PP  KPPP  +P         P P Y PP + PP +  P P Y PP +
Sbjct: 96  PPVQKPPTPTYSPP-IKPPPVQKP---------PTPTYSPPIKPPPVQKPPTPTYSPPVK 145

Query: 190 IPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPP-PEYNPPHEKPPHE 366
            PPP  +PP   P +  SPP   PP + P P Y PP + PP + PP P Y+PP + PP +
Sbjct: 146 -PPPVQKPP--TPTY--SPPIKPPPVKPPTPIYSPPVKPPPVQKPPTPTYSPPIKPPPVK 200

Query: 367 HPSPEYQPPHQKPPHENPP-PKFQP 438
            P+P Y PP + PP + PP P + P
Sbjct: 201 PPTPTYSPPVKPPPVQKPPTPTYSP 225

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 38/98 (38%), Positives = 48/98 (48%), Gaps = 8/98 (8%)
 Frame = +1

Query: 205 HQPPHEKPPHAKSPPEYQPPHEHPP-PEYLPPHEKPPHENPPPEYNPPHEKPP-HEHPSP 378
           H P  + P    SPP   PP + PP P Y PP + PP + P P Y+PP   PP  + P+P
Sbjct: 11  HHPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVKPPTPIYSPPVMPPPVQQPPTP 70

Query: 379 EYQPPHQKPPHENPPPKFQPPNE------KPPHEKSPP 474
            Y PP +      PPP  +PP        KPP  + PP
Sbjct: 71  SYSPPVK------PPPVQKPPTPTYSPPVKPPPVQKPP 102

[60][TOP]
>UniRef100_Q2UQ79 von Willebrand factor and related coagulation proteins n=1
           Tax=Aspergillus oryzae RepID=Q2UQ79_ASPOR
          Length = 1014

 Score =  124 bits (310), Expect = 4e-27
 Identities = 67/170 (39%), Positives = 85/170 (50%), Gaps = 12/170 (7%)
 Frame = +1

Query: 1   PHHAKP-PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKP-PHEHSPPGY 174
           P H KP P    P   +PPH KP P ++ P G +P    P   +PPH KP P +  P G 
Sbjct: 136 PPHTKPEPTHEKPTGTEPPHTKPEPTHEKPTGTEPPHTKPTGTEPPHTKPQPTQEKPTGT 195

Query: 175 QPPHEIPPPEHQPPHEKP-PHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENP-PPEY 336
           +PPH   P   +PPH KP P  + P   +PPH  P    PP   P   +PPH  P P + 
Sbjct: 196 EPPH-TKPTGTEPPHTKPQPTQEKPTGTEPPHTKPTGTEPPHTKPTGTEPPHTKPQPTQE 254

Query: 337 NPPHEKPPHEHPSPEYQPPHQKP----PHENPPPKFQPPNEKPPHEKSPP 474
            P   +PPH  P+   +PPH KP    P    P   +PP+ KPPH+  PP
Sbjct: 255 KPTGTEPPHTKPTGT-EPPHTKPTGTEPPHTKPTGTEPPHTKPPHQTEPP 303

 Score =  118 bits (296), Expect = 2e-25
 Identities = 68/195 (34%), Positives = 87/195 (44%), Gaps = 39/195 (20%)
 Frame = +1

Query: 7   HAKPPYENPPPEYQPPHEKPP-------------PEYQPPHGKQP-HVNPPPQYQ----- 129
           H +PP+   P   +P HEKPP             P ++ P G +P H  P P ++     
Sbjct: 57  HKEPPHNTEPSHEKPTHEKPPNKEPSKTEPPHTEPTHEKPTGTEPAHTKPEPTHEKPTHG 116

Query: 130 --PPHEKP-PHEHSPPGYQPPHEIPPPEHQPPH-EKPPHAKSPPEYQPPHEHPPPEYLPP 297
             PPH KP P    P G +PPH  P P H+ P   +PPH K  P ++ P    PP   P 
Sbjct: 117 TEPPHTKPEPTHEKPTGTEPPHTKPEPTHEKPTGTEPPHTKPEPTHEKPTGTEPPHTKPT 176

Query: 298 HEKPPHENPPPEY------NPPHEK-----PPHEHPSP-EYQPPHQKPPHENP----PPK 429
             +PPH  P P         PPH K     PPH  P P + +P   +PPH  P    PP 
Sbjct: 177 GTEPPHTKPQPTQEKPTGTEPPHTKPTGTEPPHTKPQPTQEKPTGTEPPHTKPTGTEPPH 236

Query: 430 FQPPNEKPPHEKSPP 474
            +P   +PPH K  P
Sbjct: 237 TKPTGTEPPHTKPQP 251

 Score =  114 bits (285), Expect = 3e-24
 Identities = 71/193 (36%), Positives = 88/193 (45%), Gaps = 40/193 (20%)
 Frame = +1

Query: 7   HAKPPY----ENPPPEYQPPHEKPPPEYQPPHGKQPHVNP----PPQYQPPHEKPPHEHS 162
           H +PP      NPPP     H++PP   +P H K  H  P    P + +PPH +P HE  
Sbjct: 37  HKEPPQWTEAPNPPPRPTGSHKEPPHNTEPSHEKPTHEKPPNKEPSKTEPPHTEPTHE-K 95

Query: 163 PPGYQPPHEIPPPEH-------QPPHEKP-PHAKSPPEYQPPHEHPPPEY------LPPH 300
           P G +P H  P P H       +PPH KP P  + P   +PPH  P P +       PPH
Sbjct: 96  PTGTEPAHTKPEPTHEKPTHGTEPPHTKPEPTHEKPTGTEPPHTKPEPTHEKPTGTEPPH 155

Query: 301 EK--PPHENP----PPEYNPPHEKPPHEHPSPEY------QPPHQK-----PPHENP-PP 426
            K  P HE P    PP   P   +PPH  P P        +PPH K     PPH  P P 
Sbjct: 156 TKPEPTHEKPTGTEPPHTKPTGTEPPHTKPQPTQEKPTGTEPPHTKPTGTEPPHTKPQPT 215

Query: 427 KFQPPNEKPPHEK 465
           + +P   +PPH K
Sbjct: 216 QEKPTGTEPPHTK 228

 Score =  109 bits (273), Expect = 8e-23
 Identities = 59/156 (37%), Positives = 71/156 (45%), Gaps = 9/156 (5%)
 Frame = +1

Query: 1   PHHAKP----PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKP-PHEHSP 165
           P H KP    P    P   +PPH KP P  + P G +P    P   +PPH KP P +  P
Sbjct: 160 PTHEKPTGTEPPHTKPTGTEPPHTKPQPTQEKPTGTEPPHTKPTGTEPPHTKPQPTQEKP 219

Query: 166 PGYQPPHEIP----PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPE 333
            G +PPH  P    PP  +P   +PPH K  P  + P    PP   P   +PPH  P   
Sbjct: 220 TGTEPPHTKPTGTEPPHTKPTGTEPPHTKPQPTQEKPTGTEPPHTKPTGTEPPHTKPTGT 279

Query: 334 YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP 441
             PPH KP         +PPH KPPH+  PP    P
Sbjct: 280 -EPPHTKPTGT------EPPHTKPPHQTEPPHNTQP 308

 Score =  100 bits (248), Expect = 7e-20
 Identities = 61/163 (37%), Positives = 77/163 (47%), Gaps = 23/163 (14%)
 Frame = +1

Query: 55  HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEH----QPPHE 222
           H++PP   + P       NPPP+    H++PPH   P   +P HE PP +     +PPH 
Sbjct: 37  HKEPPQWTEAP-------NPPPRPTGSHKEPPHNTEPSHEKPTHEKPPNKEPSKTEPPHT 89

Query: 223 KPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP--EYNPPHEK-----PPHEHPSPE 381
           +P H K P   +P H  P P     HEKP H   PP  +  P HEK     PPH  P P 
Sbjct: 90  EPTHEK-PTGTEPAHTKPEPT----HEKPTHGTEPPHTKPEPTHEKPTGTEPPHTKPEPT 144

Query: 382 Y------QPPHQK--PPHENP----PPKFQPPNEKPPHEKSPP 474
           +      +PPH K  P HE P    PP  +P   +PPH K  P
Sbjct: 145 HEKPTGTEPPHTKPEPTHEKPTGTEPPHTKPTGTEPPHTKPQP 187

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 30/70 (42%), Positives = 36/70 (51%), Gaps = 6/70 (8%)
 Frame = +1

Query: 1   PHHAKP-PYENPPPEYQPPHEKP----PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           P H KP P +  P   +PPH KP    PP  +P   + PH  P    +PPH KPPH+  P
Sbjct: 244 PPHTKPQPTQEKPTGTEPPHTKPTGTEPPHTKPTGTEPPHTKPTGT-EPPHTKPPHQTEP 302

Query: 166 P-GYQPPHEI 192
           P   QP  EI
Sbjct: 303 PHNTQPITEI 312

[61][TOP]
>UniRef100_Q9LIE8 Similarity to cell wall-plasma membrane linker protein n=1
           Tax=Arabidopsis thaliana RepID=Q9LIE8_ARATH
          Length = 1480

 Score =  123 bits (309), Expect = 6e-27
 Identities = 71/151 (47%), Positives = 80/151 (52%), Gaps = 3/151 (1%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEI 192
           KPP   P P  +PP  KPPP  + PH K P V P P  +PP +  PH   PP    PH  
Sbjct: 48  KPPAVKPHPHPKPPTIKPPPPKRHPHPKPPTVKPHPHPKPPTKPHPHP-KPPTKPHPHPK 106

Query: 193 PPPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLP-PHEKPPHENPPPEYNPPHEKPPHE 366
           PP    PPH KP PH K PP  + PH HP P   P PH KPP ++  P   PP  KPP +
Sbjct: 107 PPTIKPPPHPKPRPHPK-PPNVK-PHPHPKPPTKPHPHPKPPTKH-HPHPKPPTIKPPPK 163

Query: 367 HPSPEYQPPHQKPPHENPPPKF-QPPNEKPP 456
            PS +  P   KPP  NPPP   QPP  KPP
Sbjct: 164 PPSVKPPPSTPKPPTTNPPPSTPQPPTHKPP 194

 Score =  121 bits (303), Expect = 3e-26
 Identities = 72/170 (42%), Positives = 82/170 (48%), Gaps = 10/170 (5%)
 Frame = +1

Query: 1   PH-HAKPPYENPPPEYQPPHEKPPPEYQPPHGK---QPHVNPPPQYQP-PHEKPPHEHSP 165
           PH H KPP   PPP  + PH KPP     PH K   +PH +P P  +P PH KPP    P
Sbjct: 54  PHPHPKPPTIKPPPPKRHPHPKPPTVKPHPHPKPPTKPHPHPKPPTKPHPHPKPPTIKPP 113

Query: 166 PGYQP-PHEIPPPEHQPPHEKPPHAKSPPEYQPP---HEHPPPEYLPPHEKPPHENPPPE 333
           P  +P PH  PP     PH KPP  K  P  +PP   H HP P  + P  KPP   PPP 
Sbjct: 114 PHPKPRPHPKPPNVKPHPHPKPP-TKPHPHPKPPTKHHPHPKPPTIKPPPKPPSVKPPPS 172

Query: 334 Y-NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
              PP   PP   P P   P H+ PP    PP   PP   PP +  P A+
Sbjct: 173 TPKPPTTNPPPSTPQP---PTHKPPPCTPTPPVASPPMATPPTQMPPIAT 219

 Score =  120 bits (300), Expect = 6e-26
 Identities = 71/171 (41%), Positives = 81/171 (47%), Gaps = 16/171 (9%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHE----KPPPEYQPPHGKQPHVNPPPQYQPPHEKPP----HEHSPPG 171
           PP  +P P   P H     KPP     PH K P + PPP  + PH KPP    H H  P 
Sbjct: 29  PPKPSPKPHKPPKHSVVPPKPPAVKPHPHPKPPTIKPPPPKRHPHPKPPTVKPHPHPKPP 88

Query: 172 YQPPHEIPPPEHQPPHEKPPHAKSPPEYQP-PHEHPPPEYLPPHEKPP---HENP-PPEY 336
            +P     PP    PH KPP  K PP  +P PH  PP     PH KPP   H +P PP  
Sbjct: 89  TKPHPHPKPPTKPHPHPKPPTIKPPPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKPPTK 148

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENP-PPKFQPP--NEKPPHEKSPPAS 480
           + PH KPP   P P  +PP  KPP   P PP   PP    +PP  K PP +
Sbjct: 149 HHPHPKPPTIKPPP--KPPSVKPPPSTPKPPTTNPPPSTPQPPTHKPPPCT 197

 Score =  115 bits (289), Expect = 1e-24
 Identities = 74/169 (43%), Positives = 84/169 (49%), Gaps = 11/169 (6%)
 Frame = +1

Query: 7   HAKPPYENPPPEYQPP---HEKPPPEYQP-PHGKQPHVNPPPQYQP-PHEKPP----HEH 159
           H KPP   P P  +PP   H  P P  +P PH K P + PPP  +P PH KPP    H H
Sbjct: 73  HPKPPTVKPHPHPKPPTKPHPHPKPPTKPHPHPKPPTIKPPPHPKPRPHPKPPNVKPHPH 132

Query: 160 SPPGYQP-PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY 336
             P  +P PH  PP +H P H KPP  K PP  +PP   PPP       KPP  NPPP  
Sbjct: 133 PKPPTKPHPHPKPPTKHHP-HPKPPTIKPPP--KPPSVKPPPS----TPKPPTTNPPPST 185

Query: 337 -NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
             PP  KPP   P+    PP   PP   PP +  PP   PP  KSP A+
Sbjct: 186 PQPPTHKPPPCTPT----PPVASPPMATPPTQ-MPPIATPPIAKSPVAT 229

 Score =  108 bits (269), Expect = 2e-22
 Identities = 67/158 (42%), Positives = 74/158 (46%), Gaps = 11/158 (6%)
 Frame = +1

Query: 40  EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQP-PHEKPPHEHSPPGYQPPHEIPPPEHQPP 216
           E  PP   P P   P H   P    PP  +P PH KPP    PP  + PH  PP     P
Sbjct: 26  ECSPPKPSPKPHKPPKHSVVPP--KPPAVKPHPHPKPPTIKPPPPKRHPHPKPPTVKPHP 83

Query: 217 HEKPPHAKSPPEYQPPHEHPPPEYLP-PHEKPPHENPPPEYNP-PHEKP----PHEHPSP 378
           H KPP      +   PH HP P   P PH KPP   PPP   P PH KP    PH HP P
Sbjct: 84  HPKPP-----TK---PHPHPKPPTKPHPHPKPPTIKPPPHPKPRPHPKPPNVKPHPHPKP 135

Query: 379 EYQP-PHQKPP---HENPPPKFQPPNEKPPHEKSPPAS 480
             +P PH KPP   H +P P    P  KPP  K PP++
Sbjct: 136 PTKPHPHPKPPTKHHPHPKPPTIKPPPKPPSVKPPPST 173

 Score =  105 bits (261), Expect = 2e-21
 Identities = 76/185 (41%), Positives = 80/185 (43%), Gaps = 28/185 (15%)
 Frame = +1

Query: 7   HAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQY-QPP-HEKPPHEHSPPGYQP 180
           H KPP   PPP+  PP  KPPP    P    P  NPPP   QPP H+ PP   +PP   P
Sbjct: 152 HPKPPTIKPPPK--PPSVKPPPSTPKP----PTTNPPPSTPQPPTHKPPPCTPTPPVASP 205

Query: 181 PHEIPPPEHQPPHEKPPHAKSP----PEYQPPHEHPP----PEYLPPHEKPPHENPP--- 327
           P   PP +  PP   PP AKSP    P   PP   PP    P   PP   PP  NPP   
Sbjct: 206 PMATPPTQ-MPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIM 264

Query: 328 -----------PEYNPPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKPPHE 462
                      P  NPP  KPP   P P   PP  KPP   P    PP   PP   PP  
Sbjct: 265 PPIATPPVAAPPITNPPISKPPVTTP-PTTTPPIAKPPIATPPISTPPAATPPAATPPIT 323

Query: 463 KSPPA 477
             PPA
Sbjct: 324 TLPPA 328

 Score =  102 bits (254), Expect = 1e-20
 Identities = 72/187 (38%), Positives = 81/187 (43%), Gaps = 29/187 (15%)
 Frame = +1

Query: 7   HAKPPYENPPPEYQPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH-SPP 168
           H KPP   P P  +PP     H KPP ++ P H K P + PPP+  PP  KPP     PP
Sbjct: 121 HPKPPNVKPHPHPKPPTKPHPHPKPPTKHHP-HPKPPTIKPPPK--PPSVKPPPSTPKPP 177

Query: 169 GYQPPHEIP-PPEHQPPHEKP-PHAKSPPEYQPPHEHPP---------PEYLPPHEKPPH 315
              PP   P PP H+PP   P P   SPP   PP + PP         P   PP   PP 
Sbjct: 178 TTNPPPSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPT 237

Query: 316 ENPP----PEYNPPHEKPPHEHPS----PEYQPPHQKPPHENPP----PKFQPPNEKPPH 459
             PP    P   PP   PP  +P     P   PP   PP  NPP    P   PP   PP 
Sbjct: 238 ATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPI 297

Query: 460 EKSPPAS 480
            K P A+
Sbjct: 298 AKPPIAT 304

 Score =  102 bits (253), Expect = 2e-20
 Identities = 70/174 (40%), Positives = 81/174 (46%), Gaps = 17/174 (9%)
 Frame = +1

Query: 1   PH-HAKPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPP-----HEKPPHEH 159
           PH H KPP + P P  +PP  KPPP  +P PH K P+V P P  +PP     H KPP +H
Sbjct: 91  PHPHPKPPTK-PHPHPKPPTIKPPPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKPPTKH 149

Query: 160 ----SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEY-QPP-HEHPPPEYLPPHEKPPHEN 321
                PP  +PP + P  +  P   KPP    PP   QPP H+ PP    PP   PP   
Sbjct: 150 HPHPKPPTIKPPPKPPSVKPPPSTPKPPTTNPPPSTPQPPTHKPPPCTPTPPVASPPMAT 209

Query: 322 PPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
           PP +  PP   PP    SP   PP   PP   P    PP   PP   PP    P
Sbjct: 210 PPTQM-PPIATPPIA-KSPVATPPIATPPTATPPITIPPVATPPITTPPIANPP 261

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 68/174 (39%), Positives = 73/174 (41%), Gaps = 15/174 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPP----PEYQPPHEKPP---PEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
           P  AKPP E PP    P  +PP   PP   P    P    P +  P   +PP   PP   
Sbjct: 448 PPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLA- 506

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP----P 327
            PP  +PP  + PP   PP   PP AKSP     P    PP   PP  KPP   P    P
Sbjct: 507 IPPVAKPP-VVTPPTATPPIATPPIAKSP--VATPPTATPPVATPPIAKPPVVTPPTTTP 563

Query: 328 PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP----PKFQPPNEKPPHEKSPPA 477
           P   PP  KPP   P P   PP  KPP   PP    P   PP   PP    PPA
Sbjct: 564 PTATPPVAKPPVATP-PIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPA 616

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 68/164 (41%), Positives = 75/164 (45%), Gaps = 4/164 (2%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P  AKPP   PP    P     PP   PP  K P V  PP   PP EKPP   +PP  +P
Sbjct: 968  PPIAKPPTTTPPTATPPV--AMPPIATPPTAKPP-VATPPIANPPVEKPPVA-TPPIAKP 1023

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP----PEYLPPHEKPPHENPPPEYNPPH 348
            P  +PP   +PP E  P A +PP   PP   PP    P  +PP  KPP   PP   NPP 
Sbjct: 1024 PTVLPPIA-KPPVETSPTA-TPPTATPPVAIPPVVKPPVAIPPITKPPVATPPVT-NPPT 1080

Query: 349  EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
              PP   P P   PP  K P   PP    PP  KPP    P A+
Sbjct: 1081 AMPPIVTPPPIVTPPIAKSPIATPPVS-TPPIAKPPIATPPVAT 1123

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 68/179 (37%), Positives = 76/179 (42%), Gaps = 19/179 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPP----PEYQPPHEKPPPEYQP---PHGKQPHVNPPPQYQPPHEKPPHEH 159
           P   KPP   PP    P   PP  KPP E  P   P   +P ++ PP  +PP   PP   
Sbjct: 428 PPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPA-- 485

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPP---- 327
           + P    P  + PP   PP   PP AK PP   PP   PP    PP  K P   PP    
Sbjct: 486 ATPPITTPTPVKPPVATPPLAIPPVAK-PPVVTPPTATPPIA-TPPIAKSPVATPPTATP 543

Query: 328 PEYNPPHEKPPHEHPS----PEYQPPHQKPPHENPP----PKFQPPNEKPPHEKSPPAS 480
           P   PP  KPP   P     P   PP  KPP   PP    P  +PP   PP  KSP A+
Sbjct: 544 PVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVAT 602

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 72/184 (39%), Positives = 78/184 (42%), Gaps = 24/184 (13%)
 Frame = +1

Query: 1    PHHAKPPYENPP----PEYQPPHEKPPPEYQ----PPHGKQPHVNPPPQYQPPHEKPPHE 156
            P  A PP  NPP    P  +PP   PP        PP GK P V  PP  +PP   PP  
Sbjct: 1134 PPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPP-VATPPMAKPPVASPPIA 1192

Query: 157  HSPPGYQPPHEIPP---------PEHQPPHEKPPHAKSPPEYQPPHEHP---PPEYLPPH 300
             +PP  +PP   PP         P   PP  KPP A SP E  P  + P   PP   PP 
Sbjct: 1193 -TPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPI 1251

Query: 301  EKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQP----PNEKPPHEKS 468
             KPP   PP    PP  K P   P P   PP  KPP   PP    P    P  KPP    
Sbjct: 1252 VKPPIVTPPIA-TPPIAKSPIA-PPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATP 1309

Query: 469  PPAS 480
            PPA+
Sbjct: 1310 PPAT 1313

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 72/180 (40%), Positives = 76/180 (42%), Gaps = 21/180 (11%)
 Frame = +1

Query: 1    PHHAKPPYENPP----PEYQPPHEKPP----PEYQPPHGKQPHVNPPPQYQPPHEKPPHE 156
            P  AKPP   PP    P  +PP   PP    P   PP  K P V  PP   PP   PP  
Sbjct: 743  PPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSP-VATPPTATPPVATPPIA 801

Query: 157  HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP---- 324
              PP   PP   PP    PP  KPP A +PP   PP   PP    PP  KPP   P    
Sbjct: 802  -KPPVATPPTTAPPTA-TPPVAKPPVA-TPPIATPPTAKPPI-LTPPISKPPVATPPAAT 857

Query: 325  PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP---------PKFQPPNEKPPHEKSPPA 477
            PP   PP  KPP   P P   PP  KPP   PP         P  +PP   PP +  PPA
Sbjct: 858  PPITTPPPAKPPVATP-PIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPA 916

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 75/212 (35%), Positives = 81/212 (38%), Gaps = 52/212 (24%)
 Frame = +1

Query: 1    PHHAKPPYENPP---------PEYQPPHEKPPPEYQP--------PHGKQPHVNPPPQYQ 129
            P  A PP E PP         P   PP  KPP E  P        P    P V  PP   
Sbjct: 1003 PPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAI 1062

Query: 130  PPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSP---------PEYQPPHEHPP- 279
            PP  KPP   +PP   PP  +PP    PP   PP AKSP         P  +PP   PP 
Sbjct: 1063 PPITKPPVA-TPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPV 1121

Query: 280  --------PEYLPPHEKPPHENPP----PEYNPPHEKPPHEHPS---------PEYQPPH 396
                    P   PP   PP  NPP    P   PP   PP   PS         P   PP 
Sbjct: 1122 ATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPM 1181

Query: 397  QKPPHENP----PPKFQPPNEKPPHEKSPPAS 480
             KPP  +P    PP  +PP   PP  K P A+
Sbjct: 1182 AKPPVASPPIATPPIIKPPVATPPITKPPVAT 1213

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 73/189 (38%), Positives = 79/189 (41%), Gaps = 29/189 (15%)
 Frame = +1

Query: 1    PHHAKPPYENPP----PEYQPPHEKPP----PEYQPPHGKQPHVNPP----PQYQPPHEK 144
            P  AKPP  +PP    P  +PP   PP    P   PP    P   PP    P   PP  K
Sbjct: 1179 PPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAK 1238

Query: 145  PPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSP---------PEYQPPHEHPP----PE 285
            PP   +PP   PP  + PP   PP   PP AKSP         P  +PP   PP    P 
Sbjct: 1239 PPVT-TPPVATPPI-VKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPV 1296

Query: 286  YLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKP 453
               P  KPP   PPP   PP  KPP   P P   PP   PP   P    PP   PP   P
Sbjct: 1297 ATSPIAKPPVATPPPA-TPPVAKPPVATP-PTVTPPVATPPIAKPPGARPPVATPPVATP 1354

Query: 454  PHEKSPPAS 480
            P  KSP A+
Sbjct: 1355 PIAKSPVAT 1363

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 76/214 (35%), Positives = 79/214 (36%), Gaps = 54/214 (25%)
 Frame = +1

Query: 1   PHHAKPPYENPP---------PEYQPPHEKPP----PEYQPPHGKQPHVNPPPQYQPPHE 141
           P  A PP  NPP         P   PP  KPP    P   PP    P   PP    PP  
Sbjct: 270 PPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLPP-A 328

Query: 142 KPPHEHSP-------PGYQPPHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHP---- 276
           KPP   SP       P  QPP   PP    P   PP   PP +KSP    P  E P    
Sbjct: 329 KPPVAISPIVTPPVTPIAQPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPVATP 388

Query: 277 ----PPEYLPPHEKPPHENP--------------PPEYNPPHEKPPHEHP----SPEYQP 390
                P   PP  KPP   P              PP   PP EKPP   P     P   P
Sbjct: 389 PTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATP 448

Query: 391 PHQKPPHENP----PPKFQPPNEKPPHEKSPPAS 480
           P  KPP E P    PP  +PP   PP  K P A+
Sbjct: 449 PVAKPPVETPPIATPPTAKPPISTPPISKPPVAT 482

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 70/185 (37%), Positives = 77/185 (41%), Gaps = 28/185 (15%)
 Frame = +1

Query: 10   AKPPYENPPPEYQPPHEKP---PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            AKPP   PP +  PP + P   PP   PP  K P V  PP   PP   PP   +PP   P
Sbjct: 651  AKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPP-VATPPTATPPIATPPIA-TPPVVTP 708

Query: 181  PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPP---------PEYLPPHEKPPHEN 321
            P   PP    P  +PP   PP A +PP   PP   PP         P  +PP  KPP   
Sbjct: 709  PTATPPVATPPIAKPPTTIPPTA-TPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVT 767

Query: 322  PP----PEYNPPHEKPPHEHPS----PEYQPPHQKPPHENPP----PKFQPPNEKPPHEK 465
            PP    P   PP  K P   P     P   PP  KPP   PP    P   PP  KPP   
Sbjct: 768  PPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVAT 827

Query: 466  SPPAS 480
             P A+
Sbjct: 828  PPIAT 832

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 68/187 (36%), Positives = 76/187 (40%), Gaps = 27/187 (14%)
 Frame = +1

Query: 1    PHHAKPPYENPP----PEYQPPHEKPP---PEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
            P  AKPP   PP    P  +PP   PP   P    P    P +  PP  +PP   PP   
Sbjct: 818  PPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIA- 876

Query: 160  SPPGYQPPHEIPPPEHQP----PHEKPPHAKSPPEYQPPHEHP---PPEYLPPHEKPPHE 318
            +PP  +PP   PP    P    P  KPP A  P +  PP + P   PP   PP  KPP  
Sbjct: 877  TPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVA 936

Query: 319  NPP---------PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP----PKFQPPNEKPPH 459
             PP         P   PP   PP    SP   PP  KPP   PP    P   PP   PP 
Sbjct: 937  TPPTATPPIATSPIATPPVVTPPTA-TSPVATPPIAKPPTTTPPTATPPVAMPPIATPPT 995

Query: 460  EKSPPAS 480
             K P A+
Sbjct: 996  AKPPVAT 1002

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 70/180 (38%), Positives = 74/180 (41%), Gaps = 21/180 (11%)
 Frame = +1

Query: 1    PHHAKPPYENPP----PEYQPPHEKPP----PEYQPPHGKQPHVNPPPQYQPPHEKPPHE 156
            P   KPP   PP    P  +PP   PP    P   PP  K P V  PP   PP   PP  
Sbjct: 493  PTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSP-VATPPTATPPVATPPIA 551

Query: 157  HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP---- 324
              PP   PP   PP    PP  KPP A +PP   PP   PP    PP  K P   P    
Sbjct: 552  -KPPVVTPPTTTPPTA-TPPVAKPPVA-TPPIATPPTAKPPIS-TPPISKSPVATPPAAT 607

Query: 325  PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP---------PKFQPPNEKPPHEKSPPA 477
            PP   PP  KPP   P P   PP  KPP   PP         P  +PP   PP +  PPA
Sbjct: 608  PPITTPPPAKPPVATP-PIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPA 666

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 68/179 (37%), Positives = 74/179 (41%), Gaps = 19/179 (10%)
 Frame = +1

Query: 1    PHHAKPPYENPP---PEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPPHEH 159
            P  A PP   PP   P    P    PP   PP  K P   PP    P  +PP   PP   
Sbjct: 538  PPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISK 597

Query: 160  SP----PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLP----PHEKPPH 315
            SP    P   PP   PPP  +PP   PP A +PP  +PP   PP    P    P  KPP 
Sbjct: 598  SPVATPPAATPPITTPPPA-KPPVATPPIA-TPPIAKPPVATPPTATPPIATSPVAKPPV 655

Query: 316  ENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSPPAS 480
              PP +  PP  KPP   P P   PP  KPP   P    PP   PP   PP    P A+
Sbjct: 656  ATPPIK-TPPPAKPPVAIP-PIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTAT 712

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 70/177 (39%), Positives = 76/177 (42%), Gaps = 17/177 (9%)
 Frame = +1

Query: 1    PHHAKPPYENPP----PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
            P  AKPP   PP    P   PP  KPP    PP    P   PP    PP  KPP   +PP
Sbjct: 798  PPIAKPPVATPPTTAPPTATPPVAKPPVA-TPPIATPPTAKPPI-LTPPISKPPVA-TPP 854

Query: 169  GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLP----PHEKPPHENPPPEY 336
               PP   PPP  +PP   PP A +PP  +PP   PP    P    P  KPP   PP + 
Sbjct: 855  AATPPITTPPPA-KPPVATPPIA-TPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIK- 911

Query: 337  NPPHEKPPHEHPSPEYQPPHQKPPHENPP---------PKFQPPNEKPPHEKSPPAS 480
             PP  KPP   P P   PP  KPP   PP         P   PP   PP   SP A+
Sbjct: 912  TPPPAKPPVAIP-PIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVAT 967

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 72/194 (37%), Positives = 77/194 (39%), Gaps = 34/194 (17%)
 Frame = +1

Query: 1    PHHAKPPYENPP----PEYQPPHEKPP----PEYQPPHGKQPHVNPPPQYQPPHEKPPHE 156
            P  A PP   PP    P   PP  KPP    P   PP  K P V  PP   PP  KPP  
Sbjct: 1199 PPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPP-VTTPPVATPPIVKPPIV 1257

Query: 157  HSPPGYQPPHE----IPPPEHQPPHEKPPHAKSP---------PEYQPPHEHPPPEYLPP 297
             +PP   PP       PPP   PP  KPP A  P         P  +PP   PPP   PP
Sbjct: 1258 -TPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPA-TPP 1315

Query: 298  HEKPPHENPP---------PEYNPPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQP 438
              KPP   PP         P   PP  +PP   P P   PP  K P   P    PP    
Sbjct: 1316 VAKPPVATPPTVTPPVATPPIAKPPGARPPVATP-PVATPPIAKSPVATPPMTKPPVASS 1374

Query: 439  PNEKPPHEKSPPAS 480
            P   PP  K+P A+
Sbjct: 1375 PIATPPIAKTPIAT 1388

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 65/162 (40%), Positives = 68/162 (41%), Gaps = 21/162 (12%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPP----PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP- 165
            P  AKPP   PP    PP  KPP    P   PP  K P + PPP   PP  KPP    P 
Sbjct: 1234 PPVAKPPVTTPPVA-TPPIVKPPIVTPPIATPPIAKSP-IAPPPIGTPPIAKPPVATPPT 1291

Query: 166  --------PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP----PEYLPPHEKP 309
                    P  +PP   PPP   PP  KPP A +PP   PP   PP    P   PP   P
Sbjct: 1292 ATPPVATSPIAKPPVATPPPA-TPPVAKPPVA-TPPTVTPPVATPPIAKPPGARPPVATP 1349

Query: 310  PHENPP----PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP 423
            P   PP    P   PP  KPP    SP   PP  K P   PP
Sbjct: 1350 PVATPPIAKSPVATPPMTKPP-VASSPIATPPIAKTPIATPP 1390

[62][TOP]
>UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO
          Length = 538

 Score =  123 bits (309), Expect = 6e-27
 Identities = 72/172 (41%), Positives = 77/172 (44%), Gaps = 14/172 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPP-----HEKPPHEHSP 165
           P ++ PP   PPP Y PP   PPP   PP    P   PPP Y PP     +  PP   SP
Sbjct: 254 PVYSPPP---PPPVYSPP---PPPPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSP 307

Query: 166 PGYQPPHEIPPPEHQPPHEKPP----HAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPE 333
           P   PP   PPP   PP   PP        PP   PP   PPP  LPP  +PP   PPP 
Sbjct: 308 PPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPP---PPPP 364

Query: 334 YNPPHEKPP---HEHPSPEY--QPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            N P   PP      P+P Y   PP   PPH  PPP   PP   PPH   PP
Sbjct: 365 PNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPP 416

 Score =  123 bits (308), Expect = 7e-27
 Identities = 69/166 (41%), Positives = 78/166 (46%), Gaps = 8/166 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  + PP   PPP Y PP   PPP   PP        PPP   PP  +PP    PP   P
Sbjct: 319 PPPSPPPPSPPPPVYSPP--PPPPSPPPPS------PPPPSPLPPCVRPP-PPPPPNSPP 369

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH---- 348
           P   PPP   PP   P +  SPP   PPH  PPP + PP   PPH  PPP ++PP     
Sbjct: 370 P---PPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYP 426

Query: 349 --EKPPHEHP--SPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               PP  HP  SP   P +  PP  +PPP  +PP   P  E SPP
Sbjct: 427 YLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPP 472

 Score =  122 bits (306), Expect = 1e-26
 Identities = 70/185 (37%), Positives = 80/185 (43%), Gaps = 25/185 (13%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    P Y  PPP   PP   PPP Y PP    P   PPP   PP   PP    PP   P
Sbjct: 308 PPPPPPVYSPPPPPSPPPPSPPPPVYSPP--PPPPSPPPPSPPPPSPLPPCVRPPPP-PP 364

Query: 181 PHEIPPPE--HQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH-- 348
           P+  PPP     PP   P +  SPP   PPH  PPP + PP   PPH  PPP ++PP   
Sbjct: 365 PNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPI 424

Query: 349 ----EKPPHEHP--SPEYQPPHQKPPHENPPPKFQPP---------------NEKPPHEK 465
                 PP  HP  SP   P +  PP  +PPP  +PP               +  PP + 
Sbjct: 425 YPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQY 484

Query: 466 SPPAS 480
            PP S
Sbjct: 485 KPPPS 489

 Score =  121 bits (304), Expect = 2e-26
 Identities = 69/165 (41%), Positives = 76/165 (46%), Gaps = 7/165 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGK-QPHVNPPPQYQPPH--EKPPHEHSPPG 171
           P ++ PP   PPP Y PP   PPP Y PP     P   PPP Y PP     PP    PP 
Sbjct: 277 PVYSPPP--PPPPVYSPP--PPPPVYSPPPPPPSPPPPPPPVYSPPPPPSPPPPSPPPPV 332

Query: 172 YQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPE----YN 339
           Y PP   PPP   PP   PP +  PP  +PP   PPP   PP   P    PPP      +
Sbjct: 333 YSPP---PPPPSPPPPSPPPPSPLPPCVRPPP--PPPPNSPPPPPPLFSPPPPTPYYYSS 387

Query: 340 PPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP   PPH  P P + PP   PPH  PPP   PP    P+   PP
Sbjct: 388 PPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPP 432

 Score =  120 bits (302), Expect = 4e-26
 Identities = 69/178 (38%), Positives = 80/178 (44%), Gaps = 20/178 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P ++ PP   PPP Y PP   PPP   PP     +  PPP   PP   PP  +SPP   P
Sbjct: 287 PVYSPPP---PPPVYSPP---PPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPP--PP 338

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYL-------------PPHEKPPHEN 321
           P   PPP   PP   PP  + PP   PP+  PPP  L             PP   PPH  
Sbjct: 339 PPSPPPPSPPPPSPLPPCVRPPPP-PPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSP 397

Query: 322 PPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQ-------PPNEKPPHEKSPP 474
           PPP ++PP   PPH  P P + PP    P+ +PPP          PP   PP   SPP
Sbjct: 398 PPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPP 455

 Score =  116 bits (291), Expect = 7e-25
 Identities = 66/166 (39%), Positives = 77/166 (46%), Gaps = 8/166 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P   +PP   PPP   PP   PPP + PP     + + PP   PPH  PP  HSPP   P
Sbjct: 354 PPCVRPP--PPPPPNSPP--PPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSP 409

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYL---PPHEKPPHENPPP-----EY 336
           PH  PPP H PP    P+   PP   P +  PPP      PP   PP   PPP     EY
Sbjct: 410 PHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEY 469

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           +PP   PP   P P  Q  ++ PP  +PPP        PP  +SPP
Sbjct: 470 SPP---PPSPSPPPPTQ--YKPPPSPSPPPPPVHYYSPPPPSQSPP 510

 Score =  108 bits (269), Expect = 2e-22
 Identities = 64/153 (41%), Positives = 69/153 (45%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           P    PPP   P     PP Y PP    P   PPP Y PP   PP    PP Y PP   P
Sbjct: 230 PTLPAPPPPSPPMPVPSPPVYLPPPVYSP-PPPPPVYSPP--PPPPSPPPPVYSPPPP-P 285

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
           PP + PP   P ++  PP   PP   PPP Y PP   PP   PPP   PP   PP   PS
Sbjct: 286 PPVYSPPPPPPVYSPPPPPPSPP-PPPPPVYSPP---PPPSPPPPSPPPPVYSPPPPPPS 341

Query: 376 PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   PP   PP    PP  +PP   PP+   PP
Sbjct: 342 P---PPPSPPPPSPLPPCVRPPPPPPPNSPPPP 371

 Score =  103 bits (256), Expect = 8e-21
 Identities = 60/157 (38%), Positives = 71/157 (45%), Gaps = 15/157 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKP-----PPEYQPPHGKQPHVNPPPQYQPPHEKPP--HEH 159
           P ++ PP   PPP + PP   P     PP   PPH   P  + PP   PPH  PP  H  
Sbjct: 364 PPNSPPP---PPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSP 420

Query: 160 SPPGY------QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHEN 321
            PP Y       PPH +  P   P +  PP    PP  +PP   P  EY PP   PP  +
Sbjct: 421 PPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPP---PPSPS 477

Query: 322 PPP--EYNPPHEKPPHEHPSPEYQPPHQKPPHENPPP 426
           PPP  +Y PP    P   P   Y PP   PP ++PPP
Sbjct: 478 PPPPTQYKPPPSPSPPPPPVHYYSPP---PPSQSPPP 511

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 58/154 (37%), Positives = 74/154 (48%), Gaps = 12/154 (7%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P H+ PP  + PP   PPH  PPP + PP    P+++PPP   P +  PP    PP Y P
Sbjct: 393 PPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPP----PPVYSP 448

Query: 181 PHE-IPPPEHQPP-------HEKPPHAKSPP---EYQPPHE-HPPPEYLPPHEKPPHENP 324
           P    PPP  +PP       +  PP + SPP   +Y+PP    PPP   P H   P   P
Sbjct: 449 PPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPP--PVHYYSP---P 503

Query: 325 PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPP 426
           PP  +PP   P +E P     PP     + +PPP
Sbjct: 504 PPSQSPPPPAPVYEGP----LPPITGVSYASPPP 533

[63][TOP]
>UniRef100_B8NCP9 WW domain protein n=1 Tax=Aspergillus flavus NRRL3357
           RepID=B8NCP9_ASPFN
          Length = 332

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/161 (36%), Positives = 91/161 (56%), Gaps = 9/161 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPP-HEKPPPEYQPPHGKQPHVNPPPQYQ------PPHEKPPHEH 159
           P + +PPY  PP    P  +E+PP + +PP+G++P  + PP  Q      P +E+PP+E 
Sbjct: 10  PPYGQPPYGQPPYGQSPGGYERPPYDQRPPYGERPSYDRPPYEQGPPGDRPQYERPPYEQ 69

Query: 160 SPP-GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY 336
            PP G +PP++ PP E     ++PP  +  P  +PP+E PPP     +E+PP+  PP + 
Sbjct: 70  GPPSGERPPYDRPPYE-----QRPPSGERSPYDRPPYEQPPPGERSQYERPPYGQPPQDQ 124

Query: 337 NPPHEKPPHEHPSPEYQPP-HQKPPHENPPPKFQPPNEKPP 456
            PP+++PP E P  E       +PP+ + PP  +PP   PP
Sbjct: 125 RPPYDRPPSERPPYESDRSFDSRPPYSSAPPSARPPQIPPP 165

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 62/205 (30%), Positives = 94/205 (45%), Gaps = 50/205 (24%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQ-PPHEKPPPEYQPPHGKQPHVNPPPQYQPP------HEKPPHEH 159
           P + +PPYE  PP  + PP+++PP E +PP G++   + PP  QPP      +E+PP+  
Sbjct: 60  PQYERPPYEQGPPSGERPPYDRPPYEQRPPSGERSPYDRPPYEQPPPGERSQYERPPYGQ 119

Query: 160 SPPGYQPPHEIPPPEHQPPHE-------KPPHAKSPPEYQPPHEHPPP-------EYLP- 294
            P   +PP++ PP E +PP+E       +PP++ +PP  +PP   PPP       E+ P 
Sbjct: 120 PPQDQRPPYDRPPSE-RPPYESDRSFDSRPPYSSAPPSARPPQIPPPPLPMGWVQEWEPN 178

Query: 295 --------------PHEKPPHEN--------PPPEYNPPHEKPPHEHPSPEYQPPHQKPP 408
                           E+P  ++        PP   +PP   P    P   Y  P   PP
Sbjct: 179 ARRAFWVEVATGNSQWEQPFGDSSRDMGPGGPPAIMSPPPSGPISPPPGGYYGGP---PP 235

Query: 409 HEN---PPP---KFQPPNEKPPHEK 465
            E    PPP   ++Q   ++   EK
Sbjct: 236 QEGGYYPPPQQGEYQSEADRKKSEK 260

[64][TOP]
>UniRef100_B8MZV6 Cell surface protein, putative n=1 Tax=Aspergillus flavus NRRL3357
           RepID=B8MZV6_ASPFN
          Length = 637

 Score =  123 bits (308), Expect = 7e-27
 Identities = 74/202 (36%), Positives = 92/202 (45%), Gaps = 44/202 (21%)
 Frame = +1

Query: 1   PHHAKPPYENP---------PPEYQPPHEKP-----------PPEYQPPHGKQ-PHVNPP 117
           P H KP +E P         PP  +P HEKP           P   +P HG + PH  P 
Sbjct: 66  PSHEKPTHEKPPNKEPSKTEPPHTEPTHEKPTGTEPAHTKPEPTHEKPTHGTEPPHTKPE 125

Query: 118 PQY------QPPHEKP-PHEHSPPGYQPPHEIPPPEH------QPPHEKP-PHAKSPPEY 255
           P +      +PPH KP P    P G +PPH  P P H      +PPH KP P  + P   
Sbjct: 126 PTHEKPTGTEPPHTKPEPTHEKPTGTEPPHTKPQPTHEKPTGTEPPHTKPQPTHEKPTGT 185

Query: 256 QPPHEHP-PPEYLPPHEKPPHENP----PPEYNPPHEKPPHEHPSPEYQPPHQKP----P 408
           +PPH  P P +  P   +PPH  P    PP   P   +PPH  P+   +PPH KP    P
Sbjct: 186 EPPHTKPQPTQEKPTGTEPPHTKPTGTEPPHTKPTGTEPPHTKPTGT-EPPHTKPTGTEP 244

Query: 409 HENPPPKFQPPNEKPPHEKSPP 474
               P   +PP+ KPPH+  PP
Sbjct: 245 PHTKPTGTEPPHTKPPHQTEPP 266

 Score =  119 bits (299), Expect = 8e-26
 Identities = 75/202 (37%), Positives = 94/202 (46%), Gaps = 45/202 (22%)
 Frame = +1

Query: 1   PHHAKPPYENP----PPEYQPPHEKP-----------PPEYQPPHGKQP-HVNPPPQYQ- 129
           P H KPP + P    PP  +P HEKP           P   +P HG +P H  P P ++ 
Sbjct: 71  PTHEKPPNKEPSKTEPPHTEPTHEKPTGTEPAHTKPEPTHEKPTHGTEPPHTKPEPTHEK 130

Query: 130 -----PPHEKP-PHEHSPPGYQPPHEIPPPEHQ------PPHEKP-PHAKSPPEYQPPHE 270
                PPH KP P    P G +PPH  P P H+      PPH KP P  + P   +PPH 
Sbjct: 131 PTGTEPPHTKPEPTHEKPTGTEPPHTKPQPTHEKPTGTEPPHTKPQPTHEKPTGTEPPHT 190

Query: 271 HPPP-EYLPPHEKPPHENP----PPEYNPPHEKPPHEHPSPEYQPPHQKP-----PHENP 420
            P P +  P   +PPH  P    PP   P   +PPH  P+   +PPH KP     PH  P
Sbjct: 191 KPQPTQEKPTGTEPPHTKPTGTEPPHTKPTGTEPPHTKPTGT-EPPHTKPTGTEPPHTKP 249

Query: 421 ----PPKFQPPNE-KPPHEKSP 471
               PP  +PP++ +PPH   P
Sbjct: 250 TGTEPPHTKPPHQTEPPHNTQP 271

 Score =  114 bits (285), Expect = 3e-24
 Identities = 67/183 (36%), Positives = 84/183 (45%), Gaps = 30/183 (16%)
 Frame = +1

Query: 7   HAKPPY----ENPPPEYQPPHEKPPPEYQPPHGKQPHVNP----PPQYQPPHEKPPHEHS 162
           H +PP      NPPP     H++PP   +P H K  H  P    P + +PPH +P HE  
Sbjct: 37  HKEPPQWTEAPNPPPRPTGSHKEPPHNTEPSHEKPTHEKPPNKEPSKTEPPHTEPTHE-K 95

Query: 163 PPGYQPPHEIPPPEH-------QPPHEKP-PHAKSPPEYQPPHEHPPPEY-LPPHEKPPH 315
           P G +P H  P P H       +PPH KP P  + P   +PPH  P P +  P   +PPH
Sbjct: 96  PTGTEPAHTKPEPTHEKPTHGTEPPHTKPEPTHEKPTGTEPPHTKPEPTHEKPTGTEPPH 155

Query: 316 ENPPPEY------NPPHEKPPHEHPSPE-YQPPHQKP------PHENPPPKFQPPNEKPP 456
             P P +       PPH KP   H  P   +PPH KP      P    PP  +P   +PP
Sbjct: 156 TKPQPTHEKPTGTEPPHTKPQPTHEKPTGTEPPHTKPQPTQEKPTGTEPPHTKPTGTEPP 215

Query: 457 HEK 465
           H K
Sbjct: 216 HTK 218

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 57/153 (37%), Positives = 74/153 (48%), Gaps = 13/153 (8%)
 Frame = +1

Query: 55  HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEH----QPPHE 222
           H++PP   + P       NPPP+    H++PPH   P   +P HE PP +     +PPH 
Sbjct: 37  HKEPPQWTEAP-------NPPPRPTGSHKEPPHNTEPSHEKPTHEKPPNKEPSKTEPPHT 89

Query: 223 KPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP--EYNPPHEK-----PPHEHPSPE 381
           +P H K P   +P H  P P     HEKP H   PP  +  P HEK     PPH  P P 
Sbjct: 90  EPTHEK-PTGTEPAHTKPEPT----HEKPTHGTEPPHTKPEPTHEKPTGTEPPHTKPEPT 144

Query: 382 YQ-PPHQKPPHENPPPKFQ-PPNEKPPHEKSPP 474
           ++ P   +PPH  P P  + P   +PPH K  P
Sbjct: 145 HEKPTGTEPPHTKPQPTHEKPTGTEPPHTKPQP 177

[65][TOP]
>UniRef100_A5GXN8 Glycoamidase (Fragment) n=1 Tax=Candida albicans RepID=A5GXN8_CANAL
          Length = 171

 Score =  123 bits (308), Expect = 7e-27
 Identities = 68/145 (46%), Positives = 83/145 (57%), Gaps = 5/145 (3%)
 Frame = +1

Query: 55  HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPH 234
           H K    ++   GK      PP ++PPH KPPHE   P ++PPHE   P H+PPHE P H
Sbjct: 16  HHKDDKHHKDKDGKPKKPEHPP-HEPPH-KPPHE---PPHEPPHE---PPHEPPHEPPHH 67

Query: 235 AKSPPEYQPPHE---HPPPEYLPPHEKPPHENP-PPEYNPPHEKPPHEHP-SPEYQPPHQ 399
               P ++PPHE   HPP E  PPHE PPHE P  P + PPHE PPHE P  P ++PPH+
Sbjct: 68  PPHEPPHEPPHEPPHHPPHE--PPHE-PPHEPPHEPPHEPPHE-PPHEPPHEPPHKPPHE 123

Query: 400 KPPHENPPPKFQPPNEKPPHEKSPP 474
            P H    P   PP+  PPH+   P
Sbjct: 124 PPHHPPHEPPHHPPHH-PPHDPHDP 147

 Score =  117 bits (293), Expect = 4e-25
 Identities = 68/144 (47%), Positives = 82/144 (56%), Gaps = 2/144 (1%)
 Frame = +1

Query: 1   PHHAKPPYENP-PPEYQPPHEKP-PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY 174
           P H  PP+E P  P ++PPHE P  P ++PPH    H    P ++PPHE PPHE   P +
Sbjct: 33  PEH--PPHEPPHKPPHEPPHEPPHEPPHEPPHEPPHH----PPHEPPHE-PPHE---PPH 82

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
            PPHE   P H+PPHE PPH    P ++PPHE       PPHE PPHE   P + PPHE 
Sbjct: 83  HPPHE---PPHEPPHE-PPH---EPPHEPPHE-------PPHE-PPHE---PPHKPPHEP 124

Query: 355 PPHEHPSPEYQPPHQKPPHENPPP 426
           P H    P + PPH  PPH+   P
Sbjct: 125 PHHPPHEPPHHPPHH-PPHDPHDP 147

 Score =  110 bits (276), Expect = 4e-23
 Identities = 68/147 (46%), Positives = 80/147 (54%), Gaps = 3/147 (2%)
 Frame = +1

Query: 43  YQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHE 222
           ++  H K        H K     P     PPHE P   H PP ++PPHE   P H+PPHE
Sbjct: 7   HKDKHHKGKHHKDDKHHKDKDGKPKKPEHPPHEPP---HKPP-HEPPHE---PPHEPPHE 59

Query: 223 KPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP-PPEYNPPHEKPPHEHP-SPEYQPPH 396
            PPH       +PPH HPP E  PPHE PPHE P  P + PPHE PPHE P  P ++PPH
Sbjct: 60  -PPH-------EPPH-HPPHE--PPHE-PPHEPPHHPPHEPPHE-PPHEPPHEPPHEPPH 106

Query: 397 QKPPHENP-PPKFQPPNEKPPHEKSPP 474
           + PPHE P  P  +PP+E P H    P
Sbjct: 107 E-PPHEPPHEPPHKPPHEPPHHPPHEP 132

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 55/120 (45%), Positives = 71/120 (59%), Gaps = 2/120 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPP-PEYQPPHGKQPHVNP-PPQYQPPHEKPPHEHSPPGY 174
           PHH  PP+E   P ++PPHE P  P ++PPH + PH  P  P ++PPHE PPHE      
Sbjct: 65  PHH--PPHE---PPHEPPHEPPHHPPHEPPH-EPPHEPPHEPPHEPPHE-PPHE------ 111

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
            PPHE   P H+PPHE P H    P ++PPH HPP  + PPH+  PH+ P   +   HE+
Sbjct: 112 -PPHE---PPHKPPHEPPHH----PPHEPPH-HPP--HHPPHD--PHD-PNHHHGKYHEE 157

[66][TOP]
>UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0K5_ARATH
          Length = 760

 Score =  122 bits (306), Expect = 1e-26
 Identities = 68/171 (39%), Positives = 76/171 (44%), Gaps = 18/171 (10%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPE--YQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           PP   PPP Y PP   PPP   Y PP    P   PPP Y PP   PP    PP Y PP  
Sbjct: 427 PPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPP-PPPVYSPPPPPPPPPPPPPVYSPPPP 485

Query: 190 IPPPEHQP---PHEKPPHAKSPPEYQPP----HEHPPPEYLP---------PHEKPPHEN 321
            PPP   P   P   PP    PP Y PP    +  PPP   P         P   PPH  
Sbjct: 486 SPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSP 545

Query: 322 PPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PPP+++PP  +P +    P   PPH  PP  +PPP   PP    P+   PP
Sbjct: 546 PPPQFSPPPPEPYYYSSPP---PPHSSPPPHSPPPPHSPPPPIYPYLSPPP 593

 Score =  119 bits (297), Expect = 1e-25
 Identities = 67/179 (37%), Positives = 79/179 (44%), Gaps = 23/179 (12%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPE----YQPPHGKQPHVNPPPQYQPPHEKPPHEHSP---PGY 174
           PP   PPP Y PP   PPP     Y PP    P   PPP Y PP   PP    P   P  
Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPP 499

Query: 175 QPPHEIPPPEHQPP----HEKPPHAKSP---------PEYQPPHEHPPPEYLPPHEKPPH 315
            PP   PPP + PP    +  PP   SP         P   PPH  PPP++ PP  +P +
Sbjct: 500 PPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYY 559

Query: 316 ENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPP---HEKSPPASC 483
            + PP   PPH  PP   P P + PP    P+ +PPP   P +  PP   +   PP  C
Sbjct: 560 YSSPP---PPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPC 615

 Score =  116 bits (290), Expect = 9e-25
 Identities = 70/167 (41%), Positives = 76/167 (45%), Gaps = 9/167 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPE-YQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           P    P +  PP    PP   PPP  Y PP    P   PPP Y PP   PP    PP Y 
Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPP---PPPVYSPPPPPPPPP-PPPVYS 465

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP---- 345
           PP   PPP   PP   PP    PP   PP   PPP Y PP   PP   PPP Y+PP    
Sbjct: 466 PPPPPPPPPPPPPVYSPP----PPSPPPP---PPPVYSPP-PPPPPPPPPPVYSPPPPPV 517

Query: 346 ---HEKPPHEHPSPEY-QPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
                 PP   P+P Y   P   PPH  PPP+F PP  +P +  SPP
Sbjct: 518 YSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPP 564

 Score =  105 bits (263), Expect = 1e-21
 Identities = 71/187 (37%), Positives = 81/187 (43%), Gaps = 29/187 (15%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQP---PHGKQPHVNPPPQYQPP----HEKPPHEH 159
           P    PP   PPP Y PP   PPP   P   P    P   PPP Y PP    +  PP   
Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525

Query: 160 SP---------PGYQPPHEIPPPEHQPPHEKP--------PHAKSPPEYQPPHEHPPPEY 288
           SP         P   PPH  PPP+  PP  +P        PH+ SPP + PP  H PP  
Sbjct: 526 SPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHS-SPPPHSPPPPHSPPPP 584

Query: 289 LPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPP----KFQPPNEKP- 453
           + P+  PP   PPP    P   PP   P+P Y PP   P  E PPP    ++ PP   P 
Sbjct: 585 IYPYLSPP---PPP---TPVSSPP---PTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPV 635

Query: 454 PHEKSPP 474
            H  SPP
Sbjct: 636 VHYSSPP 642

 Score =  104 bits (260), Expect = 3e-21
 Identities = 70/185 (37%), Positives = 81/185 (43%), Gaps = 32/185 (17%)
 Frame = +1

Query: 16   PPYENPPPEYQPP----HEKPPPEYQP---------PHGKQPHVNPPPQYQPPHEKPPHE 156
            PP   PPP Y PP    +  PPP   P         P    PH  PPPQ+ PP  +P + 
Sbjct: 501  PPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYY 560

Query: 157  HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPP---HENPP 327
             SPP   PPH   PP H PP   PPH+  PP Y  P+  PPP   P    PP   +  PP
Sbjct: 561  SSPP---PPHS-SPPPHSPP---PPHSPPPPIY--PYLSPPPPPTPVSSPPPTPVYSPPP 611

Query: 328  PEYNPPHEKPPHEHPSPEYQPP-------HQKPP-----HENPPPK----FQPPNEKPPH 459
            P   PP  +PP   P  EY PP       +  PP     + +PPP       PP   P H
Sbjct: 612  P---PPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVH 668

Query: 460  EKSPP 474
              SPP
Sbjct: 669  YSSPP 673

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 65/187 (34%), Positives = 77/187 (41%), Gaps = 33/187 (17%)
 Frame = +1

Query: 16   PPYENPPPEY------QPPHEKPPPEYQPPHGKQPHVN--PPPQYQPPHEKPPHEHSPPG 171
            PP   P P Y       PPH  PPP++ PP  +  + +  PPP   PP   PP  HSPP 
Sbjct: 524  PPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPP 583

Query: 172  YQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPP-----EYLPP-------HEKPP- 312
               P+  PPP   P    PP     P   PP   PPP     EY PP       +  PP 
Sbjct: 584  PIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPP 643

Query: 313  ----HENPPPE---YNPPHEKPPHEHPSP-----EYQPPHQKPPHENPPPKFQPPNEKPP 456
                + +PPP    Y+ P   PP  + SP      Y  P   P H + PP   PP   P 
Sbjct: 644  PPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPP---PPPSAPC 700

Query: 457  HEKSPPA 477
             E  PPA
Sbjct: 701  EESPPPA 707

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 63/184 (34%), Positives = 76/184 (41%), Gaps = 26/184 (14%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEY---QPPHGKQPHVNPPPQ--YQPPHEKPPHEHSP 165
            P H+ PP  +PPP    PH  PPP Y    PP    P  +PPP   Y PP   P  E  P
Sbjct: 565  PPHSSPPPHSPPP----PHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPP 620

Query: 166  PG----YQPP-------HEIPPPE---HQPPHEKPPHAKSPPEYQPPH-EHPPPEYLPPH 300
            P     Y PP       +  PPP    +  P   P +  SPP   P H   PPP  +  H
Sbjct: 621  PPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYH 680

Query: 301  EKPP----HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKF--QPPNEKPPHE 462
              PP    + +PPP  + P E+ P   P   + PP     H  PPP     PP   P +E
Sbjct: 681  SPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSPEYE 740

Query: 463  KSPP 474
               P
Sbjct: 741  GPLP 744

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 65/180 (36%), Positives = 81/180 (45%), Gaps = 25/180 (13%)
 Frame = +1

Query: 16   PPYENPPPEYQ--PPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE-HSPPGYQPPH 186
            PP+ +PPP +   PPH  PPP Y       P+++PPP   P    PP   +SPP   P  
Sbjct: 565  PPHSSPPP-HSPPPPHSPPPPIY-------PYLSPPPPPTPVSSPPPTPVYSPPPPPPCI 616

Query: 187  EIPPP----EHQPPHEKP-PHAKSPPEYQPPHEHPPPEYL----PPHEKPPHEN--PPPE 333
            E PPP    E+ PP   P  H  SPP     +  PPP  +    PP   P H +  PPPE
Sbjct: 617  EPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPE 676

Query: 334  --YNPPHEKPPH--EHPSPEYQPPHQKPP-----HENPPPKFQPPNEKPP--HEKSPPAS 480
              Y+ P   P H    P P   P  + PP     H +PPP     +  PP  H+  PP S
Sbjct: 677  VHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPS 736

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 44/100 (44%), Positives = 46/100 (46%), Gaps = 1/100 (1%)
 Frame = +1

Query: 178 PPHEIP-PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
           PP  +P PP   P    PP   SPP   PP    PP Y PP   PP   PPP Y+PP   
Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPP----PPVYSPPPPPPP---PPPVYSPPPPP 455

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP   P P Y PP   PP   PPP   PP   PP    PP
Sbjct: 456 PPPP-PPPVYSPP--PPPPPPPPP---PPVYSPPPPSPPP 489

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 59/169 (34%), Positives = 68/169 (40%), Gaps = 25/169 (14%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPP------HGKQPHVNPPPQYQPPHEKPPHEHS 162
            P ++ PP   PPP  +PP   P  EY PP      H   P   PP  Y  P   P +  S
Sbjct: 605  PVYSPPP---PPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPP-PPVYYSSPPPPPVYYSS 660

Query: 163  PPGYQPPH--EIPPPE---HQPPHEKPPHAKSPP-------EYQPPH----EHPPPEYLP 294
            PP   P H    PPPE   H PP   P H  SPP       E  PP      H PP  + 
Sbjct: 661  PPPPPPVHYSSPPPPEVHYHSPP-PSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMV 719

Query: 295  PHEKPP---HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKF 432
             H  PP   H++PPP  +P +E P        Y  P        PPP F
Sbjct: 720  HHSPPPPVIHQSPPPP-SPEYEGPLPPVIGVSYASP--------PPPPF 759

[67][TOP]
>UniRef100_B9RZI2 Protein binding protein, putative n=1 Tax=Ricinus communis
            RepID=B9RZI2_RICCO
          Length = 829

 Score =  122 bits (306), Expect = 1e-26
 Identities = 75/177 (42%), Positives = 83/177 (46%), Gaps = 24/177 (13%)
 Frame = +1

Query: 16   PPYENPPPEY-----QPPHEKPPPEYQPPHGKQPHVN--PPPQYQPPHEKPP---HEHSP 165
            PP ++PPP        PP + PPP  Q P    P VN  PPP Y PP   PP   H   P
Sbjct: 628  PPGQSPPPTTPEQSPSPPGQSPPPPTQSP---PPPVNSPPPPVYSPPPPSPPPPVHSPPP 684

Query: 166  PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPP------HENPP 327
            P Y PP   PPP   P H  PP   SPP   P H  PPP Y PP   PP      H  PP
Sbjct: 685  PVYSPPPPSPPP---PVHSPPPPVHSPPP--PVHSPPPPVYSPPPPSPPSPPPPMHSPPP 739

Query: 328  PEYNPPHEKPPHEHPSPEYQPP---HQKPP--HENPPPKFQPPNEK---PPHEKSPP 474
            P Y+PP   P    P P + PP   H  PP  +  PPP+F PP  +   PP   SPP
Sbjct: 740  PVYSPP-PPPVRSPPPPVHSPPPPVHSPPPPIYSPPPPRFSPPPPRFSPPPPTSSPP 795

 Score =  111 bits (277), Expect = 3e-23
 Identities = 70/173 (40%), Positives = 80/173 (46%), Gaps = 24/173 (13%)
 Frame = +1

Query: 16   PPYENPPPEYQPP----HEKPPPEYQPPHGKQP---HVNPPPQYQPPHEKPP---HEHSP 165
            PP ++PPP  Q P    +  PPP Y PP    P   H  PPP Y PP   PP   H   P
Sbjct: 644  PPGQSPPPPTQSPPPPVNSPPPPVYSPPPPSPPPPVHSPPPPVYSPPPPSPPPPVHSPPP 703

Query: 166  PGYQPP---HEIPPPEHQPPHEKPP------HAKSPPEYQPPHEHPPPEYLPP---HEKP 309
            P + PP   H  PPP + PP   PP      H+  PP Y PP   PPP   PP   H  P
Sbjct: 704  PVHSPPPPVHSPPPPVYSPPPPSPPSPPPPMHSPPPPVYSPP---PPPVRSPPPPVHSPP 760

Query: 310  PHEN--PPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHE 462
            P  +  PPP Y+PP   P    P P + PP   PP  +PPP   P    PP E
Sbjct: 761  PPVHSPPPPIYSPP--PPRFSPPPPRFSPP---PPTSSPPP--TPTVAAPPPE 806

 Score =  108 bits (270), Expect = 2e-22
 Identities = 68/168 (40%), Positives = 78/168 (46%), Gaps = 15/168 (8%)
 Frame = +1

Query: 16   PPYENPPPEYQPP--HEKPPPEYQPPHGKQP---HVNPPPQYQPP---HEKPPHEHSPPG 171
            PP  +PPP   PP  H  PPP Y PP    P   H  PPP + PP   H  PP  +SPP 
Sbjct: 665  PPVYSPPPPSPPPPVHSPPPPVYSPPPPSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPP 724

Query: 172  YQPPHEIPPPEHQPP----HEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP-PPEY 336
              PP   PPP H PP       PP  +SPP   P H  PPP + PP   PP  +P PP +
Sbjct: 725  PSPPSP-PPPMHSPPPPVYSPPPPPVRSPPP--PVHSPPPPVHSPP---PPIYSPPPPRF 778

Query: 337  NPPHEKPPHEHPSPEYQPPHQKPPHENPPPK--FQPPNEKPPHEKSPP 474
            +PP   PP   P P    P   P    PPP+    PPN    +   PP
Sbjct: 779  SPP---PPRFSPPPPTSSPPPTPTVAAPPPEDFILPPNIGFQYSSPPP 823

 Score =  105 bits (262), Expect = 2e-21
 Identities = 63/158 (39%), Positives = 71/158 (44%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    P +  PPP Y PP   PPP   P H   P V+ PP   P H  PP  +SPP   P
Sbjct: 673  PSPPPPVHSPPPPVYSPPPPSPPP---PVHSPPPPVHSPP--PPVHSPPPPVYSPPPPSP 727

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP H PP         PP Y PP   PPP   PP   P H  PPP ++PP   P 
Sbjct: 728  PSP-PPPMHSPP---------PPVYSPP---PPPVRSPP--PPVHSPPPPVHSPP--PPI 770

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            +  P P + PP   PP  +PPP    P   P     PP
Sbjct: 771  YSPPPPRFSPP---PPRFSPPPPTSSPPPTPTVAAPPP 805

 Score =  103 bits (256), Expect = 8e-21
 Identities = 68/193 (35%), Positives = 80/193 (41%), Gaps = 35/193 (18%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQP--PHEKPPPEYQPPHGKQPHVNPPPQY------QPPHEKPPHE 156
            P     P  +P PEY    P   P PE +P   + P   P P+        P  E+ P  
Sbjct: 572  PSEPTSPTTSPSPEYNSSEPSPTPSPESEP---QSPTSTPSPESPLSSPTSPTLEQSP-- 626

Query: 157  HSPPGYQPPHEIPPPEHQPPHEKPP----------HAKSPPEYQPP--------HEHPPP 282
             SPPG  PP   P     PP + PP          ++  PP Y PP        H  PPP
Sbjct: 627  -SPPGQSPPPTTPEQSPSPPGQSPPPPTQSPPPPVNSPPPPVYSPPPPSPPPPVHSPPPP 685

Query: 283  EYLPPHEKPP---HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPP------HENPPPKFQ 435
             Y PP   PP   H  PPP ++PP   P H  P P Y PP   PP      H  PPP + 
Sbjct: 686  VYSPPPPSPPPPVHSPPPPVHSPP--PPVHSPPPPVYSPPPPSPPSPPPPMHSPPPPVYS 743

Query: 436  PPNEKPPHEKSPP 474
            PP   PP  +SPP
Sbjct: 744  PP---PPPVRSPP 753

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 63/162 (38%), Positives = 73/162 (45%), Gaps = 16/162 (9%)
 Frame = +1

Query: 1    PHHAKPP--YENPPPEYQPP-HEKPPPEYQPPHGKQPHVNPPPQYQPP-----------H 138
            P H+ PP  Y  PPP   PP H  PPP + PP     H  PPP Y PP           H
Sbjct: 678  PVHSPPPPVYSPPPPSPPPPVHSPPPPVHSPP--PPVHSPPPPVYSPPPPSPPSPPPPMH 735

Query: 139  EKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHE 318
              PP  +SPP   P    PPP H PP   P H+  PP Y P    PPP + PP   PP  
Sbjct: 736  SPPPPVYSPPP-PPVRSPPPPVHSPP--PPVHSPPPPIYSP----PPPRFSPP---PPRF 785

Query: 319  NPPPEYNPPHEKPPHEHPSPE--YQPPHQKPPHENPPPKFQP 438
            +PPP  + P   P    P PE    PP+    + +PPP   P
Sbjct: 786  SPPPPTSSPPPTPTVAAPPPEDFILPPNIGFQYSSPPPPMFP 827

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 60/187 (32%), Positives = 72/187 (38%), Gaps = 29/187 (15%)
 Frame = +1

Query: 1    PHHAKPPYENP-----PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQP--------PHE 141
            P  + PP  +P     P E   P   P P  +P     P  +P P+Y          P  
Sbjct: 540  PLESTPPTTSPSLSPEPSEPTSPTTSPSPSPEPSEPTSPTTSPSPEYNSSEPSPTPSPES 599

Query: 142  KPPHEHSPPGYQPPHEIP----------PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYL 291
            +P    S P  + P   P          PP   PP   P  + SPP   PP   PP +  
Sbjct: 600  EPQSPTSTPSPESPLSSPTSPTLEQSPSPPGQSPPPTTPEQSPSPPGQSPP---PPTQSP 656

Query: 292  PPHEKPPHENPPPEYNPPHEKPP---HEHPSPEYQPPHQKPPHENPPPKFQPP---NEKP 453
            PP   P +  PPP Y+PP   PP   H  P P Y PP    P   PPP   PP   +  P
Sbjct: 657  PP---PVNSPPPPVYSPPPPSPPPPVHSPPPPVYSPP----PPSPPPPVHSPPPPVHSPP 709

Query: 454  PHEKSPP 474
            P   SPP
Sbjct: 710  PPVHSPP 716

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 57/188 (30%), Positives = 69/188 (36%), Gaps = 30/188 (15%)
 Frame = +1

Query: 1    PHHAKP------PYENPPP-EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
            P  +KP      P  +P P E  PP   P P  +P     P  +P P  +P    PP   
Sbjct: 490  PEPSKPTSPTTSPSPSPEPSEPTPPATSPSPSSEPSEPTSPTTSPSPSSEPLESTPPTTS 549

Query: 160  ---SPPGYQP--PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP--PHE 318
               SP   +P  P   P P  +P     P     PEY      P P    P  +P  P  
Sbjct: 550  PSLSPEPSEPTSPTTSPSPSPEPSEPTSPTTSPSPEYNSSEPSPTPS---PESEPQSPTS 606

Query: 319  NPPPEY--------------NPPHEKPPHEHPSPEYQPPHQK--PPHENPPPKFQPPNEK 450
             P PE               +PP + PP   P     PP Q   PP ++PPP   P N  
Sbjct: 607  TPSPESPLSSPTSPTLEQSPSPPGQSPPPTTPEQSPSPPGQSPPPPTQSPPP---PVNSP 663

Query: 451  PPHEKSPP 474
            PP   SPP
Sbjct: 664  PPPVYSPP 671

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 52/184 (28%), Positives = 60/184 (32%), Gaps = 26/184 (14%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPP-PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
            P++  P      P   P   KP  P   P    +P    PP   P     P E + P   
Sbjct: 474  PYNPSPGGHRESPTPSPEPSKPTSPTTSPSPSPEPSEPTPPATSPSPSSEPSEPTSPTTS 533

Query: 178  PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
            P     P E  PP   P  +  P E   P   P P   P     P  +P PEYN     P
Sbjct: 534  PSPSSEPLESTPPTTSPSLSPEPSEPTSPTTSPSPSPEPSEPTSPTTSPSPEYNSSEPSP 593

Query: 358  ----------PHEHPSPEY--------------QPPHQKPPHENPPPKFQPPNEK-PPHE 462
                      P   PSPE                PP Q PP   P     PP +  PP  
Sbjct: 594  TPSPESEPQSPTSTPSPESPLSSPTSPTLEQSPSPPGQSPPPTTPEQSPSPPGQSPPPPT 653

Query: 463  KSPP 474
            +SPP
Sbjct: 654  QSPP 657

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 42/164 (25%), Positives = 52/164 (31%), Gaps = 5/164 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP-----PQYQPPHEKPPHEHSP 165
           P  + P    P   Y P    PP     P    P+V  P     P    P   PP +  P
Sbjct: 406 PRPSTPSVPTPSTPYVPTPSTPPSTSYGPTPSTPYVPTPSTPYVPTPSTPSPSPPQQEVP 465

Query: 166 PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP 345
               P  E   P      E P  +  P +   P   P P   P    PP  +P P   P 
Sbjct: 466 TPQTPSSEPYNPSPGGHRESPTPSPEPSKPTSPTTSPSPSPEPSEPTPPATSPSPSSEPS 525

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
               P   PSP  +P    PP  +P    +P     P     P+
Sbjct: 526 EPTSPTTSPSPSSEPLESTPPTTSPSLSPEPSEPTSPTTSPSPS 569

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 45/166 (27%), Positives = 59/166 (35%), Gaps = 8/166 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKP---PHEHSPPG 171
           P  + PP  +  P    P+   P     P    P  +PP Q  P  + P   P+  SP G
Sbjct: 422 PTPSTPPSTSYGPTPSTPYVPTPSTPYVPTPSTPSPSPPQQEVPTPQTPSSEPYNPSPGG 481

Query: 172 YQPPHEIPPPEHQP-----PHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY 336
           ++   E P P  +P     P   P  +  P E  PP   P P   P     P  +P P  
Sbjct: 482 HR---ESPTPSPEPSKPTSPTTSPSPSPEPSEPTPPATSPSPSSEPSEPTSPTTSPSPSS 538

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            P    PP   PS   +P     P  +P P  +P     P     P
Sbjct: 539 EPLESTPPTTSPSLSPEPSEPTSPTTSPSPSPEPSEPTSPTTSPSP 584

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 44/165 (26%), Positives = 60/165 (36%), Gaps = 11/165 (6%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPP 198
           P  +PP +  P  + P  E   P       +P P  +P     P     P  +P    PP
Sbjct: 455 PSPSPPQQEVPTPQTPSSEPYNPSPGGHRESPTPSPEPSKPTSPTTSPSPSPEPSEPTPP 514

Query: 199 PEHQPPHEKPPHAKSP-----PEYQPPHEHPP---PEYLPPHEKP--PHENPPPEYNPPH 348
                P  +P    SP     P  +P    PP   P   P   +P  P  +P P   P  
Sbjct: 515 ATSPSPSSEPSEPTSPTTSPSPSSEPLESTPPTTSPSLSPEPSEPTSPTTSPSPSPEPSE 574

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPN-EKPPHEKSPPAS 480
              P   PSPEY   +   P   P P+ +P +    P  +SP +S
Sbjct: 575 PTSPTTSPSPEY---NSSEPSPTPSPESEPQSPTSTPSPESPLSS 616

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 39/146 (26%), Positives = 48/146 (32%), Gaps = 6/146 (4%)
 Frame = +1

Query: 37  PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPP 216
           P    P     P    P+   P   P   Y P    P        Y P    P P   PP
Sbjct: 403 PSSPRPSTPSVPTPSTPYVPTPSTPPSTSYGPTPSTPYVPTPSTPYVPTPSTPSP--SPP 460

Query: 217 HEKPPHAKSPPE--YQPP----HEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSP 378
            ++ P  ++P    Y P      E P P   P     P  +P P   P    PP   PSP
Sbjct: 461 QQEVPTPQTPSSEPYNPSPGGHRESPTPSPEPSKPTSPTTSPSPSPEPSEPTPPATSPSP 520

Query: 379 EYQPPHQKPPHENPPPKFQPPNEKPP 456
             +P     P  +P P  +P    PP
Sbjct: 521 SSEPSEPTSPTTSPSPSSEPLESTPP 546

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 35/133 (26%), Positives = 43/133 (32%), Gaps = 1/133 (0%)
 Frame = +1

Query: 85  PHGKQPHV-NPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQP 261
           P    P V  P   Y P    PP     P    P+   P     P    P    P +  P
Sbjct: 406 PRPSTPSVPTPSTPYVPTPSTPPSTSYGPTPSTPYVPTPSTPYVPTPSTPSPSPPQQEVP 465

Query: 262 PHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP 441
             + P  E   P      E+P P   P     P   PSP  +P    PP  +P P  +P 
Sbjct: 466 TPQTPSSEPYNPSPGGHRESPTPSPEPSKPTSPTTSPSPSPEPSEPTPPATSPSPSSEPS 525

Query: 442 NEKPPHEKSPPAS 480
               P     P+S
Sbjct: 526 EPTSPTTSPSPSS 538

[68][TOP]
>UniRef100_UPI0000D9B337 PREDICTED: hypothetical protein n=1 Tax=Macaca mulatta
           RepID=UPI0000D9B337
          Length = 376

 Score =  122 bits (305), Expect = 2e-26
 Identities = 76/180 (42%), Positives = 88/180 (48%), Gaps = 23/180 (12%)
 Frame = +1

Query: 1   PHHAKPPYENP---PPEYQPPHEKPP----PEYQPPHGKQPHVNPP----PQYQPPHEKP 147
           P    P Y  P   PPEY  P  +PP    PEY PP    P   PP    P+Y PP    
Sbjct: 154 PECGPPEYGTPEYGPPEYGTPEYRPPKYGPPEYGPPEYGTPKCGPPEYGTPEYGPPEYGT 213

Query: 148 PHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPH 315
           P E+ PP Y PP E  PPE++PP   PP   +P EY PP   P    PPEY PP   PP 
Sbjct: 214 P-EYGPPKYGPP-EYGPPEYRPPEYGPPEYGTP-EYGPPKYGPLECGPPEYGPPEYGPPE 270

Query: 316 ENPP----PEYNPPHEKPPH----EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
              P    PEY PP   PP     E+ +PEY PP   PP E  PP++ PP   PP  ++P
Sbjct: 271 YGTPEYGTPEYGPPECGPPECGPPEYGTPEYGPPEYGPP-EYGPPEYGPPEYGPPEYETP 329

 Score =  112 bits (279), Expect = 2e-23
 Identities = 75/186 (40%), Positives = 86/186 (46%), Gaps = 28/186 (15%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPH----EKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPPHE 156
           P +  P Y   PPEY  P     E  PPEY PP    P   PP    P+Y+PP    P E
Sbjct: 84  PEYGPPEYG--PPEYGTPEYGTPESGPPEYGPPEYGTPEYGPPEYGTPEYRPPEYGTP-E 140

Query: 157 HSPPGYQPPH----EIPPPEHQPPHEKPPHAKSP----PEYQPPHEHPPPEYLPPHEKPP 312
           + PP Y PP     E  PPE+  P   PP   +P    P+Y PP E+ PPEY  P   PP
Sbjct: 141 YGPPEYGPPKYGTPECGPPEYGTPEYGPPEYGTPEYRPPKYGPP-EYGPPEYGTPKCGPP 199

Query: 313 H----ENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP----PKFQPPNEKP----P 456
                E  PPEY  P   PP   P PEY PP  +PP   PP    P++ PP   P    P
Sbjct: 200 EYGTPEYGPPEYGTPEYGPPKYGP-PEYGPPEYRPPEYGPPEYGTPEYGPPKYGPLECGP 258

Query: 457 HEKSPP 474
            E  PP
Sbjct: 259 PEYGPP 264

 Score =  108 bits (269), Expect = 2e-22
 Identities = 73/194 (37%), Positives = 83/194 (42%), Gaps = 43/194 (22%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKP----PPEYQPPHGKQPHVNP----PPQYQPPHEKPPH------- 153
           P E  PPEY PP  +P    PPEY P     P   P     P+Y PP   PP        
Sbjct: 43  PPEYGPPEYGPPEYRPPEYGPPEYGPLEYGTPEYGPLEYGTPEYGPPEYGPPEYGTPEYG 102

Query: 154 --EHSPPGYQPPH----EIPPPEHQPPHEKPPH----AKSPPEYQPPH------------ 267
             E  PP Y PP     E  PPE+  P  +PP        PPEY PP             
Sbjct: 103 TPESGPPEYGPPEYGTPEYGPPEYGTPEYRPPEYGTPEYGPPEYGPPKYGTPECGPPEYG 162

Query: 268 --EHPPPEYLPPHEKPPHENP----PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPK 429
             E+ PPEY  P  +PP   P    PPEY  P   PP E+ +PEY PP    P E  PPK
Sbjct: 163 TPEYGPPEYGTPEYRPPKYGPPEYGPPEYGTPKCGPP-EYGTPEYGPPEYGTP-EYGPPK 220

Query: 430 FQPPNEKPPHEKSP 471
           + PP   PP  + P
Sbjct: 221 YGPPEYGPPEYRPP 234

 Score =  108 bits (269), Expect = 2e-22
 Identities = 74/174 (42%), Positives = 84/174 (48%), Gaps = 16/174 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNP----PPQYQPPHEKPPHEHSPP 168
           P +  P Y   PPEY+PP E  PPEY P     P   P     P+Y PP   PP E+  P
Sbjct: 44  PEYGPPEYG--PPEYRPP-EYGPPEYGPLEYGTPEYGPLEYGTPEYGPPEYGPP-EYGTP 99

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSP----PEYQPPH----EHPPPEYLPPHEKPPHENP 324
            Y  P E  PPE+ PP    P    P    PEY+PP     E+ PPEY PP    P E  
Sbjct: 100 EYGTP-ESGPPEYGPPEYGTPEYGPPEYGTPEYRPPEYGTPEYGPPEYGPPKYGTP-ECG 157

Query: 325 PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP----PKFQPPNEKPPHEKSPP 474
           PPEY  P   PP E+ +PEY+PP   PP   PP    PK  PP    P E  PP
Sbjct: 158 PPEYGTPEYGPP-EYGTPEYRPPKYGPPEYGPPEYGTPKCGPPEYGTP-EYGPP 209

 Score =  108 bits (269), Expect = 2e-22
 Identities = 73/176 (41%), Positives = 83/176 (47%), Gaps = 22/176 (12%)
 Frame = +1

Query: 1   PHHAKPPYENPP---PEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKP---- 147
           P +  P Y  P    PEY PP +  PPEY PP  + P   PP    P+Y PP   P    
Sbjct: 199 PEYGTPEYGPPEYGTPEYGPP-KYGPPEYGPPEYRPPEYGPPEYGTPEYGPPKYGPLECG 257

Query: 148 PHEHSPPGYQPPH----EIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH 315
           P E+ PP Y PP     E   PE+ PP   PP    PPEY  P E+ PPEY PP   PP 
Sbjct: 258 PPEYGPPEYGPPEYGTPEYGTPEYGPPECGPPEC-GPPEYGTP-EYGPPEYGPPEYGPP- 314

Query: 316 ENPPPEYNPP-HEKPPHEHPS---PEYQPPHQKPPHENPPPKF---QPPNEKPPHE 462
           E  PPEY PP +E P +  P    PEY  P    P   PP      QP  EK  H+
Sbjct: 315 EYGPPEYGPPEYETPKYGTPECGPPEYGAPEYGTPEYGPPECLLWEQPATEKREHQ 370

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 62/159 (38%), Positives = 72/159 (45%), Gaps = 30/159 (18%)
 Frame = +1

Query: 85  PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP---------PHEIPPPEHQPPHEKPPH- 234
           P G  P    PP+Y PP  +PP E+ PP Y P         P E   PE+ PP   PP  
Sbjct: 38  PTGYGPPEYGPPEYGPPEYRPP-EYGPPEYGPLEYGTPEYGPLEYGTPEYGPPEYGPPEY 96

Query: 235 --------AKSPPEYQPPH----EHPPPEYLPPHEKPPH----ENPPPEYNPPH----EK 354
                      PPEY PP     E+ PPEY  P  +PP     E  PPEY PP     E 
Sbjct: 97  GTPEYGTPESGPPEYGPPEYGTPEYGPPEYGTPEYRPPEYGTPEYGPPEYGPPKYGTPEC 156

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
            P E+ +PEY PP    P E  PPK+ PP   PP   +P
Sbjct: 157 GPPEYGTPEYGPPEYGTP-EYRPPKYGPPEYGPPEYGTP 194

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 44/112 (39%), Positives = 53/112 (47%), Gaps = 8/112 (7%)
 Frame = +1

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP----P 327
           +P GY PP E  PPE+            PPEY+PP E+ PPEY P     P   P     
Sbjct: 37  APTGYGPP-EYGPPEY-----------GPPEYRPP-EYGPPEYGPLEYGTPEYGPLEYGT 83

Query: 328 PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP----PKFQPPNEKPPHEKSP 471
           PEY PP   PP E+ +PEY  P   PP   PP    P++ PP    P  + P
Sbjct: 84  PEYGPPEYGPP-EYGTPEYGTPESGPPEYGPPEYGTPEYGPPEYGTPEYRPP 134

[69][TOP]
>UniRef100_Q2U177 Predicted protein n=1 Tax=Aspergillus oryzae RepID=Q2U177_ASPOR
          Length = 334

 Score =  122 bits (305), Expect = 2e-26
 Identities = 58/161 (36%), Positives = 91/161 (56%), Gaps = 9/161 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPP-HEKPPPEYQPPHGKQPHVNPPPQYQ------PPHEKPPHEH 159
           P + +PPY  PP    P  +E+PP + +PP+G++P  + PP  Q      P +++PP+E 
Sbjct: 10  PPYGQPPYGQPPYGQSPGGYERPPYDQRPPYGERPSYDRPPYEQGPPGDRPQYDRPPYEQ 69

Query: 160 SPP-GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY 336
            PP G +PP++ PP E     ++PP  +  P  +PP+E PPP     +E+PP+  PP + 
Sbjct: 70  GPPSGERPPYDRPPYE-----QRPPSGERSPYDRPPYEQPPPGERSQYERPPYGQPPQDQ 124

Query: 337 NPPHEKPPHEHPSPEYQPP-HQKPPHENPPPKFQPPNEKPP 456
            PP+++PP E P  E       +PP+ + PP  +PP   PP
Sbjct: 125 RPPYDRPPSERPPYESDRSFDSRPPYSSAPPSARPPQIPPP 165

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 62/205 (30%), Positives = 94/205 (45%), Gaps = 50/205 (24%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQ-PPHEKPPPEYQPPHGKQPHVNPPPQYQPP------HEKPPHEH 159
           P + +PPYE  PP  + PP+++PP E +PP G++   + PP  QPP      +E+PP+  
Sbjct: 60  PQYDRPPYEQGPPSGERPPYDRPPYEQRPPSGERSPYDRPPYEQPPPGERSQYERPPYGQ 119

Query: 160 SPPGYQPPHEIPPPEHQPPHE-------KPPHAKSPPEYQPPHEHPPP-------EYLP- 294
            P   +PP++ PP E +PP+E       +PP++ +PP  +PP   PPP       E+ P 
Sbjct: 120 PPQDQRPPYDRPPSE-RPPYESDRSFDSRPPYSSAPPSARPPQIPPPPLPMGWVQEWEPN 178

Query: 295 --------------PHEKPPHEN--------PPPEYNPPHEKPPHEHPSPEYQPPHQKPP 408
                           E+P  ++        PP   +PP   P    P   Y  P   PP
Sbjct: 179 ARRAFWVEVATGNSQWEQPFGDSSRDMGPGGPPAIMSPPPSGPISPPPGGYYGGP---PP 235

Query: 409 HEN---PPP---KFQPPNEKPPHEK 465
            E    PPP   ++Q   ++   EK
Sbjct: 236 QEGGYYPPPQQGEYQSEADRKKSEK 260

[70][TOP]
>UniRef100_Q9KK12 Surface protein PspC n=1 Tax=Streptococcus pneumoniae
           RepID=Q9KK12_STRPN
          Length = 584

 Score =  121 bits (304), Expect = 2e-26
 Identities = 68/157 (43%), Positives = 77/157 (49%), Gaps = 3/157 (1%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE +P  EKP PE +P P   +P VNP P+   P  KP  E   P  +P  E
Sbjct: 360 KPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVNPQPEKPKPEVKPQPEKPKPEVKPQPE 419

Query: 190 IPPPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PH 363
            P PE +P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P 
Sbjct: 420 KPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPE 479

Query: 364 EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             P PE   P  KP  E P P+ +P  EKP  + S P
Sbjct: 480 VKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPDNSKP 516

 Score =  118 bits (295), Expect = 2e-25
 Identities = 67/156 (42%), Positives = 74/156 (47%), Gaps = 3/156 (1%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE +P  EKP PE +P P   +P V P P+   P  KP  E   P   P  E
Sbjct: 338 KPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVNPQPE 397

Query: 190 IPPPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PH 363
            P PE +P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P 
Sbjct: 398 KPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPE 457

Query: 364 EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             P PE   P  KP  E P P+ +P  EKP  E  P
Sbjct: 458 VKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 493

 Score =  116 bits (291), Expect = 7e-25
 Identities = 66/156 (42%), Positives = 74/156 (47%), Gaps = 3/156 (1%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE +P  EKP PE +P P   +P V P P+   P   P  E   P  +P  E
Sbjct: 349 KPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVNPQPEKPKPEVKPQPE 408

Query: 190 IPPPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PH 363
            P PE +P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P 
Sbjct: 409 KPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPE 468

Query: 364 EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             P PE   P  KP  E P P+ +P  EKP  E  P
Sbjct: 469 VKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 504

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/152 (42%), Positives = 72/152 (47%), Gaps = 3/152 (1%)
 Frame = +1

Query: 25  ENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPP 201
           E P PE +P  EKP PE +P P   +P V P P+   P  KP  E   P  +P  E P P
Sbjct: 331 EKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKP 390

Query: 202 EHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PHEHPS 375
           E  P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P   P 
Sbjct: 391 EVNPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQ 450

Query: 376 PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           PE   P  KP  E P P+ +P  EKP  E  P
Sbjct: 451 PEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 482

 Score =  110 bits (276), Expect = 4e-23
 Identities = 65/159 (40%), Positives = 74/159 (46%), Gaps = 3/159 (1%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE +P  EKP PE  P P   +P V P P+   P  KP  E   P  +P  E
Sbjct: 371 KPQPEKPKPEVKPQPEKPKPEVNPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPE 430

Query: 190 IPPPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PH 363
            P PE +P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P 
Sbjct: 431 KPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPE 490

Query: 364 EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
             P PE   P  KP  E P    +P N KP  +   P++
Sbjct: 491 VKPQPEKPKPEVKPQPEKP----KPDNSKPQADDKKPST 525

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 61/154 (39%), Positives = 73/154 (47%), Gaps = 3/154 (1%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEI 192
           P  E P PE +P  EKP PE +P P   +P V P P+   P  KP  E   P  +P  E 
Sbjct: 394 PQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEK 453

Query: 193 PPPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEH 369
           P PE +P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP  ++
Sbjct: 454 PKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPDN 513

Query: 370 PSPEYQPPHQKPPHENPPPK-FQPPNEKPPHEKS 468
             P  Q   +KP   N   K  QP N+   +EK+
Sbjct: 514 SKP--QADDKKPSTTNNLSKDKQPSNQASTNEKA 545

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 60/165 (36%), Positives = 73/165 (44%), Gaps = 17/165 (10%)
 Frame = +1

Query: 28  NPPPEYQPPHEKPPPEYQPPHGKQPHVN---------PPPQYQPPHEKPPHEHSPPGYQP 180
           +P PE +P   +P  + Q  +  Q + N         P P+ +P  EKP  E  P   +P
Sbjct: 299 SPQPEVKP---QPKNQNQRLNRNQKNQNQRLNRNLEKPKPEVKPQPEKPKPEVKPQPEKP 355

Query: 181 PHEIPP-PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLP------PHEKPPHENPPPEYN 339
             E+ P PE   P  KP   K  PE +P  E P PE  P      P  KP  E P PE  
Sbjct: 356 KPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVNPQPEKPKPEVKPQPEKPKPEVK 415

Query: 340 PPHEKP-PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           P  EKP P   P PE   P  KP  E P P+ +P  EKP  E  P
Sbjct: 416 PQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 460

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 60/166 (36%), Positives = 71/166 (42%), Gaps = 9/166 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQP-PHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           P + KP       +  P P  KP P+ Q     +   N   +     EKP  E  P   +
Sbjct: 284 PGNKKPSAPKTGMQPSPQPEVKPQPKNQNQRLNRNQKNQNQRLNRNLEKPKPEVKPQPEK 343

Query: 178 PPHEIPP-PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP-PHENPPPEYNPPHE 351
           P  E+ P PE   P  KP   K  PE +P  E P PE  P  EKP P  NP PE   P  
Sbjct: 344 PKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVNPQPEKPKPEV 403

Query: 352 KPPHEHPSPEYQP------PHQKPPHENPPPKFQPPNEKPPHEKSP 471
           KP  E P PE +P      P  KP  E P P+ +P  EKP  E  P
Sbjct: 404 KPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 449

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 56/148 (37%), Positives = 71/148 (47%), Gaps = 6/148 (4%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE +P  EKP PE +P P   +P V P P+   P  KP  E   P  +P  E
Sbjct: 415 KPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPE 474

Query: 190 IPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPH-- 363
            P PE +P  EKP      PE +P  E P PE  P  EKP  +N  P+ +   +K P   
Sbjct: 475 KPKPEVKPQPEKP-----KPEVKPQPEKPKPEVKPQPEKPKPDNSKPQAD---DKKPSTT 526

Query: 364 EHPSPEYQPPHQKPPHE---NPPPKFQP 438
            + S + QP +Q   +E   N P K  P
Sbjct: 527 NNLSKDKQPSNQASTNEKATNKPKKSLP 554

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 53/145 (36%), Positives = 64/145 (44%), Gaps = 3/145 (2%)
 Frame = +1

Query: 46  QPPHEKPP-PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHE 222
           +P ++KP  P+       QP V P P+ Q        ++         E P PE +P  E
Sbjct: 283 EPGNKKPSAPKTGMQPSPQPEVKPQPKNQNQRLNRNQKNQNQRLNRNLEKPKPEVKPQPE 342

Query: 223 KP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PHEHPSPEYQPPH 396
           KP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P  +P PE   P 
Sbjct: 343 KPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVNPQPEKPKPE 402

Query: 397 QKPPHENPPPKFQPPNEKPPHEKSP 471
            KP  E P P+ +P  EKP  E  P
Sbjct: 403 VKPQPEKPKPEVKPQPEKPKPEVKP 427

[71][TOP]
>UniRef100_Q9KK09 Surface protein PcpC n=1 Tax=Streptococcus pneumoniae
           RepID=Q9KK09_STRPN
          Length = 580

 Score =  121 bits (304), Expect = 2e-26
 Identities = 68/157 (43%), Positives = 77/157 (49%), Gaps = 3/157 (1%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE +P  EKP PE +P P   +P VNP P+   P  KP  E   P  +P  E
Sbjct: 356 KPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVNPQPEKPKPEVKPQPEKPKPEVKPQPE 415

Query: 190 IPPPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PH 363
            P PE +P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P 
Sbjct: 416 KPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPE 475

Query: 364 EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             P PE   P  KP  E P P+ +P  EKP  + S P
Sbjct: 476 VKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPDNSKP 512

 Score =  118 bits (295), Expect = 2e-25
 Identities = 67/156 (42%), Positives = 74/156 (47%), Gaps = 3/156 (1%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE +P  EKP PE +P P   +P V P P+   P  KP  E   P   P  E
Sbjct: 334 KPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVNPQPE 393

Query: 190 IPPPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PH 363
            P PE +P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P 
Sbjct: 394 KPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPE 453

Query: 364 EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             P PE   P  KP  E P P+ +P  EKP  E  P
Sbjct: 454 VKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 489

 Score =  116 bits (291), Expect = 7e-25
 Identities = 66/156 (42%), Positives = 74/156 (47%), Gaps = 3/156 (1%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE +P  EKP PE +P P   +P V P P+   P   P  E   P  +P  E
Sbjct: 345 KPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVNPQPEKPKPEVKPQPE 404

Query: 190 IPPPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PH 363
            P PE +P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P 
Sbjct: 405 KPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPE 464

Query: 364 EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             P PE   P  KP  E P P+ +P  EKP  E  P
Sbjct: 465 VKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 500

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/152 (42%), Positives = 72/152 (47%), Gaps = 3/152 (1%)
 Frame = +1

Query: 25  ENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPP 201
           E P PE +P  EKP PE +P P   +P V P P+   P  KP  E   P  +P  E P P
Sbjct: 327 EKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKP 386

Query: 202 EHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PHEHPS 375
           E  P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P   P 
Sbjct: 387 EVNPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQ 446

Query: 376 PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           PE   P  KP  E P P+ +P  EKP  E  P
Sbjct: 447 PEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 478

 Score =  110 bits (276), Expect = 4e-23
 Identities = 65/159 (40%), Positives = 74/159 (46%), Gaps = 3/159 (1%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE +P  EKP PE  P P   +P V P P+   P  KP  E   P  +P  E
Sbjct: 367 KPQPEKPKPEVKPQPEKPKPEVNPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPE 426

Query: 190 IPPPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PH 363
            P PE +P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P 
Sbjct: 427 KPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPE 486

Query: 364 EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
             P PE   P  KP  E P    +P N KP  +   P++
Sbjct: 487 VKPQPEKPKPEVKPQPEKP----KPDNSKPQADDKKPST 521

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 61/154 (39%), Positives = 73/154 (47%), Gaps = 3/154 (1%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEI 192
           P  E P PE +P  EKP PE +P P   +P V P P+   P  KP  E   P  +P  E 
Sbjct: 390 PQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEK 449

Query: 193 PPPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEH 369
           P PE +P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP  ++
Sbjct: 450 PKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPDN 509

Query: 370 PSPEYQPPHQKPPHENPPPK-FQPPNEKPPHEKS 468
             P  Q   +KP   N   K  QP N+   +EK+
Sbjct: 510 SKP--QADDKKPSTTNNLSKDKQPSNQASTNEKA 541

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 60/165 (36%), Positives = 73/165 (44%), Gaps = 17/165 (10%)
 Frame = +1

Query: 28  NPPPEYQPPHEKPPPEYQPPHGKQPHVN---------PPPQYQPPHEKPPHEHSPPGYQP 180
           +P PE +P   +P  + Q  +  Q + N         P P+ +P  EKP  E  P   +P
Sbjct: 295 SPQPEVKP---QPKNQNQRLNRNQKNQNQRLNRNLEKPKPEVKPQPEKPKPEVKPQPEKP 351

Query: 181 PHEIPP-PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLP------PHEKPPHENPPPEYN 339
             E+ P PE   P  KP   K  PE +P  E P PE  P      P  KP  E P PE  
Sbjct: 352 KPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVNPQPEKPKPEVKPQPEKPKPEVK 411

Query: 340 PPHEKP-PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           P  EKP P   P PE   P  KP  E P P+ +P  EKP  E  P
Sbjct: 412 PQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 456

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 60/166 (36%), Positives = 71/166 (42%), Gaps = 9/166 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQP-PHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           P + KP       +  P P  KP P+ Q     +   N   +     EKP  E  P   +
Sbjct: 280 PGNKKPSAPKTGMQPSPQPEVKPQPKNQNQRLNRNQKNQNQRLNRNLEKPKPEVKPQPEK 339

Query: 178 PPHEIPP-PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP-PHENPPPEYNPPHE 351
           P  E+ P PE   P  KP   K  PE +P  E P PE  P  EKP P  NP PE   P  
Sbjct: 340 PKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVNPQPEKPKPEV 399

Query: 352 KPPHEHPSPEYQP------PHQKPPHENPPPKFQPPNEKPPHEKSP 471
           KP  E P PE +P      P  KP  E P P+ +P  EKP  E  P
Sbjct: 400 KPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 445

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 56/148 (37%), Positives = 71/148 (47%), Gaps = 6/148 (4%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE +P  EKP PE +P P   +P V P P+   P  KP  E   P  +P  E
Sbjct: 411 KPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPE 470

Query: 190 IPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPH-- 363
            P PE +P  EKP      PE +P  E P PE  P  EKP  +N  P+ +   +K P   
Sbjct: 471 KPKPEVKPQPEKP-----KPEVKPQPEKPKPEVKPQPEKPKPDNSKPQAD---DKKPSTT 522

Query: 364 EHPSPEYQPPHQKPPHE---NPPPKFQP 438
            + S + QP +Q   +E   N P K  P
Sbjct: 523 NNLSKDKQPSNQASTNEKATNKPKKSLP 550

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 53/145 (36%), Positives = 64/145 (44%), Gaps = 3/145 (2%)
 Frame = +1

Query: 46  QPPHEKPP-PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHE 222
           +P ++KP  P+       QP V P P+ Q        ++         E P PE +P  E
Sbjct: 279 EPGNKKPSAPKTGMQPSPQPEVKPQPKNQNQRLNRNQKNQNQRLNRNLEKPKPEVKPQPE 338

Query: 223 KP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PHEHPSPEYQPPH 396
           KP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P  +P PE   P 
Sbjct: 339 KPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVNPQPEKPKPE 398

Query: 397 QKPPHENPPPKFQPPNEKPPHEKSP 471
            KP  E P P+ +P  EKP  E  P
Sbjct: 399 VKPQPEKPKPEVKPQPEKPKPEVKP 423

[72][TOP]
>UniRef100_P06600 Proline-rich 33 kDa extensin-related protein (Fragment) n=1
           Tax=Daucus carota RepID=PRP33_DAUCA
          Length = 211

 Score =  121 bits (304), Expect = 2e-26
 Identities = 77/182 (42%), Positives = 92/182 (50%), Gaps = 26/182 (14%)
 Frame = +1

Query: 7   HAKPPYENPPPEYQPPHEKPP----PEYQPPHGKQPHVNPPPQYQPPHE-KPPHE----- 156
           H+ PP   PP  Y PP  KPP    P Y PP  K P V  PP ++PP E KPP E     
Sbjct: 17  HSHPPIHKPPV-YTPPVHKPPIHKPPVYTPPVHKPP-VYTPPVHKPPSEYKPPVEATNSV 74

Query: 157 -------HSPPGYQPPHEIPPPEHQPPHEKPPHAKSP----PEYQPPHEHPPPEYLP-PH 300
                  H PP Y+PP + P PEH+PP  KPP  K P    P     H    P + P P 
Sbjct: 75  TEDHYPIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPI 134

Query: 301 EKPPHENPPPEYNPPHEKPPHEH-PSPEYQPPH-QKPPHENPPPKFQPPNEKPP--HEKS 468
            +PP   PP E+ PP  +P  EH PSP YQPP  +KP  E+ PP   P   +PP  H+ +
Sbjct: 135 HRPPVHKPPTEHKPPVHEPATEHKPSPVYQPPKTEKPVPEHKPPHLPPIVVRPPPTHKPN 194

Query: 469 PP 474
           PP
Sbjct: 195 PP 196

 Score =  117 bits (294), Expect = 3e-25
 Identities = 66/171 (38%), Positives = 86/171 (50%), Gaps = 13/171 (7%)
 Frame = +1

Query: 1   PHHAKPPYENP---PPEYQPPHEKPPPEYQPP-----HGKQPH--VNPPPQYQPPHEKPP 150
           P H  P Y  P   PP Y PP  KPP EY+PP        + H  ++ PP Y+PP +KP 
Sbjct: 36  PIHKPPVYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHYPIHKPPVYKPPVQKPA 95

Query: 151 HEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHE-KPPHENPP 327
            EH PP ++PP    PP H  P     H  + P ++P   H PP + PP E KPP   P 
Sbjct: 96  PEHKPPVHKPPIH-KPPVHNTPSVTDDHYPAHPIHKPQPIHRPPVHKPPTEHKPPVHEPA 154

Query: 328 PEY--NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            E+  +P ++ P  E P PE++PPH  P    PPP  +P      H + PP
Sbjct: 155 TEHKPSPVYQPPKTEKPVPEHKPPHLPPIVVRPPPTHKPNPPYGHHPRHPP 205

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 50/131 (38%), Positives = 62/131 (47%), Gaps = 12/131 (9%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGK----------QPHVNPPPQYQPPHEKPPHEHS 162
           KPP + P PE++PP  KPP    P H             P   P P ++PP  KPP EH 
Sbjct: 88  KPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHRPPVHKPPTEHK 147

Query: 163 PPGYQPPHEIPP-PEHQPPH-EKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY 336
           PP ++P  E  P P +QPP  EKP     PP   P    PPP + P        NPP  +
Sbjct: 148 PPVHEPATEHKPSPVYQPPKTEKPVPEHKPPHLPPIVVRPPPTHKP--------NPPYGH 199

Query: 337 NPPHEKPPHEH 369
           +P H  PP E+
Sbjct: 200 HPRH--PPVEN 208

[73][TOP]
>UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1
            Tax=Ostreococcus tauri RepID=Q010M7_OSTTA
          Length = 1449

 Score =  121 bits (303), Expect = 3e-26
 Identities = 64/154 (41%), Positives = 69/154 (44%), Gaps = 1/154 (0%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP  +PPP   PP   PPP    P    P  +PPP   PP   PP   SPP   PP   P
Sbjct: 800  PPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPP---PPSSPPPPSPSPPPSPPPAPSP 856

Query: 196  PPE-HQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHP 372
            PP  + PP   PP   SPP   PP   PPP   PP   PP  +PPP  NPP   PP    
Sbjct: 857  PPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPP---- 912

Query: 373  SPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
                 P    PP  +PPP   PP   PP   SPP
Sbjct: 913  -----PLSSPPPLSSPPPPSSPPPPSPPLPPSPP 941

 Score =  114 bits (285), Expect = 3e-24
 Identities = 64/153 (41%), Positives = 67/153 (43%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP   PPP   PP   PPP   PP        PPP   PP   PP   SPP    P   P
Sbjct: 787  PPPSPPPP--LPPSPPPPPSPPPP--------PPPPSPPPPPNPPTPPSPP----PPPSP 832

Query: 196  PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
            PP   PP   PP + SPP   PP   PPP    P   PP   PPP  +PP   PP   P 
Sbjct: 833  PP---PPSSPPPPSPSPPPSPPPAPSPPP----PPNPPPAPTPPPPPSPPPSPPPSPPPP 885

Query: 376  PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            P   PP   PP  +PPP   PP   PP   SPP
Sbjct: 886  PSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPP 918

 Score =  112 bits (280), Expect = 1e-23
 Identities = 63/165 (38%), Positives = 68/165 (41%), Gaps = 7/165 (4%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   P P   PP    P   PPP   PP   PP   SPP   P
Sbjct: 823  PPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSP---PPPPNPPPAPTPPPPPSPPPSPP 879

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   P    PP  +PPP  +PP   PP
Sbjct: 880  PSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSP----PPLSSPPPPSSPPPPSPP 935

Query: 361  HEHPSPEYQPPHQKPPHENP-------PPKFQPPNEKPPHEKSPP 474
               PSP   P    PP  +P       PP+   P+  PP    PP
Sbjct: 936  LP-PSPPLPPNPPPPPSPSPXXXXXXXPPRLPTPSPPPPSPPLPP 979

 Score =  109 bits (272), Expect = 1e-22
 Identities = 63/158 (39%), Positives = 67/158 (42%), Gaps = 1/158 (0%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNP-PPQYQPPHEKPPHEHSPPGYQ 177
            P  + PP  NPP    PP   PPP   PP    P  +P PP   PP   PP    PP   
Sbjct: 810  PPPSPPPPPNPPT---PPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPP----PPPNP 862

Query: 178  PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
            PP   PPP   PP   PP    PP   PP   PP    PP   PP  +PPP  +P    P
Sbjct: 863  PPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSP----P 918

Query: 358  PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
            P   P P   PP   PP    PP   PPN  PP   SP
Sbjct: 919  PLSSPPPPSSPPPPSPPLPPSPP--LPPNPPPPPSPSP 954

 Score =  103 bits (256), Expect = 8e-21
 Identities = 55/130 (42%), Positives = 61/130 (46%), Gaps = 2/130 (1%)
 Frame = +1

Query: 97   QPHVNPPPQYQPP-HEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEH 273
            Q   +PPP   PP    PP   SPP   PP   PPP + P    PP   SPP   PP   
Sbjct: 782  QARQSPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPP--PPPSSP 839

Query: 274  PPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHEN-PPPKFQPPNEK 450
            PPP   PP   PP  +PPP  NPP    P   PSP   PP   PP  + PPP   PP+  
Sbjct: 840  PPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPS 899

Query: 451  PPHEKSPPAS 480
            PP   +PP S
Sbjct: 900  PPPSSNPPLS 909

[74][TOP]
>UniRef100_Q95JC9 Parotid hormone n=1 Tax=Sus scrofa RepID=PRP_PIG
          Length = 676

 Score =  121 bits (303), Expect = 3e-26
 Identities = 68/163 (41%), Positives = 75/163 (46%), Gaps = 4/163 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 263 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 321

Query: 181 PHEIP----PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   P    PP   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 322 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 381

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
             PP   P P  +PP   PP   PPP   PP  +PP    PPA
Sbjct: 382 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPPPPPPA 423

 Score =  119 bits (298), Expect = 1e-25
 Identities = 67/162 (41%), Positives = 74/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 74  PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 132

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 133 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 192

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 193 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 233

 Score =  119 bits (298), Expect = 1e-25
 Identities = 67/162 (41%), Positives = 74/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 459 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 517

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 518 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 577

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 578 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 618

 Score =  119 bits (298), Expect = 1e-25
 Identities = 67/162 (41%), Positives = 74/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 480 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 538

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 539 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 598

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 599 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 639

 Score =  119 bits (297), Expect = 1e-25
 Identities = 67/162 (41%), Positives = 74/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 116 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 174

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 175 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 234

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 235 PPPPGPAP-PGARPPPGPPPLGPPPPGPAPPGARPPPGPPPP 275

 Score =  119 bits (297), Expect = 1e-25
 Identities = 67/162 (41%), Positives = 74/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 179 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 237

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 238 PGPAPPGARPPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 297

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 298 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 338

 Score =  118 bits (296), Expect = 2e-25
 Identities = 67/162 (41%), Positives = 74/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 242 PPGARPP-PGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 300

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 301 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 360

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 361 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 401

 Score =  117 bits (293), Expect = 4e-25
 Identities = 65/162 (40%), Positives = 71/162 (43%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   P     PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 437 PKKKPPPPAGPPPPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 496

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 497 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 556

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 557 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 597

 Score =  116 bits (291), Expect = 7e-25
 Identities = 66/161 (40%), Positives = 73/161 (45%), Gaps = 4/161 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 95  PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 153

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 154 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 213

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             PP   P P  +PP   PP   PPP   PP  +PP    P
Sbjct: 214 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPP 253

 Score =  116 bits (291), Expect = 7e-25
 Identities = 67/163 (41%), Positives = 75/163 (46%), Gaps = 5/163 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 137 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 195

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 196 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP--GPPP 253

Query: 349 EKPPHEHPSPE-YQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P+P   +PP   PP   PPP   PP  +PP    PP
Sbjct: 254 LGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 296

 Score =  116 bits (291), Expect = 7e-25
 Identities = 67/167 (40%), Positives = 72/167 (43%), Gaps = 8/167 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 247 PPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 306

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEY 336
           G +PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP  
Sbjct: 307 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 366

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 367 APPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 413

 Score =  116 bits (290), Expect = 9e-25
 Identities = 66/163 (40%), Positives = 71/163 (43%), Gaps = 4/163 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 147 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 205

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP----PEYLPPHEKPPHENPPPEYNPPH 348
           P   PPP   PP   PP A+ PP   PP   PP    P   PP   PP   PPP   PP 
Sbjct: 206 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPG 265

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 266 ARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 308

 Score =  116 bits (290), Expect = 9e-25
 Identities = 65/162 (40%), Positives = 73/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 289 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 348

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           G +PP   PPP   PP   PP A+ PP   PP   PPP   PP  +PP   PPP   PP 
Sbjct: 349 GARPPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 407

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P   PP  + P + P P    P +KPP    PP
Sbjct: 408 PAPPGARPPPPPPPPADE-PQQGPAPSGDKPKKKPPPPAGPP 448

 Score =  115 bits (289), Expect = 1e-24
 Identities = 67/167 (40%), Positives = 72/167 (43%), Gaps = 8/167 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 79  PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 138

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEY 336
           G +PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP  
Sbjct: 139 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 198

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 199 APPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 245

 Score =  115 bits (289), Expect = 1e-24
 Identities = 66/158 (41%), Positives = 72/158 (45%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP  +PPP   PP G  P    PP  +PP   PP    PPG  P
Sbjct: 205 PPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAP 263

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 264 PGARPPPGPPPPGPPPP-GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 322

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 323 GPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 359

 Score =  115 bits (289), Expect = 1e-24
 Identities = 66/169 (39%), Positives = 75/169 (44%), Gaps = 11/169 (6%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 326 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 384

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP----------PHENPPP 330
           P   PP    PP   PP    PP   PP   PPP   PP ++P          P + PPP
Sbjct: 385 PGPAPPGARPPPGPPPP-GPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPPP 443

Query: 331 EYNPPHEKPPHEHPSPE-YQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP   PP   P+P   +PP   PP   PPP   PP  +PP    PP
Sbjct: 444 PAGPPPPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 492

 Score =  115 bits (289), Expect = 1e-24
 Identities = 67/169 (39%), Positives = 74/169 (43%), Gaps = 10/169 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQP-----PHGKQPHVNPPPQYQPPHEKPPHE-HS 162
           P    PP    PP  +PP   PPP  +P     P G +P   PPP   PP   PP    +
Sbjct: 399 PPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPSPGPA 458

Query: 163 PPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPP 330
           PPG +PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP
Sbjct: 459 PPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 518

Query: 331 EYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 519 GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 567

 Score =  115 bits (289), Expect = 1e-24
 Identities = 67/167 (40%), Positives = 72/167 (43%), Gaps = 8/167 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 464 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 523

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEY 336
           G +PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP  
Sbjct: 524 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 583

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 584 APPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 630

 Score =  115 bits (289), Expect = 1e-24
 Identities = 67/167 (40%), Positives = 72/167 (43%), Gaps = 8/167 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 485 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 544

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEY 336
           G +PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP  
Sbjct: 545 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 604

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 605 APPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 651

 Score =  115 bits (288), Expect = 2e-24
 Identities = 66/162 (40%), Positives = 73/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 158 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 216

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PP    PP   PP   PPP   PP 
Sbjct: 217 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPPPGPPPPG 276

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 277 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 317

 Score =  115 bits (288), Expect = 2e-24
 Identities = 67/167 (40%), Positives = 72/167 (43%), Gaps = 8/167 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQP----PHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP   P    P G  P    PP   PP   PP   +PP
Sbjct: 226 PPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 285

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEY 336
           G +PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP  
Sbjct: 286 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 345

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 346 APPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 392

 Score =  115 bits (288), Expect = 2e-24
 Identities = 65/159 (40%), Positives = 72/159 (45%), Gaps = 1/159 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNP-PPQYQPPHEKPPHEHSPPGYQ 177
           P  A  P + P P    P +KPPP   PP    P   P PP  +PP   PP    PPG  
Sbjct: 420 PPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPSPGPAPPGARPPPGPPPPGPPPPGPA 479

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
           PP   PPP   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP   P
Sbjct: 480 PPGARPPPGPPPPGPPPP-GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 538

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 539 PGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 576

 Score =  115 bits (288), Expect = 2e-24
 Identities = 65/162 (40%), Positives = 71/162 (43%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 511 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 569

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP----PEYLPPHEKPPHENPPPEYNPPH 348
           P   PPP   PP   PP A+ PP   PP   PP    P   PP   PP   PPP   PP 
Sbjct: 570 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 629

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            +PP   P P   PP   PP   PPP   PP   P   + PP
Sbjct: 630 ARPPPGPPPPGPPPPGPAPPGARPPPGPPPPPPGPSPPRPPP 671

 Score =  115 bits (287), Expect = 2e-24
 Identities = 67/163 (41%), Positives = 72/163 (44%), Gaps = 5/163 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 506 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 565

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           G +PP   PPP   PP   PP A+ PP   PP   PPP   PP  +PP   PPP   PP 
Sbjct: 566 GARPPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 624

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHE-KSPP 474
             PP   P P   PP   PP   PP    PP   PP    SPP
Sbjct: 625 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPPPGPSPP 667

 Score =  114 bits (286), Expect = 3e-24
 Identities = 66/164 (40%), Positives = 73/164 (44%), Gaps = 4/164 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 105 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 163

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP----PEYLPPHEKPPHENPPPEYNPPH 348
           P   PPP   PP   PP A+ PP   PP   PP    P   PP   PP   PPP   PP 
Sbjct: 164 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 223

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
            +PP   P P   PP   PP   PPP   PP   PP   +PP +
Sbjct: 224 ARPPPGPPPPGPPPPGPAPPGARPPPG-PPPLGPPPPGPAPPGA 266

 Score =  114 bits (286), Expect = 3e-24
 Identities = 65/161 (40%), Positives = 70/161 (43%), Gaps = 4/161 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 163 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 222

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           G +PP   PPP   PP   PP A+ PP   PP   PPP   PP  +PP   PPP   PP 
Sbjct: 223 GARPPPGPPPPGPPPPGPAPPGARPPPG-PPPLGPPPPGPAPPGARPPPGPPPPGPPPPG 281

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             PP   P P   PP   PP   PP    PP   PP    P
Sbjct: 282 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 322

 Score =  114 bits (286), Expect = 3e-24
 Identities = 65/165 (39%), Positives = 73/165 (44%), Gaps = 8/165 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 268 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 327

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEY 336
           G +PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP  
Sbjct: 328 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 387

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
            PP  +PP   P P   PP   PP   PPP   PP ++P    +P
Sbjct: 388 APPGARPPPGPPPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAP 432

 Score =  114 bits (286), Expect = 3e-24
 Identities = 61/158 (38%), Positives = 71/158 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP ++P    +P G +P
Sbjct: 378 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKP 437

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
             + PPP   PP   P    +PP  +PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 438 KKKPPPPAGPPPPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 497

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 498 GPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 534

 Score =  114 bits (286), Expect = 3e-24
 Identities = 64/158 (40%), Positives = 68/158 (43%), Gaps = 4/158 (2%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP   P P    P   PPP   PP G  P    PP   PP   PP   +PPG +PP   P
Sbjct: 452 PPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP 511

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEYNPPHEKPPH 363
           PP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP   PP  +PP 
Sbjct: 512 PPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 571

Query: 364 EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
             P P   PP   PP   PPP   PP   PP    P A
Sbjct: 572 GPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 609

 Score =  114 bits (284), Expect = 4e-24
 Identities = 66/164 (40%), Positives = 73/164 (44%), Gaps = 6/164 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 347 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 405

Query: 181 PHEIPPPEHQPPHEKPPHAKSP-----PEYQPPHEHPPPEYLPPHEKPPHENP-PPEYNP 342
           P   PP   +PP   PP A  P     P    P + PPP   PP   PP   P PP   P
Sbjct: 406 PGPAPPGA-RPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPSPGPAPPGARP 464

Query: 343 PHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 465 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 508

 Score =  113 bits (283), Expect = 6e-24
 Identities = 66/164 (40%), Positives = 73/164 (44%), Gaps = 9/164 (5%)
 Frame = +1

Query: 13  KPPYENP-----PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           +PP + P     PP  +PP   PPP   PP G  P    PP   PP   PP   +PPG +
Sbjct: 62  RPPGDGPEQGPAPPGARPPPGPPPPG-PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGAR 120

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEYNPP 345
           PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP   PP
Sbjct: 121 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 180

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
             +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 181 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 224

 Score =  113 bits (283), Expect = 6e-24
 Identities = 68/179 (37%), Positives = 76/179 (42%), Gaps = 21/179 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 310 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 369

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP------ 330
           G +PP   PPP   PP   PP A+ PP   PP   PPP   PP  +PP   PPP      
Sbjct: 370 GARPPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPPPPPPADEPQQ 428

Query: 331 -----------EYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
                      +  PP   PP   PSP   PP  +PP   PPP   PP   PP  + PP
Sbjct: 429 GPAPSGDKPKKKPPPPAGPPPPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 487

 Score =  113 bits (282), Expect = 7e-24
 Identities = 66/170 (38%), Positives = 72/170 (42%), Gaps = 11/170 (6%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 357 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 415

Query: 181 PHEIPPPEHQP----------PHEKPPHAKSPPEYQPPHEHP-PPEYLPPHEKPPHENPP 327
           P   PPP  +P          P +KPP    PP   PP   P PP   PP   PP   PP
Sbjct: 416 PPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPSPGPAPPGARPPPGPPPPGPPP 475

Query: 328 PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           P   PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 476 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 525

 Score =  112 bits (281), Expect = 1e-23
 Identities = 64/164 (39%), Positives = 71/164 (43%), Gaps = 6/164 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP  +PPP   PP   +P   P P    P +KPP    PP   P
Sbjct: 394 PPPGPPPPGPPPPGPAPPGARPPPP-PPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGP 452

Query: 181 PHEIP------PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNP 342
           P   P      PP   PP   PP   +PP  +PP   PPP   PP   PP   PPP   P
Sbjct: 453 PSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP 512

Query: 343 PHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 513 PGPPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 555

 Score =  112 bits (279), Expect = 2e-23
 Identities = 66/167 (39%), Positives = 71/167 (42%), Gaps = 8/167 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 184 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 243

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEY 336
           G +PP   PP    PP   PP A+ PP   PP   P    PP   PP   PP   PPP  
Sbjct: 244 GARPPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 303

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 304 APPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 350

 Score =  112 bits (279), Expect = 2e-23
 Identities = 62/160 (38%), Positives = 69/160 (43%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 305 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 363

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PP    PP   PP    PP   PP   PPP   PP   PP   PP    PP   PP
Sbjct: 364 PGPAPPGARPPPGPPPP-GPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPPPPPP 422

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
            + P     P   KP  + PPP   PP   P    +PP +
Sbjct: 423 ADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPSPGPAPPGA 462

 Score =  112 bits (279), Expect = 2e-23
 Identities = 66/168 (39%), Positives = 73/168 (43%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 469 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 527

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH----ENPPPE----- 333
           P   PPP   PP   PP A+ PP   PP   PPP   PP  +PP       PPP      
Sbjct: 528 PPGPPPPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPP 586

Query: 334 -YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 587 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 634

 Score =  112 bits (279), Expect = 2e-23
 Identities = 66/168 (39%), Positives = 73/168 (43%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 490 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 548

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH----ENPPPE----- 333
           P   PPP   PP   PP A+ PP   PP   PPP   PP  +PP       PPP      
Sbjct: 549 PPGPPPPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPP 607

Query: 334 -YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 608 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 655

 Score =  111 bits (278), Expect = 2e-23
 Identities = 66/168 (39%), Positives = 73/168 (43%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 126 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 184

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH----ENPPPE----- 333
           P   PPP   PP   PP A+ PP   PP   PPP   PP  +PP       PPP      
Sbjct: 185 PPGPPPPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPP 243

Query: 334 -YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 244 GARPPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 291

 Score =  111 bits (278), Expect = 2e-23
 Identities = 66/168 (39%), Positives = 73/168 (43%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 168 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 226

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH----ENPPPE----- 333
           P   PPP   PP   PP A+ PP   PP   PPP   PP  +PP       PPP      
Sbjct: 227 PPGPPPPGPPPPGPAPPGARPPPG-PPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 285

Query: 334 -YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 286 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 333

 Score =  111 bits (277), Expect = 3e-23
 Identities = 66/168 (39%), Positives = 73/168 (43%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 210 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG-PPPLGPPPPGPAPPGARP 268

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH----ENPPPE----- 333
           P   PPP   PP   PP A+ PP   PP   PPP   PP  +PP       PPP      
Sbjct: 269 PPGPPPPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPP 327

Query: 334 -YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 328 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 375

 Score =  110 bits (276), Expect = 4e-23
 Identities = 64/164 (39%), Positives = 69/164 (42%), Gaps = 6/164 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P   KP  + PPP   PP   P P   PP  + P   PPP   PP   PP    PPG  P
Sbjct: 432 PSGDKPKKKPPPPAGPPPPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP 491

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPE------YNP 342
           P   PPP   PP  +PP    PP   PP   PP    PP   PP   PPP         P
Sbjct: 492 PGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP--GPPPPGPAPPGARP 548

Query: 343 PHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 549 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 592

 Score =  108 bits (269), Expect = 2e-22
 Identities = 63/164 (38%), Positives = 71/164 (43%), Gaps = 6/164 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPH------EKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHS 162
           P  A+PP   PPP  +P        +KP  +  PP G  P   P P   PP  +PP    
Sbjct: 410 PPGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPSPGPAPPGARPPPGPP 469

Query: 163 PPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNP 342
           PPG  PP   PP   +PP   PP    PP   PP   PPP   PP   PP    PP   P
Sbjct: 470 PPGPPPPGPAPPGA-RPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 527

Query: 343 PHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 528 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 571

 Score =  108 bits (269), Expect = 2e-22
 Identities = 64/156 (41%), Positives = 71/156 (45%), Gaps = 4/156 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 527 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 586

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           G +PP   PPP   PP   PP A+ PP   PP   PPP   PP  +PP   PPP   PP 
Sbjct: 587 GARPPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 645

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPP 456
             PP   P P   PP   PP  +PP   +PP   PP
Sbjct: 646 PAPPGARPPPGPPPP---PPGPSPP---RPPPGPPP 675

 Score =  107 bits (268), Expect = 3e-22
 Identities = 66/172 (38%), Positives = 72/172 (41%), Gaps = 14/172 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQ---------PPHEKP-----PPEYQPPHGKQPHVNPPPQYQPPH 138
           P    PP   PP E Q         PP + P     PP  +PP G  P   PPP   PP 
Sbjct: 38  PPGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAPPG 97

Query: 139 EKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHE 318
            +PP    PPG  PP   PP   +PP   PP    PP   PP   PPP   PP   PP  
Sbjct: 98  ARPPPGPPPPGPPPPGPAPPGA-RPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 156

Query: 319 NPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 157 -APPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 207

 Score =  107 bits (267), Expect = 4e-22
 Identities = 62/162 (38%), Positives = 67/162 (41%), Gaps = 9/162 (5%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKP---------PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           +PP    PP   PP E           PP   P  G  P    PP   PP   PP   +P
Sbjct: 36  RPPPGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAP 95

Query: 166 PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP 345
           PG +PP   PPP   PP   PP A+ PP   PP   PPP   PP  +PP   PPP   PP
Sbjct: 96  PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPP 154

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
              PP   P P   PP   PP   PP    PP   PP    P
Sbjct: 155 GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 196

 Score =  103 bits (258), Expect = 5e-21
 Identities = 61/154 (39%), Positives = 68/154 (44%), Gaps = 5/154 (3%)
 Frame = +1

Query: 31  PPPEYQPPHEKPPPEYQPP-HGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEH 207
           PPP   PP   PP E Q   H K+P        +PP + P    +PPG +PP   PPP  
Sbjct: 37  PPPGGGPPRPPPPEESQGEGHQKRP--------RPPGDGPEQGPAPPGARPPPGPPPPGP 88

Query: 208 QPPHEKPPHAKSPPEYQPPHEHPP----PEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
            PP   PP A+ PP   PP   PP    P   PP   PP   PPP   PP  +PP   P 
Sbjct: 89  PPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP 148

Query: 376 PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           P   PP   PP   PPP   PP   PP    P A
Sbjct: 149 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 182

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 59/147 (40%), Positives = 65/147 (44%), Gaps = 4/147 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 543 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 601

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PP    PP 
Sbjct: 602 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG--PP---PPGPAPPGARPPPG 656

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPK 429
             PP   PSP   PP        PPP+
Sbjct: 657 PPPPPPGPSPPRPPP-------GPPPQ 676

[75][TOP]
>UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2B5_EHV86
          Length = 2332

 Score =  120 bits (302), Expect = 4e-26
 Identities = 66/161 (40%), Positives = 67/161 (41%), Gaps = 8/161 (4%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP   PPP   PP   P P   PP    P   PPP   PP   P    SPP   PP   P
Sbjct: 845  PPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAP 904

Query: 196  PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHEN--------PPPEYNPPHE 351
            PP + PP   PP    PP   PP   PPP   PP   PP           PPP   PP  
Sbjct: 905  PPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPS 964

Query: 352  KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   PSP   PP   PP   PPP   PPN  PP   SPP
Sbjct: 965  PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPP---SPP 1002

 Score =  119 bits (299), Expect = 8e-26
 Identities = 65/155 (41%), Positives = 67/155 (43%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP  +PPP   PP   PPP   PP    P   P P   PP   PP    PP   PP   P
Sbjct: 830  PPPPSPPPPLPPP-PLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPP 888

Query: 196  PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
             P   PP   PP    PP   PP   PPP  LPP   PP   PPP   PP   PP   PS
Sbjct: 889  SPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPP---PS 945

Query: 376  PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
            P   PP   PP   PPP   PP+  P    SPP S
Sbjct: 946  PPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPS 980

 Score =  119 bits (299), Expect = 8e-26
 Identities = 66/161 (40%), Positives = 72/161 (44%), Gaps = 3/161 (1%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHV--NPPPQYQPPHEKPPHEHSPPGY 174
            P  + PP   P P   PP   PPP   PP    P    +PPP   PP   PP    PP  
Sbjct: 1124 PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPS- 1182

Query: 175  QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP-PPEYLPPHEKPPHENPPPEYNPPHE 351
             PP  +PPP   PP   PP    PP   PP   P PP  LPP   PP  +PPP  +PP  
Sbjct: 1183 -PPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPP--SPPPS 1239

Query: 352  KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   PSP   PP   PP   PPP   PP+  PP    PP
Sbjct: 1240 PPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPPTPPPPP 1280

 Score =  119 bits (297), Expect = 1e-25
 Identities = 67/163 (41%), Positives = 73/163 (44%), Gaps = 3/163 (1%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHV--NPPPQYQPPHEKPPHEHSPPGY 174
            P  + PP   P P   PP   PPP   PP    P    +PPP   PP   PP    PP  
Sbjct: 855  PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSP 914

Query: 175  QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP-PPEYLPPHEKPPHENPPPEYNPPHE 351
             PP  +PPP   PP   PP    PP   PP   P PP  LPP   PP  +PPP  +PP  
Sbjct: 915  PPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPP--SPPPS 972

Query: 352  KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
             PP   PSP   PP   PP   PPP   PP+  PP    PP S
Sbjct: 973  PPPSPPPSP---PPPTPPPPAPPPPNPPPPSPPPPLPLPPPPS 1012

 Score =  118 bits (296), Expect = 2e-25
 Identities = 64/160 (40%), Positives = 69/160 (43%), Gaps = 1/160 (0%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P  + PP   P P   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 965  PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPP 1024

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP-PHENPPPEYNPPHEKP 357
            P  +PPP   PP   P    SPP   PP   PPP   PP   P P  +PPP   PP   P
Sbjct: 1025 P-PLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPP 1083

Query: 358  PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            P   P P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 1084 PPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPS 1123

 Score =  118 bits (295), Expect = 2e-25
 Identities = 64/160 (40%), Positives = 68/160 (42%), Gaps = 1/160 (0%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   P P   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 787  PPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPP 846

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP-PHENPPPEYNPPHEKP 357
            P  +PPP   PP   P    SPP   PP   PPP   PP   P P  +PPP   PP   P
Sbjct: 847  P-PLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPP 905

Query: 358  PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            P   P P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 906  PPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPS 945

 Score =  117 bits (294), Expect = 3e-25
 Identities = 64/161 (39%), Positives = 68/161 (42%), Gaps = 2/161 (1%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHV--NPPPQYQPPHEKPPHEHSPPGY 174
            P  + PP   P P   PP   PPP   PP    P    +PPP   PP   PP    PP  
Sbjct: 1033 PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSP 1092

Query: 175  QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
             PP  +PPP   PP   PP    PP   PP   P P   PP   PP   PPP   PP   
Sbjct: 1093 PPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPP-SPPPPTPPPPAPP 1151

Query: 355  PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP   PSP   PP   PP   PPP   PP   PP    PP+
Sbjct: 1152 PPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPS 1192

 Score =  117 bits (294), Expect = 3e-25
 Identities = 66/160 (41%), Positives = 70/160 (43%), Gaps = 1/160 (0%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   P P   PP   PPP   PP    P  +PPP   PP   PP   SPP   P
Sbjct: 1577 PSPLPPPSPPPSPPPSPP-PSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPP--SPPPLPP 1633

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP-PPEYLPPHEKPPHENPPPEYNPPHEKP 357
            P  +PPP   PP   P    SPP   PP   P PP   PP   PP  +PP    PP   P
Sbjct: 1634 P-PLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPP 1692

Query: 358  PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            P   PSP   PP Q PP   PPP   PP   PP    PP+
Sbjct: 1693 PPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPS 1732

 Score =  117 bits (292), Expect = 5e-25
 Identities = 66/163 (40%), Positives = 70/163 (42%), Gaps = 4/163 (2%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P  A PP   PPP   PP   PPP   PP    P + PPP   PP   PP    PP   P
Sbjct: 900  PPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPL-PPPPVPPPPSPPP---LPPPPLP 955

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP----PPEYNPPH 348
            P  +PPP   PP   P    SPP   PP   PPP   PP+  PP   P    PP  +PP 
Sbjct: 956  PPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPP 1015

Query: 349  EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              PP   P P   PP   PP   P P   PP   PP    PPA
Sbjct: 1016 PLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPA 1058

 Score =  117 bits (292), Expect = 5e-25
 Identities = 64/158 (40%), Positives = 65/158 (41%), Gaps = 5/158 (3%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP  +PPP   PP   PPP   PP    P   P P   PP   PP    PP   PP   P
Sbjct: 1008 PPPPSPPPPLPPP-PLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPP 1066

Query: 196  PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEK-----PPHENPPPEYNPPHEKPP 360
             P   PP   PP    PP   PP   PPP  LPP        PP   PPP   PP   PP
Sbjct: 1067 SPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPP 1126

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               PSP   PP   PP   PPP   PP   P    SPP
Sbjct: 1127 SPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPP 1164

 Score =  117 bits (292), Expect = 5e-25
 Identities = 66/155 (42%), Positives = 69/155 (44%), Gaps = 1/155 (0%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP   PPP   PP   P P   PP    P   PPP   PP   P    SPP   PP   P
Sbjct: 1023 PPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAP 1082

Query: 196  PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
            PP + PP   PP    PP   PP   PPP  LPP   PP  +PPP  +PP   PP   PS
Sbjct: 1083 PPPNPPPPSPPPPLPLPPPPSPPPPLPPPP-LPPPPLPPPPSPPP--SPPPSPPPSPPPS 1139

Query: 376  -PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
             P   PP   PP   PPP   PP   PP    PPA
Sbjct: 1140 PPPPTPPPPAPPPPAPPP--SPPPSPPPPTPPPPA 1172

 Score =  117 bits (292), Expect = 5e-25
 Identities = 65/155 (41%), Positives = 67/155 (43%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP  +PPP   PP   PPP   PP    P   P P   PP   PP    PP   PP   P
Sbjct: 1099 PPPPSPPPPLPPP-PLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPP 1157

Query: 196  PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
             P   PP   PP    PP   PP   PPP  LPP   PP   PPP   PP   PP   PS
Sbjct: 1158 SPPPSPPPPTPPPPAPPPPNPPPPSPPPP--LPPPPSPPPPLPPPPLPPPPVPPP---PS 1212

Query: 376  PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
            P   PP   PP   PPP   PP+  P    SPP S
Sbjct: 1213 PPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPS 1247

 Score =  116 bits (290), Expect = 9e-25
 Identities = 64/160 (40%), Positives = 67/160 (41%), Gaps = 2/160 (1%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHV--NPPPQYQPPHEKPPHEHSPPGY 174
            P  + PP   P P   PP   PPP   PP    P    +PPP   PP   PP    PP  
Sbjct: 764  PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSP 823

Query: 175  QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
             PP  +PPP   PP   PP    PP   PP   P P   PP   PP   PPP   PP   
Sbjct: 824  PPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPP-PSPPPSPPPPTPPPPAPP 882

Query: 355  PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            PP   PSP   PP   PP   PPP   PP   PP    PP
Sbjct: 883  PPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPP 922

 Score =  116 bits (290), Expect = 9e-25
 Identities = 66/158 (41%), Positives = 68/158 (43%), Gaps = 5/158 (3%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP  +PPP   PP   PPP   PP    P + PPP   PP   PP   SPP   PP   P
Sbjct: 921  PPPPSPPPPLPPPPLPPPPVPPPP--SPPPLPPPPLPPPPLPPPP---SPPPSPPPSPPP 975

Query: 196  PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEK-----PPHENPPPEYNPPHEKPP 360
             P   PP   PP    PP   PP   PPP  LPP        PP   PPP   PP   PP
Sbjct: 976  SPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPP 1035

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               PSP   PP   PP   PPP   PP   P    SPP
Sbjct: 1036 SPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPP 1073

 Score =  116 bits (290), Expect = 9e-25
 Identities = 63/153 (41%), Positives = 65/153 (42%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP   PPP   PP   PPP   P     P  +PPP   PP   PP    PP   PP  +P
Sbjct: 950  PPPPLPPPPLPPP-PSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLP 1008

Query: 196  PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
            PP   PP   PP    PP   PP   P P   PP   PP   PPP   PP   PP   PS
Sbjct: 1009 PPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPP-PSPPPSPPPPTPPPPAPPPPAPPPS 1067

Query: 376  PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            P   PP   PP   PPP   PP   PP    PP
Sbjct: 1068 PPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPP 1100

 Score =  115 bits (288), Expect = 2e-24
 Identities = 65/159 (40%), Positives = 69/159 (43%), Gaps = 1/159 (0%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P  + PP   PPP   PP   P P   PP    P   PPP   PP   PP    PP   P
Sbjct: 867  PPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSP 926

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPP-PEYNPPHEKP 357
            P  +PPP   PP   PP   SPP   PP   PPP  LPP   PP   PP P  +PP   P
Sbjct: 927  PPPLPPPPLPPPPVPPP--PSPPPLPPPPLPPPP--LPPPPSPPPSPPPSPPPSPPPSPP 982

Query: 358  PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            P   P P   PP+  PP   PP    PP   PP    PP
Sbjct: 983  PPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPP 1021

 Score =  115 bits (287), Expect = 2e-24
 Identities = 64/156 (41%), Positives = 66/156 (42%), Gaps = 1/156 (0%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP   PPP   PP   PPP   PP    P  +PPP   PP   PP    PP   PP   P
Sbjct: 981  PPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPP-PLPPPPLPPPPSPPPSPPP 1039

Query: 196  PPEHQPPHEKPPHAKSPPEYQPPHEHP-PPEYLPPHEKPPHENPPPEYNPPHEKPPHEHP 372
             P   PP   PP    PP   PP   P PP   PP   PP   PPP   PP   PP   P
Sbjct: 1040 SPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLP 1099

Query: 373  SPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
             P   PP   PP   PPP   PP+  P    SPP S
Sbjct: 1100 PPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPS 1135

 Score =  115 bits (287), Expect = 2e-24
 Identities = 64/160 (40%), Positives = 68/160 (42%), Gaps = 1/160 (0%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   P P   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 1056 PPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPP 1115

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP-PHENPPPEYNPPHEKP 357
            P  +PPP   PP   P    SPP   PP   PPP   PP   P P  +PPP   PP   P
Sbjct: 1116 P-PLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPP 1174

Query: 358  PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            P   P P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 1175 PPNPPPP--SPPPPLPPPPSPPPPLPPPPLPPPPVPPPPS 1212

 Score =  114 bits (286), Expect = 3e-24
 Identities = 63/159 (39%), Positives = 65/159 (40%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P  + PP   P P   PP   PPP   PP    P   P P   PP   PP   SPP   P
Sbjct: 725  PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPP---SPPPSPP 781

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   P    SPP   PP   PPP   PP   PP    PP  +PP   PP
Sbjct: 782  PPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPP 841

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
               P P   PP   PP   P P   PP   PP    PPA
Sbjct: 842  PPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPA 880

 Score =  114 bits (286), Expect = 3e-24
 Identities = 65/164 (39%), Positives = 66/164 (40%), Gaps = 5/164 (3%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPH-----EHSP 165
            P    PP  NPPP   PP    PP   PP    P   PPP   PP   PP        SP
Sbjct: 986  PPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSP 1045

Query: 166  PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP 345
            P   PP   PPP   PP   P    SPP   PP   PPP   PP   PP    PP  +PP
Sbjct: 1046 PPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPP 1105

Query: 346  HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
               PP   P P   PP   PP   P P   PP   PP    PPA
Sbjct: 1106 PPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPA 1149

 Score =  114 bits (286), Expect = 3e-24
 Identities = 68/160 (42%), Positives = 70/160 (43%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P  A PP   PPP   PP   PPP   PP    P + PPP   PP   P    SPP   P
Sbjct: 987  PPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPP 1046

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP A  PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 1047 PS--PPPPTPPPPAPPPPA--PPPSPPPS--PPPPTPPPPAPPPPNPPPPSPPPPLPLPP 1100

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
               P P   PP   PP   PPP   PP+  P    SPP S
Sbjct: 1101 PPSPPPPLPPP-PLPPPPLPPPPSPPPSPPPSPPPSPPPS 1139

 Score =  114 bits (286), Expect = 3e-24
 Identities = 65/158 (41%), Positives = 67/158 (42%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P  + PP   PPP   PP   P P   PP    P   PPP   PP   PP    PP   P
Sbjct: 1045 PPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSP 1104

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P  +PPP   PP   PP   SPP   PP   P P   PP   PP   PPP   PP   PP
Sbjct: 1105 PPPLPPPPLPPPPLPPP--PSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPP--SPP 1160

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               P P   PP   PP  NPPP   PP   PP    PP
Sbjct: 1161 PSPPPP--TPPPPAPPPPNPPPPSPPPPLPPPPSPPPP 1196

 Score =  114 bits (285), Expect = 3e-24
 Identities = 64/159 (40%), Positives = 64/159 (40%), Gaps = 6/159 (3%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPP-PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEI 192
            PP   PPP   PP   PP P   PP    P   P P   PP   PP    PP   PP   
Sbjct: 737  PPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPP 796

Query: 193  PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEK-----PPHENPPPEYNPPHEKP 357
            P P   PP   PP    PP   PP   PPP  LPP        PP   PPP   PP   P
Sbjct: 797  PSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPP 856

Query: 358  PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            P   PSP   PP   PP   PPP   PP   P    SPP
Sbjct: 857  PSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPP 895

 Score =  114 bits (284), Expect = 4e-24
 Identities = 64/161 (39%), Positives = 65/161 (40%), Gaps = 3/161 (1%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKP-PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
            P    PP  +PPP   PP   P PP   PP    P   PPP   PP   P    SPP   
Sbjct: 682  PPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSP 741

Query: 178  PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH--E 351
            PP   PPP   PP   P    SPP   PP   P P   PP   PP   PPP   PP    
Sbjct: 742  PPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPP 801

Query: 352  KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P   PP   PP   PPP   PP   PP    PP
Sbjct: 802  SPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPP 842

 Score =  114 bits (284), Expect = 4e-24
 Identities = 63/158 (39%), Positives = 65/158 (41%), Gaps = 1/158 (0%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKP-PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
            P    PP   PPP   PP   P PP   PP    P  NPPP   PP    P   SPP   
Sbjct: 1049 PPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPL 1108

Query: 178  PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
            PP  +PPP   PP   PP     P   PP   PPP   PP   PP   P P  +PP   P
Sbjct: 1109 PPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTP 1168

Query: 358  PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
            P   P P   PP   PP   PPP   PP   PP    P
Sbjct: 1169 PPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPP 1206

 Score =  114 bits (284), Expect = 4e-24
 Identities = 70/164 (42%), Positives = 73/164 (44%), Gaps = 4/164 (2%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P  A PP   PPP   PP   PPP   PP    P + PPP   PP   P    SPP   P
Sbjct: 1078 PPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPP 1137

Query: 181  PHEIPPPEHQPPHEKPPHAK--SPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
            P   PPP   PP   PP A   SPP   PP   PPP   PP   PP  +PPP   PP   
Sbjct: 1138 PS--PPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPA--PPPPNPPPPSPPPPLPPPPSP 1193

Query: 355  PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKP--PHEKSPPAS 480
            PP   P P   PP   PP  +PPP   PP   P  P   SPP S
Sbjct: 1194 PPPLPPPP--LPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPS 1235

 Score =  113 bits (283), Expect = 6e-24
 Identities = 65/167 (38%), Positives = 69/167 (41%), Gaps = 8/167 (4%)
 Frame = +1

Query: 1    PHHAKPPYENPP--PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY 174
            P  A PP   PP  P   PP   P P   PP    P   PPP   PP   P    SPP  
Sbjct: 747  PPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPP 806

Query: 175  QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPP-----PEYN 339
             PP   PPP + PP   PP    PP   PP   PPP   PP   PP   PP     P  +
Sbjct: 807  TPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPS 866

Query: 340  PPHEKPPHEHPSPEYQPPHQKP-PHENPPPKFQPPNEKPPHEKSPPA 477
            PP   PP   P P   PP   P P  +PPP   PP   PP    PP+
Sbjct: 867  PPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPS 913

 Score =  113 bits (283), Expect = 6e-24
 Identities = 66/165 (40%), Positives = 70/165 (42%), Gaps = 6/165 (3%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPE---YQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPG 171
            P    PP   PPP   PP   PPP      PP    P + PPP   PP   PP     P 
Sbjct: 921  PPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPS--PPPSPPPSPPPSPP 978

Query: 172  YQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHE 351
              PP   PPP   PP   PP +  PP   PP   PPP   PP   PP   PPP  +PP  
Sbjct: 979  PSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPP--SPPPS 1036

Query: 352  KPPHEHPSPEYQPPHQKPPHENPPPKFQPPN---EKPPHEKSPPA 477
             PP   PSP   PP   PP   PPP   PP+     PP    PPA
Sbjct: 1037 PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPA 1081

 Score =  113 bits (282), Expect = 7e-24
 Identities = 66/164 (40%), Positives = 70/164 (42%), Gaps = 5/164 (3%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQP-PHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP-PGY 174
            P    PP   PPP   P P   PPP   P     P  +PPP   PP   PP    P P  
Sbjct: 742  PPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPP 801

Query: 175  QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
             PP   PPP   PP   PP +  PP   PP   PPP   PP   PP   PPP  +PP   
Sbjct: 802  SPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPP--SPPPSP 859

Query: 355  PPHEHPSPEYQPPHQKPPHENPPPKFQPPN---EKPPHEKSPPA 477
            PP   PSP   PP   PP   PPP   PP+     PP    PPA
Sbjct: 860  PPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPA 903

 Score =  113 bits (282), Expect = 7e-24
 Identities = 62/160 (38%), Positives = 64/160 (40%), Gaps = 2/160 (1%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P  + PP   P P   PP   PPP   PP    P   P P   PP   PP    PP   P
Sbjct: 760  PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPP 819

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   PPP   PP   PP    PP   PP   PPP   PP   PP   P P  +PP   PP
Sbjct: 820  PPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPS--PPPSPPPSPPPSPPPSPPPPTPP 877

Query: 361  HEHPSPEYQPPHQ--KPPHENPPPKFQPPNEKPPHEKSPP 474
               P P   PP     PP   PPP   PP   PP    PP
Sbjct: 878  PPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPP 917

 Score =  112 bits (281), Expect = 1e-23
 Identities = 64/160 (40%), Positives = 66/160 (41%), Gaps = 2/160 (1%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPE--YQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY 174
            P  + PP   PPP   PP   PPP     PP    P   PPP   PP   PP     P  
Sbjct: 676  PSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPP 735

Query: 175  QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
             PP   PPP   PP   PP   +PP   PP   P P   PP   PP   PPP   PP   
Sbjct: 736  SPPPSPPPPTPPPPAPPPP---APPPAPPPSPPPSPPPSPP-PSPPPSPPPPTPPPPAPP 791

Query: 355  PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            PP   PSP   PP   PP   PPP   PP   PP    PP
Sbjct: 792  PPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPP 831

 Score =  112 bits (281), Expect = 1e-23
 Identities = 63/155 (40%), Positives = 68/155 (43%), Gaps = 1/155 (0%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP  +PPP   PP   PPP   P     P  +PPP   PP   PP    PP   PP   P
Sbjct: 705  PPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPS--PPPPTPPPPAPPPPAPPPAPPP 762

Query: 196  PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP-PHENPPPEYNPPHEKPPHEHP 372
             P   PP   PP   SPP   PP   PPP   PP   P P  +PPP   PP   PP   P
Sbjct: 763  SPPPSPPPSPPP---SPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPP 819

Query: 373  SPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
             P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 820  PPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPS 854

 Score =  112 bits (281), Expect = 1e-23
 Identities = 62/159 (38%), Positives = 66/159 (41%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   P P   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 878  PPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPP 937

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P  +PPP   PP   PP    PP   PP   PPP   P     P  +PPP   PP   PP
Sbjct: 938  P-PVPPPPSPPPLPPPP---LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPP 993

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
               P P   PP   PP  +PPP   PP   PP    PP+
Sbjct: 994  PNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPS 1032

 Score =  112 bits (281), Expect = 1e-23
 Identities = 65/160 (40%), Positives = 67/160 (41%), Gaps = 6/160 (3%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKP---PHEHSPPGYQPPH 186
            PP   PPP   PP   PPP   PP    P  +PPP   PP   P   P   SPP   PP 
Sbjct: 1072 PPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPS 1131

Query: 187  EIPPPEHQPPHEKPPHAKSPPEYQPPHEHP-PPEYLPPHEKPPHENPPPEYNPPHEKPPH 363
              P P   PP   PP    PP   PP   P PP   PP   PP  NPPP   PP   PP 
Sbjct: 1132 PPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPP 1191

Query: 364  EHPSPEYQPPHQKPPHENP--PPKFQPPNEKPPHEKSPPA 477
              P P   PP   PP   P  PP   PP   PP    PP+
Sbjct: 1192 SPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPS 1231

 Score =  112 bits (280), Expect = 1e-23
 Identities = 64/157 (40%), Positives = 65/157 (41%), Gaps = 2/157 (1%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP   PPP   PP   P P   PP    P   PPP   PP   P    SPP   PP   P
Sbjct: 715  PPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPP 774

Query: 196  PPEHQPPHEKPPHAKSPPEYQPPHEHP-PPEYLPPHEKPPHENPPPEYNPPH-EKPPHEH 369
             P   PP   PP    PP   PP   P PP   PP   PP  NPPP   PP    PP   
Sbjct: 775  SPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPS 834

Query: 370  PSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
            P P   PP   PP   PPP   PP+  P    SPP S
Sbjct: 835  PPPPLPPP-PLPPPPLPPPPSPPPSPPPSPPPSPPPS 870

 Score =  112 bits (279), Expect = 2e-23
 Identities = 64/156 (41%), Positives = 69/156 (44%), Gaps = 2/156 (1%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP  +PPP   PP   PPP   PP    P   P P   PP   PP    PP   PP+  P
Sbjct: 941  PPPPSPPP--LPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNP-P 997

Query: 196  PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPP-PEYNPPHEKPPHEHP 372
            PP   PP   PP    PP   PP   PPP  LPP   PP   PP P  +PP   PP   P
Sbjct: 998  PPSPPPPLPLPPPPSPPPPLPPPPLPPPP--LPPPPSPPPSPPPSPPPSPPPSPPPPTPP 1055

Query: 373  SPEYQPPHQKP-PHENPPPKFQPPNEKPPHEKSPPA 477
             P   PP   P P  +PPP   PP   PP    PP+
Sbjct: 1056 PPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPS 1091

 Score =  110 bits (276), Expect = 4e-23
 Identities = 66/166 (39%), Positives = 68/166 (40%), Gaps = 6/166 (3%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P  + PP   PPP   PP   PPP   PP    P   PPP   PP   PP    PP   P
Sbjct: 1532 PSPSPPPPSPPPPSPSPPPSPPPP--SPPPSPPPPSPPPP--LPPPPVPPSPLPPPS-PP 1586

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
            P   P P   PP   PP    PP   PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 1587 PSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPP--LPPPPLPPPPSPPP 1644

Query: 361  HEHPSPEYQPPHQKPPHENP------PPKFQPPNEKPPHEKSPPAS 480
               PSP   PP   PP  +P      PP   PP   PP    PP S
Sbjct: 1645 SPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPS 1690

 Score =  110 bits (275), Expect = 5e-23
 Identities = 64/170 (37%), Positives = 69/170 (40%), Gaps = 11/170 (6%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   PPP   PP    P + PPP   PP   P    SPP   P
Sbjct: 1598 PPSPPPPLPLPPPPSPPPPLPPPPVPPPP--SPPPLPPPPLPPPPSPPPSPPPSPPPSPP 1655

Query: 181  PHEIP----------PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP 330
            P   P          PP   PP   PP    PP   PP   P P  +PP + PP   PPP
Sbjct: 1656 PSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPP 1715

Query: 331  EYNPPHEKPPHEHPSPE-YQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
               PP   PP   P P    PP   PP  +PPP   PP   PP    PP+
Sbjct: 1716 PLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPP--SPPPSPPPPSPPPPS 1763

 Score =  109 bits (273), Expect = 8e-23
 Identities = 63/160 (39%), Positives = 64/160 (40%), Gaps = 2/160 (1%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP   PPP   PP   P P   PP    P   P P   PP   PP   SPP   P
Sbjct: 1623 PPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPP-SPPLPSP 1681

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPE--YNPPHEK 354
            P   PPP   PP   P  +  PP   PP   PPP   PP   PP   PPP     PP   
Sbjct: 1682 PLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSP 1741

Query: 355  PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            PP   PSP   PP   PP   PPP   P    P    SPP
Sbjct: 1742 PP---PSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPP 1778

 Score =  108 bits (269), Expect = 2e-22
 Identities = 64/162 (39%), Positives = 69/162 (42%), Gaps = 9/162 (5%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNP------PPQYQPPHEKPPHEHSPPGYQ 177
            PP   PPP   PP   P P   PP    P  +P      PP   PP   PP    PP   
Sbjct: 1632 PPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSP 1691

Query: 178  PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
            PP   P P   PP + PP    PP   PP   PPP  LPP   PP  +PPP   PP   P
Sbjct: 1692 PPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPP--LPPPPSPP--SPPPPSPPPPSPP 1747

Query: 358  PHEHPSPEYQPPHQKPP--HENPPPKFQPPNEKPPH-EKSPP 474
            P   PSP   PP   PP    +PPP    P+  PP    SPP
Sbjct: 1748 PSPPPSP--PPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPP 1787

 Score =  105 bits (263), Expect = 1e-21
 Identities = 66/170 (38%), Positives = 70/170 (41%), Gaps = 13/170 (7%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPP---PEYQPPHGKQPHVNPPPQYQPPHEKPPHEH---- 159
            P    PP   PPP   PP   PP   P   PP    P   P P   PP   PP       
Sbjct: 1608 PPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPP 1667

Query: 160  --SPPGYQPPHEIPP-PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP 330
              +PP   PP   PP P   PP   PP+A SP    PP + PPP  LPP   PP  NPPP
Sbjct: 1668 PPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSS-MPPSQSPPPP-LPPPPLPPPPNPPP 1725

Query: 331  EYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPN---EKPPHEKSP 471
               PP   P    PSP    P   PP   PPP   PP+     PP   SP
Sbjct: 1726 PLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSP 1775

 Score =  105 bits (261), Expect = 2e-21
 Identities = 63/157 (40%), Positives = 67/157 (42%), Gaps = 3/157 (1%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP   PPP   PP   PPP   PP    P  +PPP   PP   PP   SPP   PP   P
Sbjct: 1597 PPPSPPPPLPLPPPPSPPPPLPPPPVPPPP-SPPPLPPPPLPPPP---SPPPSPPPSPPP 1652

Query: 196  -PPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEH 369
             PP   PP   P P   +PP   PP   PP    PP   PP   P P   PP + PP   
Sbjct: 1653 SPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPL 1712

Query: 370  PSPEYQPPHQKPPHENPPPK-FQPPNEKPPHEKSPPA 477
            P P   PP   PP   PPP    PP   PP    PP+
Sbjct: 1713 PPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPS 1749

 Score =  104 bits (260), Expect = 3e-21
 Identities = 60/158 (37%), Positives = 65/158 (41%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P  + PP  +PPP   PP   PPP   PP    P V PPP   PP   PP    PP   P
Sbjct: 1589 PPPSPPP--SPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPS--PPPLPPPPLPPPPSPPP 1644

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
                 PP   PP   P  +  PP   PP   PP    P    PP   PPP    P   PP
Sbjct: 1645 SPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPP 1704

Query: 361  HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             + P P   PP   PP   PPP   PP+   P   SPP
Sbjct: 1705 SQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPP 1742

 Score =  104 bits (260), Expect = 3e-21
 Identities = 64/176 (36%), Positives = 69/176 (39%), Gaps = 18/176 (10%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEY----QPPHGKQPHVNPPPQYQP-PHEKPPHEHSP 165
            P  + PP   P P   PP   PPP       PP    P  +PPP   P P   PP +  P
Sbjct: 1650 PPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPP 1709

Query: 166  PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNP- 342
            P   PP   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP  +P 
Sbjct: 1710 PPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPS--PPPSPPPPSPPPPSLSPS 1767

Query: 343  -------PHEKPPHEHPSPEYQPPHQKPPHEN-----PPPKFQPPNEKPPHEKSPP 474
                   P   PP   PSP        PP  +     PPP   P    PP   SPP
Sbjct: 1768 PPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPP 1823

 Score =  103 bits (258), Expect = 5e-21
 Identities = 59/145 (40%), Positives = 63/145 (43%), Gaps = 3/145 (2%)
 Frame = +1

Query: 52   PHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPP 231
            P   PPP   PP    P  +PPP   PP   PP   SPP   PP  +PPP   PP   PP
Sbjct: 676  PSPSPPPPSPPP----PSPSPPPS-PPPPSPPP---SPPPPSPPPPLPPPPLPPPPLPPP 727

Query: 232  HAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPH 411
                 P   PP   PPP   PP   PP   P P  +PP   PP   PSP   PP   PP 
Sbjct: 728  SPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPP 787

Query: 412  ENPPPKFQPPN---EKPPHEKSPPA 477
              PPP   PP+     PP    PPA
Sbjct: 788  PAPPPPTPPPSPPPSPPPPTPPPPA 812

 Score =  103 bits (258), Expect = 5e-21
 Identities = 63/158 (39%), Positives = 66/158 (41%), Gaps = 1/158 (0%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKP-PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
            P    PP   PPP   PP   P PP   PP    P  NPPP   PP   PP   SPP   
Sbjct: 1140 PPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPP--SPPPPL 1197

Query: 178  PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
            PP  +PPP   PP   PP    PP   PP   PPP   PP   PP   P P  +PP   P
Sbjct: 1198 PPPPLPPPPVPPPPSPPP--LPPPPLPPPPLPPPPS--PPPSPPPSPPPSPPPSPPPSPP 1253

Query: 358  PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
            P         PP   PP   PPP   PP   PP   +P
Sbjct: 1254 PP-------TPPPPAPPPPTPPPSPPPPTPPPPPPLAP 1284

 Score =  101 bits (251), Expect = 3e-20
 Identities = 62/171 (36%), Positives = 68/171 (39%), Gaps = 13/171 (7%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P  A PP   PPP    P   PP +  PP    P + PPP   PP   PP   SPP   P
Sbjct: 1682 PLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSP 1741

Query: 181  PHEIPPPEHQPPHEKPPHAKSPPEYQP------PHEHPPPEYLPPHEKPP--HENPPPEY 336
            P   PPP   PP   PP +  PP   P          PPP    P   PP    +PPP  
Sbjct: 1742 PPPSPPP--SPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPS 1799

Query: 337  NPPHEKPPHEHPSPEYQPPHQKPP----HENPPPKFQPPNEKPPHEK-SPP 474
              P   PP   PSP   P    PP      +PPP    P+  PP    SPP
Sbjct: 1800 LSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPP 1850

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 61/165 (36%), Positives = 67/165 (40%), Gaps = 10/165 (6%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHV-NPPPQYQPPHEKPPHEHSPPGYQPPHEI 192
            PP ++PPP   PP   PPP   PP    P   +PPP   PP   PP   SPP   PP   
Sbjct: 1703 PPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPP---SPPPSPPPPSP 1759

Query: 193  PPPEHQP--------PHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
            PPP   P        P   PP A   P        PPP  L P   PP  +P P   P  
Sbjct: 1760 PPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPAS 1819

Query: 349  EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPH-EKSPPAS 480
              PP    SP   PP   P   +PPP    P+  PP    SPP S
Sbjct: 1820 PSPPPPSASPSPPPPSSSP---SPPPPSSSPSPPPPSLSPSPPPS 1861

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 61/155 (39%), Positives = 66/155 (42%), Gaps = 4/155 (2%)
 Frame = +1

Query: 16   PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
            PP  +PPP        PPP   PP    P   PPP   PP   PP   SPP   PP   P
Sbjct: 2088 PPPPSPPPSLPSSSPSPPPP-SPPLPPSPPPLPPPPVPPPPTPPP---SPPPLPPPPTPP 2143

Query: 196  P-PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEK---PPHENPPPEYNPPHEKPPH 363
            P P   PP   PP    P    PP   P P  LPP      PP   PPP   PPH  PP 
Sbjct: 2144 PSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPPPH--PPP 2201

Query: 364  EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKS 468
            + P P   PP   PP   PPP   PP++ P  E +
Sbjct: 2202 QSPLPP-SPPPPPPPPPLPPPPSPPPSQPPSLENA 2235

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 52/151 (34%), Positives = 59/151 (39%), Gaps = 4/151 (2%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
            P    PP  +PPP   PP   PPP   PP    P ++P P        PP   + P   P
Sbjct: 1731 PSPPSPPPPSPPPPSPPP--SPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPP 1788

Query: 181  PHEIP--PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP--PPEYNPPH 348
            P   P  PP    P   PP     P   P    PPP    P   PP  +P  PP  + P 
Sbjct: 1789 PSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSSSPS 1848

Query: 349  EKPPHEHPSPEYQPPHQKPPHENPPPKFQPP 441
              PP   PSP   PP   PP  +PP    PP
Sbjct: 1849 PPPPSLSPSPPPSPPPSSPPPPSPPTPPAPP 1879

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 55/165 (33%), Positives = 61/165 (36%), Gaps = 7/165 (4%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPP---HEKPPHEHSPPG 171
            P +  PP   PP    PP   PPP   PP    P  +PPP   PP      PP   + P 
Sbjct: 1720 PPNPPPPLPPPPSPPSPPPPSPPPPSPPP---SPPPSPPPPSPPPPSLSPSPPPPSTSPS 1776

Query: 172  YQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPP----HENPPPEYN 339
              PP   P P        PP     P   PP   P P   P    PP      +PPP  +
Sbjct: 1777 PPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSS 1836

Query: 340  PPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             P   PP   PSP   PP   P     PP   PP   PP   +PP
Sbjct: 1837 SPSPPPPSSSPSP--PPPSLSPSPPPSPPPSSPPPPSPPTPPAPP 1879

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 58/159 (36%), Positives = 63/159 (39%), Gaps = 11/159 (6%)
 Frame = +1

Query: 31  PPPEYQPPHEKPPPEYQPPHGKQPHVNP---PPQYQPPHEKPPHEHSPP----GYQPPHE 189
           PPP   P    PPP    P    P V+P   PP   P    P    SPP       PP  
Sbjct: 245 PPPSISP---SPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPS 301

Query: 190 IPPPEHQP-PHEKPPHAKSPPEYQPP-HEHPPPEYLPPHEKPPH--ENPPPEYNPPHEKP 357
            PPP   P P  +PP + SP    P     PPP  L P   PP    +PPP    P   P
Sbjct: 302 PPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPP 361

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   PSP    P   PP  +PPP   PP   PP    PP
Sbjct: 362 PSLSPSPPPATPPPSPPPPSPPPPLPPPPSPPPPLPPPP 400

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 55/156 (35%), Positives = 59/156 (37%), Gaps = 5/156 (3%)
 Frame = +1

Query: 31  PPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQ 210
           PPP   P    PPP    P    P ++P P   PP   P    SPP   PP   P P   
Sbjct: 272 PPPSLSP---SPPPPSLSPSPPPPSLSPSPPPSPP--PPSTSPSPPPRPPPSASPSPPPP 326

Query: 211 PPHEKPPHAKSPPEYQPPH--EHPPPEYLPPHEKPPHENP-PPEYNPPHEKPPHEHPSPE 381
                PP     P   PP     PPP    P   PP  +P PP   PP   PP   P P 
Sbjct: 327 SLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPSPPPP- 385

Query: 382 YQPPHQKPPHENPPPKFQPPNEKPPHEKSP--PASC 483
             PP   PP   PPP   PP   PP    P  P +C
Sbjct: 386 -LPPPPSPPPPLPPPPIPPPPSPPPPPPPPLAPFTC 420

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 49/127 (38%), Positives = 53/127 (41%)
 Frame = +1

Query: 28  NPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEH 207
           +PPP   PP   P P  +PP    P   PPP   P    P    SPP        PPP  
Sbjct: 297 SPPPSPPPPSTSPSPPPRPPPSASPSP-PPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSF 355

Query: 208 QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQ 387
            P    P  + SPP   PP   PPP   PP   PP  +PPP   PP   PP   PSP   
Sbjct: 356 SPSPPPPSLSPSPPPATPPPSPPPPS--PPPPLPPPPSPPPPLPPPPIPPP---PSP--- 407

Query: 388 PPHQKPP 408
           PP   PP
Sbjct: 408 PPPPPPP 414

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 55/155 (35%), Positives = 59/155 (38%), Gaps = 2/155 (1%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PPY   PP    P   PPP   P         PPP   P    P    SPP        P
Sbjct: 205 PPY---PPSLPSPPSLPPPSASPSP-------PPPSLSPSPPPPSLSPSPPPPSISPSPP 254

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPH--EHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEH 369
           PP   P    P  + SPP   PP     PPP  L P   PP  +P P  +PP   PP   
Sbjct: 255 PPSLSPSPPPPSVSPSPP---PPSLSPSPPPPSLSPSPPPPSLSPSPPPSPP---PPSTS 308

Query: 370 PSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PSP  +PP    P   PPP   P    P    SPP
Sbjct: 309 PSPPPRPPPSASP-SPPPPSLSPSPPPPSLSPSPP 342

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 51/128 (39%), Positives = 56/128 (43%), Gaps = 8/128 (6%)
 Frame = +1

Query: 115  PPQYQPPHEKPPHEHSPPGYQPPHEIPP-PEHQPPHEKPP---HAKSPPEYQPPHEHPP- 279
            PP   PP   P    SPP   PP  +PP P   PP   PP      SPP   PP   PP 
Sbjct: 2088 PPPPSPPPSLPSSSPSPPPPSPP--LPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPS 2145

Query: 280  PEYLPPHEKPPHENPP---PEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEK 450
            P  LPP   PP ++PP   P    P   PP   PSP   PP   PP  +PPP   P +  
Sbjct: 2146 PPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPPPHPPPQSPL 2205

Query: 451  PPHEKSPP 474
            PP    PP
Sbjct: 2206 PPSPPPPP 2213

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 58/171 (33%), Positives = 63/171 (36%), Gaps = 13/171 (7%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKP--PPEYQPPHGKQPHVNP---PPQYQPPHEKPPHEHSP 165
           P    PP    PP   PP   P  PP    P    P ++P   PP   P    P    SP
Sbjct: 203 PSPPYPPSLPSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSP 262

Query: 166 PGYQPPHEIPPPEHQPPHEKPPHAKSPP----EYQPPHEHPPPEYLP-PHEKPPHE---N 321
           P        PPP   P    P  + SPP       PP   PPP   P P  +PP     +
Sbjct: 263 PPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPS 322

Query: 322 PPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PPP    P   PP   PSP   PP   P    PPP F P    P    SPP
Sbjct: 323 PPPPSLSPSPPPPSLSPSP--PPPSLSP--SPPPPSFSPSPPPPSLSPSPP 369

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 45/107 (42%), Positives = 46/107 (42%)
 Frame = +1

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN 339
           +P    PP   PPP   PP   PP   SPP   PP   PPP  LPP   PP   PPP   
Sbjct: 675 APSPSPPPPSPPPPSPSPPPSPPP--PSPPPSPPPPSPPPP--LPPPPLPPPPLPPP--- 727

Query: 340 PPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
                PP   PSP   PP   PP   PPP   PP   P    SPP S
Sbjct: 728 ---SPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPS 771

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 41/102 (40%), Positives = 44/102 (43%), Gaps = 6/102 (5%)
 Frame = +1

Query: 190  IPPPEHQPPHEKPPHAKSPPEYQPPHEHP------PPEYLPPHEKPPHENPPPEYNPPHE 351
            +P P   PP   PP    PP   PP   P      PP  LPP   PP   PPP  +PP  
Sbjct: 1531 VPSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPP--SPPPS 1588

Query: 352  KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
             PP   PSP   PP   PP   PPP   PP   PP    PP+
Sbjct: 1589 PPPSPPPSP---PPSPPPPLPLPPPPSPPPPLPPPPVPPPPS 1627

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 46/118 (38%), Positives = 48/118 (40%), Gaps = 12/118 (10%)
 Frame = +1

Query: 163  PPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLP-PHEKPPHENPPPE-- 333
            PP   PP  +P     PP   PP   SPP   PP   PPP   P P   PP   PPP   
Sbjct: 2088 PPPPSPPPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPP 2147

Query: 334  -----YNPPHEKPP---HEHPSPEYQPPHQKP-PHENPPPKFQPPNEKPPHEKSPPAS 480
                   PP + PP      PSP   PP   P P   PPP   PP   PPH   PP S
Sbjct: 2148 PLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPPPH--PPPQS 2203

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 39/107 (36%), Positives = 43/107 (40%), Gaps = 3/107 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNP---PPQYQPPHEKPPHEHSPPG 171
           P    PP  +P P        PPP    P    P ++P   PP + P    P    SPP 
Sbjct: 311 PPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPP 370

Query: 172 YQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPP 312
             PP   PPP   PP   PP   SPP   PP   PPP   PP   PP
Sbjct: 371 ATPPPSPPPPSPPPPLPPPP---SPPPPLPPPPIPPPPSPPPPPPPP 414

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 46/156 (29%), Positives = 49/156 (31%), Gaps = 16/156 (10%)
 Frame = +1

Query: 1    PHHAKPPYENPPPEYQPP------HEKPPPEYQPPHGKQPHVNP--PPQYQPPHEKPPHE 156
            P  + PP   PPP   P          PPP    P    P  +P  PP    P   PP  
Sbjct: 1750 PPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPST 1809

Query: 157  HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY 336
               P   P    PPP    P   PP +   P        PPP  L P   PP   PP   
Sbjct: 1810 SPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPPPPSLSP--SPPPSPPPSSP 1867

Query: 337  NPPHEKPPHEHPSP--------EYQPPHQKPPHENP 420
             PP    P   P P          QP    PP   P
Sbjct: 1868 PPPSPPTPPAPPRPFLVSLDIIATQPSSSNPPERYP 1903

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 42/123 (34%), Positives = 49/123 (39%), Gaps = 11/123 (8%)
 Frame = +1

Query: 145 PPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPH--EHPPPEYLPPHEKPPH- 315
           PP+   PP    P  +PPP   P    P  + SPP   PP     PPP  + P   PP  
Sbjct: 205 PPY---PPSLPSPPSLPPPSASPSPPPPSLSPSPP---PPSLSPSPPPPSISPSPPPPSL 258

Query: 316 -ENPPPEYNPPHEKPPHEHPSPEYQPPHQKPP-------HENPPPKFQPPNEKPPHEKSP 471
             +PPP    P   PP   PSP   PP    P         +PPP   PP+  P     P
Sbjct: 259 SPSPPPPSVSPSPPPPSLSPSP---PPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRP 315

Query: 472 PAS 480
           P S
Sbjct: 316 PPS 318

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 41/109 (37%), Positives = 43/109 (39%), Gaps = 2/109 (1%)
 Frame = +1

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPP--HENPPPE 333
           SPP   PP    PP   PP   P  +  PP   P    PPP  L P   PP    +PPP 
Sbjct: 204 SPP--YPPSLPSPPSLPPPSASP--SPPPPSLSP---SPPPPSLSPSPPPPSISPSPPPP 256

Query: 334 YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
              P   PP   PSP   PP   P    PPP   P    P    SPP S
Sbjct: 257 SLSPSPPPPSVSPSP--PPPSLSP--SPPPPSLSPSPPPPSLSPSPPPS 301

[76][TOP]
>UniRef100_A9PE91 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9PE91_POPTR
          Length = 182

 Score =  120 bits (302), Expect = 4e-26
 Identities = 68/157 (43%), Positives = 82/157 (52%), Gaps = 1/157 (0%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPH-EKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           ++  P YE  PP ++PP  EKP PE++PP  K P +  PP Y     KPP  + PP  +P
Sbjct: 24  YYKPPKYEPKPPYFKPPKVEKPFPEHKPPVYKPPKIEKPPVY-----KPPPVYKPPIEKP 78

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP ++PP EKPP  K PP Y+PP E PP        KPP E PP    P  EKPP
Sbjct: 79  PVYKPPPVYKPPIEKPPVYKPPPVYKPPIEKPPVY------KPPIEKPPVYKPPKIEKPP 132

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
              P    +PP  KPP    PP F  P   PP+   P
Sbjct: 133 VYKPPKIEKPPVYKPPKIEKPPPFHKP--LPPYGHYP 167

 Score =  120 bits (301), Expect = 5e-26
 Identities = 69/154 (44%), Positives = 81/154 (52%), Gaps = 4/154 (2%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHV-NPPPQYQPPHEKPPHEHSPPGYQP 180
           +  KPPY  PP   +P  E  PP Y+PP  ++P V  PPP Y+PP EKPP          
Sbjct: 30  YEPKPPYFKPPKVEKPFPEHKPPVYKPPKIEKPPVYKPPPVYKPPIEKPPVYK------- 82

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
               PPP ++PP EKPP  K PP Y+PP E  PP Y PP EKPP   PP    PP  KPP
Sbjct: 83  ----PPPVYKPPIEKPPVYKPPPVYKPPIE-KPPVYKPPIEKPPVYKPPKIEKPPVYKPP 137

Query: 361 HEHPSPEYQPPH-QKPP--HENPPPKFQPPNEKP 453
                P Y+PP  +KPP  H+  PP    P   P
Sbjct: 138 KIEKPPVYKPPKIEKPPPFHKPLPPYGHYPGHPP 171

 Score =  119 bits (298), Expect = 1e-25
 Identities = 68/146 (46%), Positives = 80/146 (54%), Gaps = 10/146 (6%)
 Frame = +1

Query: 67  PPEYQPPHGKQPHVNPPPQYQPPH-EKPPHEHSPPGYQPPH------EIPPPEHQPPHEK 225
           PP+Y+P          PP ++PP  EKP  EH PP Y+PP         PPP ++PP EK
Sbjct: 27  PPKYEPK---------PPYFKPPKVEKPFPEHKPPVYKPPKIEKPPVYKPPPVYKPPIEK 77

Query: 226 PPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKP 405
           PP  K PP Y+PP E PP    PP  KPP E  PP Y PP EKPP   P    +PP  KP
Sbjct: 78  PPVYKPPPVYKPPIEKPPVYKPPPVYKPPIEK-PPVYKPPIEKPPVYKPPKIEKPPVYKP 136

Query: 406 PHENPPPKFQPPN-EKPP--HEKSPP 474
           P    PP ++PP  EKPP  H+  PP
Sbjct: 137 PKIEKPPVYKPPKIEKPPPFHKPLPP 162

 Score =  114 bits (286), Expect = 3e-24
 Identities = 59/124 (47%), Positives = 72/124 (58%), Gaps = 6/124 (4%)
 Frame = +1

Query: 118 PQYQPPHEKPPHEHSPPGYQPPH-EIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLP 294
           P +   ++ P +E  PP ++PP  E P PEH+PP  KPP  + PP Y+     PPP Y P
Sbjct: 19  PSFADYYKPPKYEPKPPYFKPPKVEKPFPEHKPPVYKPPKIEKPPVYK-----PPPVYKP 73

Query: 295 PHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPN-EKPPH 459
           P EKPP   PPP Y PP EKPP   P P Y+PP +KPP   P    PP ++PP  EKPP 
Sbjct: 74  PIEKPPVYKPPPVYKPPIEKPPVYKPPPVYKPPIEKPPVYKPPIEKPPVYKPPKIEKPPV 133

Query: 460 EKSP 471
            K P
Sbjct: 134 YKPP 137

 Score =  112 bits (279), Expect = 2e-23
 Identities = 68/147 (46%), Positives = 76/147 (51%), Gaps = 8/147 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPH------EKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHS 162
           P   KP  E+ PP Y+PP        KPPP Y+PP  K P   PPP Y+PP EKPP    
Sbjct: 40  PKVEKPFPEHKPPVYKPPKIEKPPVYKPPPVYKPPIEKPPVYKPPPVYKPPIEKPPVYKP 99

Query: 163 PPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNP 342
           PP Y+PP E  PP ++PP EK      PP Y+PP    PP Y     KPP    PP Y P
Sbjct: 100 PPVYKPPIE-KPPVYKPPIEK------PPVYKPPKIEKPPVY-----KPPKIEKPPVYKP 147

Query: 343 PH-EKPPHEH-PSPEYQPPHQKPPHEN 417
           P  EKPP  H P P Y      PP EN
Sbjct: 148 PKIEKPPPFHKPLPPYGHYPGHPPVEN 174

[77][TOP]
>UniRef100_Q95JC9-2 Isoform 2 of Basic proline-rich protein n=1 Tax=Sus scrofa
           RepID=Q95JC9-2
          Length = 511

 Score =  120 bits (302), Expect = 4e-26
 Identities = 68/163 (41%), Positives = 75/163 (46%), Gaps = 4/163 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 295 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 353

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 354 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 413

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
             PP   P P  +PP   PP   PPP   PP  +PP    PPA
Sbjct: 414 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPA 455

 Score =  120 bits (301), Expect = 5e-26
 Identities = 67/162 (41%), Positives = 73/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 231 PPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 290

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 291 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 350

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 351 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 391

 Score =  119 bits (299), Expect = 8e-26
 Identities = 65/157 (41%), Positives = 70/157 (44%), Gaps = 4/157 (2%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPP 198
           P + PPP   PP   PPP   PP G  P    PP   PP   PP   +PPG +PP   PP
Sbjct: 226 PKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP 285

Query: 199 PEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEYNPPHEKPPHE 366
           P   PP   PP A+ PP   PP   P    PP   PP   PP   PPP   PP  +PP  
Sbjct: 286 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 345

Query: 367 HPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            P P   PP   PP   PPP   PP   PP    P A
Sbjct: 346 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 382

 Score =  119 bits (298), Expect = 1e-25
 Identities = 67/162 (41%), Positives = 74/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 253 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 311

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 312 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 371

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 372 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 412

 Score =  119 bits (298), Expect = 1e-25
 Identities = 67/162 (41%), Positives = 74/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 274 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 332

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 333 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 392

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 393 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 433

 Score =  116 bits (291), Expect = 7e-25
 Identities = 64/158 (40%), Positives = 72/158 (45%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 326 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 384

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP A+ PP   PP   PPP   PP  +PP   PPP   PP   PP
Sbjct: 385 PPGPPPPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPP 443

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP  + P + P P    P +KPP    PP
Sbjct: 444 GARPPPGPPPPADE-PQQGPAPSGDKPKKKPPPPAGPP 480

 Score =  115 bits (289), Expect = 1e-24
 Identities = 67/167 (40%), Positives = 72/167 (43%), Gaps = 8/167 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 258 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 317

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEY 336
           G +PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP  
Sbjct: 318 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 377

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 378 APPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 424

 Score =  115 bits (289), Expect = 1e-24
 Identities = 67/167 (40%), Positives = 72/167 (43%), Gaps = 8/167 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 279 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 338

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEY 336
           G +PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP  
Sbjct: 339 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 398

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 399 APPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 445

 Score =  115 bits (288), Expect = 2e-24
 Identities = 67/167 (40%), Positives = 72/167 (43%), Gaps = 8/167 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 237 PPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 296

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEY 336
           G +PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP  
Sbjct: 297 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 356

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 357 APPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 403

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/163 (39%), Positives = 72/163 (44%), Gaps = 5/163 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQ-YQPPHEKPPHEHSPPGYQ 177
           P  A  P + P P    P +KPPP   PP    P   PPP    PP  +PP    PPG  
Sbjct: 209 PPSADGPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPP 268

Query: 178 PPHEIP----PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP 345
           PP   P    PP   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP
Sbjct: 269 PPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 328

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 329 GPPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 370

 Score =  114 bits (286), Expect = 3e-24
 Identities = 64/159 (40%), Positives = 71/159 (44%), Gaps = 4/159 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 300 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 359

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           G +PP   PPP   PP   PP A+ PP   PP   PPP   PP  +PP   PPP   PP 
Sbjct: 360 GARPPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 418

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEK 465
             PP   P P   PP   PP   PP    PP   PP ++
Sbjct: 419 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPADE 457

 Score =  112 bits (279), Expect = 2e-23
 Identities = 66/168 (39%), Positives = 73/168 (43%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 242 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 300

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH----ENPPPE----- 333
           P   PPP   PP   PP A+ PP   PP   PPP   PP  +PP       PPP      
Sbjct: 301 PPGPPPPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPP 359

Query: 334 -YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 360 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 407

 Score =  112 bits (279), Expect = 2e-23
 Identities = 66/168 (39%), Positives = 73/168 (43%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 263 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 321

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH----ENPPPE----- 333
           P   PPP   PP   PP A+ PP   PP   PPP   PP  +PP       PPP      
Sbjct: 322 PPGPPPPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPP 380

Query: 334 -YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 381 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 428

 Score =  112 bits (279), Expect = 2e-23
 Identities = 66/168 (39%), Positives = 73/168 (43%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 284 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 342

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH----ENPPPE----- 333
           P   PPP   PP   PP A+ PP   PP   PPP   PP  +PP       PPP      
Sbjct: 343 PPGPPPPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPP 401

Query: 334 -YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 402 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 449

 Score =  109 bits (273), Expect = 8e-23
 Identities = 64/162 (39%), Positives = 73/162 (45%), Gaps = 5/162 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 305 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 363

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH----ENPPPE-YNPP 345
           P   PPP   PP   PP A+ PP   PP   PPP   PP  +PP       PPP    PP
Sbjct: 364 PPGPPPPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPP 422

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             +PP   P P   PP   PP   PPP   PP ++P    +P
Sbjct: 423 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPADEPQQGPAP 464

 Score =  108 bits (269), Expect = 2e-22
 Identities = 62/152 (40%), Positives = 71/152 (46%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP  +PPP   PP G  P    PP  +PP   PP    PPG  P
Sbjct: 342 PPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 400

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP ++ P
Sbjct: 401 PGARPPPGPPPPGPPPP-GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPADE-P 458

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPP 456
            + P+P    P +KP    PPP   PP   PP
Sbjct: 459 QQGPAPSGDKPKKKP----PPPAGPPPPPPPP 486

 Score =  106 bits (265), Expect = 7e-22
 Identities = 64/174 (36%), Positives = 68/174 (39%), Gaps = 15/174 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP-----------EYQPPHGKQPHVNPPPQYQPPHEKP 147
           P    PP   PP     P  +PPP           E  PP    P   P P    P +KP
Sbjct: 171 PGAGHPPRPPPPANESQPGPRPPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKP 230

Query: 148 PHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPH 315
           P    PP   PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP 
Sbjct: 231 P----PPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 286

Query: 316 ENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
             PPP   PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 287 GPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 340

 Score =  106 bits (265), Expect = 7e-22
 Identities = 62/163 (38%), Positives = 68/163 (41%), Gaps = 10/163 (6%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPPPEYQPPHGKQPH------VNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  N   E  PP    P +   P G +P         PPP   PP   PP   +PPG +P
Sbjct: 199 PPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARP 258

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEYNPPH 348
           P   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP   PP 
Sbjct: 259 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 318

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 319 ARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 361

 Score =  102 bits (255), Expect = 1e-20
 Identities = 61/168 (36%), Positives = 70/168 (41%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 74  PPGARPPP-GPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 132

Query: 181 PHEIPPPEHQPPHEKPP----HAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    PP   PP         P +  P + PPP   P    PP   PP   + P 
Sbjct: 133 PGPAPPGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPP---PGAGHPPRPPPPANESQPG 189

Query: 349 EKPPHEHPSP------EYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            +PP   PSP      E  PP    P + P P    P +KPP    PP
Sbjct: 190 PRPPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAGPP 237

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/166 (38%), Positives = 72/166 (43%), Gaps = 8/166 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP  +PPP   PP G      P P +  P +KPP    PPG   
Sbjct: 121 PPPGPPPPGPPPPGPAPPGARPPPGPPPPAGGLQQ-GPAPSHVGPKKKPP----PPGAGH 175

Query: 181 PHEIPPP--EHQPPHEKPPHAKSPP-----EYQPPHEHPPPE-YLPPHEKPPHENPPPEY 336
           P   PPP  E QP    PP   SPP     E  PP    P +   P  +KP  + PPP  
Sbjct: 176 PPRPPPPANESQPGPRPPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAG 235

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 236 PPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 281

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 61/164 (37%), Positives = 71/164 (43%), Gaps = 10/164 (6%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKP---------PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           +PP    PP   PP E           PP   P  G  P    PP   PP   PP   +P
Sbjct: 36  RPPPGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAP 95

Query: 166 PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP 345
           PG +PP   PPP   PP   PP A+ PP   PP   PPP   PP  +PP   PPP     
Sbjct: 96  PGARPPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPP-PGPPPPAGGL 153

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP-NEKPPHEKSPP 474
            + P   H  P+ +PP   PP    PP+  PP NE  P  + PP
Sbjct: 154 QQGPAPSHVGPKKKPP---PPGAGHPPRPPPPANESQPGPRPPP 194

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 63/179 (35%), Positives = 76/179 (42%), Gaps = 19/179 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP  +PPP   PP G  P    PP  +PP   PP    PPG  P
Sbjct: 79  PPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 137

Query: 181 PHEIPPPEHQPP----HEKPPHAKSPPEYQPPHE---HPPPEYLPPHEKPPHENPPP--- 330
           P   PPP   PP     + P  +   P+ +PP     HPP    P +E  P   PPP   
Sbjct: 138 PGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPPPGAGHPPRPPPPANESQPGPRPPPGPP 197

Query: 331 --------EYNPPHEKPPHEHPSPEYQPPHQK-PPHENPPPKFQPPNEKPPHEKSPPAS 480
                   E +PP    P + P+P    P +K PP   PPP   PP   PP   +PP +
Sbjct: 198 SPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGA 256

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 61/169 (36%), Positives = 68/169 (40%), Gaps = 11/169 (6%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P H  P  + PPP    P   PPP  +     QP   PPP    P      E SPP    
Sbjct: 159 PSHVGPKKKPPPPGAGHPPRPPPPANE----SQPGPRPPPGPPSPPANDSQEGSPPSADG 214

Query: 181 PHEIPPPEHQPPHEKPPH-AKSPPEYQPPHEHPPPEYLPPHEKPPH----ENPPPE---- 333
           P + P P    P +KPP  A  PP   PP   PPP   PP  +PP       PPP     
Sbjct: 215 PQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 274

Query: 334 --YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 275 PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 323

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 60/157 (38%), Positives = 68/157 (43%), Gaps = 7/157 (4%)
 Frame = +1

Query: 31  PPPEYQPPHEKPPPEYQPP-HGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEH 207
           PPP   PP   PP E Q   H K+P        +PP + P    +PPG +PP   PPP  
Sbjct: 37  PPPGGGPPRPPPPEESQGEGHQKRP--------RPPGDGPEQGPAPPGARPPPGPPPPGP 88

Query: 208 QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQ 387
            PP   PP A+ PP   PP   PPP   PP  +PP   PPP   PP   PP   P P   
Sbjct: 89  PPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP 147

Query: 388 PP------HQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
           PP         P H  P  K  PP    P    PPA+
Sbjct: 148 PPAGGLQQGPAPSHVGPKKKPPPPGAGHPPRPPPPAN 184

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 58/148 (39%), Positives = 66/148 (44%), Gaps = 3/148 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 358 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 416

Query: 181 PHEIPP---PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHE 351
           P   PP   P   PP   PP    PP   PP   PPP   PP ++ P + P P  + P +
Sbjct: 417 PGPAPPGARPPPGPPPPGPP----PPGPAPPGARPPPGPPPPADE-PQQGPAPSGDKPKK 471

Query: 352 KPPHEHPSPEYQPPHQKPPHENPPPKFQ 435
           KPP         PP   PP   PPP  Q
Sbjct: 472 KPP---------PPAGPPPPPPPPPGIQ 490

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 47/124 (37%), Positives = 55/124 (44%)
 Frame = +1

Query: 106 VNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPE 285
           + PPP   PP   PP E    G+Q          +PP + P    +PP  +PP   PPP 
Sbjct: 35  LRPPPGGGPPRPPPPEESQGEGHQ-------KRPRPPGDGPEQGPAPPGARPPPGPPPPG 87

Query: 286 YLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEK 465
             PP   PP   PPP   PP   PP   P P  +PP   PP   PPP   PP  +PP   
Sbjct: 88  PPPPGPAPPGARPPPGPPPPGPPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGP 146

Query: 466 SPPA 477
            PPA
Sbjct: 147 PPPA 150

[78][TOP]
>UniRef100_Q95JC9-3 Isoform 3 of Basic proline-rich protein n=1 Tax=Sus scrofa
           RepID=Q95JC9-3
          Length = 566

 Score =  120 bits (302), Expect = 4e-26
 Identities = 68/163 (41%), Positives = 75/163 (46%), Gaps = 4/163 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 295 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 353

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 354 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 413

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
             PP   P P  +PP   PP   PPP   PP  +PP    PPA
Sbjct: 414 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPA 455

 Score =  120 bits (301), Expect = 5e-26
 Identities = 67/162 (41%), Positives = 73/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 231 PPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 290

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 291 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 350

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 351 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 391

 Score =  119 bits (299), Expect = 8e-26
 Identities = 65/157 (41%), Positives = 70/157 (44%), Gaps = 4/157 (2%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPP 198
           P + PPP   PP   PPP   PP G  P    PP   PP   PP   +PPG +PP   PP
Sbjct: 226 PKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP 285

Query: 199 PEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEYNPPHEKPPHE 366
           P   PP   PP A+ PP   PP   P    PP   PP   PP   PPP   PP  +PP  
Sbjct: 286 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 345

Query: 367 HPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            P P   PP   PP   PPP   PP   PP    P A
Sbjct: 346 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 382

 Score =  119 bits (298), Expect = 1e-25
 Identities = 67/162 (41%), Positives = 74/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 253 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 311

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 312 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 371

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 372 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 412

 Score =  119 bits (298), Expect = 1e-25
 Identities = 67/162 (41%), Positives = 74/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 274 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 332

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 333 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPG 392

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 393 PPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 433

 Score =  119 bits (297), Expect = 1e-25
 Identities = 64/162 (39%), Positives = 73/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 363 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 422

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           G +PP   PPP   PP   PP A+ PP   PP + P     P  +KP  + PPP   PP 
Sbjct: 423 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPP 482

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 483 PPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 524

 Score =  117 bits (293), Expect = 4e-25
 Identities = 66/165 (40%), Positives = 78/165 (47%), Gaps = 5/165 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 337 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 395

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    P   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP 
Sbjct: 396 PGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPA 455

Query: 349 EKPPHEHPSPEYQPPHQKPPH-ENPPPKFQPPNEKPPHEKSPPAS 480
           ++P  + P+P    P +KPP    PPP   PP   PP   +PP +
Sbjct: 456 DEP-QQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGA 499

 Score =  116 bits (291), Expect = 7e-25
 Identities = 63/159 (39%), Positives = 71/159 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP  +PPP   PP G  P    PP  +PP   PP    PPG  P
Sbjct: 384 PPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 442

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP ++P    +P   +P  + PPP   PP   PP   PPP   PP  +PP
Sbjct: 443 PGARPPPGPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPP 502

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              P P   PP   PP   PPP   PP   PP    P A
Sbjct: 503 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 541

 Score =  115 bits (289), Expect = 1e-24
 Identities = 67/167 (40%), Positives = 72/167 (43%), Gaps = 8/167 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 258 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 317

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEY 336
           G +PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP  
Sbjct: 318 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 377

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 378 APPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 424

 Score =  115 bits (289), Expect = 1e-24
 Identities = 67/167 (40%), Positives = 72/167 (43%), Gaps = 8/167 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 279 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 338

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEY 336
           G +PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP  
Sbjct: 339 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 398

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 399 APPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 445

 Score =  115 bits (289), Expect = 1e-24
 Identities = 65/162 (40%), Positives = 73/162 (45%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 321 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 380

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           G +PP   PPP   PP   PP A+ PP   PP   PPP   PP  +PP   PPP   PP 
Sbjct: 381 GARPPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 439

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             PP   P P   PP  + P + P P    P +KPP    PP
Sbjct: 440 PAPPGARPPPGPPPPADE-PQQGPAPSGDKPKKKPPPPAGPP 480

 Score =  115 bits (288), Expect = 2e-24
 Identities = 67/167 (40%), Positives = 72/167 (43%), Gaps = 8/167 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 237 PPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 296

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEY 336
           G +PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP  
Sbjct: 297 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 356

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 357 APPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 403

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/163 (39%), Positives = 72/163 (44%), Gaps = 5/163 (3%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQ-YQPPHEKPPHEHSPPGYQ 177
           P  A  P + P P    P +KPPP   PP    P   PPP    PP  +PP    PPG  
Sbjct: 209 PPSADGPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPP 268

Query: 178 PPHEIP----PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP 345
           PP   P    PP   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP
Sbjct: 269 PPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 328

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP   P P  +PP   PP   PPP   PP  +PP    PP
Sbjct: 329 GPPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 370

 Score =  114 bits (286), Expect = 3e-24
 Identities = 64/159 (40%), Positives = 71/159 (44%), Gaps = 4/159 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 300 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 359

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           G +PP   PPP   PP   PP A+ PP   PP   PPP   PP  +PP   PPP   PP 
Sbjct: 360 GARPPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 418

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEK 465
             PP   P P   PP   PP   PP    PP   PP ++
Sbjct: 419 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPADE 457

 Score =  114 bits (285), Expect = 3e-24
 Identities = 66/168 (39%), Positives = 74/168 (44%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP----EYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP   PPP   PP  +PPP       PP G  P    PP   PP   PP   +PP
Sbjct: 342 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 401

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           G +PP   PPP   PP   PP A+ PP   PP   PPP   PP  +PP   PPP   P  
Sbjct: 402 GARPPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPPADEPQQ 460

Query: 349 ------EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
                 +KP  + P P   PP   PP   PPP   PP  +PP    PP
Sbjct: 461 GPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPP 508

 Score =  112 bits (280), Expect = 1e-23
 Identities = 66/169 (39%), Positives = 72/169 (42%), Gaps = 11/169 (6%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 379 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 437

Query: 181 PHEIPPPEHQPPHEKPPHAKSP-----PEYQPPHEHPPPEYLPPHEKPPHENPPPE---- 333
           P   PP    PP   PP A  P     P    P + PPP   PP   PP   PPP     
Sbjct: 438 PGPAPPGARPPPGPPPP-ADEPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAP 496

Query: 334 --YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 497 PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 545

 Score =  112 bits (280), Expect = 1e-23
 Identities = 63/159 (39%), Positives = 70/159 (44%), Gaps = 1/159 (0%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PP  +P
Sbjct: 400 PPGARPP-PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPADEP 458

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
                P   +P  + PP A  PP   PP   PPP   PP  +PP   PPP   PP   PP
Sbjct: 459 QQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 518

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHE-KSPP 474
              P P   PP   PP   PP    PP   PP    SPP
Sbjct: 519 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPPPGPSPP 557

 Score =  112 bits (279), Expect = 2e-23
 Identities = 66/168 (39%), Positives = 73/168 (43%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 242 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 300

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH----ENPPPE----- 333
           P   PPP   PP   PP A+ PP   PP   PPP   PP  +PP       PPP      
Sbjct: 301 PPGPPPPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPP 359

Query: 334 -YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 360 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 407

 Score =  112 bits (279), Expect = 2e-23
 Identities = 66/168 (39%), Positives = 73/168 (43%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 263 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 321

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH----ENPPPE----- 333
           P   PPP   PP   PP A+ PP   PP   PPP   PP  +PP       PPP      
Sbjct: 322 PPGPPPPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPP 380

Query: 334 -YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 381 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 428

 Score =  110 bits (274), Expect = 6e-23
 Identities = 65/174 (37%), Positives = 72/174 (41%), Gaps = 16/174 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP    PP  +PP   PPP   PP    P   PPP   PP   PP   +PPG +P
Sbjct: 389 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP-APPGARP 447

Query: 181 PHEIPPPEHQP----------PHEKPPHAKSPPEYQPPHEHPPPE------YLPPHEKPP 312
           P   PPP  +P          P +KPP    PP   PP   PPP         PP   PP
Sbjct: 448 PPGPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPP 507

Query: 313 HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PPP   PP  +PP   P P   PP   PP   PPP   PP   P   + PP
Sbjct: 508 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPPPGPSPPRPPP 561

 Score =  106 bits (265), Expect = 7e-22
 Identities = 64/174 (36%), Positives = 68/174 (39%), Gaps = 15/174 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPP-----------EYQPPHGKQPHVNPPPQYQPPHEKP 147
           P    PP   PP     P  +PPP           E  PP    P   P P    P +KP
Sbjct: 171 PGAGHPPRPPPPANESQPGPRPPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKP 230

Query: 148 PHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPH 315
           P    PP   PP   PPP   PP   PP A+ PP   PP   P    PP   PP   PP 
Sbjct: 231 P----PPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPP 286

Query: 316 ENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
             PPP   PP  +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 287 GPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 340

 Score =  106 bits (265), Expect = 7e-22
 Identities = 62/163 (38%), Positives = 68/163 (41%), Gaps = 10/163 (6%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPPPEYQPPHGKQPH------VNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  N   E  PP    P +   P G +P         PPP   PP   PP   +PPG +P
Sbjct: 199 PPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARP 258

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEYNPPH 348
           P   PPP   PP   PP A+ PP   PP   P    PP   PP   PP   PPP   PP 
Sbjct: 259 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 318

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            +PP   P P   PP   PP   PPP   PP   PP    P A
Sbjct: 319 ARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 361

 Score =  103 bits (258), Expect = 5e-21
 Identities = 57/151 (37%), Positives = 61/151 (40%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP   PP  + P   PPP  +P     P    P    P
Sbjct: 416 PPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPPADEPQQGPAPSGDKPKKKPP 474

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   +PP  +PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 475 PPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 534

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKP 453
              P     PP   PP   P P   PP   P
Sbjct: 535 GPAPPGARPPPGPPPPPPGPSPPRPPPGPPP 565

 Score =  102 bits (255), Expect = 1e-20
 Identities = 61/168 (36%), Positives = 70/168 (41%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP   PP    PP  +PP G  P   PPP   PP  +PP    PPG  P
Sbjct: 74  PPGARPPP-GPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPP 132

Query: 181 PHEIPPPEHQPPHEKPP----HAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   PP    PP   PP         P +  P + PPP   P    PP   PP   + P 
Sbjct: 133 PGPAPPGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPP---PGAGHPPRPPPPANESQPG 189

Query: 349 EKPPHEHPSP------EYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            +PP   PSP      E  PP    P + P P    P +KPP    PP
Sbjct: 190 PRPPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAGPP 237

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/166 (38%), Positives = 72/166 (43%), Gaps = 8/166 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP  +PPP   PP G      P P +  P +KPP    PPG   
Sbjct: 121 PPPGPPPPGPPPPGPAPPGARPPPGPPPPAGGLQQ-GPAPSHVGPKKKPP----PPGAGH 175

Query: 181 PHEIPPP--EHQPPHEKPPHAKSPP-----EYQPPHEHPPPE-YLPPHEKPPHENPPPEY 336
           P   PPP  E QP    PP   SPP     E  PP    P +   P  +KP  + PPP  
Sbjct: 176 PPRPPPPANESQPGPRPPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAG 235

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 236 PPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 281

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 61/164 (37%), Positives = 71/164 (43%), Gaps = 10/164 (6%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKP---------PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           +PP    PP   PP E           PP   P  G  P    PP   PP   PP   +P
Sbjct: 36  RPPPGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAP 95

Query: 166 PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP 345
           PG +PP   PPP   PP   PP A+ PP   PP   PPP   PP  +PP   PPP     
Sbjct: 96  PGARPPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPP-PGPPPPAGGL 153

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP-NEKPPHEKSPP 474
            + P   H  P+ +PP   PP    PP+  PP NE  P  + PP
Sbjct: 154 QQGPAPSHVGPKKKPP---PPGAGHPPRPPPPANESQPGPRPPP 194

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 63/179 (35%), Positives = 76/179 (42%), Gaps = 19/179 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP  +PPP   PP G  P    PP  +PP   PP    PPG  P
Sbjct: 79  PPPGPPPPGPPPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 137

Query: 181 PHEIPPPEHQPP----HEKPPHAKSPPEYQPPHE---HPPPEYLPPHEKPPHENPPP--- 330
           P   PPP   PP     + P  +   P+ +PP     HPP    P +E  P   PPP   
Sbjct: 138 PGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPPPGAGHPPRPPPPANESQPGPRPPPGPP 197

Query: 331 --------EYNPPHEKPPHEHPSPEYQPPHQK-PPHENPPPKFQPPNEKPPHEKSPPAS 480
                   E +PP    P + P+P    P +K PP   PPP   PP   PP   +PP +
Sbjct: 198 SPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGA 256

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 61/169 (36%), Positives = 68/169 (40%), Gaps = 11/169 (6%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P H  P  + PPP    P   PPP  +     QP   PPP    P      E SPP    
Sbjct: 159 PSHVGPKKKPPPPGAGHPPRPPPPANE----SQPGPRPPPGPPSPPANDSQEGSPPSADG 214

Query: 181 PHEIPPPEHQPPHEKPPH-AKSPPEYQPPHEHPPPEYLPPHEKPPH----ENPPPE---- 333
           P + P P    P +KPP  A  PP   PP   PPP   PP  +PP       PPP     
Sbjct: 215 PQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 274

Query: 334 --YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
               PP   PP   P P   PP  +PP   PPP   PP   PP  + PP
Sbjct: 275 PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 323

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 60/157 (38%), Positives = 68/157 (43%), Gaps = 7/157 (4%)
 Frame = +1

Query: 31  PPPEYQPPHEKPPPEYQPP-HGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEH 207
           PPP   PP   PP E Q   H K+P        +PP + P    +PPG +PP   PPP  
Sbjct: 37  PPPGGGPPRPPPPEESQGEGHQKRP--------RPPGDGPEQGPAPPGARPPPGPPPPGP 88

Query: 208 QPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQ 387
            PP   PP A+ PP   PP   PPP   PP  +PP   PPP   PP   PP   P P   
Sbjct: 89  PPPGPAPPGARPPPG-PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP 147

Query: 388 PP------HQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
           PP         P H  P  K  PP    P    PPA+
Sbjct: 148 PPAGGLQQGPAPSHVGPKKKPPPPGAGHPPRPPPPAN 184

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 61/156 (39%), Positives = 68/156 (43%), Gaps = 4/156 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP  +PPP   PP   +P   P P    P +KPP    PP   P
Sbjct: 426 PPPGPPPPGPPPPGPAPPGARPPPG-PPPPADEPQQGPAPSGDKPKKKPP----PPAGPP 480

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH----ENPPPEYNPPH 348
           P   PPP   PP   PP A+ PP   PP   PPP   PP  +PP       PP    PP 
Sbjct: 481 PPPPPPPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPP----PPG 535

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPP 456
             PP   P P   PP   PP  +PP   +PP   PP
Sbjct: 536 PAPPGARPPPGPPPP---PPGPSPP---RPPPGPPP 565

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 55/143 (38%), Positives = 63/143 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P  A+PP   PPP  +P     P   +P     P   PPP   PP   PP   +PPG +P
Sbjct: 442 PPGARPPPGPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARP 501

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   P    PP   +PP  +PP   PPP   PP   PP   PPP   PP   PP
Sbjct: 502 PPGPPPPG--P----PPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP--GPP---PP 550

Query: 361 HEHPSPEYQPPHQKPPHENPPPK 429
              PSP   PP        PPP+
Sbjct: 551 PPGPSPPRPPP-------GPPPQ 566

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 47/124 (37%), Positives = 55/124 (44%)
 Frame = +1

Query: 106 VNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPE 285
           + PPP   PP   PP E    G+Q          +PP + P    +PP  +PP   PPP 
Sbjct: 35  LRPPPGGGPPRPPPPEESQGEGHQ-------KRPRPPGDGPEQGPAPPGARPPPGPPPPG 87

Query: 286 YLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEK 465
             PP   PP   PPP   PP   PP   P P  +PP   PP   PPP   PP  +PP   
Sbjct: 88  PPPPGPAPPGARPPPGPPPPGPPPPGPAP-PGARPPPGPPPPGPPPPGPAPPGARPPPGP 146

Query: 466 SPPA 477
            PPA
Sbjct: 147 PPPA 150

[79][TOP]
>UniRef100_UPI0001985257 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001985257
          Length = 448

 Score =  120 bits (300), Expect = 6e-26
 Identities = 69/152 (45%), Positives = 76/152 (50%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP+  PPP   PPH +PPP   PP    PH+NPPP   PPH +PP         PPH  P
Sbjct: 12  PPFSPPPP---PPHRRPPP---PP----PHINPPP---PPHTRPP--------PPPHTRP 50

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
           PP        PPH   PP   PPH  PPP   PPH +PP   PPP  NPP   PPH  P 
Sbjct: 51  PP-------PPPHINPPP---PPHTRPPP---PPHRRPP--PPPPHINPP--PPPHTRPP 93

Query: 376 PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           P   PPH +PP   PPP   PP   P  +  P
Sbjct: 94  P---PPHTRPP---PPPHVLPPPPSPSPDSHP 119

 Score =  102 bits (254), Expect = 1e-20
 Identities = 62/130 (47%), Positives = 71/130 (54%), Gaps = 3/130 (2%)
 Frame = +1

Query: 100 PHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEK---PPHAKSPPEYQPPHE 270
           P  +PPP   PPH +PP    PP   PPH  PPP   PPH +   PPH + PP   PPH 
Sbjct: 12  PPFSPPPP--PPHRRPP----PP---PPHINPPP---PPHTRPPPPPHTRPPP--PPPHI 57

Query: 271 HPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEK 450
           +PPP   PPH +PP   PPP   PP   PPH +P P   PPH +PP   PPP  +PP   
Sbjct: 58  NPPP---PPHTRPP---PPPHRRPP-PPPPHINPPP---PPHTRPP---PPPHTRPP--P 102

Query: 451 PPHEKSPPAS 480
           PPH   PP S
Sbjct: 103 PPHVLPPPPS 112

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 50/117 (42%), Positives = 57/117 (48%), Gaps = 3/117 (2%)
 Frame = +1

Query: 1   PHHAKPP---YENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPG 171
           P H +PP   +  PPP   PPH  PPP         PH  PPP   PPH +PP    PP 
Sbjct: 37  PPHTRPPPPPHTRPPPP--PPHINPPP--------PPHTRPPP---PPHRRPP----PP- 78

Query: 172 YQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNP 342
             PPH  PPP        PPH + PP   PPH  PPP   PPH  PP  +P P+ +P
Sbjct: 79  --PPHINPPP--------PPHTRPPP---PPHTRPPP---PPHVLPPPPSPSPDSHP 119

[80][TOP]
>UniRef100_C6TGK1 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TGK1_SOYBN
          Length = 161

 Score =  120 bits (300), Expect = 6e-26
 Identities = 75/152 (49%), Positives = 87/152 (57%), Gaps = 4/152 (2%)
 Frame = +1

Query: 37  PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPP 216
           P+    +EKPP  Y+PP      V  PP Y+PP EKPP  + PP Y+PP E  PP ++PP
Sbjct: 22  PQVLADYEKPPI-YKPP------VYTPPVYKPPVEKPP-VYKPPVYKPPVE-KPPVYKPP 72

Query: 217 HEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPH 396
             KPP  K PP Y+PP E  PP Y PP  KPP    PP Y PP EKPP   P P Y+PP 
Sbjct: 73  VYKPPIYK-PPVYKPPVE-KPPVYKPPVYKPP-VYKPPVYKPPIEKPPVYKP-PVYKPPV 128

Query: 397 QKPPHENP----PPKFQPPNEKPPHEKSPPAS 480
            KPP   P    PP  +PP  KPP+ K PP S
Sbjct: 129 YKPPVYKPPVYKPPVKKPPIYKPPYPKYPPGS 160

 Score =  118 bits (296), Expect = 2e-25
 Identities = 71/136 (52%), Positives = 83/136 (61%), Gaps = 1/136 (0%)
 Frame = +1

Query: 34  PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQP 213
           PP Y+PP    PP Y+PP  K P V  PP Y+PP EKPP  + PP Y+PP    PP ++P
Sbjct: 31  PPIYKPP-VYTPPVYKPPVEKPP-VYKPPVYKPPVEKPP-VYKPPVYKPPI-YKPPVYKP 86

Query: 214 PHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPP 393
           P EKPP  K PP Y+PP  + PP Y PP EKPP   PP  Y PP  KPP   P P Y+PP
Sbjct: 87  PVEKPPVYK-PPVYKPP-VYKPPVYKPPIEKPPVYKPPV-YKPPVYKPPVYKP-PVYKPP 142

Query: 394 HQKPPHENPP-PKFQP 438
            +KPP   PP PK+ P
Sbjct: 143 VKKPPIYKPPYPKYPP 158

 Score =  114 bits (284), Expect = 4e-24
 Identities = 72/142 (50%), Positives = 84/142 (59%), Gaps = 5/142 (3%)
 Frame = +1

Query: 7   HAKPPYENPP----PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY 174
           + KPP   PP    P Y+PP EKPP  Y+PP  K P V  PP Y+PP  KPP  + PP Y
Sbjct: 28  YEKPPIYKPPVYTPPVYKPPVEKPPV-YKPPVYKPP-VEKPPVYKPPVYKPPI-YKPPVY 84

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
           +PP E  PP ++PP  KPP  K PP Y+PP E PP  Y PP  KPP   PP  Y PP  K
Sbjct: 85  KPPVE-KPPVYKPPVYKPPVYK-PPVYKPPIEKPPV-YKPPVYKPPVYKPPV-YKPPVYK 140

Query: 355 PPHEHPSPEYQPPHQK-PPHEN 417
           PP + P P Y+PP+ K PP  N
Sbjct: 141 PPVKKP-PIYKPPYPKYPPGSN 161

[81][TOP]
>UniRef100_Q8LGR5 Proline rich protein 2 n=1 Tax=Vitis vinifera RepID=Q8LGR5_VITVI
          Length = 193

 Score =  119 bits (299), Expect = 8e-26
 Identities = 73/169 (43%), Positives = 91/169 (53%), Gaps = 9/169 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQP-PHEKPPHEHSPPGYQ 177
           P H  PP+E PPPE++PP EKPPPE++PP  K     PPP+++P P EKPP    P    
Sbjct: 25  PKH--PPFEKPPPEHKPPVEKPPPEHKPPMEK-----PPPEHKPTPLEKPPKGEKP---L 74

Query: 178 PPHEIPPPEHQPPH-EKPPHAKSPPEYQPPHEHPPPEYLPPHE--KPPHENPPPEYNPPH 348
           P H+ P P  +PP  EKPPH    P + PP E+    Y PP    KPP    PP Y    
Sbjct: 75  PEHKPPAPVGKPPKGEKPPHYGHNPGH-PPAENAEDSYKPPTPVGKPPTGEKPPHYGHNP 133

Query: 349 EKPPHEHPSPEYQPPHQKP--PHENPPP---KFQPPNEKPPHEKSPPAS 480
            +PP E+    ++PP  KP  P    PP   K +P   KPPH+  PP S
Sbjct: 134 GQPPAENAEDLFKPPKIKPRLPKNKLPPIPRKIKP--RKPPHKPPPPPS 180

 Score =  103 bits (256), Expect = 8e-21
 Identities = 68/165 (41%), Positives = 83/165 (50%), Gaps = 17/165 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQP------PHGKQP---HVNPPPQYQPPH-EKPP 150
           P H KPP E PPPE++PP EKPPPE++P      P G++P   H  P P  +PP  EKPP
Sbjct: 35  PEH-KPPVEKPPPEHKPPMEKPPPEHKPTPLEKPPKGEKPLPEHKPPAPVGKPPKGEKPP 93

Query: 151 HEHSPPGYQPPHEIPPPEHQPPHE--KPPHAKSPPEY-----QPPHEHPPPEYLPPHEKP 309
           H    PG+ PP E     ++PP    KPP  + PP Y     QPP E+    + PP  KP
Sbjct: 94  HYGHNPGH-PPAENAEDSYKPPTPVGKPPTGEKPPHYGHNPGQPPAENAEDLFKPPKIKP 152

Query: 310 PHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPN 444
                      P  K P   P P    P +KPPH+ PPP   P N
Sbjct: 153 ---------RLPKNKLP---PIPRKIKP-RKPPHKPPPPPSHPTN 184

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 45/104 (43%), Positives = 54/104 (51%), Gaps = 23/104 (22%)
 Frame = +1

Query: 232 HAKSPPEYQPPHEHPPP-EYLPPHEKPPHENPPPEYNP-PHEKPPH-EHPSPEYQPP--- 393
           + K PP  +PP EH PP E  PP  KPP E PPPE+ P P EKPP  E P PE++PP   
Sbjct: 24  YPKHPPFEKPPPEHKPPVEKPPPEHKPPMEKPPPEHKPTPLEKPPKGEKPLPEHKPPAPV 83

Query: 394 -----HQKPPH----------ENPPPKFQPPNE--KPPHEKSPP 474
                 +KPPH          EN    ++PP    KPP  + PP
Sbjct: 84  GKPPKGEKPPHYGHNPGHPPAENAEDSYKPPTPVGKPPTGEKPP 127

[82][TOP]
>UniRef100_O49201 Proline-rich protein n=1 Tax=Gossypium hirsutum RepID=O49201_GOSHI
          Length = 299

 Score =  119 bits (299), Expect = 8e-26
 Identities = 76/185 (41%), Positives = 92/185 (49%), Gaps = 28/185 (15%)
 Frame = +1

Query: 4   HHAKPP-YENP--------PPEYQPPHE---KP-PPEYQPPHGKQPHVNPPPQYQPPHEK 144
           H  KPP YE P        PP Y PP +   KP PP Y+PP  ++P   PP    P  EK
Sbjct: 78  HGPKPPMYEPPKKEKPEPKPPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEK 137

Query: 145 PPHEHSPPGYQPPH----EIPPPEHQPPHEKPPHAKSPPEYQPPHEHP--------PPEY 288
           P  E  PP Y+PP     E  PP + PP ++ P  K PP Y+PP + P        PP Y
Sbjct: 138 P--EPKPPVYEPPKKEKPEPRPPVYTPPKKEKPEPK-PPVYEPPKKPPMYEPKPPKPPVY 194

Query: 289 LPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP---PPKFQPPNEKPPH 459
            PP ++ P E  PP Y PP +KPP   P P   P +  P  E P   PP +QPPN  P +
Sbjct: 195 TPPKKEKP-EPKPPMYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYQPPNNPPIY 252

Query: 460 EKSPP 474
           E  PP
Sbjct: 253 EPKPP 257

 Score =  117 bits (294), Expect = 3e-25
 Identities = 72/172 (41%), Positives = 91/172 (52%), Gaps = 15/172 (8%)
 Frame = +1

Query: 1   PHHAKPPYENP-PPEYQPP-HEKP---PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           P   KPP   P PP Y+PP  EKP   PP Y PP  K+ H   PP Y+PP ++ P E  P
Sbjct: 40  PPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPK-KEKHGPKPPMYEPPKKEKP-EPKP 97

Query: 166 PGYQPP-HEIP---PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP--- 324
           P Y PP  E P   PP ++PP ++ P  K PP Y PP +  P    P +E P  E P   
Sbjct: 98  PVYTPPKKEEPKPKPPVYEPPKKEKPEPK-PPIYTPPKKEKPEPKPPVYEPPKKEKPEPR 156

Query: 325 PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPK---FQPPNEKPPHEKSP 471
           PP Y PP ++ P   P P Y+PP + P +E  PPK   + PP ++ P  K P
Sbjct: 157 PPVYTPPKKEKPEPKP-PVYEPPKKPPMYEPKPPKPPVYTPPKKEKPEPKPP 207

 Score =  114 bits (284), Expect = 4e-24
 Identities = 70/170 (41%), Positives = 90/170 (52%), Gaps = 13/170 (7%)
 Frame = +1

Query: 1   PHHAKPPYENP---PPEYQPPH-EKP---PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
           P +  P  E P   PP Y PP  EKP   PP Y+PP  ++P   PP    P  EKP  E 
Sbjct: 113 PVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPRPPVYTPPKKEKP--EP 170

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPE-- 333
            PP Y+PP +  PP ++P   KPP   +PP+ + P E  PP Y PP + P +E  PP+  
Sbjct: 171 KPPVYEPPKK--PPMYEPKPPKPP-VYTPPKKEKP-EPKPPMYEPPKKPPMYEPKPPKPP 226

Query: 334 -YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPK---FQPPNEKPPHEKSP 471
            Y PP ++ P   P P YQPP+  P +E  PPK   + PP E+ P  K P
Sbjct: 227 VYTPPKKEKPEPKP-PMYQPPNNPPIYEPKPPKPPVYAPPKEEKPKPKPP 275

 Score =  108 bits (271), Expect = 1e-22
 Identities = 64/178 (35%), Positives = 86/178 (48%), Gaps = 22/178 (12%)
 Frame = +1

Query: 7   HAKPPYENPP-PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPP 183
           +  P Y  PP P ++PP  KPPP Y+P          PP Y+PP ++ P E  PP Y PP
Sbjct: 25  YESPNYGKPPTPVFKPPKVKPPP-YEPK---------PPVYEPPKKEKP-EPKPPVYAPP 73

Query: 184 ----HEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP---PPEYNP 342
               H   PP ++PP ++ P  K PP Y PP +  P    P +E P  E P   PP Y P
Sbjct: 74  KKEKHGPKPPMYEPPKKEKPEPK-PPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTP 132

Query: 343 PHEKPPHEHPSPEYQPPHQKPPHENP--------------PPKFQPPNEKPPHEKSPP 474
           P ++ P   P P Y+PP ++ P   P              PP ++PP + P +E  PP
Sbjct: 133 PKKEKPEPKP-PVYEPPKKEKPEPRPPVYTPPKKEKPEPKPPVYEPPKKPPMYEPKPP 189

 Score =  108 bits (271), Expect = 1e-22
 Identities = 72/186 (38%), Positives = 91/186 (48%), Gaps = 29/186 (15%)
 Frame = +1

Query: 1   PHHAKPPYENP---PPEYQPPH-EKP---PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
           P +  P  E P   PP Y+PP  EKP   PP Y PP  ++P   PP  Y+PP ++ P E 
Sbjct: 98  PVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPV-YEPPKKEKP-EP 155

Query: 160 SPPGYQPPH----EIPPPEHQPPHEKP---PHAKSPPEYQPPH----EHPPPEYLPPHEK 306
            PP Y PP     E  PP ++PP + P   P    PP Y PP     E  PP Y PP + 
Sbjct: 156 RPPVYTPPKKEKPEPKPPVYEPPKKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPPKKP 215

Query: 307 PPHENPPPE---YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPK--------FQPPNEKP 453
           P +E  PP+   Y PP ++ P   P P YQPP+  P +E  PPK         + P  KP
Sbjct: 216 PMYEPKPPKPPVYTPPKKEKPEPKP-PMYQPPNNPPIYEPKPPKPPVYAPPKEEKPKPKP 274

Query: 454 PHEKSP 471
           P   +P
Sbjct: 275 PVYDAP 280

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 53/133 (39%), Positives = 64/133 (48%), Gaps = 14/133 (10%)
 Frame = +1

Query: 1   PHHAKPPYENP--PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPG- 171
           P    P YE P  PP Y+P   KPP  Y PP  ++P   PP  Y+PP + P +E  PP  
Sbjct: 168 PEPKPPVYEPPKKPPMYEPKPPKPPV-YTPPKKEKPEPKPP-MYEPPKKPPMYEPKPPKP 225

Query: 172 --YQPPH----EIPPPEHQPPHEKP---PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP 324
             Y PP     E  PP +QPP+  P   P    PP Y PP E  P    P ++ P HE P
Sbjct: 226 PVYTPPKKEKPEPKPPMYQPPNNPPIYEPKPPKPPVYAPPKEEKPKPKPPVYDAPAHEPP 285

Query: 325 PPEY--NPPHEKP 357
              Y  +PP  KP
Sbjct: 286 YGHYPGHPPLGKP 298

[83][TOP]
>UniRef100_C1PGW2 Tracheary element differentiation-related 7B n=1 Tax=Zinnia
           violacea RepID=C1PGW2_ZINEL
          Length = 283

 Score =  119 bits (299), Expect = 8e-26
 Identities = 72/166 (43%), Positives = 77/166 (46%), Gaps = 8/166 (4%)
 Frame = +1

Query: 1   PHHAKP-PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           PH   P P   PPP    P   PP    PP    PH  PPP   PPH  PP  H  P   
Sbjct: 11  PHFPPPSPAATPPPAPTTPSTPPPHFISPP----PHSVPPPS--PPHSVPPPLHPVPPPL 64

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
           PPH +PPP H  P   PPH  SP    PPH  PPP    P   PPH  PPP  +PPH   
Sbjct: 65  PPHSVPPPSHTVPPPSPPHPVSP----PPHTVPPPSPPHPVSPPPHTVPPP--SPPHHVS 118

Query: 358 PHEH----PSPEYQPPHQKPPHENPP---PKFQPPNEKPPHEKSPP 474
           P  H    PSP + PP   PP+  PP   P F PP   PP+   PP
Sbjct: 119 PPPHTVPPPSPHFVPP---PPNTVPPPPAPHFVPP-PPPPYIIPPP 160

 Score =  117 bits (294), Expect = 3e-25
 Identities = 67/160 (41%), Positives = 73/160 (45%), Gaps = 4/160 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEY--QPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY 174
           P  A      PPP +   PPH  PPP   PPH   P ++P P   PPH  PP  H+ P  
Sbjct: 22  PPPAPTTPSTPPPHFISPPPHSVPPPS--PPHSVPPPLHPVPPPLPPHSVPPPSHTVPPP 79

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHE--KPPHENPPPEYNPPH 348
            PPH + PP H  P   PPH  SPP    PH  PPP   PPH    PPH  PPP    PH
Sbjct: 80  SPPHPVSPPPHTVPPPSPPHPVSPP----PHTVPPPS--PPHHVSPPPHTVPPPS---PH 130

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKS 468
             PP  +  P    PH  PP   PPP   PP    P   S
Sbjct: 131 FVPPPPNTVPPPPAPHFVPP--PPPPYIIPPPPPSPSNHS 168

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 54/137 (39%), Positives = 59/137 (43%)
 Frame = +1

Query: 70  PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPP 249
           P + PP    P   PPP    P   PPH  SPP    PH +PPP   PPH  PP     P
Sbjct: 11  PHFPPP---SPAATPPPAPTTPSTPPPHFISPP----PHSVPPPS--PPHSVPPPLHPVP 61

Query: 250 EYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPK 429
              PPH  PPP +  P   PPH   PP +  P   PPH         P   PPH  PPP 
Sbjct: 62  PPLPPHSVPPPSHTVPPPSPPHPVSPPPHTVPPPSPPH---------PVSPPPHTVPPPS 112

Query: 430 FQPPNEKPPHEKSPPAS 480
             P +  PP    PP S
Sbjct: 113 -PPHHVSPPPHTVPPPS 128

[84][TOP]
>UniRef100_Q0CQD0 Predicted protein n=1 Tax=Aspergillus terreus NIH2624
           RepID=Q0CQD0_ASPTN
          Length = 313

 Score =  119 bits (299), Expect = 8e-26
 Identities = 69/162 (42%), Positives = 73/162 (45%), Gaps = 9/162 (5%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPH-GKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEI 192
           PP   PPP   PP   PPP   PP  G  P   PPP + PP   PP    PP   PPH  
Sbjct: 135 PPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPP-VPPPHPP 193

Query: 193 P--PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN-----PPHE 351
           P  P    PP  + P A  P E  PP + PPP    P   PP E PPP        PP E
Sbjct: 194 PAEPAPPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPPPAPPVE 253

Query: 352 KPPHEH-PSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            PP  H P P   PPH  PP E PPP   PP   PP  + PP
Sbjct: 254 GPPPPHSPPPHGPPPHFPPPAEGPPPPHGPPPHSPPPSEGPP 295

 Score =  118 bits (295), Expect = 2e-25
 Identities = 69/162 (42%), Positives = 75/162 (46%), Gaps = 2/162 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP--PQYQPPHEKPPHEHSPPGY 174
           P    PP   PPP   PP   PPP   PP    P V PP  P  +P    PP    PP  
Sbjct: 152 PPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPA- 210

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
            PP E PPP   PP   PPH+   P   PP E PPP    P   PP E PPP ++PP   
Sbjct: 211 PPPVEGPPPPKGPP--PPPHSPPGP---PPAEGPPPPAKVPPPAPPVEGPPPPHSPPPHG 265

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
           PP   P P   PP   PPH  PPP   PP+E PP    P +S
Sbjct: 266 PPPHFPPPAEGPP---PPH-GPPPHSPPPSEGPPPPHGPSSS 303

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 57/170 (33%), Positives = 58/170 (34%), Gaps = 39/170 (22%)
 Frame = +1

Query: 82  PPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQ----------PPHEKPP 231
           P H  +    PPP   P     P    PP   PP   PPP             PPH  PP
Sbjct: 117 PVHHHRGRFMPPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPP 176

Query: 232 HAKSP---PEYQPPH-------EHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSP- 378
               P   P   PPH         PPP    P   PP E PPP   PP   PPH  P P 
Sbjct: 177 AGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPPKGPP--PPPHSPPGPP 234

Query: 379 ------------------EYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
                             E  PP   PP   PPP F PP E PP    PP
Sbjct: 235 PAEGPPPPAKVPPPAPPVEGPPPPHSPPPHGPPPHFPPPAEGPPPPHGPP 284

[85][TOP]
>UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B501E
          Length = 406

 Score =  119 bits (298), Expect = 1e-25
 Identities = 68/156 (43%), Positives = 71/156 (45%)
 Frame = +1

Query: 10  AKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           A P Y  PPP Y PP   PPP Y PP     +  PPP    P   PP    PP Y PP  
Sbjct: 77  APPAYAPPPPVYAPP--PPPPAYAPPPPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPP-- 132

Query: 190 IPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEH 369
            PPP + PP   PP    PP Y PP   PPP Y PP   PP   PPP Y PP   PP   
Sbjct: 133 -PPPAYGPP-PPPPPPPPPPAYGPP---PPPAYGPP-PPPPPPPPPPAYGPP--PPPAYG 184

Query: 370 PSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           P P   PP   P +  PPP    P   PP    PPA
Sbjct: 185 PPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPA 220

 Score =  115 bits (287), Expect = 2e-24
 Identities = 72/166 (43%), Positives = 75/166 (45%), Gaps = 7/166 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQP-------PHEKPPHEH 159
           P +A PP   PPP Y PP   PPP Y PP    P   PPP Y P       P   PP   
Sbjct: 95  PAYAPPP---PPPAYAPP---PPPAYAPPPPPPPPP-PPPSYGPPPPPAYGPPPPPPPPP 147

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN 339
            PP Y PP   PPP + PP   PP    PP Y PP   PPP Y PP   PP   PPP Y 
Sbjct: 148 PPPAYGPP---PPPAYGPP-PPPPPPPPPPAYGPP---PPPAYGPP-PPPPPPPPPPAYG 199

Query: 340 PPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           PP   PP   P P   PP   P +  PPP    P   PP    PPA
Sbjct: 200 PP--PPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPA 243

 Score =  112 bits (281), Expect = 1e-23
 Identities = 70/160 (43%), Positives = 73/160 (45%), Gaps = 7/160 (4%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQP-------PHEKPPHEHSPPGY 174
           PP   PPP Y PP   PPP Y PP    P   PPP Y P       P   PP    PP Y
Sbjct: 120 PPPPPPPPSYGPP---PPPAYGPPPPPPPPP-PPPAYGPPPPPAYGPPPPPPPPPPPPAY 175

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
            PP   PPP + PP   PP    PP Y PP   PPP Y PP   PP   PPP Y PP   
Sbjct: 176 GPP---PPPAYGPP-PPPPPPPPPPAYGPP---PPPAYGPP-PPPPPPPPPPAYGPP--- 224

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP  +  P   PP   PP  +PPP   PP   PP    PP
Sbjct: 225 PPPAYGPPPPPPPPPPPPAYSPPP--PPPPPPPPAAYGPP 262

 Score =  112 bits (279), Expect = 2e-23
 Identities = 69/159 (43%), Positives = 73/159 (45%), Gaps = 6/159 (3%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP   PPP Y PP   PPP Y PP    P   PPP Y PP   PP    P  Y PP   P
Sbjct: 212 PPPPPPPPAYGPP---PPPAYGPPPPPPPPP-PPPAYSPPPPPPPPP-PPAAYGPP---P 263

Query: 196 PPEHQPPHEKPP------HAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
           PP + PP   PP      +A  PP   PP   PPP Y PP   PP   PPP   PP   P
Sbjct: 264 PPAYGPPPPPPPPPPPAAYAYGPPP-PPPPPPPPPAYSPP--PPPAYGPPPPPPPPAYAP 320

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   P P Y PP   PP   PPP + PP   P +   PP
Sbjct: 321 P---PPPAYGPPAPPPPPP-PPPAYAPPPPPPAYAPPPP 355

 Score =  111 bits (278), Expect = 2e-23
 Identities = 72/173 (41%), Positives = 75/173 (43%), Gaps = 20/173 (11%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQP-------PHEKPPHEHSPPGY 174
           PP   PPP Y PP   PPP Y PP    P   PPP Y P       P   PP    PP Y
Sbjct: 143 PPPPPPPPAYGPP---PPPAYGPPPPPPPPP-PPPAYGPPPPPAYGPPPPPPPPPPPPAY 198

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
            PP   PPP + PP   PP    PP Y PP   PPP Y PP   PP   PPP Y+PP   
Sbjct: 199 GPP---PPPAYGPP-PPPPPPPPPPAYGPP---PPPAYGPP-PPPPPPPPPPAYSPPPPP 250

Query: 355 PPHEHPS-------PEYQPPHQKPPHENP------PPKFQPPNEKPPHEKSPP 474
           PP   P+       P Y PP   PP   P      PP   PP   PP    PP
Sbjct: 251 PPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPP 303

 Score =  110 bits (275), Expect = 5e-23
 Identities = 68/160 (42%), Positives = 72/160 (45%), Gaps = 7/160 (4%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP   PPP Y PP   PPP Y PP    P   PPP Y PP   PP  + PP   PP   P
Sbjct: 166 PPPPPPPPAYGPP---PPPAYGPP-PPPPPPPPPPAYGPP---PPPAYGPPP-PPPPPPP 217

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPP-------HENPPPEYNPPHEK 354
           PP + PP   PP A  PP   PP   PPP Y PP   PP          PPP Y PP   
Sbjct: 218 PPAYGPP---PPPAYGPPP-PPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPP 273

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP   P+     P   PP   PPP + PP   PP    PP
Sbjct: 274 PPPPPPAAYAYGPPPPPPPPPPPPAYSPP---PPPAYGPP 310

 Score =  109 bits (272), Expect = 1e-22
 Identities = 65/158 (41%), Positives = 70/158 (44%), Gaps = 6/158 (3%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP----GYQPP 183
           PP   PPP Y PP   PPP   PP    P   PPP Y PP   PP    PP     Y PP
Sbjct: 235 PPPPPPPPAYSPPPPPPPP--PPPAAYGP--PPPPAYGPPPPPPP---PPPPAAYAYGPP 287

Query: 184 HEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPH 363
              PPP   P +  PP    PP Y PP   PPP Y PP        PPP Y PP   PP 
Sbjct: 288 PPPPPPPPPPAYSPPP----PPAYGPPPPPPPPAYAPP--------PPPAYGPP-APPPP 334

Query: 364 EHPSPEYQPPHQKPPH--ENPPPKFQPPNEKPPHEKSP 471
             P P Y PP   P +    PPP + PP   P +  +P
Sbjct: 335 PPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPKYSPAP 372

 Score =  106 bits (264), Expect = 9e-22
 Identities = 69/165 (41%), Positives = 72/165 (43%), Gaps = 11/165 (6%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPH-EHSPPGYQPPHEI 192
           PP   PPP   PP   PPP Y PP    P   PPP   PP   P +    PP Y PP   
Sbjct: 180 PPAYGPPPP--PPPPPPPPAYGPP--PPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPP 235

Query: 193 PPPEHQPPHEKPPHAKSPP---EYQPPHEHPPPEYLPPHEKPPHENPPP----EYNPPHE 351
           PPP   P +  PP    PP    Y PP   PPP Y PP   PP   PPP     Y PP  
Sbjct: 236 PPPPPPPAYSPPPPPPPPPPPAAYGPP---PPPAYGPPPPPPP---PPPPAAYAYGPP-P 288

Query: 352 KPPHEHPSPEYQPPHQK---PPHENPPPKFQPPNEKPPHEKSPPA 477
            PP   P P Y PP      PP   PPP + PP   PP    PPA
Sbjct: 289 PPPPPPPPPAYSPPPPPAYGPPPPPPPPAYAPP---PPPAYGPPA 330

 Score =  104 bits (260), Expect = 3e-21
 Identities = 66/153 (43%), Positives = 69/153 (45%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPP 198
           P +  PP Y PP    PP Y PP        PPP Y PP   PP    PP Y PP   PP
Sbjct: 73  PGKPAPPAYAPP----PPVYAPPP-------PPPAYAPP---PP----PPAYAPP---PP 111

Query: 199 PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSP 378
           P + PP   PP    PP Y PP   PPP Y PP   PP   PPP Y PP   PP   P P
Sbjct: 112 PAYAPP-PPPPPPPPPPSYGPP---PPPAYGPP-PPPPPPPPPPAYGPP--PPPAYGPPP 164

Query: 379 EYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              PP   P +  PPP    P   PP    PPA
Sbjct: 165 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPA 197

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 58/137 (42%), Positives = 62/137 (45%), Gaps = 4/137 (2%)
 Frame = +1

Query: 31  PPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQ 210
           PPP Y PP   PPP     +   P   PPP   PP   PP    PP Y PP   PPP + 
Sbjct: 263 PPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPP---PPPAYGPPPPPPPPAYA 319

Query: 211 PPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH--ENPPPEYNPPHEKPPHEHPSP-- 378
           PP   PP A  PP   PP   PPP Y PP   P +    PPP Y PP   PP   P+P  
Sbjct: 320 PP---PPPAYGPPA-PPPPPPPPPAYAPPPPPPAYAPPPPPPAYAPP-PPPPKYSPAPIV 374

Query: 379 EYQPPHQKPPHENPPPK 429
            Y PP   PP   P  K
Sbjct: 375 VYGPPAPPPPPPAPKRK 391

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 66/171 (38%), Positives = 74/171 (43%), Gaps = 14/171 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPPPE---YQPP----HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
           P ++ PP   PPP    Y PP    +  PPP   PP        PPP   PP   PP   
Sbjct: 242 PAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPP---PPPPPPP--- 295

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN 339
            PP Y PP   PPP + PP   PP A +PP        PPP Y PP   PP   PPP Y 
Sbjct: 296 -PPAYSPP---PPPAYGPPPPPPPPAYAPP--------PPPAYGPP-APPPPPPPPPAYA 342

Query: 340 PPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQP-------PNEKPPHEKSP 471
           PP   P +  P P   PP   PP   PPPK+ P       P   PP   +P
Sbjct: 343 PPPPPPAYAPPPP---PPAYAPP--PPPPKYSPAPIVVYGPPAPPPPPPAP 388

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 57/149 (38%), Positives = 62/149 (41%), Gaps = 2/149 (1%)
 Frame = +1

Query: 37  PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE--KPPHEHSPPGYQPPHEIPPPEHQ 210
           P Y P +   P    PP        PPP Y    E    P + +PP Y PP  +  P   
Sbjct: 42  PAYSPVYAVVPAPQPPP--------PPPAYDDCDEIVLVPGKPAPPAYAPPPPVYAPPPP 93

Query: 211 PPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQP 390
           PP   PP    PP Y PP   PPP Y PP   PP   PPP Y PP   PP   P P   P
Sbjct: 94  PPAYAPP--PPPPAYAPP---PPPAYAPPPPPPPPP-PPPSYGPP--PPPAYGPPPPPPP 145

Query: 391 PHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           P   P +  PPP    P   PP    PPA
Sbjct: 146 PPPPPAYGPPPPPAYGPPPPPPPPPPPPA 174

[86][TOP]
>UniRef100_Q39686 Proline-rich protein n=1 Tax=Daucus carota RepID=Q39686_DAUCA
          Length = 235

 Score =  119 bits (298), Expect = 1e-25
 Identities = 69/175 (39%), Positives = 85/175 (48%), Gaps = 19/175 (10%)
 Frame = +1

Query: 7   HAKPPYENPP----PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY 174
           H+ PP   PP    P ++PP  KPP    P H  +P ++ PP Y PP  KPP  H PP Y
Sbjct: 21  HSHPPIHKPPVYTPPVHKPPIHKPPVYTSPVH--KPPIHKPPVYTPPVHKPPI-HKPPVY 77

Query: 175 QPPHEIPPPEHQPPHEK---------PPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPP 327
            PP   PP E++PP E          P H   PP Y+PP + P PE+ PP  KPP   PP
Sbjct: 78  TPPVHKPPSEYKPPVEATNSVTEDHYPIH--KPPVYKPPVQKPAPEHKPPVHKPPIHKPP 135

Query: 328 PEYNPP-----HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNE-KPPHEKSPP 474
               P      +   P   P P ++PP  KPP E+ PP  +P  E KP     PP
Sbjct: 136 VHNTPSVTDDHYPAHPIHKPQPIHRPPVHKPPTEHKPPVHEPATEHKPSPVYQPP 190

 Score =  114 bits (285), Expect = 3e-24
 Identities = 66/176 (37%), Positives = 85/176 (48%), Gaps = 18/176 (10%)
 Frame = +1

Query: 1   PHHAKPPYENP--------PPEYQPPHEKPPPEYQPP-----HGKQPH--VNPPPQYQPP 135
           P H  P Y  P        PP Y PP  KPP EY+PP        + H  ++ PP Y+PP
Sbjct: 55  PIHKPPVYTPPVHKPPIHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHYPIHKPPVYKPP 114

Query: 136 HEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHE-KPP 312
            +KP  EH PP ++PP    PP H  P     H  + P ++P   H PP + PP E KPP
Sbjct: 115 VQKPAPEHKPPVHKPPIH-KPPVHNTPSVTDDHYPAHPIHKPQPIHRPPVHKPPTEHKPP 173

Query: 313 HENPPPEY--NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P  E+  +P ++ P  E P PE++PPH  P    PPP  +P      H   PP
Sbjct: 174 VHEPATEHKPSPVYQPPKTEKPVPEHKPPHLPPIVVRPPPTHKPNPPYGHHPGHPP 229

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 50/131 (38%), Positives = 62/131 (47%), Gaps = 12/131 (9%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGK----------QPHVNPPPQYQPPHEKPPHEHS 162
           KPP + P PE++PP  KPP    P H             P   P P ++PP  KPP EH 
Sbjct: 112 KPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHRPPVHKPPTEHK 171

Query: 163 PPGYQPPHEIPP-PEHQPPH-EKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY 336
           PP ++P  E  P P +QPP  EKP     PP   P    PPP + P        NPP  +
Sbjct: 172 PPVHEPATEHKPSPVYQPPKTEKPVPEHKPPHLPPIVVRPPPTHKP--------NPPYGH 223

Query: 337 NPPHEKPPHEH 369
           +P H  PP E+
Sbjct: 224 HPGH--PPVEN 232

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 35/80 (43%), Positives = 40/80 (50%), Gaps = 4/80 (5%)
 Frame = +1

Query: 247 PEYQPPHEHP----PPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHE 414
           P     H HP    PP Y PP  KPP   PP   +P H+ P H+   P Y PP  KPP  
Sbjct: 15  PSLADSHSHPPIHKPPVYTPPVHKPPIHKPPVYTSPVHKPPIHK--PPVYTPPVHKPP-I 71

Query: 415 NPPPKFQPPNEKPPHEKSPP 474
           + PP + PP  KPP E  PP
Sbjct: 72  HKPPVYTPPVHKPPSEYKPP 91

[87][TOP]
>UniRef100_P13983 Extensin n=1 Tax=Nicotiana tabacum RepID=EXTN_TOBAC
          Length = 620

 Score =  119 bits (298), Expect = 1e-25
 Identities = 70/174 (40%), Positives = 82/174 (47%), Gaps = 18/174 (10%)
 Frame = +1

Query: 7   HAKPPYENPPPEYQP---------PHEKP-PPEYQPP-----HGKQP---HVNPPPQYQP 132
           HA P + + PP +QP         P  +P PP Y PP        QP   +  PPP Y P
Sbjct: 232 HAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPTYSPPPPAYAQSPQPSPTYSPPPPTYSP 291

Query: 133 PHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPP 312
           P   P +   PP Y P    PPP   P    PP A SPP   P +  PPP YLP    P 
Sbjct: 292 PPPSPIYSPPPPAYSPS---PPPTPTPTFSPPPPAYSPP---PTYSPPPPTYLPLPSSPI 345

Query: 313 HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           +  PPP Y+PP   P +  P P Y PP   PP   PPP F PP   P +E+SPP
Sbjct: 346 YSPPPPVYSPP-PPPSYSPPPPTYLPP--PPPSSPPPPSFSPP--PPTYEQSPP 394

 Score =  117 bits (294), Expect = 3e-25
 Identities = 67/173 (38%), Positives = 79/173 (45%), Gaps = 20/173 (11%)
 Frame = +1

Query: 16  PPYENPPPEY------QPPHEKPPPEYQPPHGKQPHVNPPPQYQP---PHEKPPHEHSPP 168
           P Y  PPP Y       P +  PPP Y PP     +  PPP Y P   P   P     PP
Sbjct: 263 PTYSPPPPAYAQSPQPSPTYSPPPPTYSPPPPSPIYSPPPPAYSPSPPPTPTPTFSPPPP 322

Query: 169 GYQPP--HEIPPPEHQPPHEKPPHAKSPPEYQPP----HEHPPPEYLPPHEKPPHENPPP 330
            Y PP  +  PPP + P    P ++  PP Y PP    +  PPP YLPP   PP   PPP
Sbjct: 323 AYSPPPTYSPPPPTYLPLPSSPIYSPPPPVYSPPPPPSYSPPPPTYLPP--PPPSSPPPP 380

Query: 331 EYNPP----HEKPPHEHPSPEYQPPHQKPP-HENPPPKFQPPNEKPPHEKSPP 474
            ++PP     + PP   P P Y PP   PP +  PPP + PP   PP    PP
Sbjct: 381 SFSPPPPTYEQSPP---PPPAYSPPLPAPPTYSPPPPTYSPP---PPTYAQPP 427

 Score =  117 bits (292), Expect = 5e-25
 Identities = 66/159 (41%), Positives = 75/159 (47%), Gaps = 6/159 (3%)
 Frame = +1

Query: 16  PPYENPPPEY---QPPHEKPPPEYQPPHGK-QPHVNPPPQYQPPHEKPP-HEHSPPGYQP 180
           P Y  PPP Y    PP   PPP + PP    +    PPP Y PP   PP +   PP Y P
Sbjct: 359 PSYSPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPPTYSPPPPTYSP 418

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY-NPPHEKP 357
           P   PP   QPP   P ++  PP Y PP   PPP Y PP   P +  PPP Y  PP   P
Sbjct: 419 P---PPTYAQPPPLPPTYSPPPPAYSPP---PPPTYSPP--PPTYSPPPPAYAQPPPPPP 470

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            +  P P Y PP   P +  PPP+ QP    PP    PP
Sbjct: 471 TYSPPPPAYSPPPPSPIYSPPPPQVQP---LPPTFSPPP 506

 Score =  116 bits (290), Expect = 9e-25
 Identities = 67/172 (38%), Positives = 79/172 (45%), Gaps = 14/172 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPP----HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P  + P Y  PPP Y PP    +  PPP Y PP    P   PPP + PP   P +E SPP
Sbjct: 339 PLPSSPIYSPPPPVYSPPPPPSYSPPPPTYLPP--PPPSSPPPPSFSPP--PPTYEQSPP 394

Query: 169 ---GYQPP------HEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHEN 321
               Y PP      +  PPP + PP   PP    PP   P +  PPP Y PP        
Sbjct: 395 PPPAYSPPLPAPPTYSPPPPTYSPP---PPTYAQPPPLPPTYSPPPPAYSPP-------- 443

Query: 322 PPPEYNPPHEKPPHEHPSPEY-QPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PPP Y+PP   P +  P P Y QPP   P +  PPP + PP   P +   PP
Sbjct: 444 PPPTYSPP--PPTYSPPPPAYAQPPPPPPTYSPPPPAYSPPPPSPIYSPPPP 493

 Score =  114 bits (285), Expect = 3e-24
 Identities = 70/173 (40%), Positives = 83/173 (47%), Gaps = 15/173 (8%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPP--HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY 174
           P    P +  PPP Y PP  +  PPP Y P      +  PPP Y PP   PP  +SPP  
Sbjct: 310 PPTPTPTFSPPPPAYSPPPTYSPPPPTYLPLPSSPIYSPPPPVYSPP---PPPSYSPP-- 364

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPP----EYQPPHEHPPPEYLPPHEKPP-HENPPPEYN 339
            PP  +PPP   PP   PP + SPP    E  PP   PPP Y PP   PP +  PPP Y+
Sbjct: 365 -PPTYLPPP---PPSSPPPPSFSPPPPTYEQSPP---PPPAYSPPLPAPPTYSPPPPTYS 417

Query: 340 PP---HEKPP-----HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP   + +PP     +  P P Y PP   P +  PPP + PP   PP    PP
Sbjct: 418 PPPPTYAQPPPLPPTYSPPPPAYSPP-PPPTYSPPPPTYSPP---PPAYAQPP 466

 Score =  110 bits (274), Expect = 6e-23
 Identities = 68/182 (37%), Positives = 80/182 (43%), Gaps = 25/182 (13%)
 Frame = +1

Query: 4   HHAKPPYENPPPE--YQP-PHEKPPPEYQPPHGKQPHVNPPP-------QYQPP---HEK 144
           H   P Y  PPP   Y P P  +PPP Y PP     HV P P       Q QPP   H  
Sbjct: 177 HPPPPTYAQPPPTPIYSPSPQVQPPPTYSPP--PPTHVQPTPSPPSRGHQPQPPTHRHAP 234

Query: 145 PPHEHSPPGYQPP---HEIPPPEHQPPHEKPPHAKSPPEY------QPPHEHPPPEYLPP 297
           P H H+PP +QP    H  P P  QP  + P ++  PP Y       P +  PPP Y PP
Sbjct: 235 PTHRHAPPTHQPSPLRHLPPSPRRQP--QPPTYSPPPPAYAQSPQPSPTYSPPPPTYSPP 292

Query: 298 HEKPPHENPPPEYN---PPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKS 468
              P +  PPP Y+   PP   P    P P Y PP   P +  PPP + P    P +   
Sbjct: 293 PPSPIYSPPPPAYSPSPPPTPTPTFSPPPPAYSPP---PTYSPPPPTYLPLPSSPIYSPP 349

Query: 469 PP 474
           PP
Sbjct: 350 PP 351

 Score =  108 bits (269), Expect = 2e-22
 Identities = 63/175 (36%), Positives = 75/175 (42%), Gaps = 22/175 (12%)
 Frame = +1

Query: 16  PPYEN---PPPEYQPP------HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P YE    PPP Y PP      +  PPP Y PP        PP   QPP   P +   PP
Sbjct: 387 PTYEQSPPPPPAYSPPLPAPPTYSPPPPTYSPP--------PPTYAQPPPLPPTYSPPPP 438

Query: 169 GYQPP----HEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPE- 333
            Y PP    +  PPP + PP   PP    PP   P +  PPP Y PP   P +  PPP+ 
Sbjct: 439 AYSPPPPPTYSPPPPTYSPP---PPAYAQPPPPPPTYSPPPPAYSPPPPSPIYSPPPPQV 495

Query: 334 ------YNPPHEKPPHEHPSPEYQPPHQKPPHENP--PPKFQPPNEKPPHEKSPP 474
                 ++PP  +  H  P P  QP    P +  P  PP F PP  +  H   PP
Sbjct: 496 QPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQPPSPPTFSPPPPRQIHSPPPP 550

 Score =  107 bits (266), Expect = 5e-22
 Identities = 67/185 (36%), Positives = 83/185 (44%), Gaps = 27/185 (14%)
 Frame = +1

Query: 1   PHHAKPP--YENPPPEY-QPP-----HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE 156
           P ++ PP  Y  PPP Y QPP     +  PPP Y PP     +  PPP Y PP   PP  
Sbjct: 407 PTYSPPPPTYSPPPPTYAQPPPLPPTYSPPPPAYSPP-PPPTYSPPPPTYSPP---PPAY 462

Query: 157 HSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQ--PPHEHPPPE---YLPPHEKPPHEN 321
             PP   P +  PPP + PP   P ++  PP+ Q  PP   PPP    +LPP   PPH  
Sbjct: 463 AQPPPPPPTYSPPPPAYSPPPPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPP---PPHRQ 519

Query: 322 P------------PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP--PPKFQPPNEKPPH 459
           P            PP ++PP  +  H  P P +QP    P +  P  PP F  P  +  H
Sbjct: 520 PRPPTPTYGQPPSPPTFSPPPPRQIHSPPPPHWQPRTPTPTYGQPPSPPTFSAPPPRQIH 579

Query: 460 EKSPP 474
              PP
Sbjct: 580 SPPPP 584

 Score =  101 bits (252), Expect = 2e-20
 Identities = 73/196 (37%), Positives = 86/196 (43%), Gaps = 37/196 (18%)
 Frame = +1

Query: 1   PHHAKPP-----YENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQY-QPPHEKPPHEHS 162
           P +A+PP     Y  PPP Y PP   PPP Y PP     +  PPP Y QPP   P +   
Sbjct: 421 PTYAQPPPLPPTYSPPPPAYSPP---PPPTYSPP--PPTYSPPPPAYAQPPPPPPTYSPP 475

Query: 163 PPGYQPP-----HEIPPPEHQP--PHEKPP-----HAKSPPEYQPPHEHP-------PPE 285
           PP Y PP     +  PPP+ QP  P   PP     H   PP  QP    P       PP 
Sbjct: 476 PPAYSPPPPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQPPSPPT 535

Query: 286 YLPPHEKPPHENPPPEYNPPHEKPPH-EHPSP---EYQPPHQ----KPPHENPPPKF--- 432
           + PP  +  H  PPP + P    P + + PSP      PP Q     PPH  P P     
Sbjct: 536 FSPPPPRQIHSPPPPHWQPRTPTPTYGQPPSPPTFSAPPPRQIHSPPPPHRQPRPPTPTY 595

Query: 433 -QPPNEKPPHEKSPPA 477
            QPP+  PP   SPP+
Sbjct: 596 GQPPS--PPTTYSPPS 609

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 66/212 (31%), Positives = 82/212 (38%), Gaps = 53/212 (25%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPH-----EKPPPEYQPPHGKQP----HVNPPPQYQPPHEKPP- 150
           P H  P Y  PPP + P H     ++PP    P HG  P    H  P  Q+ P H +P  
Sbjct: 115 PSHPPPSYGAPPPSHGPGHLPSHGQRPP---SPSHGHAPPSGGHTPPRGQHPPSHRRPSP 171

Query: 151 ---HEHSPPG----------------YQPP--HEIPPPEHQPPHEKPP----------HA 237
              H H PP                  QPP  +  PPP H  P   PP          H 
Sbjct: 172 PSRHGHPPPPTYAQPPPTPIYSPSPQVQPPPTYSPPPPTHVQPTPSPPSRGHQPQPPTHR 231

Query: 238 KSPPEYQ---PPHEHPPPEYLPPH-----EKPPHENPPPEY-NPPHEKPPHEHPSPEYQP 390
            +PP ++   P H+  P  +LPP      + P +  PPP Y   P   P +  P P Y P
Sbjct: 232 HAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPTYSPPPPAYAQSPQPSPTYSPPPPTYSP 291

Query: 391 PHQKPPHENPPPKFQ---PPNEKPPHEKSPPA 477
           P   P +  PPP +    PP   P     PPA
Sbjct: 292 PPPSPIYSPPPPAYSPSPPPTPTPTFSPPPPA 323

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 65/178 (36%), Positives = 79/178 (44%), Gaps = 27/178 (15%)
 Frame = +1

Query: 1   PHHAKPP--YENPPPEY-QPP-----HEKPPPEYQPPHGKQPHVNPPPQYQP--PHEKPP 150
           P ++ PP  Y  PPP Y QPP     +  PPP Y PP     +  PPPQ QP  P   PP
Sbjct: 446 PTYSPPPPTYSPPPPAYAQPPPPPPTYSPPPPAYSPPPPSPIYSPPPPQVQPLPPTFSPP 505

Query: 151 HE---HSPPGYQPPHEIP------------PPEHQPPHEKPPHAKSPPEYQPPHEHPPPE 285
                H PP   PPH  P            PP   PP  +  H+  PP +QP    P P 
Sbjct: 506 PPRRIHLPP---PPHRQPRPPTPTYGQPPSPPTFSPPPPRQIHSPPPPHWQP--RTPTPT 560

Query: 286 YLPPHEKPPHENPPPE--YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKP 453
           Y  P   P    PPP   ++PP   PPH  P P   P + +PP  +PP  + PP+  P
Sbjct: 561 YGQPPSPPTFSAPPPRQIHSPP---PPHRQPRPP-TPTYGQPP--SPPTTYSPPSPPP 612

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 64/195 (32%), Positives = 82/195 (42%), Gaps = 36/195 (18%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEY---------QPPHE-----------KPPPEYQPPHGKQPHVNPPP 120
           P HA P +  PPP +          PPH             P P   P H    +  PPP
Sbjct: 68  PRHAPPRHAYPPPSHGHLPPSVGGPPPHRGHLPPSRGFNPPPSPVISPSHPPPSYGAPPP 127

Query: 121 QYQPPH-----EKPP---HEHSPP--GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHE 270
            + P H     ++PP   H H+PP  G+ PP    PP H+ P     H   PP   P + 
Sbjct: 128 SHGPGHLPSHGQRPPSPSHGHAPPSGGHTPPRGQHPPSHRRPSPPSRHGHPPP---PTYA 184

Query: 271 HPPPEYLPPHEKPPHENPPPEYNPP---HEKPPHEHPSPEYQPPHQKPPHENPPP--KFQ 435
            PPP   P +   P   PPP Y+PP   H +P    PS  +QP  Q P H + PP  +  
Sbjct: 185 QPPPT--PIYSPSPQVQPPPTYSPPPPTHVQPTPSPPSRGHQP--QPPTHRHAPPTHRHA 240

Query: 436 PPNEKP-PHEKSPPA 477
           PP  +P P    PP+
Sbjct: 241 PPTHQPSPLRHLPPS 255

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 60/178 (33%), Positives = 74/178 (41%), Gaps = 30/178 (16%)
 Frame = +1

Query: 31  PPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPH----------EKPPHEHSPPGYQP 180
           P P + PP    PP   P HG   H+ P     PPH            PP     P + P
Sbjct: 66  PSPRHAPPRHAYPP---PSHG---HLPPSVGGPPPHRGHLPPSRGFNPPPSPVISPSHPP 119

Query: 181 P-HEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPP---------EYLPPHEKPP----HE 318
           P +  PPP H P H  P H + PP   P H H PP         ++ P H +P     H 
Sbjct: 120 PSYGAPPPSHGPGH-LPSHGQRPP--SPSHGHAPPSGGHTPPRGQHPPSHRRPSPPSRHG 176

Query: 319 NPPPEYNPPHEKPPHE---HPSPEYQPPHQKPPHENPPPKFQPPNEKPP---HEKSPP 474
           +PPP   P + +PP      PSP+ QPP   P +  PPP    P   PP   H+  PP
Sbjct: 177 HPPP---PTYAQPPPTPIYSPSPQVQPP---PTYSPPPPTHVQPTPSPPSRGHQPQPP 228

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 44/131 (33%), Positives = 51/131 (38%), Gaps = 6/131 (4%)
 Frame = +1

Query: 103 HVNPPPQYQPPHEK----PPHEHSPPGYQPPHE--IPPPEHQPPHEKPPHAKSPPEYQPP 264
           ++ PP   QPP       PP   S P   PP    +P P H PP     HA  PP     
Sbjct: 33  YLPPPVTSQPPPSSIGLSPP---SAPTTTPPSRGHVPSPRHAPPR----HAYPPPS---- 81

Query: 265 HEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPN 444
           H H PP    P     H  P   +NPP        PSP   P H  P +  PPP    P 
Sbjct: 82  HGHLPPSVGGPPPHRGHLPPSRGFNPP--------PSPVISPSHPPPSYGAPPPS-HGPG 132

Query: 445 EKPPHEKSPPA 477
             P H + PP+
Sbjct: 133 HLPSHGQRPPS 143

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 50/151 (33%), Positives = 60/151 (39%), Gaps = 15/151 (9%)
 Frame = +1

Query: 64  PPPEYQPPHGKQPHVNPPPQYQPPHEKPP---HEHSPPGYQPPHEIPPPEHQPPHEKPPH 234
           PPP    P      ++PP     P   PP   H  SP    P H  PPP H      PP 
Sbjct: 35  PPPVTSQPPPSSIGLSPP---SAPTTTPPSRGHVPSPRHAPPRHAYPPPSHG---HLPPS 88

Query: 235 AKSPPEYQ---PPHE--HPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPH- 396
              PP ++   PP    +PPP    P   P H  PPP Y      PP  H  P + P H 
Sbjct: 89  VGGPPPHRGHLPPSRGFNPPPS---PVISPSH--PPPSYGA----PPPSH-GPGHLPSHG 138

Query: 397 QKPP---HENPPPK---FQPPNEKPPHEKSP 471
           Q+PP   H + PP      P  + PP  + P
Sbjct: 139 QRPPSPSHGHAPPSGGHTPPRGQHPPSHRRP 169

[88][TOP]
>UniRef100_UPI0001983486 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983486
          Length = 195

 Score =  119 bits (297), Expect = 1e-25
 Identities = 75/175 (42%), Positives = 88/175 (50%), Gaps = 17/175 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP---G 171
           P H  PP+E PPPE++PP EKPPPE++PP         PPQ     EKP  EH PP   G
Sbjct: 25  PEH--PPFEKPPPEHKPPVEKPPPEHKPP-------TKPPQ----GEKPLPEHKPPTPIG 71

Query: 172 YQPPHEIPPPEHQP-PHEKPPHAKSP-PEYQPP--------HEHPPPEYLPPHE--KPPH 315
             P  E PPP H+P P EKPP  + P PE++PP         E P PE  PP    KPP 
Sbjct: 72  KPPKGEKPPPGHKPTPFEKPPKGEKPLPEHKPPTPVGKPPKGEKPLPENKPPTPVGKPPK 131

Query: 316 ENPPPEY--NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              PP Y  NP H  PP E+    Y+PP +  P   P  K   P +K P     P
Sbjct: 132 GEKPPHYGHNPGH--PPAENAEDSYKPPRKIKPPSTPAKKQPAPGKKLPTSPHKP 184

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 62/145 (42%), Positives = 74/145 (51%), Gaps = 18/145 (12%)
 Frame = +1

Query: 100 PHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP 279
           P   PPP+++PP EKPP EH PP   P  E P PEH+PP         PP+     E PP
Sbjct: 29  PFEKPPPEHKPPVEKPPPEHKPPTKPPQGEKPLPEHKPPTP----IGKPPK----GEKPP 80

Query: 280 PEYLP-PHEKPPH-ENPPPEYNPPHE--KPPH-EHPSPEYQPPHQ--KPPHENPPPKF-- 432
           P + P P EKPP  E P PE+ PP    KPP  E P PE +PP    KPP    PP +  
Sbjct: 81  PGHKPTPFEKPPKGEKPLPEHKPPTPVGKPPKGEKPLPENKPPTPVGKPPKGEKPPHYGH 140

Query: 433 ---QPPNE------KPPHEKSPPAS 480
               PP E      KPP +  PP++
Sbjct: 141 NPGHPPAENAEDSYKPPRKIKPPST 165

[89][TOP]
>UniRef100_UPI00006A19C0 UPI00006A19C0 related cluster n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI00006A19C0
          Length = 362

 Score =  119 bits (297), Expect = 1e-25
 Identities = 65/172 (37%), Positives = 79/172 (45%), Gaps = 13/172 (7%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQ-------PPHEKPPHEH 159
           P    PPY  PP E  PPH + P   Q P  + P +  PPQ Q       PP   PP E 
Sbjct: 189 PIETAPPYTAPPIETVPPHTQCPQLRQSPQKQCPQLRQPPQKQCPQLRQSPPKTVPPIET 248

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN 339
           +PP   PP E  PP H P    PP+   P E  PP+  PP E  PP    P+ + PP ++
Sbjct: 249 APPKTVPPIETVPPIHPPIETAPPYTVPPIETAPPYTVPPIETAPPIHSAPNRDSPPIHS 308

Query: 340 PPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPP------HEKSPPA 477
            P + PP+  P  E  PP+  PP E  PP   PP E P       H   PP+
Sbjct: 309 APRQPPPYTVPPIETAPPYTAPPIETAPPYTVPPIETPKPAIPVRHTALPPS 360

 Score =  111 bits (277), Expect = 3e-23
 Identities = 64/176 (36%), Positives = 76/176 (43%), Gaps = 18/176 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQP------HVNPPPQYQPPHEKPPHEHS 162
           P    PPY  PP E  PP+  PP E  PP+   P      H   P   Q P ++ P    
Sbjct: 167 PIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPIETVPPHTQCPQLRQSPQKQCPQLRQ 226

Query: 163 PPGYQ-------PPHEIPPPEHQPPHEKPPHAKSPP-----EYQPPHEHPPPEYLPPHEK 306
           PP  Q       PP  +PP E  PP   PP    PP     E  PP+  PP E  PP+  
Sbjct: 227 PPQKQCPQLRQSPPKTVPPIETAPPKTVPPIETVPPIHPPIETAPPYTVPPIETAPPYTV 286

Query: 307 PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP E  PP ++ P+   P  H +P   PP+  PP E  PP   PP E  P    PP
Sbjct: 287 PPIETAPPIHSAPNRDSPPIHSAPRQPPPYTVPPIETAPPYTAPPIETAPPYTVPP 342

 Score =  105 bits (261), Expect = 2e-21
 Identities = 66/185 (35%), Positives = 79/185 (42%), Gaps = 27/185 (14%)
 Frame = +1

Query: 1   PHHAKPPYENPP----------PEYQPPHEKPPPEYQPPHGKQPHVNP----------PP 120
           PH   PPY  PP          P+  PP   PP E  PP    P  +P          PP
Sbjct: 38  PHRKCPPYTVPPIETVPPIHSAPKQSPPFTVPPIETVPPIHSAPKQSPPFTVPPIETAPP 97

Query: 121 QYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPE------YQPPHEHPPP 282
              PP E  P  HS P   PP+ +PP E  PP + P   +SP +        PP+  PP 
Sbjct: 98  YTVPPIETVPPIHSAPKQSPPYTVPPIETVPPKQCPQLRQSPQKQCPQLRQSPPYTVPPI 157

Query: 283 EYLPPHEKPPHENPPPEYNPPHE-KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPH 459
           E  PP+  PP E  PP   PP E  PP+  P  E  PP+  PP E  PP  Q P  +   
Sbjct: 158 ETAPPYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPIETVPPHTQCPQLRQSP 217

Query: 460 EKSPP 474
           +K  P
Sbjct: 218 QKQCP 222

 Score =  101 bits (252), Expect = 2e-20
 Identities = 63/188 (33%), Positives = 80/188 (42%), Gaps = 30/188 (15%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQ----------PPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPP 150
           P    PP E  PP +           PP E  PP   PP    P ++  P+  PP+  PP
Sbjct: 64  PPFTVPPIETVPPIHSAPKQSPPFTVPPIETAPPYTVPPIETVPPIHSAPKQSPPYTVPP 123

Query: 151 HEHSPP-----------------GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP 279
            E  PP                    PP+ +PP E  PP+  PP   +PP   PP E  P
Sbjct: 124 IETVPPKQCPQLRQSPQKQCPQLRQSPPYTVPPIETAPPYTVPPIETAPPYTVPPIETAP 183

Query: 280 PEYLPPHE-KPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQ--PPNEK 450
           P   PP E  PP+  PP E  PPH + P    SP+ Q P  + P +   P+ +  PP   
Sbjct: 184 PYTAPPIETAPPYTAPPIETVPPHTQCPQLRQSPQKQCPQLRQPPQKQCPQLRQSPPKTV 243

Query: 451 PPHEKSPP 474
           PP E +PP
Sbjct: 244 PPIETAPP 251

 Score =  100 bits (249), Expect = 5e-20
 Identities = 65/190 (34%), Positives = 81/190 (42%), Gaps = 36/190 (18%)
 Frame = +1

Query: 10  AKPPYE--NPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE-----HSPP 168
           A P Y+  +  P +  PH K PP   PP    P ++  P+  PP   PP E     HS P
Sbjct: 22  ATPTYKIIHSAPIHNAPHRKCPPYTVPPIETVPPIHSAPKQSPPFTVPPIETVPPIHSAP 81

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSP-----PEYQPPHEHPPPEYLPP------------ 297
              PP  +PP E  PP+  PP    P     P+  PP+  PP E +PP            
Sbjct: 82  KQSPPFTVPPIETAPPYTVPPIETVPPIHSAPKQSPPYTVPPIETVPPKQCPQLRQSPQK 141

Query: 298 -----HEKPPHENPPPEYNPPHEKPPHEHPSP------EYQPPHQKPPHENPPPKFQPPN 444
                 + PP+  PP E  PP+  PP E   P      E  PP+  PP E  PP   PP 
Sbjct: 142 QCPQLRQSPPYTVPPIETAPPYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPI 201

Query: 445 EK-PPHEKSP 471
           E  PPH + P
Sbjct: 202 ETVPPHTQCP 211

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 61/166 (36%), Positives = 76/166 (45%), Gaps = 8/166 (4%)
 Frame = +1

Query: 1   PHHAKPPYEN-PPPEYQPPHEKPPPEYQPPHGK-QPHVNPPPQYQPPHEKPPHEHSPPGY 174
           PH   P   N   P Y+  H  P   +  PH K  P+  PP +  PP    P + SPP  
Sbjct: 11  PHTVLPKENNIATPTYKIIHSAPI--HNAPHRKCPPYTVPPIETVPPIHSAPKQ-SPPFT 67

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
            PP E  PP H  P + PP    P E  PP+  PP E +PP    P ++PP    P    
Sbjct: 68  VPPIETVPPIHSAPKQSPPFTVPPIETAPPYTVPPIETVPPIHSAPKQSPPYTVPPIETV 127

Query: 355 PPHEHP----SPEYQPP--HQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP + P    SP+ Q P   Q PP+  PP +  PP   PP E +PP
Sbjct: 128 PPKQCPQLRQSPQKQCPQLRQSPPYTVPPIETAPPYTVPPIETAPP 173

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 50/135 (37%), Positives = 64/135 (47%), Gaps = 2/135 (1%)
 Frame = +1

Query: 85  PHGKQPHVN--PPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQ 258
           PH   P  N    P Y+  H  P H ++P    PP+ +PP E  PP    P  +SPP   
Sbjct: 11  PHTVLPKENNIATPTYKIIHSAPIH-NAPHRKCPPYTVPPIETVPPIHSAPK-QSPPFTV 68

Query: 259 PPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQP 438
           PP E  PP +  P + PP   PP E  PP+  PP E   P +  P Q PP+  PP +  P
Sbjct: 69  PPIETVPPIHSAPKQSPPFTVPPIETAPPYTVPPIETVPPIHSAPKQSPPYTVPPIETVP 128

Query: 439 PNEKPPHEKSPPASC 483
           P + P   +SP   C
Sbjct: 129 PKQCPQLRQSPQKQC 143

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 35/96 (36%), Positives = 43/96 (44%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PPY  PP E  PP+  PP E  PP    P+ + PP +  P + PP+   P    P
Sbjct: 266 PIETAPPYTVPPIETAPPYTVPPIETAPPIHSAPNRDSPPIHSAPRQPPPYTVPPIETAP 325

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEY 288
           P+  PP E  PP+  PP     P     H   PP Y
Sbjct: 326 PYTAPPIETAPPYTVPPIETPKPAIPVRHTALPPSY 361

[90][TOP]
>UniRef100_A1YL95 Proline-rich protein n=1 Tax=Gossypium hirsutum RepID=A1YL95_GOSHI
          Length = 258

 Score =  119 bits (297), Expect = 1e-25
 Identities = 67/168 (39%), Positives = 89/168 (52%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYEN--PPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY 174
           P++ KPP     PP    PP+E  PP Y+PP  ++P   PP    P  EKP  +  PP Y
Sbjct: 27  PNYGKPPTPEFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKPGPK--PPVY 84

Query: 175 QPPH----EIPPPEHQPPHEKPPHAKSPPEYQPPH----EHPPPEYLPPHEKPPHENPPP 330
           +PP     E  PP + PP ++ P  K PP Y+PP     E  PP Y PP ++ P E  PP
Sbjct: 85  EPPKKEKPEPKPPVYTPPKKEEPKPK-PPVYEPPKKEKPEPKPPIYTPPKKEKP-EPKPP 142

Query: 331 EYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            Y PP ++ P   P P Y PP ++ P E  PP ++PP + P +E  PP
Sbjct: 143 VYEPPKKEKPEPKP-PVYTPPKKEKP-EPKPPVYEPPKKPPMYEPKPP 188

 Score =  114 bits (284), Expect = 4e-24
 Identities = 73/170 (42%), Positives = 92/170 (54%), Gaps = 13/170 (7%)
 Frame = +1

Query: 1   PHHAKPPYENP-PPEYQPP-HEKP---PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           P   KPP   P PP Y+PP  EKP   PP Y PP  ++P    PP Y+PP ++ P E  P
Sbjct: 39  PPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKPGPK-PPVYEPPKKEKP-EPKP 96

Query: 166 PGYQPP-HEIP---PPEHQPPHEKPPHAKSPPEYQPPH----EHPPPEYLPPHEKPPHEN 321
           P Y PP  E P   PP ++PP ++ P  K PP Y PP     E  PP Y PP ++ P E 
Sbjct: 97  PVYTPPKKEEPKPKPPVYEPPKKEKPEPK-PPIYTPPKKEKPEPKPPVYEPPKKEKP-EP 154

Query: 322 PPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
            PP Y PP ++ P   P P Y+PP + P +E  PPK  PP   PP ++ P
Sbjct: 155 KPPVYTPPKKEKPEPKP-PVYEPPKKPPMYEPKPPK--PPVYTPPKKEKP 201

 Score =  105 bits (262), Expect = 2e-21
 Identities = 75/184 (40%), Positives = 92/184 (50%), Gaps = 25/184 (13%)
 Frame = +1

Query: 1   PHHAKPPYENP---PPEYQPPH-EKP---PPEYQPPHGKQPHVNPP----PQYQPPHEKP 147
           P +A P  E P   PP Y+PP  EKP   PP Y PP  ++P   PP    P+ + P  KP
Sbjct: 67  PVYAPPKKEKPGPKPPVYEPPKKEKPEPKPPVYTPPKKEEPKPKPPVYEPPKKEKPEPKP 126

Query: 148 P---------HEHSPPGYQPPH----EIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEY 288
           P          E  PP Y+PP     E  PP + PP ++ P  K PP Y+PP +  PP Y
Sbjct: 127 PIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEPK-PPVYEPPKK--PPMY 183

Query: 289 LPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPP-HEK 465
            P   KPP    PP Y PP ++ P   P P Y+PP + P  E  PPK  PP   PP  EK
Sbjct: 184 EP---KPP---KPPVYTPPKKEKPEPIP-PMYEPPKKPPMCEPKPPK--PPVYTPPKKEK 234

Query: 466 SPPA 477
           S P+
Sbjct: 235 SDPS 238

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 61/167 (36%), Positives = 77/167 (46%), Gaps = 14/167 (8%)
 Frame = +1

Query: 1   PHHAKPPYENP---PPEYQPPH-EKP---PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
           P +  P  E P   PP Y+PP  EKP   PP Y PP  ++P   PP  Y+PP ++ P E 
Sbjct: 97  PVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPV-YEPPKKEKP-EP 154

Query: 160 SPPGYQPPHEIPPPEHQP---PHEKP----PHAKSPPEYQPPHEHPPPEYLPPHEKPPHE 318
            PP Y PP +  P    P   P +KP    P    PP Y PP +   PE +PP  +PP +
Sbjct: 155 KPPVYTPPKKEKPEPKPPVYEPPKKPPMYEPKPPKPPVYTPPKKE-KPEPIPPMYEPPKK 213

Query: 319 NPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPH 459
            P  E  PP  KPP   P  + +    +P    P P    PN    H
Sbjct: 214 PPMCEPKPP--KPPVYTPPKKEKSDPSQPCINLPQPTIYEPNHLSHH 258

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/92 (39%), Positives = 50/92 (54%), Gaps = 7/92 (7%)
 Frame = +1

Query: 217 HEKPPHAKSP-PEYQPPHEHPPPEYLPP---HEKPPHENP---PPEYNPPHEKPPHEHPS 375
           +E P + K P PE++PP +  PP Y P    +E P  E P   PP Y PP ++ P   P 
Sbjct: 24  YESPNYGKPPTPEFKPP-KVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKPGPKP- 81

Query: 376 PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           P Y+PP ++ P E  PP + PP ++ P  K P
Sbjct: 82  PVYEPPKKEKP-EPKPPVYTPPKKEEPKPKPP 112

[91][TOP]
>UniRef100_A0BVE0 Chromosome undetermined scaffold_13, whole genome shotgun sequence
           n=1 Tax=Paramecium tetraurelia RepID=A0BVE0_PARTE
          Length = 369

 Score =  119 bits (297), Expect = 1e-25
 Identities = 59/148 (39%), Positives = 78/148 (52%), Gaps = 2/148 (1%)
 Frame = +1

Query: 31  PPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE-KPPHEHSPPG-YQPPHEIPPPE 204
           P P+ Q P + PPP   PP G+ P   PP QY PP +  PP ++ PPG Y PP + PPP 
Sbjct: 184 PQPQLQQPGQYPPPGQYPPPGQYP---PPGQYPPPGQYPPPGQYPPPGQYPPPGQQPPPG 240

Query: 205 HQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEY 384
             PP   P     P +Y PP ++PPP   PP + P    PP +Y PP + PP ++P  +Y
Sbjct: 241 QYPPPGYPGQQPPPGQYPPPGQYPPPGQYPPGQYP----PPGQYPPPGQYPPGQYPPGQY 296

Query: 385 QPPHQKPPHENPPPKFQPPNEKPPHEKS 468
            PP Q PP +N     +     PP + S
Sbjct: 297 PPPGQYPPPQNTTVIIEQQGPPPPQQHS 324

 Score =  107 bits (267), Expect(2) = 3e-22
 Identities = 56/137 (40%), Positives = 76/137 (55%), Gaps = 14/137 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPPP-EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPH-EHSPPGY 174
           P    PP + PPP +Y PP + PPP   PP G+ P   PP QY PP ++PP  ++ PPGY
Sbjct: 191 PGQYPPPGQYPPPGQYPPPGQYPPPGQYPPPGQYP---PPGQYPPPGQQPPPGQYPPPGY 247

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPP-EYQPPHEHPPPEYLPPHEKPPHENPPP-EYNPPH 348
            P  + PP ++ PP + PP  + PP +Y PP ++PPP   PP + PP + PPP +Y PP 
Sbjct: 248 -PGQQPPPGQYPPPGQYPPPGQYPPGQYPPPGQYPPPGQYPPGQYPPGQYPPPGQYPPPQ 306

Query: 349 E----------KPPHEH 369
                       PP +H
Sbjct: 307 NTTVIIEQQGPPPPQQH 323

 Score = 21.2 bits (43), Expect(2) = 3e-22
 Identities = 8/24 (33%), Positives = 13/24 (54%)
 Frame = +2

Query: 401 NHHMRIHHQSSNLLMRNHLMKSHH 472
           NHH   HH  + ++++ H    HH
Sbjct: 348 NHHHHHHHGPNVVVVKKH---GHH 368

 Score =  105 bits (261), Expect = 2e-21
 Identities = 53/130 (40%), Positives = 76/130 (58%), Gaps = 11/130 (8%)
 Frame = +1

Query: 112 PPPQYQPPHEKPPHEHSPPG-YQPPHEIPPP-EHQPPHEKPPHAKSPP--EYQPPHEHPP 279
           PPPQ   P  + P ++ PPG Y PP + PPP ++ PP + PP  + PP  +Y PP + PP
Sbjct: 182 PPPQ---PQLQQPGQYPPPGQYPPPGQYPPPGQYPPPGQYPPPGQYPPPGQYPPPGQQPP 238

Query: 280 PEYLPP-----HEKPPHENPPP-EYNPPHEKPPHEHPSP-EYQPPHQKPPHENPPPKFQP 438
           P   PP      + PP + PPP +Y PP + PP ++P P +Y PP Q PP + PP ++ P
Sbjct: 239 PGQYPPPGYPGQQPPPGQYPPPGQYPPPGQYPPGQYPPPGQYPPPGQYPPGQYPPGQYPP 298

Query: 439 PNEKPPHEKS 468
           P + PP + +
Sbjct: 299 PGQYPPPQNT 308

 Score =  104 bits (260), Expect = 3e-21
 Identities = 55/134 (41%), Positives = 71/134 (52%), Gaps = 2/134 (1%)
 Frame = +1

Query: 79  QPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPP-EHQPPHEKPPHAKSPPEY 255
           QPP   QP +  P QY PP + PP    P  Y PP + PPP ++ PP + PP    P +Y
Sbjct: 180 QPPP-PQPQLQQPGQYPPPGQYPP----PGQYPPPGQYPPPGQYPPPGQYPP----PGQY 230

Query: 256 QPPHEHPPPEYLPPHEKPPHENPPPEYNPPHE-KPPHEHPSPEYQPPHQKPPHENPPPKF 432
            PP + PPP   PP   P  + PP +Y PP +  PP ++P  +Y PP Q PP    PP  
Sbjct: 231 PPPGQQPPPGQYPPPGYPGQQPPPGQYPPPGQYPPPGQYPPGQYPPPGQYPPPGQYPPGQ 290

Query: 433 QPPNEKPPHEKSPP 474
            PP + PP  + PP
Sbjct: 291 YPPGQYPPPGQYPP 304

[92][TOP]
>UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J4Y2_HUMAN
          Length = 253

 Score =  119 bits (297), Expect = 1e-25
 Identities = 67/168 (39%), Positives = 70/168 (41%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHG------KQPHVNPPPQYQPPHEKPPHEHS 162
           P    PP  +PPP   PP   PPP   PP          P  +PPP    P   PP   S
Sbjct: 61  PSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPS 120

Query: 163 PPGYQPPHEIPPPEHQPPH----EKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP 330
           PP   PP   PPP   PP       PP   SPP   PP   PPP   PP   PP   PPP
Sbjct: 121 PP--PPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPP 178

Query: 331 EYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             +PPH  PP   P P   PP   PP   PPP   PP   PP    PP
Sbjct: 179 PPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPP 226

 Score =  117 bits (293), Expect = 4e-25
 Identities = 66/154 (42%), Positives = 71/154 (46%), Gaps = 1/154 (0%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP  +PPP    P   PPP   PP    P ++PPP   PP   PP   SPP   PP   P
Sbjct: 99  PPLPSPPPPPPLPSSPPPPPPSPP---PPPLSPPPP--PPSPPPPPLLSPP---PPPPSP 150

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
           PP   PP   PP    PP   PP   PPP   PPH  PP   PPP  +PP   PP   P 
Sbjct: 151 PPP-PPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPP 209

Query: 376 PEYQPPHQKPPHEN-PPPKFQPPNEKPPHEKSPP 474
           P   PP   PP    PPP   PP+  PP   SPP
Sbjct: 210 PLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPP 243

 Score =  115 bits (288), Expect = 2e-24
 Identities = 68/160 (42%), Positives = 73/160 (45%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP  +PPP   PP   PPP   PP    P ++PPP   PP   PP   SPP   P
Sbjct: 111 PSSPPPPPPSPPP---PPLSPPPPPPSPP--PPPLLSPPPP--PPSPPPPPPPSPP---P 160

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
           P   PPP   PP   PP   SPP   PP   PPP   PP   PP   PPP  +PP   PP
Sbjct: 161 PPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPP 220

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
               SP   PP   PP   PPP   PP+  PP    PP S
Sbjct: 221 ----SPPLPPPPPPPPSPPPPP---PPSPPPPSPPPPPPS 253

 Score =  113 bits (283), Expect = 6e-24
 Identities = 68/158 (43%), Positives = 72/158 (45%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   PPP  QPP    P  +PPP   PP   PP   SPP   P
Sbjct: 40  PPSPLPPSPPPPP---PPSPPPPPPSQPP---PPPSSPPPPPPPPSPPPPPPPSPPPPLP 93

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
               PPP   PP   PP   SPP   PP   PPP  L P   PP   PPP  +PP   PP
Sbjct: 94  SPPPPPPLPSPP-PPPPLPSSPP---PPPPSPPPPPLSPPPPPPSPPPPPLLSPP--PPP 147

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
              P P   PP   PP  +PPP   PP+  PP   SPP
Sbjct: 148 PSPPPP--PPPSPPPPPPSPPPPLPPPSPLPPPPPSPP 183

 Score =  112 bits (280), Expect = 1e-23
 Identities = 66/154 (42%), Positives = 71/154 (46%), Gaps = 1/154 (0%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP  +PPP   PP   PPP    P    P   PPP   PP   PP   SPP   PP   P
Sbjct: 2   PPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPP---SPPPPPPPSPPP 58

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPS 375
           PP  QPP   PP +  PP   PP   PPP   PP   PP  +PPP    P   PP   PS
Sbjct: 59  PPPSQPP---PPPSSPPPPPPPPSPPPPP---PPSPPPPLPSPPPPPPLPSPPPPPPLPS 112

Query: 376 -PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            P   PP   PP  +PPP   PP+  PP   SPP
Sbjct: 113 SPPPPPPSPPPPPLSPPP--PPPSPPPPPLLSPP 144

 Score =  112 bits (280), Expect = 1e-23
 Identities = 67/161 (41%), Positives = 68/161 (42%), Gaps = 8/161 (4%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP + PPP   PP   PPP   PP    P   PPP   PP   PP   SPP   P    P
Sbjct: 60  PPSQPPPPPSSPPPPPPPPSPPPPPPPSP---PPPLPSPP--PPPPLPSPPPPPPLPSSP 114

Query: 196 PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYL--------PPHEKPPHENPPPEYNPPHE 351
           PP   PP   PP   SPP   PP   PPP  L        PP   PP   PPP   PP  
Sbjct: 115 PP---PPPSPPPPPLSPPP--PPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPL 169

Query: 352 KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            PP   P P   PPH  PP   PPP   PP   PP    PP
Sbjct: 170 PPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPP 210

 Score =  106 bits (265), Expect = 7e-22
 Identities = 61/160 (38%), Positives = 61/160 (38%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    PP   PPP   PP   P P   PP    P    PP   PP   PP   SPP   P
Sbjct: 2   PPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPP 61

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPP 360
               PPP   PP   PP    PP   PP   P P   PP   PP   P P   PP   PP
Sbjct: 62  SQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPP---PP 118

Query: 361 HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
              P P   PP   PP   PPP   PP   P     PP S
Sbjct: 119 PSPPPPPLSPP-PPPPSPPPPPLLSPPPPPPSPPPPPPPS 157

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/148 (37%), Positives = 57/148 (38%)
 Frame = +1

Query: 31  PPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQ 210
           PPP   PP   PPP   PP        PPP   PP   PP              PPP   
Sbjct: 1   PPPPPSPPPPPPPPSSPPPP-------PPPSPPPPPPSPP--------------PPPPPS 39

Query: 211 PPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQP 390
           PP   PP    PP   PP   PPP   PP   PP   PPP   P    PP   P P    
Sbjct: 40  PPSPLPPSPPPPPPPSPPP--PPPSQPPP---PPSSPPPPPPPPSPPPPPPPSPPPPLPS 94

Query: 391 PHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P   PP  +PPP    P+  PP   SPP
Sbjct: 95  PPPPPPLPSPPPPPPLPSSPPPPPPSPP 122

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 29/70 (41%), Positives = 31/70 (44%), Gaps = 1/70 (1%)
 Frame = +1

Query: 274 PPPEYLPPHEKPPHENPPPEYNP-PHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEK 450
           PPP   PP   PP  +PPP   P P   PP   P P   PP   PP   PPP   PP   
Sbjct: 1   PPPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPP 60

Query: 451 PPHEKSPPAS 480
           P     PP+S
Sbjct: 61  PSQPPPPPSS 70

[93][TOP]
>UniRef100_UPI00006A19BE UPI00006A19BE related cluster n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI00006A19BE
          Length = 314

 Score =  118 bits (296), Expect = 2e-25
 Identities = 64/166 (38%), Positives = 78/166 (46%), Gaps = 9/166 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE-------H 159
           P    PPY  PP E  PP+  PP E  PPH + P +   PQ Q P  + P +        
Sbjct: 145 PIETAPPYTAPPIETAPPYTAPPIETVPPHTQCPQLRQSPQKQCPQLRQPPQKQCPQLRQ 204

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPP-HEKPPHENPPPEY 336
           SPP   PP E  PP+  PP   PP+   P E  PP+  PP E  PP H  P  ++PP   
Sbjct: 205 SPPKTVPPIETAPPKTVPPKTAPPYTVPPIETAPPYTVPPIETAPPIHSAPNRDSPPIHS 264

Query: 337 NPPHEKPPHEHPSPEYQPP-HQKPPHENPPPKFQPPNEKPPHEKSP 471
            P  + PPH  P P   PP    PP+  PP +  PP   PP E +P
Sbjct: 265 APNRDSPPHRQPPPYTVPPIETAPPYTAPPIETAPPYTVPPIEXTP 310

 Score =  117 bits (293), Expect = 4e-25
 Identities = 64/167 (38%), Positives = 81/167 (48%), Gaps = 9/167 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEK-PPHEHSPPGYQ 177
           P    PPY  PP E  PP+  PP E  PP+   P    PP   PP E  PPH   P   Q
Sbjct: 123 PIETAPPYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPIETVPPHTQCPQLRQ 182

Query: 178 PPHEIPPPEHQPPHEKPPHAK-SPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
            P +  P   QPP ++ P  + SPP+  PP E  PP+ +PP   PP+  PP E  PP+  
Sbjct: 183 SPQKQCPQLRQPPQKQCPQLRQSPPKTVPPIETAPPKTVPPKTAPPYTVPPIETAPPYTV 242

Query: 355 PP-------HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP       H  P+ +  P H  P  ++PP +  PP   PP E +PP
Sbjct: 243 PPIETAPPIHSAPNRDSPPIHSAPNRDSPPHRQPPPYTVPPIETAPP 289

 Score =  107 bits (266), Expect = 5e-22
 Identities = 59/157 (37%), Positives = 77/157 (49%), Gaps = 4/157 (2%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ-PPHEI 192
           PP+  PP E  PP+  PP    PP+   P    PP+  P   + P +  P   Q PP+ +
Sbjct: 62  PPFTVPPIETVPPYTVPPMRQSPPYTVPPIETVPPKQCPQLRQSPQKQCPQLRQSPPYTV 121

Query: 193 PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHE-KPPHENPPPEYNPPHEKPPHEH 369
           PP E  PP+  PP   +PP   PP E  PP   PP E  PP+  PP E  PPH + P   
Sbjct: 122 PPIETAPPYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPIETVPPHTQCPQLR 181

Query: 370 PSPEYQPPHQKPPHENPPPKFQ--PPNEKPPHEKSPP 474
            SP+ Q P  + P +   P+ +  PP   PP E +PP
Sbjct: 182 QSPQKQCPQLRQPPQKQCPQLRQSPPKTVPPIETAPP 218

 Score =  104 bits (260), Expect = 3e-21
 Identities = 59/167 (35%), Positives = 77/167 (46%), Gaps = 10/167 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPH--EKPPHEHSPPGY 174
           P    PPY  PP    PP+  PP E  PP  + P +   PQ Q P   + PP+   P   
Sbjct: 68  PIETVPPYTVPPMRQSPPYTVPPIETVPPK-QCPQLRQSPQKQCPQLRQSPPYTVPPIET 126

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPP------EYQPPHEHPPPEYLPPHEKPPHENPPPEY 336
            PP+ +PP E  PP+  PP   +PP      E  PP+  PP E +PPH + P     P+ 
Sbjct: 127 APPYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPIETVPPHTQCPQLRQSPQK 186

Query: 337 NPPHEKPPHEHPSPEYQ--PPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             P  + P +   P+ +  PP   PP E  PPK  PP   PP+   P
Sbjct: 187 QCPQLRQPPQKQCPQLRQSPPKTVPPIETAPPKTVPPKTAPPYTVPP 233

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 62/172 (36%), Positives = 74/172 (43%), Gaps = 20/172 (11%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ-PPHEI 192
           PPY  PP E  P  + P     PP+   P     P +  P+   PH   P   Q PP  +
Sbjct: 9   PPYTMPPIESAPHTQCPQLRQSPPYTVPPIETVHPIHSAPNA--PHTQCPQLRQSPPFTV 66

Query: 193 PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLP-----------------PHEKPPHEN 321
           PP E  PP+  PP  +SPP   PP E  PP+  P                 P+  PP E 
Sbjct: 67  PPIETVPPYTVPPMRQSPPYTVPPIETVPPKQCPQLRQSPQKQCPQLRQSPPYTVPPIET 126

Query: 322 PPPEYNPPHE-KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEK-PPHEKSP 471
            PP   PP E  PP+  P  E  PP+  PP E  PP   PP E  PPH + P
Sbjct: 127 APPYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPIETVPPHTQCP 178

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 63/181 (34%), Positives = 80/181 (44%), Gaps = 23/181 (12%)
 Frame = +1

Query: 1   PHHAKPPYENPP----PEYQ--PPHEKPP-------------PEYQPPHGKQ--PHVNPP 117
           P +  PP E+ P    P+ +  PP+  PP             P  Q P  +Q  P   PP
Sbjct: 9   PPYTMPPIESAPHTQCPQLRQSPPYTVPPIETVHPIHSAPNAPHTQCPQLRQSPPFTVPP 68

Query: 118 PQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQ-PPHEHPPPEYLP 294
            +  PP+  PP   SPP   PP E  PP+  P   + P  + P   Q PP+  PP E  P
Sbjct: 69  IETVPPYTVPPMRQSPPYTVPPIETVPPKQCPQLRQSPQKQCPQLRQSPPYTVPPIETAP 128

Query: 295 PHEKPPHENPPPEYNPPHE-KPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           P+  PP E  PP   PP E  PP+  P  E  PP+  PP E  PP  Q P  +   +K  
Sbjct: 129 PYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPIETVPPHTQCPQLRQSPQKQC 188

Query: 472 P 474
           P
Sbjct: 189 P 189

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 32/81 (39%), Positives = 38/81 (46%), Gaps = 1/81 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPP-HEKPPHEHSPPGYQ 177
           P    PPY  PP E  PP    P    PP    P+ + PP  QPP +  PP E +PP   
Sbjct: 233 PIETAPPYTVPPIETAPPIHSAPNRDSPPIHSAPNRDSPPHRQPPPYTVPPIETAPPYTA 292

Query: 178 PPHEIPPPEHQPPHEKPPHAK 240
           PP E  PP   PP E  P ++
Sbjct: 293 PPIETAPPYTVPPIEXTPRSR 313

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 39/102 (38%), Positives = 47/102 (46%), Gaps = 6/102 (5%)
 Frame = +1

Query: 196 PPEHQPPHEKPPHAKSPPEYQ-PPHEHPPPEYLPP-HEKP--PHENPPP-EYNPPHEKPP 360
           PP   PP E  PH + P   Q PP+  PP E + P H  P  PH   P    +PP   PP
Sbjct: 9   PPYTMPPIESAPHTQCPQLRQSPPYTVPPIETVHPIHSAPNAPHTQCPQLRQSPPFTVPP 68

Query: 361 HEHPSPEYQPP-HQKPPHENPPPKFQPPNEKPPHEKSPPASC 483
            E   P   PP  Q PP+  PP +  PP + P   +SP   C
Sbjct: 69  IETVPPYTVPPMRQSPPYTVPPIETVPPKQCPQLRQSPQKQC 110

[94][TOP]
>UniRef100_UPI00006A19BC UPI00006A19BC related cluster n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI00006A19BC
          Length = 358

 Score =  118 bits (296), Expect = 2e-25
 Identities = 64/166 (38%), Positives = 78/166 (46%), Gaps = 9/166 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE-------H 159
           P    PPY  PP E  PP+  PP E  PPH + P +   PQ Q P  + P +        
Sbjct: 189 PIETAPPYTAPPIETAPPYTAPPIETVPPHTQCPQLRQSPQKQCPQLRQPPQKQCPQLRQ 248

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPP-HEKPPHENPPPEY 336
           SPP   PP E  PP+  PP   PP+   P E  PP+  PP E  PP H  P  ++PP   
Sbjct: 249 SPPKTVPPIETAPPKTVPPKTAPPYTVPPIETAPPYTVPPIETAPPIHSAPNRDSPPIHS 308

Query: 337 NPPHEKPPHEHPSPEYQPP-HQKPPHENPPPKFQPPNEKPPHEKSP 471
            P  + PPH  P P   PP    PP+  PP +  PP   PP E +P
Sbjct: 309 APNRDSPPHRQPPPYTVPPIETAPPYTAPPIETAPPYTVPPIEXTP 354

 Score =  117 bits (293), Expect = 4e-25
 Identities = 64/167 (38%), Positives = 81/167 (48%), Gaps = 9/167 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEK-PPHEHSPPGYQ 177
           P    PPY  PP E  PP+  PP E  PP+   P    PP   PP E  PPH   P   Q
Sbjct: 167 PIETAPPYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPIETVPPHTQCPQLRQ 226

Query: 178 PPHEIPPPEHQPPHEKPPHAK-SPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
            P +  P   QPP ++ P  + SPP+  PP E  PP+ +PP   PP+  PP E  PP+  
Sbjct: 227 SPQKQCPQLRQPPQKQCPQLRQSPPKTVPPIETAPPKTVPPKTAPPYTVPPIETAPPYTV 286

Query: 355 PP-------HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP       H  P+ +  P H  P  ++PP +  PP   PP E +PP
Sbjct: 287 PPIETAPPIHSAPNRDSPPIHSAPNRDSPPHRQPPPYTVPPIETAPP 333

 Score =  102 bits (255), Expect = 1e-20
 Identities = 63/171 (36%), Positives = 79/171 (46%), Gaps = 14/171 (8%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPHEKPP----PEYQPPHGKQ--PHVNPPPQYQPPHEKPPHEHSP 165
           H A  PY  PP E  PP + P     P+ Q P  +Q  P+  PP +  PP+  PP E +P
Sbjct: 124 HSAPNPYTVPPIETVPPKQCPQLRQSPQKQCPQLRQSPPYTVPPIETAPPYTVPPIETAP 183

Query: 166 PGYQPPHEIPPPEHQPPHE-KPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPE--- 333
           P   PP E  PP   PP E  PP+   P E  PPH   P     P ++ P    PP+   
Sbjct: 184 PYTVPPIETAPPYTAPPIETAPPYTAPPIETVPPHTQCPQLRQSPQKQCPQLRQPPQKQC 243

Query: 334 ----YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
                +PP   PP E   P+  PP   PP+  PP +  PP   PP E +PP
Sbjct: 244 PQLRQSPPKTVPPIETAPPKTVPPKTAPPYTVPPIETAPPYTVPPIETAPP 294

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 61/168 (36%), Positives = 77/168 (45%), Gaps = 16/168 (9%)
 Frame = +1

Query: 16  PPYENPPPEYQPP-HEKPPPEYQPP----HGKQ-PHVNPPPQYQPPH--EKPPHEHSPPG 171
           PPY  PP E  PP H  P P   PP      KQ P +   PQ Q P   + PP+   P  
Sbjct: 110 PPYTVPPIETVPPIHSAPNPYTVPPIETVPPKQCPQLRQSPQKQCPQLRQSPPYTVPPIE 169

Query: 172 YQPPHEIPPPEHQPPHEKPPHAKSPP------EYQPPHEHPPPEYLPPHEKPPHENPPPE 333
             PP+ +PP E  PP+  PP   +PP      E  PP+  PP E +PPH + P     P+
Sbjct: 170 TAPPYTVPPIETAPPYTVPPIETAPPYTAPPIETAPPYTAPPIETVPPHTQCPQLRQSPQ 229

Query: 334 YNPPHEKPPHEHPSPEYQ--PPHQKPPHENPPPKFQPPNEKPPHEKSP 471
              P  + P +   P+ +  PP   PP E  PPK  PP   PP+   P
Sbjct: 230 KQCPQLRQPPQKQCPQLRQSPPKTVPPIETAPPKTVPPKTAPPYTVPP 277

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 57/148 (38%), Positives = 65/148 (43%), Gaps = 2/148 (1%)
 Frame = +1

Query: 46  QPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEK 225
           QPPH   P   +PP    P  + P  +  P    PH   PP   PP E  PP H  P + 
Sbjct: 2   QPPH--CPHREEPPTQHPPTPSLPSPHSAPIHNAPHRKCPPYTVPPIETVPPIHSAPKQC 59

Query: 226 PPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKP 405
           P   +SPP   PP E  PP  +PP E PPH   P    PPH + P    S    PP+  P
Sbjct: 60  PQLRQSPPFTVPPIETVPPYTVPPIESPPHSQCPQLKQPPHTQCPQLRQS----PPYTVP 115

Query: 406 PHENPPPKFQPPN--EKPPHEKSPPASC 483
           P E  PP    PN    PP E  PP  C
Sbjct: 116 PIETVPPIHSAPNPYTVPPIETVPPKQC 143

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 64/184 (34%), Positives = 72/184 (39%), Gaps = 26/184 (14%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P H  P  E PP ++ P    P P   P H   PH   PP   PP E  P  HS P   P
Sbjct: 3   PPHC-PHREEPPTQHPPTPSLPSPHSAPIHNA-PHRKCPPYTVPPIETVPPIHSAPKQCP 60

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPH-------EKPPHENPPPEYN 339
                PP   PP E  P    PP   PPH   P    PPH       + PP+  PP E  
Sbjct: 61  QLRQSPPFTVPPIETVPPYTVPPIESPPHSQCPQLKQPPHTQCPQLRQSPPYTVPPIETV 120

Query: 340 PP-HEKP-PHEHPSPEYQPP-----------------HQKPPHENPPPKFQPPNEKPPHE 462
           PP H  P P+  P  E  PP                  Q PP+  PP +  PP   PP E
Sbjct: 121 PPIHSAPNPYTVPPIETVPPKQCPQLRQSPQKQCPQLRQSPPYTVPPIETAPPYTVPPIE 180

Query: 463 KSPP 474
            +PP
Sbjct: 181 TAPP 184

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 38/94 (40%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = +1

Query: 193 PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEK-PPHENPPPEYNPPHEKPPHEH 369
           P P H P  E+PP  + PP    P  H  P +  PH K PP+  PP E  PP    P + 
Sbjct: 1   PQPPHCPHREEPP-TQHPPTPSLPSPHSAPIHNAPHRKCPPYTVPPIETVPPIHSAPKQC 59

Query: 370 PSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           P     PP   PP E  PP   PP E PPH + P
Sbjct: 60  PQLRQSPPFTVPPIETVPPYTVPPIESPPHSQCP 93

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 32/81 (39%), Positives = 38/81 (46%), Gaps = 1/81 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPP-HEKPPHEHSPPGYQ 177
           P    PPY  PP E  PP    P    PP    P+ + PP  QPP +  PP E +PP   
Sbjct: 277 PIETAPPYTVPPIETAPPIHSAPNRDSPPIHSAPNRDSPPHRQPPPYTVPPIETAPPYTA 336

Query: 178 PPHEIPPPEHQPPHEKPPHAK 240
           PP E  PP   PP E  P ++
Sbjct: 337 PPIETAPPYTVPPIEXTPRSR 357

[95][TOP]
>UniRef100_Q94G51 Proline-rich protein-1 n=1 Tax=Gossypium hirsutum
           RepID=Q94G51_GOSHI
          Length = 299

 Score =  118 bits (295), Expect = 2e-25
 Identities = 73/177 (41%), Positives = 89/177 (50%), Gaps = 19/177 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHE---KP-PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P   KP  E  PP Y PP +   KP PP Y+PP  ++P   PP    P  EKP  E  PP
Sbjct: 88  PKKEKP--EPKPPVYTPPKKEVPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKP--EPKPP 143

Query: 169 GYQPPH----EIPPPEHQPPHEKPPHAKSPPEYQPPHEHP--------PPEYLPPHEKPP 312
            Y+PP     E  PP + PP ++ P  K PP Y+PP + P        PP Y PP ++ P
Sbjct: 144 VYEPPKKEKPEPKPPVYTPPKKEKPEPK-PPVYEPPKKPPMYEPKPPKPPVYTPPKKEKP 202

Query: 313 HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP---PPKFQPPNEKPPHEKSPP 474
            E  PP Y PP +KPP   P P   P +  P  E P   PP +QPPN  P +E  PP
Sbjct: 203 -EPKPPMYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYQPPNNPPIYEPKPP 257

 Score =  116 bits (290), Expect = 9e-25
 Identities = 67/168 (39%), Positives = 89/168 (52%), Gaps = 10/168 (5%)
 Frame = +1

Query: 1   PHHAKPPYE--NPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY 174
           P++ KPP     PP    PP+E  PP Y+PP  ++P    PP Y PP +K  H   P  Y
Sbjct: 28  PNYGKPPTPVFKPPKVKPPPYEPKPPVYEPPKKEKPEPK-PPVYAPP-KKEKHGPKPTMY 85

Query: 175 QPPH----EIPPPEHQPPHEKPPHAKSPPEYQPPH----EHPPPEYLPPHEKPPHENPPP 330
           +PP     E  PP + PP ++ P  K PP Y+PP     E  PP Y PP ++ P E  PP
Sbjct: 86  EPPKKEKPEPKPPVYTPPKKEVPKPK-PPVYEPPKKEKPEPKPPIYTPPKKEKP-EPKPP 143

Query: 331 EYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            Y PP ++ P   P P Y PP ++ P E  PP ++PP + P +E  PP
Sbjct: 144 VYEPPKKEKPEPKP-PVYTPPKKEKP-EPKPPVYEPPKKPPMYEPKPP 189

 Score =  114 bits (284), Expect = 4e-24
 Identities = 70/170 (41%), Positives = 90/170 (52%), Gaps = 13/170 (7%)
 Frame = +1

Query: 1   PHHAKPPYENP---PPEYQPPH-EKP---PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
           P +  P  E P   PP Y PP  EKP   PP Y+PP  ++P   PP    P  EKP  E 
Sbjct: 113 PVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKP--EP 170

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPE-- 333
            PP Y+PP +  PP ++P   KPP   +PP+ + P E  PP Y PP + P +E  PP+  
Sbjct: 171 KPPVYEPPKK--PPMYEPKPPKPP-VYTPPKKEKP-EPKPPMYEPPKKPPMYEPKPPKPP 226

Query: 334 -YNPPHEKPPHEHPSPEYQPPHQKPPHENPPPK---FQPPNEKPPHEKSP 471
            Y PP ++ P   P P YQPP+  P +E  PPK   + PP E+ P  K P
Sbjct: 227 VYTPPKKEKPEPKP-PMYQPPNNPPIYEPKPPKPPVYAPPKEEKPKPKPP 275

 Score =  107 bits (267), Expect = 4e-22
 Identities = 66/170 (38%), Positives = 85/170 (50%), Gaps = 13/170 (7%)
 Frame = +1

Query: 1   PHHAKPPYENP---PPEYQPPH-EKP---PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
           P +  P  E P   PP Y+PP  EKP   PP Y PP  ++P   PP  Y+PP + P +E 
Sbjct: 128 PIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPV-YEPPKKPPMYEP 186

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPP---HAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPP 330
            PP    P    PP+ + P  KPP     K PP Y+ P    PP Y PP ++ P E  PP
Sbjct: 187 KPP---KPPVYTPPKKEKPEPKPPMYEPPKKPPMYE-PKPPKPPVYTPPKKEKP-EPKPP 241

Query: 331 EYNPPHEKPPHEHPSPEYQPPHQKPPHENP---PPKFQPPNEKPPHEKSP 471
            Y PP+  P +E P P   P +  P  E P   PP ++PP  +PP+   P
Sbjct: 242 MYQPPNNPPIYE-PKPPKPPVYAPPKEEKPKPKPPVYEPPAHEPPYGHYP 290

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 62/153 (40%), Positives = 76/153 (49%), Gaps = 2/153 (1%)
 Frame = +1

Query: 1   PHHAKPPYENP--PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY 174
           P    P YE P  PP Y+P   KPP  Y PP  ++P   PP  Y+PP + P +E  PP  
Sbjct: 168 PEPKPPVYEPPKKPPMYEPKPPKPPV-YTPPKKEKPEPKPP-MYEPPKKPPMYEPKPP-- 223

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEK 354
             P    PP+ + P  K      PP YQPP+   PP Y P   KPP    PP Y PP E+
Sbjct: 224 -KPPVYTPPKKEKPEPK------PPMYQPPNN--PPIYEP---KPP---KPPVYAPPKEE 268

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKP 453
            P   P P Y+PP  +PP+ + P    PP  KP
Sbjct: 269 KPKPKP-PVYEPPAHEPPYGHYPG--HPPLGKP 298

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/108 (37%), Positives = 53/108 (49%), Gaps = 8/108 (7%)
 Frame = +1

Query: 172 YQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP-- 345
           Y+ P+   PP    P  KPP  K PP Y+P     PP Y PP ++ P E  PP Y PP  
Sbjct: 25  YESPNYGKPPT---PVFKPPKVK-PPPYEP----KPPVYEPPKKEKP-EPKPPVYAPPKK 75

Query: 346 --HEKPPHEHPSPEYQPPHQKPPHENPP----PKFQPPNEKPPHEKSP 471
             H   P  +  P+ + P  KPP   PP    PK +PP  +PP ++ P
Sbjct: 76  EKHGPKPTMYEPPKKEKPEPKPPVYTPPKKEVPKPKPPVYEPPKKEKP 123

[96][TOP]
>UniRef100_O81765 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=O81765_ARATH
          Length = 699

 Score =  117 bits (294), Expect = 3e-25
 Identities = 64/157 (40%), Positives = 76/157 (48%), Gaps = 3/157 (1%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIP 195
           PP  +PPP   P H  PPP + PP        PPP Y PP   PP  HSPP   P    P
Sbjct: 528 PPVYSPPPPPPPVHSPPPPVHSPP--------PPPVYSPPPPPPP-VHSPP--PPVFSPP 576

Query: 196 PPEHQPP---HEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHE 366
           PP + PP   H  PP   SPP   P H  PPP + PP   P +  PPP ++P    PP +
Sbjct: 577 PPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSP----PPSQ 632

Query: 367 HPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            P   Y PP  +PP  N PP   PP      +++PPA
Sbjct: 633 SPPVVYSPP-PRPPKINSPPVQSPPPAPVEKKETPPA 668

 Score =  116 bits (290), Expect = 9e-25
 Identities = 63/157 (40%), Positives = 80/157 (50%), Gaps = 3/157 (1%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPP-HEHSPPGYQPPHE 189
           +PP E+P P+  P  + P  + + P     +  PPP Y PP   PP H   PP + PP  
Sbjct: 495 QPPKESPQPD-DPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPP-- 551

Query: 190 IPPPEHQPPHEKPP-HAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHE 366
            PPP + PP   PP H+  PP + PP    PP Y PP   P H  PPP ++PP   P H 
Sbjct: 552 -PPPVYSPPPPPPPVHSPPPPVFSPP----PPVYSPP--PPVHSPPPPVHSPPPPAPVHS 604

Query: 367 HPSPEYQPPHQKPPHENPPPKFQ-PPNEKPPHEKSPP 474
            P P + PP   P +  PPP F  PP++ PP   SPP
Sbjct: 605 PPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPP 641

 Score =  114 bits (286), Expect = 3e-24
 Identities = 64/163 (39%), Positives = 75/163 (46%), Gaps = 4/163 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P+   P  +   P   P +  PPP Y PP    P  +PPP   P H  PP    PP Y P
Sbjct: 506 PYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPP---PVHSPPP----PPVYSP 558

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPP---HEHPPPEYLPPHEKPPHENPPPEYNPPHE 351
           P   PPP H PP   P  +  PP Y PP   H  PPP + PP   P H  PPP ++PP  
Sbjct: 559 PPP-PPPVHSPP--PPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPP 615

Query: 352 KPPHEHPSPEYQ-PPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
            P +  P P +  PP Q PP    PP   P    PP +  PPA
Sbjct: 616 PPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPA 658

 Score =  110 bits (275), Expect = 5e-23
 Identities = 61/156 (39%), Positives = 70/156 (44%), Gaps = 15/156 (9%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHV--NPPPQYQPP---HEKPPHEHSPP 168
           H   PP  +PPP   PP   PPP   P H   P V   PPP Y PP   H  PP  HSPP
Sbjct: 541 HSPPPPVHSPPP---PPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPP 597

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP- 345
              P H  PPP H PP   P ++  PP + PP    PP    P  +PP  N PP  +PP 
Sbjct: 598 PPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPP 657

Query: 346 -----HEKPPHEHPSPEYQ----PPHQKPPHENPPP 426
                 E PP   P+P       PP     + +PPP
Sbjct: 658 APVEKKETPPAHAPAPSDDEFIIPPFIGHQYASPPP 693

 Score =  103 bits (258), Expect = 5e-21
 Identities = 59/159 (37%), Positives = 68/159 (42%), Gaps = 7/159 (4%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP------PQYQPPHEKPPHEHSPPGYQP 180
           P + P P    P +KP P  + P    P+   P      P   P +  PP  +SPP   P
Sbjct: 479 PVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPP 538

Query: 181 P-HEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP 357
           P H  PPP H PP   PP   SPP   PP   PPP    P        PPP Y+PP   P
Sbjct: 539 PVHSPPPPVHSPP---PPPVYSPPPPPPPVHSPPPPVFSP--------PPPVYSPP--PP 585

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            H  P P + PP   P H  PPP   PP   P +   PP
Sbjct: 586 VHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPP 624

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 63/177 (35%), Positives = 76/177 (42%), Gaps = 25/177 (14%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQP------PHEKPPHEHSPPGY-- 174
           P   P P    P +KP P    P  K   V   P ++P      P +KP    S P    
Sbjct: 435 PVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLATPVDKPSPVPSRPVQKP 494

Query: 175 QPPHEIPPPEHQPPHEKPPHAK--SPPEYQPPHEHPPPEYLPPHEKPPHENPPPE----- 333
           QPP E P P+   P+++ P  K  SPP   P +  PPP Y PP   PP  +PPP      
Sbjct: 495 QPPKESPQPDD--PYDQSPVTKRRSPPP-APVNSPPPPVYSPPPPPPPVHSPPPPVHSPP 551

Query: 334 ----YNPPHEKPP-HEHPSPEYQPP---HQKPP--HENPPPKFQPPNEKPPHEKSPP 474
               Y+PP   PP H  P P + PP   +  PP  H  PPP   PP   P H   PP
Sbjct: 552 PPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPP 608

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 49/160 (30%), Positives = 63/160 (39%), Gaps = 2/160 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P    P ++  P    P H+  P    P     P    P Q   P    P     P    
Sbjct: 419 PSKPSPVHKPTPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLAT 478

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP-PEYLPPHEKPPHENPPPEYNPPHEKP 357
           P + P P    P +KP   K  P+   P++  P  +   P   P +  PPP Y+PP   P
Sbjct: 479 PVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPP 538

Query: 358 P-HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P H  P P + PP   PP  +PPP   P +  PP   SPP
Sbjct: 539 PVHSPPPPVHSPP--PPPVYSPPPPPPPVHSPPPPVFSPP 576

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 41/116 (35%), Positives = 50/116 (43%), Gaps = 6/116 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHE--KPPHEHSPPGY 174
           P H+ PP  + PP   P H  PPP + PP        PPP Y PP     PP   SPP  
Sbjct: 585 PVHSPPPPVHSPPPPAPVHSPPPPVHSPP-------PPPPVYSPPPPVFSPPPSQSPPVV 637

Query: 175 QPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPE----YLPPHEKPPHENPPP 330
             P   PP  + PP + PP A    +  PP   P P      +PP     + +PPP
Sbjct: 638 YSPPPRPPKINSPPVQSPPPAPVEKKETPPAHAPAPSDDEFIIPPFIGHQYASPPP 693

[97][TOP]
>UniRef100_B9HRV2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HRV2_POPTR
          Length = 711

 Score =  117 bits (294), Expect = 3e-25
 Identities = 75/181 (41%), Positives = 85/181 (46%), Gaps = 23/181 (12%)
 Frame = +1

Query: 1   PHHAKPPYEN--PPPEYQPP----HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHS 162
           P H+ PP  +  PPP + PP    H  PPP Y PP    P V  PP   P H  PP  HS
Sbjct: 419 PAHSPPPSIHFPPPPVHSPPPPPVHSPPPPIYSPP----PLVYSPP--PPVHSPPPPVHS 472

Query: 163 PPGYQPPHEIPPPEHQPP---HEKPPHAKSPPEYQPP---HEHPPPEYLPPH--EKPP-- 312
           PP   P    PPP H PP   H  PP    PP Y PP   H  PPP Y PP   + PP  
Sbjct: 473 PP--PPVQSFPPPVHSPPPPVHSPPP----PPVYSPPPPVHSPPPPVYSPPPLVQSPPPP 526

Query: 313 -HENPPPEYNPP----HEKPP--HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
            H  PPP ++PP    +  PP  H  P P + PP   PP ++PPP    P   P H   P
Sbjct: 527 VHSPPPPLHSPPPPPVYSPPPPVHSPPPPVHSPP---PPIQSPPPPVHSPPPPPIHSPPP 583

Query: 472 P 474
           P
Sbjct: 584 P 584

 Score =  114 bits (286), Expect = 3e-24
 Identities = 76/182 (41%), Positives = 80/182 (43%), Gaps = 25/182 (13%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPP 183
           H   PP  +PPP   P H  PPP Y PP    P V  PP   P H  PP  HSPP   P 
Sbjct: 428 HFPPPPVHSPPPP--PVHSPPPPIYSPP----PLVYSPPP--PVHSPPPPVHSPP--PPV 477

Query: 184 HEIPPPEHQPP---HEKPPHAKSPPEYQPP---HEHPPPEYLPP----------HEKPPH 315
              PPP H PP   H  PP    PP Y PP   H  PPP Y PP          H  PP 
Sbjct: 478 QSFPPPVHSPPPPVHSPPP----PPVYSPPPPVHSPPPPVYSPPPLVQSPPPPVHSPPPP 533

Query: 316 EN---PPPEYNPP---HEKPPHEHPSPEYQPPHQKPP---HENPPPKFQPPNEKPPHEKS 468
            +   PPP Y+PP   H  PP  H  P   PP Q PP   H  PPP    P   PP +  
Sbjct: 534 LHSPPPPPVYSPPPPVHSPPPPVHSPP---PPIQSPPPPVHSPPPPPIHSP--PPPVQSL 588

Query: 469 PP 474
           PP
Sbjct: 589 PP 590

 Score =  110 bits (276), Expect = 4e-23
 Identities = 73/190 (38%), Positives = 84/190 (44%), Gaps = 30/190 (15%)
 Frame = +1

Query: 1   PHHAKPP--YENPPPEYQPP---HEKPPPEYQPPHGKQP-----HVNPPPQYQPP----H 138
           P H+ PP  Y  PP  Y PP   H  PPP + PP   Q      H  PPP + PP    +
Sbjct: 441 PVHSPPPPIYSPPPLVYSPPPPVHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPVY 500

Query: 139 EKPPHEHSPPG--YQPPHEI---PPPEHQPP---HEKPPHAKSPPEYQPP---HEHPPPE 285
             PP  HSPP   Y PP  +   PPP H PP   H  PP    PP Y PP   H  PPP 
Sbjct: 501 SPPPPVHSPPPPVYSPPPLVQSPPPPVHSPPPPLHSPPP----PPVYSPPPPVHSPPPPV 556

Query: 286 YLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQK-----PPHENPPPKFQPPNEK 450
           + PP   PP ++PPP  + P   P H  P P    P        PP  +PPP    P   
Sbjct: 557 HSPP---PPIQSPPPPVHSPPPPPIHSPPPPVQSLPPPPVNSPLPPVHSPPPPVHSPTS- 612

Query: 451 PPHEKSPPAS 480
           P H   PP +
Sbjct: 613 PIHSHPPPVN 622

 Score =  110 bits (275), Expect = 5e-23
 Identities = 75/184 (40%), Positives = 84/184 (45%), Gaps = 26/184 (14%)
 Frame = +1

Query: 1    PHHAKPPYEN---PPPEYQPP---HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHS 162
            P H+ PP  +   PPP Y PP   H  PPP Y PP    P V  PP   P H  PP  HS
Sbjct: 483  PVHSPPPPVHSPPPPPVYSPPPPVHSPPPPVYSPP----PLVQSPPP--PVHSPPPPLHS 536

Query: 163  PPGYQPPHEIPPPEHQPP---HEKPPHAKSPPE--YQPP----HEHPPP-EYLPPHE--- 303
            PP   P +  PPP H PP   H  PP  +SPP   + PP    H  PPP + LPP     
Sbjct: 537  PPP-PPVYSPPPPVHSPPPPVHSPPPPIQSPPPPVHSPPPPPIHSPPPPVQSLPPPPVNS 595

Query: 304  --KPPHENPPPEYNPPHEKPPHEHPSPEYQPPH-----QKPPHENPPPKFQPPNEKPPHE 462
               P H  PPP ++P    P H HP P   PP        PP  +PPP    P   P H 
Sbjct: 596  PLPPVHSPPPPVHSP--TSPIHSHPPPVNSPPPPVQSLPPPPVNSPPPPVHSPT-PPIHS 652

Query: 463  KSPP 474
             SPP
Sbjct: 653  PSPP 656

 Score =  109 bits (273), Expect = 8e-23
 Identities = 73/187 (39%), Positives = 85/187 (45%), Gaps = 29/187 (15%)
 Frame = +1

Query: 1   PHHAKPP--YENPPPEYQPP---HEKPPP--EYQPP-HGKQPHVN---PPPQYQPPHEKP 147
           P ++ PP  Y  PPP + PP   H  PPP   + PP H   P V+   PPP Y PP   P
Sbjct: 448 PIYSPPPLVYSPPPPVHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPVYSPP--PP 505

Query: 148 PHEHSPPGYQPPHEI---PPPEHQPP---HEKPPHAKSPPEYQPP---HEHPPPEYLPPH 300
            H   PP Y PP  +   PPP H PP   H  PP    PP Y PP   H  PPP + PP 
Sbjct: 506 VHSPPPPVYSPPPLVQSPPPPVHSPPPPLHSPPP----PPVYSPPPPVHSPPPPVHSPP- 560

Query: 301 EKPPHENPPPEYNPPHEKPPHEHPSPEYQPP-----HQKPPHENPPPKFQPP----NEKP 453
             PP ++PPP  + P   P H  P P    P        PP  +PPP    P    +  P
Sbjct: 561 --PPIQSPPPPVHSPPPPPIHSPPPPVQSLPPPPVNSPLPPVHSPPPPVHSPTSPIHSHP 618

Query: 454 PHEKSPP 474
           P   SPP
Sbjct: 619 PPVNSPP 625

 Score =  105 bits (263), Expect = 1e-21
 Identities = 74/181 (40%), Positives = 83/181 (45%), Gaps = 32/181 (17%)
 Frame = +1

Query: 28  NPPPEYQ--PP--HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPG--YQPPHE 189
           +PPP  Q  PP  H  PPP + PP     H  PPP + PP   PP  HSPP   Y PP  
Sbjct: 401 SPPPSSQSLPPLVHSLPPPAHSPP--PSIHFPPPPVHSPP---PPPVHSPPPPIYSPPPL 455

Query: 190 I--PPPEHQPPHEKPPHAKSPP----EYQPP-HEHPPPEYLPP----HEKPP--HENPPP 330
           +  PPP   P H  PP   SPP     + PP H  PPP + PP    +  PP  H  PPP
Sbjct: 456 VYSPPP---PVHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPVYSPPPPVHSPPPP 512

Query: 331 EYNPP----------HEKPPHEH---PSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
            Y+PP          H  PP  H   P P Y PP   P H  PPP   PP   PP +  P
Sbjct: 513 VYSPPPLVQSPPPPVHSPPPPLHSPPPPPVYSPP--PPVHSPPPPVHSPP---PPIQSPP 567

Query: 472 P 474
           P
Sbjct: 568 P 568

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 70/177 (39%), Positives = 77/177 (43%), Gaps = 20/177 (11%)
 Frame = +1

Query: 4   HHAKPPYENPPPE--YQPP---HEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           H   PP  +PPP   Y PP   H  PPP + PP   Q    PPP + PP   PP  HSPP
Sbjct: 528 HSPPPPLHSPPPPPVYSPPPPVHSPPPPVHSPPPPIQSP--PPPVHSPP---PPPIHSPP 582

Query: 169 G-------------YQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP 309
                           P H  PPP H P    P H+  PP   PP   PP + LPP   P
Sbjct: 583 PPVQSLPPPPVNSPLPPVHSPPPPVHSP--TSPIHSHPPPVNSPP---PPVQSLPP---P 634

Query: 310 PHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPP--HENPPPKFQPPNEKPPHEKSPP 474
           P  +PPP  + P   PP   PSP   P H  PP     PPP F P    PP   SPP
Sbjct: 635 PVNSPPPPVHSP--TPPIHSPSP---PLHSPPPPIRSPPPPVFSP----PPVIVSPP 682

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/137 (40%), Positives = 60/137 (43%), Gaps = 24/137 (17%)
 Frame = +1

Query: 136 HEKPPHEHSPPGYQPPHEIPPPEHQPP---HEKPPHAKSPPEYQPPHEHPPPEYLPP--- 297
           H  PP   S P     H +PPP H PP   H  PP   SPP   P H  PPP Y PP   
Sbjct: 400 HSPPPSSQSLPPLV--HSLPPPAHSPPPSIHFPPPPVHSPPP-PPVHSPPPPIYSPPPLV 456

Query: 298 HEKPP--HENPPPEYNPP----------HEKPPHEH---PSPEYQPPHQKPPHENPPPKF 432
           +  PP  H  PPP ++PP          H  PP  H   P P Y PP   P H  PPP +
Sbjct: 457 YSPPPPVHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPVYSPP--PPVHSPPPPVY 514

Query: 433 QPP---NEKPPHEKSPP 474
            PP      PP   SPP
Sbjct: 515 SPPPLVQSPPPPVHSPP 531

[98][TOP]
>UniRef100_O49870 Extensin (Fragment) n=1 Tax=Hordeum vulgare RepID=O49870_HORVU
          Length = 330

 Score =  117 bits (292), Expect = 5e-25
 Identities = 71/191 (37%), Positives = 90/191 (47%), Gaps = 35/191 (18%)
 Frame = +1

Query: 4   HHAKPPY-ENPPPEYQPPHEKP--------PPEY----QPPHGKQPHVNP-----PPQYQ 129
           HHAKPP     PP Y PP  KP        PP Y    +PP    P  +P     PP Y+
Sbjct: 40  HHAKPPVGSQAPPTYSPPTAKPTPPAPKPAPPTYAPIPKPPKPSPPAYHPTPKPAPPTYK 99

Query: 130 PPHE--------KPPHEHSPPGYQPPHEIPPPEHQP-PHEKPPHAKSPPEYQPPHEHPPP 282
           PP +        KP  + SPP Y+P  ++ PP ++P P   PP  K  P+  PP   P P
Sbjct: 100 PPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPSP 159

Query: 283 EYLPPHEKPPHENPPPEYNP-PHEKPPHEHPSPEYQPPHQKP-PHENP------PPKFQP 438
           +  PP  KP  +  PP Y P P   PP   P+P+  PP  KP P  +P      PP ++P
Sbjct: 160 KVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPPYKP 219

Query: 439 PNEKPPHEKSP 471
           P   PP +K P
Sbjct: 220 PTPTPPAQKPP 230

 Score =  114 bits (284), Expect = 4e-24
 Identities = 66/171 (38%), Positives = 85/171 (49%), Gaps = 19/171 (11%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGK-QPHVNPP-----PQYQPPHEKPPHEHSPPGYQ 177
           PP   P P+  PP  KP P+  PP  K  P V+PP     P+  PP  KP  + SPP Y+
Sbjct: 130 PPAYKPAPKVSPPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYK 189

Query: 178 PPHEIPPPEHQP-PHEKPPHAK-SPPEYQPPHEHP----PPEYLPPHEKPPHENPPPEYN 339
           P  ++ PP ++P P   PP  K +PP Y+PP   P    PP   PP  KPP    PP + 
Sbjct: 190 PAPKVSPPAYKPVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPT-PPAHK 248

Query: 340 PPHEKPPHEHPS----PEYQPPHQKPPHE---NPPPKFQPPNEKPPHEKSP 471
           PP   PP   P+    P ++PP   PP      P P ++PP   PP +K P
Sbjct: 249 PPTPTPPAHKPATPTPPAHKPPTPTPPAHKPTTPTPAYKPPTPTPPADKPP 299

 Score =  113 bits (283), Expect = 6e-24
 Identities = 70/181 (38%), Positives = 83/181 (45%), Gaps = 22/181 (12%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHE----KP------PPEYQPPHGK--QPHVNPPPQYQPPHEK 144
           P    P +E PP  ++PPH     KP      PP Y PP  K   P   P P    P  K
Sbjct: 19  PISPAPKHEKPPKGHKPPHHHHHAKPPVGSQAPPTYSPPTAKPTPPAPKPAPPTYAPIPK 78

Query: 145 PPHEHSPPGYQPPHEIPPPEHQPPHE---KPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH 315
           PP + SPP Y P  +  PP ++PP +    PP  K  P+  PP   P P+  PP  KP  
Sbjct: 79  PP-KPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAP 137

Query: 316 ENPPPEYNP-PHEKPPHEHPSPEYQPPHQK------PPHENPPPKFQPPNEKPPHEKSPP 474
           +  PP Y P P   PP   PSP+  PP  K      PP   P PK  PP  KP  + SPP
Sbjct: 138 KVSPPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPP 197

Query: 475 A 477
           A
Sbjct: 198 A 198

 Score =  113 bits (283), Expect = 6e-24
 Identities = 67/175 (38%), Positives = 86/175 (49%), Gaps = 18/175 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPP-------PEYQP-PHGKQPHVNPPPQYQPPHEKPPHE 156
           P    PP  +P P+  PP  KPP       P Y+P P    P   P P+  PP  KP  +
Sbjct: 79  PPKPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPK 138

Query: 157 HSPPGYQPPHEIPPPEHQP------PHEKPPHAKSPPEYQPPHEHPPPEYLP-PHEKPPH 315
            SPP Y+P  ++ PP ++P      P  KP    SPP Y+P  +  PP Y P P   PP 
Sbjct: 139 VSPPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPA 198

Query: 316 ENPPPEYNPPHEK---PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             P P+ +PP  K   PP++ P+P   PP QKPP    PP ++PP   PP  K P
Sbjct: 199 YKPVPKPSPPAPKPTPPPYKPPTP--TPPAQKPPTPT-PPAYKPPTPTPPAHKPP 250

 Score =  113 bits (283), Expect = 6e-24
 Identities = 69/178 (38%), Positives = 85/178 (47%), Gaps = 19/178 (10%)
 Frame = +1

Query: 1   PHHAKPPYENP------PPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEH 159
           P  A P Y+ P      PP Y+P  +  PP Y+P P    P   P P+  PP  KP  + 
Sbjct: 91  PKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKV 150

Query: 160 SPPGYQPPHEIPPPEHQP------PHEKPPHAKSPPEYQPPHEHPPPEYLP-PHEKPPHE 318
           SPP Y+P  ++ PP ++P      P  KP    SPP Y+P  +  PP Y P P   PP  
Sbjct: 151 SPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPVPKPSPPAP 210

Query: 319 NP-PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEK----SPPA 477
            P PP Y PP   PP + P P   PP  KPP    PP  +PP   PP  K    +PPA
Sbjct: 211 KPTPPPYKPPTPTPPAQKP-PTPTPPAYKPPTPT-PPAHKPPTPTPPAHKPATPTPPA 266

 Score =  113 bits (283), Expect = 6e-24
 Identities = 65/164 (39%), Positives = 80/164 (48%), Gaps = 12/164 (7%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQ-PHVNPP-----PQYQPPHEKPPHEHSPPGYQ 177
           PP   P P+  PP  KP P+  PP  K  P V+PP     P+  PP  KP  + SPP Y+
Sbjct: 108 PPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPSPKVSPPAYK 167

Query: 178 PPHEIPPPEHQP-PHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP-PHENPPPEYNPPHE 351
           P  ++ PP ++P P   PP  K  P+  PP   P P+  PP  KP P    PP   PP +
Sbjct: 168 PAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPPYKPPTPTPPAQ 227

Query: 352 KPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
           KPP   P P Y+PP   PP   P    PP  +P    PP  K P
Sbjct: 228 KPPTPTP-PAYKPPTPTPPAHKPPTPTPPAHKPATPTPPAHKPP 270

 Score =  111 bits (277), Expect = 3e-23
 Identities = 67/173 (38%), Positives = 83/173 (47%), Gaps = 18/173 (10%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQ-PHVNPP-----PQYQPPHEKPPHEHSPPGYQ 177
           PP   P P+  PP  KP P+  PP  K  P V+PP     P+  PP  KP  + SPP  +
Sbjct: 152 PPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPVPKPSPPAPK 211

Query: 178 P-PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENP----PPEYNP 342
           P P    PP   PP +KPP   +PP Y+PP    PP + PP   PP   P    PP + P
Sbjct: 212 PTPPPYKPPTPTPPAQKPP-TPTPPAYKPPTP-TPPAHKPPTPTPPAHKPATPTPPAHKP 269

Query: 343 PHEKPPHEH---PSPEYQPPHQKPPHENPPP----KFQPPNEKPPHEKSPPAS 480
           P   PP      P+P Y+PP   PP + PP       +PP   PP  K+P  S
Sbjct: 270 PTPTPPAHKPTTPTPAYKPPTPTPPADKPPTPTPLAHKPPTPTPPAYKAPTPS 322

 Score =  102 bits (253), Expect = 2e-20
 Identities = 63/163 (38%), Positives = 72/163 (44%), Gaps = 10/163 (6%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP------PQYQPPHEKPPHEHSPPGYQP 180
           P    P    P HEKPP  ++PPH    H  PP      P Y PP  KP          P
Sbjct: 14  PPSPTPISPAPKHEKPPKGHKPPHHHH-HAKPPVGSQAPPTYSPPTAKPT---------P 63

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHE---KPPHENPPPEYNPPHE 351
           P   P P    P  KPP   SPP Y P  +  PP Y PP +    PP   P P+ +PP  
Sbjct: 64  PAPKPAPPTYAPIPKPPKP-SPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAY 122

Query: 352 KPPHEHPSPEYQP-PHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
           KP  +   P Y+P P   PP   P PK  PP  KP  + SPPA
Sbjct: 123 KPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPSPKVSPPA 165

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 60/148 (40%), Positives = 69/148 (46%), Gaps = 1/148 (0%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQ-PHVNPPPQYQPPHEKPPHEHSPPGYQPPHEI 192
           PP   P P+  PP  KP P+  PP  K  P    PP   PP +KPP   +PP Y+PP   
Sbjct: 185 PPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTP-TPPAYKPPTPT 243

Query: 193 PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHP 372
           PP  H+PP   PP  K  P    P  H PP   PP  KP    P P Y PP   PP + P
Sbjct: 244 PPA-HKPPTPTPPAHK--PATPTPPAHKPPTPTPPAHKPT--TPTPAYKPPTPTPPADKP 298

Query: 373 SPEYQPPHQKPPHENPPPKFQPPNEKPP 456
            P   P   KPP    PP ++ P   PP
Sbjct: 299 -PTPTPLAHKPPTPT-PPAYKAPTPSPP 324

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 65/168 (38%), Positives = 77/168 (45%), Gaps = 15/168 (8%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQ-PHVNPP-----PQYQPPHEKP-PHEHSPPGY 174
           PP   P P+  PP  KP P+  PP  K  P V+PP     P+  PP  KP P  + PP  
Sbjct: 163 PPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPPYKPPTP 222

Query: 175 QPPHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNP 342
            PP + PP    P ++PP   PP A  PP   PP  H P    PP  KPP    PP + P
Sbjct: 223 TPPAQKPPTPTPPAYKPPTPTPP-AHKPPTPTPP-AHKPATPTPPAHKPPTPT-PPAHKP 279

Query: 343 PHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSPP 474
               P ++ P+P   PP  KPP   P    PP   PP  K P    PP
Sbjct: 280 TTPTPAYKPPTP--TPPADKPPTPTPLAHKPPTPTPPAYKAPTPSPPP 325

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 58/146 (39%), Positives = 67/146 (45%), Gaps = 9/146 (6%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKP-PPEYQPPHGKQPHVNPP----PQYQPPHEKPPHEHSPPGYQP 180
           PP   P P+  PP  KP PP Y+PP    P   PP    P Y+PP   PP  H PP   P
Sbjct: 196 PPAYKPVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPP-AHKPPTPTP 254

Query: 181 PHEIP----PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           P   P    PP H+PP        +PP ++P    P P Y PP   PP + PP    P  
Sbjct: 255 PAHKPATPTPPAHKPP------TPTPPAHKP--TTPTPAYKPPTPTPPADKPPTP-TPLA 305

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPP 426
            KPP   P P Y+ P   PP   PPP
Sbjct: 306 HKPPTPTP-PAYKAPTPSPP---PPP 327

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 41/126 (32%), Positives = 52/126 (41%), Gaps = 3/126 (2%)
 Frame = +1

Query: 1   PHHAKPPYENP---PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPG 171
           P    P Y+ P   PP ++PP   PP         +P    PP ++PP   PP  H P  
Sbjct: 230 PTPTPPAYKPPTPTPPAHKPPTPTPP-------AHKPATPTPPAHKPPTPTPP-AHKPTT 281

Query: 172 YQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHE 351
             P ++  PP   PP +KPP          P  H PP   PP  K P  +PPP       
Sbjct: 282 PTPAYK--PPTPTPPADKPP-------TPTPLAHKPPTPTPPAYKAPTPSPPP------- 325

Query: 352 KPPHEH 369
            PP+ H
Sbjct: 326 -PPYHH 330

[99][TOP]
>UniRef100_B9NAX9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NAX9_POPTR
          Length = 312

 Score =  117 bits (292), Expect = 5e-25
 Identities = 62/176 (35%), Positives = 78/176 (44%), Gaps = 23/176 (13%)
 Frame = +1

Query: 16  PPYENPPPEYQ-----PPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ- 177
           PP ++PPP Y      PP + PPP Y       P  +PPP Y      PP +  PP Y  
Sbjct: 39  PPSQSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHY 98

Query: 178 ----PPHEIPPPEHQPPHEKPPHAKSPPEYQ-----PPHEHPPPEYLPPHEKPPHENPPP 330
               PP + PPP +      PP    PP Y      PP + PPP Y      PP ++PPP
Sbjct: 99  SSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPP 158

Query: 331 EYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQ-----PPNEKPP---HEKSPP 474
            Y+     PP + P P Y      PP ++PPP +      PP + PP   H  SPP
Sbjct: 159 PYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPP 214

 Score =  117 bits (292), Expect = 5e-25
 Identities = 64/184 (34%), Positives = 81/184 (44%), Gaps = 26/184 (14%)
 Frame = +1

Query: 1   PHH---AKPPYENPPPEYQ-----PPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE 156
           P+H     PP ++PPP Y      PP + PPP Y       P  +PPP Y      PP +
Sbjct: 63  PYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK 122

Query: 157 HSPPGYQ-----PPHEIPPPEHQPPHEKPPHAKSPPEYQ-----PPHEHPPPEYLPPHEK 306
             PP Y      PP + PPP +      PP    PP Y      PP + PPP Y      
Sbjct: 123 SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPP 182

Query: 307 PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQ-----PPNEKPP---HE 462
           PP ++PPP Y+     PP + P P Y      PP ++PPP +      PP + PP   H 
Sbjct: 183 PPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHY 242

Query: 463 KSPP 474
            SPP
Sbjct: 243 SSPP 246

 Score =  117 bits (292), Expect = 5e-25
 Identities = 64/184 (34%), Positives = 81/184 (44%), Gaps = 26/184 (14%)
 Frame = +1

Query: 1   PHHAK---PPYENPPPEYQ-----PPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE 156
           P+H     PP ++PPP Y      PP + PPP Y       P  +PPP Y      PP +
Sbjct: 79  PYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK 138

Query: 157 HSPPGYQ-----PPHEIPPPEHQPPHEKPPHAKSPPEYQ-----PPHEHPPPEYLPPHEK 306
             PP Y      PP + PPP +      PP    PP Y      PP + PPP Y      
Sbjct: 139 SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPP 198

Query: 307 PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQ-----PPNEKPP---HE 462
           PP ++PPP Y+     PP + P P Y      PP ++PPP +      PP + PP   H 
Sbjct: 199 PPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHY 258

Query: 463 KSPP 474
            SPP
Sbjct: 259 SSPP 262

 Score =  117 bits (292), Expect = 5e-25
 Identities = 64/184 (34%), Positives = 81/184 (44%), Gaps = 26/184 (14%)
 Frame = +1

Query: 1   PHHAK---PPYENPPPEYQ-----PPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE 156
           P+H     PP ++PPP Y      PP + PPP Y       P  +PPP Y      PP +
Sbjct: 95  PYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK 154

Query: 157 HSPPGYQ-----PPHEIPPPEHQPPHEKPPHAKSPPEYQ-----PPHEHPPPEYLPPHEK 306
             PP Y      PP + PPP +      PP    PP Y      PP + PPP Y      
Sbjct: 155 SPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPP 214

Query: 307 PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQ-----PPNEKPP---HE 462
           PP ++PPP Y+     PP + P P Y      PP ++PPP +      PP + PP   H 
Sbjct: 215 PPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHY 274

Query: 463 KSPP 474
            SPP
Sbjct: 275 SSPP 278

 Score =  117 bits (292), Expect = 5e-25
 Identities = 64/184 (34%), Positives = 81/184 (44%), Gaps = 26/184 (14%)
 Frame = +1

Query: 1   PHHAK---PPYENPPPEYQ-----PPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE 156
           P+H     PP ++PPP Y      PP + PPP Y       P  +PPP Y      PP +
Sbjct: 111 PYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK 170

Query: 157 HSPPGYQ-----PPHEIPPPEHQPPHEKPPHAKSPPEYQ-----PPHEHPPPEYLPPHEK 306
             PP Y      PP + PPP +      PP    PP Y      PP + PPP Y      
Sbjct: 171 SPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPP 230

Query: 307 PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQ-----PPNEKPP---HE 462
           PP ++PPP Y+     PP + P P Y      PP ++PPP +      PP + PP   H 
Sbjct: 231 PPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHY 290

Query: 463 KSPP 474
            SPP
Sbjct: 291 SSPP 294

 Score =  116 bits (291), Expect = 7e-25
 Identities = 60/176 (34%), Positives = 78/176 (44%), Gaps = 18/176 (10%)
 Frame = +1

Query: 1   PHHAK---PPYENPPPEYQ-----PPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE 156
           P+H     PP ++PPP Y      PP + PPP Y       P  +PPP Y      PP +
Sbjct: 127 PYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKK 186

Query: 157 HSPPGYQ-----PPHEIPPPEHQPPHEKPPHAKSPPEYQ-----PPHEHPPPEYLPPHEK 306
             PP Y      PP + PPP +      PP    PP Y      PP + PPP Y      
Sbjct: 187 SPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPP 246

Query: 307 PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP ++PPP Y+     PP + P P Y      PP ++PPP +   +  PP +  PP
Sbjct: 247 PPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPP 302

 Score =  111 bits (278), Expect = 2e-23
 Identities = 58/170 (34%), Positives = 75/170 (44%), Gaps = 18/170 (10%)
 Frame = +1

Query: 1   PHHAK---PPYENPPPEYQ-----PPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHE 156
           P+H     PP ++PPP Y      PP + PPP Y       P  +PPP Y      PP +
Sbjct: 143 PYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKK 202

Query: 157 HSPPGYQ-----PPHEIPPPEHQPPHEKPPHAKSPPEYQ-----PPHEHPPPEYLPPHEK 306
             PP Y      PP + PPP +      PP    PP Y      PP + PPP Y      
Sbjct: 203 SPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPP 262

Query: 307 PPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPP 456
           PP ++PPP Y+     PP + P P Y      PP ++PPP +   +  PP
Sbjct: 263 PPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPP 312

 Score =  107 bits (267), Expect = 4e-22
 Identities = 59/162 (36%), Positives = 73/162 (45%), Gaps = 8/162 (4%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEI 192
           +P Y   PP   PP + PPP Y       P  +PPP Y      PP +  PP Y      
Sbjct: 30  EPYYYKSPP---PPSQSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPP 86

Query: 193 PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHP 372
           PP +  PP   P H  SPP   PP + PPP Y      PP ++PPP Y+     PP + P
Sbjct: 87  PPKKSPPP---PYHYSSPP---PPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSP 140

Query: 373 SPEYQPPHQKPPHENPPPKFQ-----PPNEKPP---HEKSPP 474
            P Y      PP ++PPP +      PP + PP   H  SPP
Sbjct: 141 PPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPP 182

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 53/141 (37%), Positives = 67/141 (47%), Gaps = 8/141 (5%)
 Frame = +1

Query: 76  YQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEY 255
           Y+P + K P   PPP   PP   PP+ +S P        PPP+  PP   P H  SPP  
Sbjct: 29  YEPYYYKSP---PPPSQSPP---PPYHYSSP--------PPPKKSPP--PPYHYTSPP-- 70

Query: 256 QPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQ 435
            PP + PPP Y      PP ++PPP Y+     PP + P P Y      PP ++PPP + 
Sbjct: 71  -PPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYH 129

Query: 436 -----PPNEKPP---HEKSPP 474
                PP + PP   H  SPP
Sbjct: 130 YSSPPPPKKSPPPPYHYSSPP 150

[100][TOP]
>UniRef100_UPI00019834A2 PREDICTED: hypothetical protein isoform 1 n=1 Tax=Vitis vinifera
           RepID=UPI00019834A2
          Length = 262

 Score =  116 bits (291), Expect = 7e-25
 Identities = 73/196 (37%), Positives = 97/196 (49%), Gaps = 36/196 (18%)
 Frame = +1

Query: 1   PHHAKPPYENPPPE---YQPPHEKPPPEYQPPHGKQPHVN---PPPQYQPPHEKPPHEHS 162
           PH  KP  E+ PP      PP EKPPP+++P    +  +    P P+++PP ++PP EH 
Sbjct: 44  PHGEKPLPEHKPPSPFGKPPPGEKPPPQHKPSDKTRKLLQVEKPLPEHKPPVKEPPTEHQ 103

Query: 163 PPGYQPPHEIPPPEHQPPHE--KPPHAKSPPEYQPPH---------EHPPPEYLPPHE-- 303
           PP   P  E P PEH+PP    KPP  + PP  Q P          E P PE+ PP    
Sbjct: 104 PPNEPPKGEKPVPEHKPPSPFGKPPQGEKPPPEQKPSDKTRNLLQGEKPLPEHKPPSPFG 163

Query: 304 KPPH-ENPPPEYNP----------PHEKPPHEHPSPEYQPPH-QKPPHE-----NPPPKF 432
           KPP  E PPPE+ P            + P H+ PSP  +PP  QKPP       +PP + 
Sbjct: 164 KPPQGEKPPPEHKPSDKTRNLLEGEKQLPEHKPPSPLGKPPKGQKPPPSGHNPGHPPAES 223

Query: 433 QPPNEKPPHEKSPPAS 480
              + KPP +  PP++
Sbjct: 224 AEESYKPPQKNMPPST 239

 Score =  109 bits (272), Expect = 1e-22
 Identities = 70/178 (39%), Positives = 86/178 (48%), Gaps = 20/178 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHE-----KPPPEYQPPH--GKQPHVNPPPQYQPPH------- 138
           P H KPP + PP E+QPP+E     KP PE++PP   GK P    PP  Q P        
Sbjct: 89  PEH-KPPVKEPPTEHQPPNEPPKGEKPVPEHKPPSPFGKPPQGEKPPPEQKPSDKTRNLL 147

Query: 139 --EKPPHEHSPP---GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPH- 300
             EKP  EH PP   G  P  E PPPEH+P  +K  +     +  P H+ P P   PP  
Sbjct: 148 QGEKPLPEHKPPSPFGKPPQGEKPPPEHKPS-DKTRNLLEGEKQLPEHKPPSPLGKPPKG 206

Query: 301 EKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           +KP    PP  +NP H  PP E     Y+PP +  P   P  K   P +KPPH+   P
Sbjct: 207 QKP----PPSGHNPGH--PPAESAEESYKPPQKNMPPSTPTKKPPAPTQKPPHKPPSP 258

 Score =  102 bits (254), Expect = 1e-20
 Identities = 64/157 (40%), Positives = 81/157 (51%), Gaps = 18/157 (11%)
 Frame = +1

Query: 55  HEKPPPEYQPPHGKQPHVNPPPQYQP-PHEKPPHEHSPPGYQPPHEIPPPEHQPPHE--K 225
           + K PP  +PP   QP   PP   +P P  KPP   SP G  PP E PPP+H+P  +  K
Sbjct: 24  YPKHPPLQKPPTQHQPPTKPPHGEKPLPEHKPP---SPFGKPPPGEKPPPQHKPSDKTRK 80

Query: 226 PPHAKSP-PEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHE--KPPH-EHPSPEYQPP 393
               + P PE++PP + PP E+ PP+E P  E P PE+ PP    KPP  E P PE +P 
Sbjct: 81  LLQVEKPLPEHKPPVKEPPTEHQPPNEPPKGEKPVPEHKPPSPFGKPPQGEKPPPEQKPS 140

Query: 394 HQK----------PPHENPPPKFQPP-NEKPPHEKSP 471
            +           P H+ P P  +PP  EKPP E  P
Sbjct: 141 DKTRNLLQGEKPLPEHKPPSPFGKPPQGEKPPPEHKP 177

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 57/137 (41%), Positives = 72/137 (52%), Gaps = 21/137 (15%)
 Frame = +1

Query: 130 PPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEY------- 288
           PP +KPP +H PP   P  E P PEH+PP    P  K PP  +PP +H P +        
Sbjct: 28  PPLQKPPTQHQPPTKPPHGEKPLPEHKPP---SPFGKPPPGEKPPPQHKPSDKTRKLLQV 84

Query: 289 ---LPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQ--KPPH-ENPPPKFQPPN-- 444
              LP H KPP + PP E+ PP+E P  E P PE++PP    KPP  E PPP+ +P +  
Sbjct: 85  EKPLPEH-KPPVKEPPTEHQPPNEPPKGEKPVPEHKPPSPFGKPPQGEKPPPEQKPSDKT 143

Query: 445 ------EKPPHEKSPPA 477
                 EKP  E  PP+
Sbjct: 144 RNLLQGEKPLPEHKPPS 160

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 56/148 (37%), Positives = 71/148 (47%), Gaps = 24/148 (16%)
 Frame = +1

Query: 13  KPPY-ENPPPEYQPPH--------EKPPPEYQPPH--GKQPH-VNPPPQYQPPH------ 138
           KPP  E PPPE +P          EKP PE++PP   GK P    PPP+++P        
Sbjct: 126 KPPQGEKPPPEQKPSDKTRNLLQGEKPLPEHKPPSPFGKPPQGEKPPPEHKPSDKTRNLL 185

Query: 139 --EKPPHEHSPP---GYQPPHEIPPPE-HQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPH 300
             EK   EH PP   G  P  + PPP  H P H  PP   +   Y+PP ++ PP    P 
Sbjct: 186 EGEKQLPEHKPPSPLGKPPKGQKPPPSGHNPGH--PPAESAEESYKPPQKNMPPS--TPT 241

Query: 301 EKPPHENPPPEYNPPHEKPPHEHPSPEY 384
           +KPP          P +KPPH+ PSP +
Sbjct: 242 KKPP---------APTQKPPHKPPSPTH 260

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 39/99 (39%), Positives = 50/99 (50%), Gaps = 17/99 (17%)
 Frame = +1

Query: 232 HAKSPPEYQPPHEHPPPEYLPPHEKP-PHENPPPEYN--PPHEKPPHEH----------- 369
           + K PP  +PP +H PP   P  EKP P   PP  +   PP EKPP +H           
Sbjct: 24  YPKHPPLQKPPTQHQPPTKPPHGEKPLPEHKPPSPFGKPPPGEKPPPQHKPSDKTRKLLQ 83

Query: 370 ---PSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              P PE++PP ++PP E+ PP   P  EKP  E  PP+
Sbjct: 84  VEKPLPEHKPPVKEPPTEHQPPNEPPKGEKPVPEHKPPS 122

[101][TOP]
>UniRef100_Q9SPM1 Extensin-like protein n=1 Tax=Solanum lycopersicum RepID=Q9SPM1_SOLLC
          Length = 711

 Score =  116 bits (291), Expect = 7e-25
 Identities = 77/185 (41%), Positives = 82/185 (44%), Gaps = 26/185 (14%)
 Frame = +1

Query: 1    PHHAKPP--YENPPPEYQPP---HEKPPPEYQPP---HGKQP--HVNPPPQYQPP---HE 141
            P H+ PP     PPP + PP   H  PPP   PP   H   P  H  PPP + PP   H 
Sbjct: 484  PVHSPPPPVASPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPPVHS 543

Query: 142  KPPHEHSPP---GYQPP--HEIPPPEHQPP---HEKPPHAKSPPEYQPPHEHPPPEYLPP 297
             PP  HSPP      PP  H  PPP H PP   H  PP   SPP   P H  PPP  +  
Sbjct: 544  PPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPPVASPPP--PVHSPPPPPPVAS 601

Query: 298  HEKPPHENPPPEYNPPHEKPPHEHPSPEYQPP---HQKPP--HENPPPKFQPPNEKPPHE 462
               P H  PPP  +PP   P H  P P   PP   H  PP  H  PPP   PP   PP  
Sbjct: 602  PPPPVHSPPPPVASPP--PPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPP---PPVA 656

Query: 463  KSPPA 477
              PPA
Sbjct: 657  SPPPA 661

 Score =  116 bits (291), Expect = 7e-25
 Identities = 71/165 (43%), Positives = 77/165 (46%), Gaps = 6/165 (3%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPP 183
           H   PP  +PPP   P H  PPP + PP    P  +PPP   P H  PP  HSPP   P 
Sbjct: 486 HSPPPPVASPPP---PVHSPPPPVHSPP---PPVASPPP---PVHSPPPPVHSPP--PPV 534

Query: 184 HEIPPPEHQPP---HEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP--- 345
           H  PPP H PP   H  PP   SPP   P H  PPP + PP   P H  PPP  +PP   
Sbjct: 535 HSPPPPVHSPPPPVHSPPPPVASPPP--PVHSPPPPVHSPP--PPVHSPPPPVASPPPPV 590

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
           H  PP   P P   PP   P H  PPP   PP   P H   PP +
Sbjct: 591 HSPPP---PPPVASPP--PPVHSPPPPVASPP--PPVHSPPPPVA 628

 Score =  114 bits (286), Expect = 3e-24
 Identities = 75/173 (43%), Positives = 81/173 (46%), Gaps = 15/173 (8%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPHEKPPPEYQPP---HGKQPHVN--PPPQYQPP---HEKPPHEH 159
           H   PP  +PPP   P H  PPP + PP   H   P V   PPP + PP   H  PP  H
Sbjct: 521 HSPPPPVHSPPP---PVHSPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVH 577

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN 339
           SPP   P    PPP H PP   PP   SPP   P H  PPP   PP   P H  PPP  +
Sbjct: 578 SPP--PPVASPPPPVHSPP--PPPPVASPPP--PVHSPPPPVASPP--PPVHSPPPPVAS 629

Query: 340 PP---HEKPP--HEHPSPEYQPPHQKPPHENPPPK--FQPPNEKPPHEKSPPA 477
           PP   H  PP  H  P P + PP   PP  +PPP   F PP   P H   PPA
Sbjct: 630 PPPPVHSPPPPVHSPPPPVHSPP---PPVASPPPALVFSPP--PPVHSPPPPA 677

 Score =  112 bits (280), Expect = 1e-23
 Identities = 74/176 (42%), Positives = 80/176 (45%), Gaps = 18/176 (10%)
 Frame = +1

Query: 1   PHHAKPP--YENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPP---HEKPPHEHSP 165
           P H+ PP     PPP + PP   PPP   PP     H  PPP   PP   H  PP  HSP
Sbjct: 455 PVHSPPPPVASPPPPVHSPP---PPPVASPP--PPVHSPPPPVASPPPPVHSPPPPVHSP 509

Query: 166 P---GYQPP--HEIPPPEHQPP---HEKPPHAKSPPEYQPPHEHPPPEYLPP---HEKPP 312
           P      PP  H  PPP H PP   H  PP   SPP   P H  PPP   PP   H  PP
Sbjct: 510 PPPVASPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP--PVHSPPPPVASPPPPVHSPPP 567

Query: 313 --HENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
             H  PPP ++PP   PP   P P    P   PP  +PPP   P +  PP   SPP
Sbjct: 568 PVHSPPPPVHSPP---PPVASPPPPVHSPPPPPPVASPPP---PVHSPPPPVASPP 617

 Score =  110 bits (275), Expect = 5e-23
 Identities = 72/177 (40%), Positives = 80/177 (45%), Gaps = 19/177 (10%)
 Frame = +1

Query: 1   PHHAKPP---YENPPPEYQPPH---EKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHS 162
           P H+ PP      PPP + PP      PPP + PP    P  +PPP   P H  PP   S
Sbjct: 440 PVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPP--PPPVASPPP---PVHSPPPPVAS 494

Query: 163 PPGYQPPHEIPPPEHQPPH---EKPPHAKSPPEYQPPHEHPPPEYLPP---HEKPP--HE 318
           PP   P H  PPP H PP      PP   SPP   P H  PPP + PP   H  PP  H 
Sbjct: 495 PP--PPVHSPPPPVHSPPPPVASPPPPVHSPPP--PVHSPPPPVHSPPPPVHSPPPPVHS 550

Query: 319 NPPPEYNPP---HEKPP--HEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
            PPP  +PP   H  PP  H  P P + PP   PP  +PPP    P   PP    PP
Sbjct: 551 PPPPVASPPPPVHSPPPPVHSPPPPVHSPP---PPVASPPPPVHSPPPPPPVASPPP 604

 Score =  105 bits (263), Expect = 1e-21
 Identities = 74/176 (42%), Positives = 79/176 (44%), Gaps = 18/176 (10%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P   KP    PPP+  PP   PPP+  PP     H  PPP    P   PP  HSPP   P
Sbjct: 413 PTTPKPNPSPPPPKTLPP---PPPKTSPP--PPVHSPPPPPVASP---PPPVHSPP--PP 462

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPP---HEKPP--HENPPPEYNPP 345
               PPP H PP   PP   SPP   P H  PPP   PP   H  PP  H  PPP  +PP
Sbjct: 463 VASPPPPVHSPP---PPPVASPPP--PVHSPPPPVASPPPPVHSPPPPVHSPPPPVASPP 517

Query: 346 ---HEKPP--HEHPSPEYQPP---HQKPP--HENPPPKFQPP---NEKPPHEKSPP 474
              H  PP  H  P P + PP   H  PP  H  PPP   PP   +  PP   SPP
Sbjct: 518 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPVHSPP 573

 Score =  105 bits (261), Expect = 2e-21
 Identities = 72/168 (42%), Positives = 77/168 (45%), Gaps = 15/168 (8%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVN--PPPQYQPPHEKPPHEHSPPGYQPPHE 189
           PP  +PPP   PP   PPP   P H   P V   PPP + PP   PP   SPP   P H 
Sbjct: 439 PPVHSPPP---PPVASPPP---PVHSPPPPVASPPPPVHSPP---PPPVASPP--PPVHS 487

Query: 190 IPPPEHQPP---HEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPP--HENPPPEYNPP--- 345
            PPP   PP   H  PP   SPP   PP   PPP   P H  PP  H  PPP ++PP   
Sbjct: 488 PPPPVASPPPPVHSPPPPVHSPP---PPVASPPP---PVHSPPPPVHSPPPPVHSPPPPV 541

Query: 346 HEKPP--HEHPSPEYQPPHQKPPHENPPPKFQPP---NEKPPHEKSPP 474
           H  PP  H  P P   PP   P H  PPP   PP   +  PP   SPP
Sbjct: 542 HSPPPPVHSPPPPVASPP--PPVHSPPPPVHSPPPPVHSPPPPVASPP 587

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 59/167 (35%), Positives = 67/167 (40%), Gaps = 15/167 (8%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPP 198
           P  + P +    H     E Q P      V PP    P   KP     PP   PP   PP
Sbjct: 376 PVVSKPVDCSKGHCGVSREGQSPKDPPKTVTPPKPSTPTTPKPNPSPPPPKTLPP---PP 432

Query: 199 PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN----PPHEKPP-- 360
           P+  PP   P H+  PP    P   PPP + PP   PP  +PPP  +    PP   PP  
Sbjct: 433 PKTSPP--PPVHSPPPPPVASP---PPPVHSPP---PPVASPPPPVHSPPPPPVASPPPP 484

Query: 361 -HEHPSPEYQPP---HQKPP--HENPPPKFQPP---NEKPPHEKSPP 474
            H  P P   PP   H  PP  H  PPP   PP   +  PP   SPP
Sbjct: 485 VHSPPPPVASPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPVHSPP 531

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 47/116 (40%), Positives = 51/116 (43%), Gaps = 11/116 (9%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPP---HEKPPHEHSPPGYQPPH 186
           PP  +PPP   P H  PPP   PP     H  PPP   PP   H  PP  HSPP   P H
Sbjct: 597 PPVASPPP---PVHSPPPPVASPP--PPVHSPPPPVASPPPPVHSPPPPVHSPP--PPVH 649

Query: 187 EIPPPEHQPP----HEKPPHAKSPPEYQPPHEHPPPEY----LPPHEKPPHENPPP 330
             PPP   PP       PP   SPP   P    PPP +    LPP     + +PPP
Sbjct: 650 SPPPPVASPPPALVFSPPPPVHSPPPPAPVMSPPPPTFEDVALPPTLGSLYASPPP 705

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 47/133 (35%), Positives = 54/133 (40%), Gaps = 6/133 (4%)
 Frame = +1

Query: 100 PHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP 279
           P V+ P      H     E   P   P    PP    P   KP  +  PP+  PP   PP
Sbjct: 376 PVVSKPVDCSKGHCGVSREGQSPKDPPKTVTPPKPSTPTTPKPNPSPPPPKTLPP---PP 432

Query: 280 PEYLPPHEKPPHENPPPEYNPPHEKPP---HEHPSPEYQPPHQKPPHENPPPKFQPPNEK 450
           P+  PP   PP  +PPP   PP   PP   H  P P   PP   PP  +PPP   PP   
Sbjct: 433 PKTSPP---PPVHSPPP---PPVASPPPPVHSPPPPVASPP---PPVHSPPP---PPVAS 480

Query: 451 PP---HEKSPPAS 480
           PP   H   PP +
Sbjct: 481 PPPPVHSPPPPVA 493

[102][TOP]
>UniRef100_Q9KK45 Surface protein PspC n=1 Tax=Streptococcus pneumoniae
           RepID=Q9KK45_STRPN
          Length = 587

 Score =  115 bits (289), Expect = 1e-24
 Identities = 68/162 (41%), Positives = 78/162 (48%), Gaps = 8/162 (4%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE +P  EKP PE +P P   +P VNP P+   P  KP  E   P  +P  E
Sbjct: 363 KPQPEKPKPEVKPQLEKPKPEVKPQPEKPKPEVNPQPEKPKPEVKPQPEKPKPEVKPQPE 422

Query: 190 IPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLP------PHEKPPHENPPPEYNPPHE 351
            P PE +P  EKP      PE +P  E P PE  P      P  KP  E P PE  P  E
Sbjct: 423 KPKPEVKPQPEKPK-----PEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPE 477

Query: 352 KP-PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           KP P   P PE   P  KP  E P P+ +P  EKP  + S P
Sbjct: 478 KPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPDNSKP 519

 Score =  114 bits (286), Expect = 3e-24
 Identities = 65/152 (42%), Positives = 72/152 (47%), Gaps = 3/152 (1%)
 Frame = +1

Query: 25  ENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPP 201
           E P PE +P  EKP PE +P P   +P V P P+   P  KP  E   P  +P  E P P
Sbjct: 334 EKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQLEKPKPEVKPQPEKPKP 393

Query: 202 EHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PHEHPS 375
           E  P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P   P 
Sbjct: 394 EVNPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQ 453

Query: 376 PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           PE   P  KP  E P P+ +P  EKP  E  P
Sbjct: 454 PEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 485

 Score =  114 bits (286), Expect = 3e-24
 Identities = 66/156 (42%), Positives = 74/156 (47%), Gaps = 3/156 (1%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQPPHGK-QPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE +P  EKP PE +P   K +P V P P+   P   P  E   P  +P  E
Sbjct: 352 KPQPEKPKPEVKPQPEKPKPEVKPQLEKPKPEVKPQPEKPKPEVNPQPEKPKPEVKPQPE 411

Query: 190 IPPPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PH 363
            P PE +P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P 
Sbjct: 412 KPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPE 471

Query: 364 EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             P PE   P  KP  E P P+ +P  EKP  E  P
Sbjct: 472 VKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 507

 Score =  114 bits (285), Expect = 3e-24
 Identities = 66/156 (42%), Positives = 73/156 (46%), Gaps = 3/156 (1%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE +P  EKP PE +P P   +P V P  +   P  KP  E   P   P  E
Sbjct: 341 KPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQLEKPKPEVKPQPEKPKPEVNPQPE 400

Query: 190 IPPPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PH 363
            P PE +P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P 
Sbjct: 401 KPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPE 460

Query: 364 EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             P PE   P  KP  E P P+ +P  EKP  E  P
Sbjct: 461 VKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 496

 Score =  105 bits (262), Expect = 2e-21
 Identities = 62/149 (41%), Positives = 73/149 (48%), Gaps = 2/149 (1%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE  P  EKP PE +P P   +P V P P+   P  KP  E   P  +P  E
Sbjct: 385 KPQPEKPKPEVNPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPE 444

Query: 190 IPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP-PHENPPPEYNPPHEKPPHE 366
            P PE +P  EKP      PE +P  E P PE  P  EKP P   P PE   P  KP  E
Sbjct: 445 KPKPEVKPQPEKP-----KPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPE 499

Query: 367 HPSPEYQPPHQKPPHENPPPKFQPPNEKP 453
            P PE +P  +KP  +N  P  Q  ++KP
Sbjct: 500 KPKPEVKPQPEKPKPDNSKP--QADDKKP 526

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 61/154 (39%), Positives = 73/154 (47%), Gaps = 3/154 (1%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEI 192
           P  E P PE +P  EKP PE +P P   +P V P P+   P  KP  E   P  +P  E 
Sbjct: 397 PQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEK 456

Query: 193 PPPEHQPPHEKP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEH 369
           P PE +P  EKP P  K  PE   P   P PE   P  KP  E P PE  P  EKP  ++
Sbjct: 457 PKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPDN 516

Query: 370 PSPEYQPPHQKPPHENPPPK-FQPPNEKPPHEKS 468
             P  Q   +KP   N   K  QP N+   +EK+
Sbjct: 517 SKP--QADDKKPSTTNNLSKDKQPSNQASTNEKA 548

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 60/165 (36%), Positives = 73/165 (44%), Gaps = 17/165 (10%)
 Frame = +1

Query: 28  NPPPEYQPPHEKPPPEYQPPHGKQPHVN---------PPPQYQPPHEKPPHEHSPPGYQP 180
           +P PE +P   +P  + Q  +  Q + N         P P+ +P  EKP  E  P   +P
Sbjct: 302 SPQPEVKP---QPKNQNQRLNRNQKNQNQRLNRNLEKPKPEVKPQPEKPKPEVKPQPEKP 358

Query: 181 PHEIPP-PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLP------PHEKPPHENPPPEYN 339
             E+ P PE   P  KP   K  PE +P  E P PE  P      P  KP  E P PE  
Sbjct: 359 KPEVKPQPEKPKPEVKPQLEKPKPEVKPQPEKPKPEVNPQPEKPKPEVKPQPEKPKPEVK 418

Query: 340 PPHEKP-PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           P  EKP P   P PE   P  KP  E P P+ +P  EKP  E  P
Sbjct: 419 PQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 463

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 60/166 (36%), Positives = 71/166 (42%), Gaps = 9/166 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQP-PHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           P + KP       +  P P  KP P+ Q     +   N   +     EKP  E  P   +
Sbjct: 287 PGNKKPSAPKTGMQPSPQPEVKPQPKNQNQRLNRNQKNQNQRLNRNLEKPKPEVKPQPEK 346

Query: 178 PPHEIPP-PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKP-PHENPPPEYNPPHE 351
           P  E+ P PE   P  KP   K  PE +P  E P PE  P  EKP P  NP PE   P  
Sbjct: 347 PKPEVKPQPEKPKPEVKPQPEKPKPEVKPQLEKPKPEVKPQPEKPKPEVNPQPEKPKPEV 406

Query: 352 KPPHEHPSPEYQP------PHQKPPHENPPPKFQPPNEKPPHEKSP 471
           KP  E P PE +P      P  KP  E P P+ +P  EKP  E  P
Sbjct: 407 KPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 452

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 56/148 (37%), Positives = 71/148 (47%), Gaps = 6/148 (4%)
 Frame = +1

Query: 13  KPPYENPPPEYQPPHEKPPPEYQP-PHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHE 189
           KP  E P PE +P  EKP PE +P P   +P V P P+   P  KP  E   P  +P  E
Sbjct: 418 KPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPE 477

Query: 190 IPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPH-- 363
            P PE +P  EKP      PE +P  E P PE  P  EKP  +N  P+ +   +K P   
Sbjct: 478 KPKPEVKPQPEKP-----KPEVKPQPEKPKPEVKPQPEKPKPDNSKPQAD---DKKPSTT 529

Query: 364 EHPSPEYQPPHQKPPHE---NPPPKFQP 438
            + S + QP +Q   +E   N P K  P
Sbjct: 530 NNLSKDKQPSNQASTNEKATNKPKKSLP 557

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 53/145 (36%), Positives = 64/145 (44%), Gaps = 3/145 (2%)
 Frame = +1

Query: 46  QPPHEKPP-PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHE 222
           +P ++KP  P+       QP V P P+ Q        ++         E P PE +P  E
Sbjct: 286 EPGNKKPSAPKTGMQPSPQPEVKPQPKNQNQRLNRNQKNQNQRLNRNLEKPKPEVKPQPE 345

Query: 223 KP-PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKP-PHEHPSPEYQPPH 396
           KP P  K  PE   P   P PE   P  KP  E P PE  P  EKP P  +P PE   P 
Sbjct: 346 KPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQLEKPKPEVKPQPEKPKPEVNPQPEKPKPE 405

Query: 397 QKPPHENPPPKFQPPNEKPPHEKSP 471
            KP  E P P+ +P  EKP  E  P
Sbjct: 406 VKPQPEKPKPEVKPQPEKPKPEVKP 430

[103][TOP]
>UniRef100_Q41289 Putative proline-rich protein n=1 Tax=Solanum palustre
           RepID=Q41289_SOLBR
          Length = 407

 Score =  115 bits (289), Expect = 1e-24
 Identities = 71/171 (41%), Positives = 85/171 (49%), Gaps = 11/171 (6%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQ-YQPPHEKPPHEHSPPGYQ 177
           P H K P +  PP  QPPH KPP   + P    PHV PP    QPP+ +PP   + P Y 
Sbjct: 35  PKHPKLPXKVKPPSTQPPHVKPPSTPKYPKDP-PHVKPPSTPKQPPYVRPP---TTPKY- 89

Query: 178 PPHEIPPPEHQPPHEKPP----HAKSPPEYQPPHEHPPPEYLPP---HEKPPHENPP--P 330
           PPH + PP  QPPH KPP    + K PP  +PP     P Y+ P    + PPH  PP  P
Sbjct: 90  PPH-VKPPSTQPPHVKPPSTPKYPKDPPHVKPPSTPKQPPYVKPPTTPKYPPHVKPPSTP 148

Query: 331 EYNPPHEKPPHEHPSPEYQPPHQKPPH-ENPPPKFQPPNEKPPHEKSPPAS 480
           ++ P    PP  H  P  +PP  KPPH   PP    PP   PP    PP +
Sbjct: 149 KHPPQKPCPPPSHHGP--KPPILKPPHVPRPPIVHPPPIVSPPSTPKPPTT 197

 Score =  109 bits (272), Expect = 1e-22
 Identities = 71/177 (40%), Positives = 80/177 (45%), Gaps = 24/177 (13%)
 Frame = +1

Query: 13  KPPYENPP-----------PEYQPPHEKPP--PEY--QPPHGK-------QPHVNPP--P 120
           +PPY  PP           P  QPPH KPP  P+Y   PPH K        P+V PP  P
Sbjct: 77  QPPYVRPPTTPKYPPHVKPPSTQPPHVKPPSTPKYPKDPPHVKPPSTPKQPPYVKPPTTP 136

Query: 121 QYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPH 300
           +Y PPH KPP   S P + P    PPP H  P  KPP  K P   +PP  HPPP   PP 
Sbjct: 137 KY-PPHVKPP---STPKHPPQKPCPPPSHHGP--KPPILKPPHVPRPPIVHPPPIVSPPS 190

Query: 301 EKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
              P   PP    PP   PP   P   Y P    PP  +PP   +PP+  PP    P
Sbjct: 191 TPKPPTTPPFTPKPPSPTPPIVSPPIVYPPITPIPPIVHPPVTPKPPSPTPPIVSPP 247

 Score =  100 bits (249), Expect = 5e-20
 Identities = 68/159 (42%), Positives = 75/159 (47%), Gaps = 22/159 (13%)
 Frame = +1

Query: 64  PPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGY--QPPHEIPP-PEHQPPHEK--- 225
           P P   P H K P    PP  QPPH KPP   S P Y   PPH  PP    QPP+ +   
Sbjct: 29  PYPPSTPKHPKLPXKVKPPSTQPPHVKPP---STPKYPKDPPHVKPPSTPKQPPYVRPPT 85

Query: 226 ----PPHAKSPPEYQPPHEHPP--PEYL--PPHEKPPHENPPPEY--------NPPHEKP 357
               PPH K PP  QPPH  PP  P+Y   PPH KPP     P Y         PPH KP
Sbjct: 86  TPKYPPHVK-PPSTQPPHVKPPSTPKYPKDPPHVKPPSTPKQPPYVKPPTTPKYPPHVKP 144

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P    +P++ P    PP  +  PK  PP  KPPH   PP
Sbjct: 145 P---STPKHPPQKPCPPPSHHGPK--PPILKPPHVPRPP 178

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 68/191 (35%), Positives = 77/191 (40%), Gaps = 33/191 (17%)
 Frame = +1

Query: 1   PHHAKPPYENPP-------PEY--QPPHEKPPPE-YQPPHGKQP-------HVNPP--PQ 123
           P H KPP   PP       P+Y   PPH KPP    QPP+ K P       HV PP  P+
Sbjct: 90  PPHVKPPSTQPPHVKPPSTPKYPKDPPHVKPPSTPKQPPYVKPPTTPKYPPHVKPPSTPK 149

Query: 124 YQPPHEKPPHEH---SPPGYQPPHE-----------IPPPEHQPPHEKPPHAKSPPEYQP 261
           + P    PP  H    PP  +PPH            + PP    P   PP    PP   P
Sbjct: 150 HPPQKPCPPPSHHGPKPPILKPPHVPRPPIVHPPPIVSPPSTPKPPTTPPFTPKPPSPTP 209

Query: 262 PHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPP 441
           P   PP  Y P    PP  +PP    PP   PP   P   Y P    PP  +PP    PP
Sbjct: 210 PIVSPPIVYPPITPIPPIVHPPVTPKPPSPTPPIVSPPIVYAPITPTPPIVSPPITPTPP 269

Query: 442 NEKPPHEKSPP 474
              PP   +PP
Sbjct: 270 IVSPPFVPNPP 280

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 73/208 (35%), Positives = 80/208 (38%), Gaps = 47/208 (22%)
 Frame = +1

Query: 1   PHHAKPP----YENPPPEY-------QPPHEKPP--PEYQPPHGKQPHVN--------PP 117
           P H KPP    Y   PP         QPP+ KPP  P+Y PPH K P           PP
Sbjct: 100 PPHVKPPSTPKYPKDPPHVKPPSTPKQPPYVKPPTTPKY-PPHVKPPSTPKHPPQKPCPP 158

Query: 118 PQY---QPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEY 288
           P +   +PP  KPPH   PP   PP  + PP    P   PP    PP   PP   PP  Y
Sbjct: 159 PSHHGPKPPILKPPHVPRPPIVHPPPIVSPPSTPKPPTTPPFTPKPPSPTPPIVSPPIVY 218

Query: 289 -----LPP------HEKPPHENPP---PEY-------NPPHEKPPHEHPSPEYQPPH-QK 402
                +PP        KPP   PP   P          PP   PP     P   PP    
Sbjct: 219 PPITPIPPIVHPPVTPKPPSPTPPIVSPPIVYAPITPTPPIVSPPITPTPPIVSPPFVPN 278

Query: 403 PPHENPPPKF-QPPNEKPPHEKSPPASC 483
           PP   PPP    PP   PP   +PP  C
Sbjct: 279 PPVVIPPPYVPSPPVVTPPIVPTPPTPC 306

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 57/157 (36%), Positives = 61/157 (38%), Gaps = 3/157 (1%)
 Frame = +1

Query: 16  PPYENP-PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEI 192
           P +  P PP  +PPH   PP   PP    P   P P   PP    P   +PP   PP   
Sbjct: 159 PSHHGPKPPILKPPHVPRPPIVHPPPIVSPPSTPKPPTTPPFTPKPPSPTPPIVSPPIVY 218

Query: 193 PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHP 372
           PP    PP   PP    PP   PP   PP  Y P    PP  +PP    PP   PP    
Sbjct: 219 PPITPIPPIVHPPVTPKPPSPTPPIVSPPIVYAPITPTPPIVSPPITPTPPIVSPPFVPN 278

Query: 373 SPEYQPPH--QKPPHENPPPKFQPPNEKPPHEKSPPA 477
            P   PP     PP   PP    PP   PP    PPA
Sbjct: 279 PPVVIPPPYVPSPPVVTPPIVPTPPTPCPP---PPPA 312

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 58/160 (36%), Positives = 65/160 (40%), Gaps = 2/160 (1%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           PH  +PP  +PPP   PP    PP   PP   +P    PP   PP   PP    PP   P
Sbjct: 172 PHVPRPPIVHPPPIVSPPSTPKPPT-TPPFTPKPPSPTPPIVSPPIVYPPITPIPPIVHP 230

Query: 181 PHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPH-ENPPPEYNPPH-EK 354
           P    PP   PP   PP   +P    PP   PP    PP   PP   NPP    PP+   
Sbjct: 231 PVTPKPPSPTPPIVSPPIVYAPITPTPPIVSPPITPTPPIVSPPFVPNPPVVIPPPYVPS 290

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           PP   P     PP   PP   PPP   P    PP + + P
Sbjct: 291 PPVVTPPIVPTPPTPCPP---PPPAIIP---SPPAQPTCP 324

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 61/165 (36%), Positives = 66/165 (40%), Gaps = 7/165 (4%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP-----PQYQPPHEKPPHEHSPP 168
           H  KPP   PP   +PP   PPP   PP   +P   PP     P   PP   PP  + P 
Sbjct: 162 HGPKPPILKPPHVPRPPIVHPPPIVSPPSTPKPPTTPPFTPKPPSPTPPIVSPPIVYPPI 221

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
              PP   PP   +PP   PP    P  Y P    PP    P    PP  +PP   NPP 
Sbjct: 222 TPIPPIVHPPVTPKPPSPTPPIVSPPIVYAPITPTPPIVSPPITPTPPIVSPPFVPNPPV 281

Query: 349 EKPPHEHPSPEYQPPH--QKPPHENPPPKFQPPNEKPPHEKSPPA 477
             PP   PSP    P     PP   PPP   PP   P    SPPA
Sbjct: 282 VIPPPYVPSPPVVTPPIVPTPPTPCPPP---PPAIIP----SPPA 319

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 36/86 (41%), Positives = 46/86 (53%), Gaps = 5/86 (5%)
 Frame = +1

Query: 229 PHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPP--PEY--NPPHEKPPHEHPSPEYQPPH 396
           P+   PP   P H   P +  PP  +PPH  PP  P+Y  +PPH KP    PS   QPP+
Sbjct: 26  PYCPYPPS-TPKHPKLPXKVKPPSTQPPHVKPPSTPKYPKDPPHVKP----PSTPKQPPY 80

Query: 397 QKPP-HENPPPKFQPPNEKPPHEKSP 471
            +PP     PP  +PP+ +PPH K P
Sbjct: 81  VRPPTTPKYPPHVKPPSTQPPHVKPP 106

[104][TOP]
>UniRef100_UPI00019834A9 PREDICTED: similar to merlot proline-rich protein 2 isoform 1 n=1
           Tax=Vitis vinifera RepID=UPI00019834A9
          Length = 262

 Score =  115 bits (288), Expect = 2e-24
 Identities = 80/217 (36%), Positives = 102/217 (47%), Gaps = 57/217 (26%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPP-----HEKPPPEYQPPH--GKQPH-VNPPPQYQP-------- 132
           P H  PP + PP E+QPP      EKP PE++PP   GK P    PPPQ++P        
Sbjct: 25  PKH--PPLQKPPTEHQPPIKPPNGEKPLPEHKPPSPFGKPPQGEKPPPQHKPSDKTRKLL 82

Query: 133 -----------PHEKPPHEHSPPGYQPPHEIPPPEHQPPHE--KPPHAKSPPEYQPPH-- 267
                      P ++PP EH PP   P  E P PEH+PP    KPP  + PP  Q P   
Sbjct: 83  QVEKPLPEHKPPVKEPPTEHQPPNEPPKGEKPVPEHKPPSPFGKPPQGEKPPPEQKPSDK 142

Query: 268 -------EHPPPEYLPPHE--KPPH-ENPPPEYNP----------PHEKPPHEHPSPEYQ 387
                  E P PE+ PP    KPP  E PPPE+ P            + P H+ PSP  +
Sbjct: 143 TRNLLQGEKPLPEHKPPSPFGKPPQGEKPPPEHKPSDKTRNLLEGEKQLPEHKPPSPLGK 202

Query: 388 PPH-QKPPHE-----NPPPKFQPPNEKPPHEKSPPAS 480
           PP  QKPP       +PP +    + KPP + +PP++
Sbjct: 203 PPKGQKPPPSGHNPGHPPAESAEDSYKPPQKITPPST 239

 Score =  108 bits (270), Expect = 2e-22
 Identities = 70/178 (39%), Positives = 86/178 (48%), Gaps = 20/178 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHE-----KPPPEYQPPH--GKQPHVNPPPQYQPPH------- 138
           P H KPP + PP E+QPP+E     KP PE++PP   GK P    PP  Q P        
Sbjct: 89  PEH-KPPVKEPPTEHQPPNEPPKGEKPVPEHKPPSPFGKPPQGEKPPPEQKPSDKTRNLL 147

Query: 139 --EKPPHEHSPP---GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPH- 300
             EKP  EH PP   G  P  E PPPEH+P  +K  +     +  P H+ P P   PP  
Sbjct: 148 QGEKPLPEHKPPSPFGKPPQGEKPPPEHKPS-DKTRNLLEGEKQLPEHKPPSPLGKPPKG 206

Query: 301 EKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           +KP    PP  +NP H  PP E     Y+PP +  P   P  K   P +KPPH+   P
Sbjct: 207 QKP----PPSGHNPGH--PPAESAEDSYKPPQKITPPSTPTKKPPAPTQKPPHKPPSP 258

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 56/148 (37%), Positives = 70/148 (47%), Gaps = 24/148 (16%)
 Frame = +1

Query: 13  KPPY-ENPPPEYQPPH--------EKPPPEYQPPH--GKQPH-VNPPPQYQPPH------ 138
           KPP  E PPPE +P          EKP PE++PP   GK P    PPP+++P        
Sbjct: 126 KPPQGEKPPPEQKPSDKTRNLLQGEKPLPEHKPPSPFGKPPQGEKPPPEHKPSDKTRNLL 185

Query: 139 --EKPPHEHSPP---GYQPPHEIPPPE-HQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPH 300
             EK   EH PP   G  P  + PPP  H P H  PP   +   Y+PP +  PP    P 
Sbjct: 186 EGEKQLPEHKPPSPLGKPPKGQKPPPSGHNPGH--PPAESAEDSYKPPQKITPPS--TPT 241

Query: 301 EKPPHENPPPEYNPPHEKPPHEHPSPEY 384
           +KPP          P +KPPH+ PSP +
Sbjct: 242 KKPP---------APTQKPPHKPPSPTH 260

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 40/99 (40%), Positives = 50/99 (50%), Gaps = 17/99 (17%)
 Frame = +1

Query: 232 HAKSPPEYQPPHEHPPPEYLPPHEK--PPHENPPPEYNPPH-EKPPHEH----------- 369
           + K PP  +PP EH PP   P  EK  P H+ P P   PP  EKPP +H           
Sbjct: 24  YPKHPPLQKPPTEHQPPIKPPNGEKPLPEHKPPSPFGKPPQGEKPPPQHKPSDKTRKLLQ 83

Query: 370 ---PSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPA 477
              P PE++PP ++PP E+ PP   P  EKP  E  PP+
Sbjct: 84  VEKPLPEHKPPVKEPPTEHQPPNEPPKGEKPVPEHKPPS 122

[105][TOP]
>UniRef100_Q9M4I1 Putative proline-rich cell wall protein n=1 Tax=Vitis vinifera
           RepID=Q9M4I1_VITVI
          Length = 217

 Score =  115 bits (288), Expect = 2e-24
 Identities = 75/183 (40%), Positives = 92/183 (50%), Gaps = 25/183 (13%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPH-EKPPHEHSPPG-- 171
           P +  PP   PPPEY+P    P P Y+PP  ++P   P P Y+PP  EKPP E+ PP   
Sbjct: 37  PVYKSPPLGKPPPEYKP----PTPVYKPPPVEKP---PTPVYRPPPVEKPPPEYKPPTPV 89

Query: 172 -YQPPHEIPPPEHQPP---HEKPPHAKSPPEYQPP---HEHPPPEYLPPHEKPPHENPPP 330
              PP E PPPE++PP   +  PP  K PPEY+PP      PPP++  P   P    PPP
Sbjct: 90  YKSPPVEKPPPEYKPPTPVYRPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPP 149

Query: 331 EYNPPH------EKPPHEHPSPEYQPPHQKPPHENPP--PKFQPPN-EKPP------HEK 465
              PP         PP + PSP +      PP E PP  P  +PP  EK P      H K
Sbjct: 150 TPKPPTLPPIIVRPPPTKEPSPPHGHYPGHPPVETPPSTPYKKPPTPEKKPWAPHHKHFK 209

Query: 466 SPP 474
           +PP
Sbjct: 210 APP 212

 Score =  110 bits (276), Expect = 4e-23
 Identities = 64/156 (41%), Positives = 82/156 (52%), Gaps = 11/156 (7%)
 Frame = +1

Query: 37  PEYQPPHEKPPPEYQPP---HGKQPHVNPPPQYQPP---HEKPPHEHSP-PGYQPPH-EI 192
           P     H+ PP E++PP   +   P   PPP+Y+PP   ++ PP E  P P Y+PP  E 
Sbjct: 19  PSLANDHKPPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEK 78

Query: 193 PPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPP---HEKPPH 363
           PPPE++PP    P  KSPP  +PP E+ PP   P +  PP E PPPEY PP      PP 
Sbjct: 79  PPPEYKPP---TPVYKSPPVEKPPPEYKPP--TPVYRPPPVEKPPPEYKPPTPVKPPPPP 133

Query: 364 EHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           +H +P   P   +PP    PP   P   +PP  K P
Sbjct: 134 KHKTPTLPPRVVRPPPTPKPPTLPPIIVRPPPTKEP 169

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 58/130 (44%), Positives = 72/130 (55%), Gaps = 22/130 (16%)
 Frame = +1

Query: 151 HEHSPPGYQ----------PPHEIPPPEHQPP---HEKPPHAKSP-PEYQPPH-EHPPPE 285
           ++H PP Y+          PP   PPPE++PP   ++ PP  K P P Y+PP  E PPPE
Sbjct: 23  NDHKPPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEKPPPE 82

Query: 286 YLPP---HEKPPHENPPPEYNPP---HEKPPHEHPSPEYQPPHQ-KPPHENPPPKFQPPN 444
           Y PP   ++ PP E PPPEY PP   +  PP E P PEY+PP   KPP   PPPK + P 
Sbjct: 83  YKPPTPVYKSPPVEKPPPEYKPPTPVYRPPPVEKPPPEYKPPTPVKPP---PPPKHKTPT 139

Query: 445 EKPPHEKSPP 474
             P   + PP
Sbjct: 140 LPPRVVRPPP 149

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 55/139 (39%), Positives = 68/139 (48%), Gaps = 20/139 (14%)
 Frame = +1

Query: 118 PQYQPPHEKPPHEHSPP---GYQPPHEIPPPEHQPPHE--KPPHAKSPPE--YQPPH-EH 273
           P     H+ PP+EH PP      PP   PPPE++PP    KPP  + PP   Y+PP  E 
Sbjct: 19  PSLANDHKPPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEK 78

Query: 274 PPPEYLPP---HEKPPHENPPPEYNPP---------HEKPPHEHPSPEYQPPHQKPPHEN 417
           PPPEY PP   ++ PP E PPPEY PP          + PP   P    +PP   PP ++
Sbjct: 79  PPPEYKPPTPVYKSPPVEKPPPEYKPPTPVYRPPPVEKPPPEYKPPTPVKPP---PPPKH 135

Query: 418 PPPKFQPPNEKPPHEKSPP 474
             P   P   +PP    PP
Sbjct: 136 KTPTLPPRVVRPPPTPKPP 154

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 39/102 (38%), Positives = 50/102 (49%), Gaps = 8/102 (7%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPH-----EKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           P   KPP   PPP+++ P       +PPP  +PP      V PPP  +P    PPH H P
Sbjct: 124 PTPVKPP---PPPKHKTPTLPPRVVRPPPTPKPPTLPPIIVRPPPTKEP---SPPHGHYP 177

Query: 166 PGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEH---PPP 282
               PP E PP     P++KPP  +  P + P H+H   PPP
Sbjct: 178 G--HPPVETPP---STPYKKPPTPEKKP-WAPHHKHFKAPPP 213

[106][TOP]
>UniRef100_Q9BIJ3 Putative microneme protein Sm70 (Fragment) n=1 Tax=Sarcocystis
           muris RepID=Q9BIJ3_SARMU
          Length = 349

 Score =  115 bits (288), Expect = 2e-24
 Identities = 80/176 (45%), Positives = 86/176 (48%), Gaps = 24/176 (13%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPP----PQYQPPHEKPPHEHSPPGYQPP 183
           PP   PP EY PP E PP EY PP G  P   PP    P+ +PP E PP E+ PPG  PP
Sbjct: 3   PPGGIPPEEY-PPGEVPPEEY-PPGGIPPEEYPPGEVPPEERPPGEVPPGEY-PPGGVPP 59

Query: 184 HEIP----PPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENP----P 327
            E P    PPE  PP   PP  + PP   PP E P    PPE +PP   PP E P    P
Sbjct: 60  EEYPPGGVPPEEIPPGGVPPE-EIPPGGVPPEEIPPGGVPPEEIPPEGVPPEEIPPGGVP 118

Query: 328 PEYNPPHEKPPHEHP----SPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSP 471
           PE  PP   PP E P     PE  PP   PP E P    PP+  PP   PP E  P
Sbjct: 119 PEEIPPGGVPPEEIPPGGVPPEEIPPGGVPPEEIPPGGVPPEEIPPEGVPPEEIPP 174

 Score =  115 bits (288), Expect = 2e-24
 Identities = 82/185 (44%), Positives = 87/185 (47%), Gaps = 27/185 (14%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQP---PHEKPPPEYQPPHGKQPHVNPPPQYQ----PPHEKP---- 147
           P    PP E PP EY P   P E+ PP   PP  + P   PP +Y     PP E P    
Sbjct: 8   PPEEYPPGEVPPEEYPPGGIPPEEYPPGEVPPEERPPGEVPPGEYPPGGVPPEEYPPGGV 67

Query: 148 PHEHSPPGYQPPHEIP----PPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHE 303
           P E  PPG  PP EIP    PPE  PP   PP  + PPE  PP E P    PPE +PP  
Sbjct: 68  PPEEIPPGGVPPEEIPPGGVPPEEIPPGGVPPE-EIPPEGVPPEEIPPGGVPPEEIPPGG 126

Query: 304 KPPHENP----PPEYNPPHEKPPHEHP----SPEYQPPHQKPPHENPPPKFQPPNEKPPH 459
            PP E P    PPE  PP   PP E P     PE  PP   PP E PP    PP E PP 
Sbjct: 127 VPPEEIPPGGVPPEEIPPGGVPPEEIPPGGVPPEEIPPEGVPPEEIPPGGV-PPGEVPP- 184

Query: 460 EKSPP 474
           E  PP
Sbjct: 185 EGVPP 189

 Score =  113 bits (282), Expect = 7e-24
 Identities = 81/178 (45%), Positives = 87/178 (48%), Gaps = 20/178 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNP----PPQYQPPHEKPPHEHSPP 168
           P   +PP E PP EY PP   PP EY PP G  P   P    PP+  PP   PP E  PP
Sbjct: 38  PPEERPPGEVPPGEY-PPGGVPPEEY-PPGGVPPEEIPPGGVPPEEIPPGGVPP-EEIPP 94

Query: 169 GYQPPHEIP----PPEHQPPHEKPPHAKSPPEYQPPHEHP----PPEYLPPHEKPPHENP 324
           G  PP EIP    PPE  PP   PP  + PP   PP E P    PPE +PP   PP E P
Sbjct: 95  GGVPPEEIPPEGVPPEEIPPGGVPPE-EIPPGGVPPEEIPPGGVPPEEIPPGGVPPEEIP 153

Query: 325 ----PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP----PPKFQPPNEKPPHEKSPP 474
               PPE  PP   PP E P P   PP + PP   P    PP+  PP E PP E  PP
Sbjct: 154 PGGVPPEEIPPEGVPPEEIP-PGGVPPGEVPPEGVPPGEVPPEGVPPGEVPP-EGVPP 209

 Score =  110 bits (276), Expect = 4e-23
 Identities = 78/172 (45%), Positives = 84/172 (48%), Gaps = 20/172 (11%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPP----PEYQPPHGKQPHVNPP----PQYQPPHEKPPHEHSPPGY 174
           P E  PPE  PP E PP    PE  PP G  P   PP    P+  PP   PP E  PPG 
Sbjct: 98  PPEEIPPEGVPPEEIPPGGVPPEEIPPGGVPPEEIPPGGVPPEEIPPGGVPPEE-IPPGG 156

Query: 175 QPPHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPP----P 330
            PP EIPP    PE  PP   PP  + PPE  PP E  PPE +PP E PP   PP    P
Sbjct: 157 VPPEEIPPEGVPPEEIPPGGVPP-GEVPPEGVPPGE-VPPEGVPPGEVPPEGVPPGEVPP 214

Query: 331 EYNPPHEKPPHEHPS----PEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           E  PP E PP   P     PE  PP + PP   PP +  P  EKP  E+ PP
Sbjct: 215 EGVPPGEVPPGGVPPEGVPPEEAPPGEVPPEGVPPAEMLPEGEKP--EELPP 264

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 61/146 (41%), Positives = 64/146 (43%), Gaps = 11/146 (7%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPP----PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPH 186
           P E  PP   PP E PP    PE  PP G  P   PP    PP E PP E  PPG  PP 
Sbjct: 138 PPEEIPPGGVPPEEIPPGGVPPEEIPPEGVPPEEIPPGGV-PPGEVPP-EGVPPGEVPPE 195

Query: 187 EIPP----PEHQPPHEKPPHAKSPPEYQP---PHEHPPPEYLPPHEKPPHENPPPEYNPP 345
            +PP    PE  PP E PP    P E  P   P E  PPE  PP E PP   PP E  P 
Sbjct: 196 GVPPGEVPPEGVPPGEVPPEGVPPGEVPPGGVPPEGVPPEEAPPGEVPPEGVPPAEMLPE 255

Query: 346 HEKPPHEHPSPEYQPPHQKPPHENPP 423
            EKP      P  +P  +K      P
Sbjct: 256 GEKP---EELPPVEPEAEKEEEGGMP 278

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 36/80 (45%), Positives = 38/80 (47%), Gaps = 4/80 (5%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPP----PEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PP E  PPE  PP E PP    P   PP G  P    PP   PP   PP E +PP
Sbjct: 183 PPEGVPPGE-VPPEGVPPGEVPPEGVPPGEVPPEGVPPG-EVPPGGVPPEGVPPEE-APP 239

Query: 169 GYQPPHEIPPPEHQPPHEKP 228
           G  PP  +PP E  P  EKP
Sbjct: 240 GEVPPEGVPPAEMLPEGEKP 259

[107][TOP]
>UniRef100_B3NC39 GG15230 n=1 Tax=Drosophila erecta RepID=B3NC39_DROER
          Length = 389

 Score =  115 bits (288), Expect = 2e-24
 Identities = 64/167 (38%), Positives = 73/167 (43%), Gaps = 15/167 (8%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNP---PPQYQPPHEKPPHEHSP------P 168
           P    P P Y PP  +PPP   PP    P   P   PPQ QPP  +PP + +P      P
Sbjct: 59  PAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPP--RPPPQPTPSAPAPLP 116

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPP-----PEYLPPHEKPPHENPPPE 333
            Y PP   PP   QP    P  +  PP+ QPP   PP     PEYLPP +  P   P   
Sbjct: 117 SYGPPQTPPPRPPQPTPSAPAPSYGPPQPQPPAPQPPSPQPGPEYLPPDQPKPRPTPSRP 176

Query: 334 YNPPHEKPPHEHPSPEY-QPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
             PP   PP   P+P Y  PP   PP   P P + PP   PP    P
Sbjct: 177 QPPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYAPPPPPPPPRPQP 223

 Score =  110 bits (276), Expect = 4e-23
 Identities = 71/203 (34%), Positives = 81/203 (39%), Gaps = 44/203 (21%)
 Frame = +1

Query: 1   PHHAKPPYENP---PPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPG 171
           P    P Y  P   PP  QPP  +P PEY PP   +P   P     PP   PP     PG
Sbjct: 133 PSAPAPSYGPPQPQPPAPQPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPPRPQPTPG 192

Query: 172 YQPPHEIPPPEHQ------------PPHEKP-------------PHAKSPPEYQPPHEHP 276
           Y PP   PPP+ Q            PP  +P             P A  PP  QPP   P
Sbjct: 193 YGPPPPPPPPKPQPTPGYAPPPPPPPPRPQPTPGYGPPPGPGPAPPAPQPPSPQPPRPQP 252

Query: 277 PPEYLPP---HEKPPHENPP----------PEYNPPHEKPPHEHPSPEYQPPHQKPPHEN 417
             EYLPP   +E  P +  P          P Y P  + PP   P P YQP  Q PP   
Sbjct: 253 GNEYLPPPGENEVTPTQPQPTAPVPAPPAGPTYQPRPQAPPAPAPGPTYQPRPQAPPAPA 312

Query: 418 PPPKFQPPNEKPP---HEKSPPA 477
           P P +QP    PP   ++  PPA
Sbjct: 313 PGPTYQPRPSSPPAPTYQPQPPA 335

 Score =  102 bits (255), Expect = 1e-20
 Identities = 65/183 (35%), Positives = 75/183 (40%), Gaps = 25/183 (13%)
 Frame = +1

Query: 1   PHHAKPPYENP---PPEYQPPHEKP--------------PPEYQPPHGKQPHVN-PPPQY 126
           P    PP   P   PP+ QPP   P              PP+  PP   QP  + P P Y
Sbjct: 81  PPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPLPSYGPPQTPPPRPPQPTPSAPAPSY 140

Query: 127 QPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEY-LPPHE 303
            PP  +PP    PP  QP  E  PP+   P   P   + PP   PP   P P Y  PP  
Sbjct: 141 GPPQPQPP-APQPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPPRPQPTPGYGPPPPP 199

Query: 304 KPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENP------PPKFQPPNEKPPHEK 465
            PP   P P Y PP   PP   P P+  P +  PP   P      PP  QPP  +P +E 
Sbjct: 200 PPPKPQPTPGYAPPPPPPP---PRPQPTPGYGPPPGPGPAPPAPQPPSPQPPRPQPGNEY 256

Query: 466 SPP 474
            PP
Sbjct: 257 LPP 259

 Score =  101 bits (252), Expect = 2e-20
 Identities = 70/192 (36%), Positives = 77/192 (40%), Gaps = 40/192 (20%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHE-KPPPE----YQPPHGKQPHVNPPPQYQPPHEKPPHEHSP 165
           P   +PP   P PEY PP + KP P       PP    P   P P Y PP   PP +  P
Sbjct: 147 PPAPQPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPPRPQPTPGYGPPPPPPPPKPQP 206

Query: 166 -PGYQPPHEIPPPEHQP---------PHEKPPHAKSPPEYQPPHEHPPPEYLPP---HEK 306
            PGY PP   PPP  QP         P   PP A  PP  QPP   P  EYLPP   +E 
Sbjct: 207 TPGYAPPPPPPPPRPQPTPGYGPPPGPGPAPP-APQPPSPQPPRPQPGNEYLPPPGENEV 265

Query: 307 PPHENPP----------PEYNPPHEKPPHEHPSPEYQPPHQKPP------------HENP 420
            P +  P          P Y P  + PP   P P YQP  Q PP               P
Sbjct: 266 TPTQPQPTAPVPAPPAGPTYQPRPQAPPAPAPGPTYQPRPQAPPAPAPGPTYQPRPSSPP 325

Query: 421 PPKFQPPNEKPP 456
            P +QP    PP
Sbjct: 326 APTYQPQPPAPP 337

 Score =  100 bits (249), Expect = 5e-20
 Identities = 66/177 (37%), Positives = 76/177 (42%), Gaps = 17/177 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNP---PPQYQPPHEKPPHEHSPPG 171
           P    PP   P P Y PP   PPP  QP  G  P   P   PP  QPP  +PP       
Sbjct: 196 PPPPPPPKPQPTPGYAPPPPPPPPRPQPTPGYGPPPGPGPAPPAPQPPSPQPPRPQPGNE 255

Query: 172 YQPP---HEIPPPEHQP--PHEKPPHAKSPPEYQPPHEHPP-----PEYLPPHEKPPHEN 321
           Y PP   +E+ P + QP  P   PP   + P YQP  + PP     P Y P  + PP   
Sbjct: 256 YLPPPGENEVTPTQPQPTAPVPAPP---AGPTYQPRPQAPPAPAPGPTYQPRPQAPPAPA 312

Query: 322 PPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQP----PNEKPPHEKSPPAS 480
           P P Y P    PP    +P YQP    PP   P P +QP    P    P   +PPAS
Sbjct: 313 PGPTYQPRPSSPP----APTYQPQPPAPPAPAPGPTYQPRPSAPAAPTPEYGTPPAS 365

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 62/180 (34%), Positives = 74/180 (41%), Gaps = 23/180 (12%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQ-----------PPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPP 150
           H+ +P    PPP              P    P P Y PP  + P   PPPQ  PP  +P 
Sbjct: 33  HYKQPSVPFPPPGSGNGIEDSGIGPGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRP- 91

Query: 151 HEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSP-PEYQPPHEHPPPEYLPPHEKPPHENPP 327
             + PP  QPP        +PP +  P A +P P Y PP   PP    P    P     P
Sbjct: 92  -SYGPPQTQPP--------RPPPQPTPSAPAPLPSYGPPQTPPPRPPQPTPSAPAPSYGP 142

Query: 328 PEYNPPHEKPPHEHPSPEYQPPHQ----------KPPHENPPPKFQP-PNEKPPHEKSPP 474
           P+  PP  +PP   P PEY PP Q          +PP   PPP+ QP P   PP    PP
Sbjct: 143 PQPQPPAPQPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPPRPQPTPGYGPPPPPPPP 202

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 36/108 (33%), Positives = 39/108 (36%), Gaps = 6/108 (5%)
 Frame = +1

Query: 175 QPPHEIPPP------EHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEY 336
           QP    PPP      E       P  +   P Y PP   PPP   PP   PP   P P Y
Sbjct: 36  QPSVPFPPPGSGNGIEDSGIGPGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPA--PRPSY 93

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPAS 480
            PP  +PP         PP   P    P P + PP   PP    P  S
Sbjct: 94  GPPQTQPPRP-------PPQPTPSAPAPLPSYGPPQTPPPRPPQPTPS 134

[108][TOP]
>UniRef100_UPI00019859A1 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019859A1
          Length = 377

 Score =  115 bits (287), Expect = 2e-24
 Identities = 73/173 (42%), Positives = 94/173 (54%), Gaps = 16/173 (9%)
 Frame = +1

Query: 4   HHAKPP----YENPPP-----EYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPP-H 153
           H++ PP    Y++PPP     +Y+ P   PPP Y PPH      +PP +Y+ P   PP +
Sbjct: 35  HYSSPPPPYYYKSPPPPPPVYKYKSP-PPPPPVYSPPH------HPPYKYKSPPPPPPVY 87

Query: 154 EHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPE----YQPPHEHPPPEYLPPHEKPPHEN 321
           ++  P   PP   PPP + PPH  P   KSPP     Y PPH HPP +Y  P   PP   
Sbjct: 88  KYKSP---PP---PPPVYSPPHHPPYKYKSPPPPPPVYSPPH-HPPYKYKSP---PP--- 134

Query: 322 PPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPP--HEKSPP 474
           PPP Y+PPH  PP+++ SP   PP   PPH +PP K++ P   PP    KSPP
Sbjct: 135 PPPVYSPPHH-PPYKYKSPPPPPPVYSPPH-HPPYKYKSPPPPPPVYKYKSPP 185

 Score =  115 bits (287), Expect = 2e-24
 Identities = 71/166 (42%), Positives = 89/166 (53%), Gaps = 9/166 (5%)
 Frame = +1

Query: 4   HHAKPPYENPPPEYQPPHEKP-----PPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           + + PP   PPP Y PPH  P     PP   P +  +    PPP Y PPH  PP+++  P
Sbjct: 57  YKSPPP---PPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHH-PPYKYKSP 112

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAKSPPE----YQPPHEHPPPEYLPPHEKPPHENPPPEY 336
              PP   PPP + PPH  P   KSPP     Y PPH HPP +Y  P   PP   PPP Y
Sbjct: 113 ---PP---PPPVYSPPHHPPYKYKSPPPPPPVYSPPH-HPPYKYKSP---PP---PPPVY 159

Query: 337 NPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           +PPH  PP+++ SP   PP  K  +++PP    PP++KP   KSPP
Sbjct: 160 SPPHH-PPYKYKSPPPPPPVYK--YKSPP----PPHKKPYKYKSPP 198

 Score =  108 bits (271), Expect = 1e-22
 Identities = 75/200 (37%), Positives = 93/200 (46%), Gaps = 42/200 (21%)
 Frame = +1

Query: 1   PHHAKPPYENPPP-----EYQPPHEKPPPEYQPPHG-----KQPHVNPPPQYQPPHEKPP 150
           PHH    Y++PPP     +Y+ P   PPP Y PPH      K P   PPP Y PPH  PP
Sbjct: 70  PHHPPYKYKSPPPPPPVYKYKSP-PPPPPVYSPPHHPPYKYKSPPP-PPPVYSPPHH-PP 126

Query: 151 HEHS-----PPGYQPPHEIP---------PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEY 288
           +++      PP Y PPH  P         PP + PPH  P   KSPP   P +++  P  
Sbjct: 127 YKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPP- 185

Query: 289 LPPHEKPPHEN--PPPEYNPPH----------EKPPHEHPSPEYQPPHQKPPHENPPPKF 432
            PPH+KP      PPP YN P             PP+++ SP   PP  K  +++PPP  
Sbjct: 186 -PPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPPPPPPVYK--YKSPPPP- 241

Query: 433 QPPNEKPP------HEKSPP 474
            PP   PP        KSPP
Sbjct: 242 -PPVHSPPPPPPPYKYKSPP 260

 Score =  104 bits (259), Expect = 3e-21
 Identities = 75/219 (34%), Positives = 95/219 (43%), Gaps = 61/219 (27%)
 Frame = +1

Query: 1   PHHAKPPYEN-----PPPEYQPPHEKP---------PPEYQPPHG-----KQPHVNPPPQ 123
           PHH  PPY+      PPP Y PPH  P         PP Y PPH      K P   PPP 
Sbjct: 102 PHH--PPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPP-PPPV 158

Query: 124 YQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPP-------------EYQ-- 258
           Y PPH  P    SPP   P ++   P   PPH+KP   KSPP             EY+  
Sbjct: 159 YSPPHHPPYKYKSPPPPPPVYKYKSPP--PPHKKPYKYKSPPPPPYNLPSGTSADEYEYK 216

Query: 259 --PPHEH-----------------PPPEYLPPHEKPPHE-----NPPPEY---NPPHEKP 357
             PP+++                 PPP + PP   PP++      PPP Y   +PP   P
Sbjct: 217 SPPPYKYKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSP 276

Query: 358 PHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPP 474
           P+++ SP   PP++      PP +++ P   P   KSPP
Sbjct: 277 PYKYKSPP-PPPYKYKSPPPPPLQYKSPPPPPYKYKSPP 314

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 66/191 (34%), Positives = 94/191 (49%), Gaps = 33/191 (17%)
 Frame = +1

Query: 1   PHHAKPPYENPPP-----EYQ---PPHEKP-------PPEYQPPHG----KQPHVNPPP- 120
           PHH    Y++PPP     +Y+   PPH+KP       PP Y  P G    +  + +PPP 
Sbjct: 162 PHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPY 221

Query: 121 QYQPPHEKPP------HEHSPPGYQPPHEIPPPEHQPPHEKPP--HAKSPPEYQPPHEH- 273
           +Y+ P   PP          PP + PP   PP +++ P   PP    KSPP   PP+++ 
Sbjct: 222 KYKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYK 281

Query: 274 -PPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPP---KFQPP 441
            PPP   PP++      PP +Y  P   PP+++ SP   PP  K  +++PPP   K++ P
Sbjct: 282 SPPP---PPYKYKSPPPPPLQYKSP-PPPPYKYKSPPPPPPVYK--YKSPPPPVYKYKSP 335

Query: 442 NEKPPHEKSPP 474
              P   KSPP
Sbjct: 336 PPPPYMYKSPP 346

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 79/261 (30%), Positives = 95/261 (36%), Gaps = 108/261 (41%)
 Frame = +1

Query: 1   PHHAKPPYEN-----PPPEYQPPHEKP---------PPEYQPPHG-----KQPHVNPPPQ 123
           PHH  PPY+      PPP Y PPH  P         PP Y PPH      K P   PPP 
Sbjct: 122 PHH--PPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPP-PPPV 178

Query: 124 YQ-----PPHEKPPHEHSPPGYQPPHEIP------------------------------- 195
           Y+     PPH+KP    SPP   PP+ +P                               
Sbjct: 179 YKYKSPPPPHKKPYKYKSPP--PPPYNLPSGTSADEYEYKSPPPYKYKSPPPPPPVYKYK 236

Query: 196 -----PPEHQPPHEKPPHA-------------KSPPEYQPPHEH---PPPEYL------- 291
                PP H PP   PP+              KSPP   PP+++   PPP Y        
Sbjct: 237 SPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPP 296

Query: 292 ---------PPHEKPPHENPPPEYN-----PPHEK------PPHEHPSPEYQPP---HQK 402
                    PP++      PPP Y      PP  K      PP+ + SP   PP   ++ 
Sbjct: 297 PLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPYMYKSPPPPPPVYKYKS 356

Query: 403 PPHENPPPK--FQPPNEKPPH 459
           PP   PPPK  +  P   PPH
Sbjct: 357 PP--PPPPKYYYSSPPPPPPH 375

[109][TOP]
>UniRef100_UPI000198347D PREDICTED: hypothetical protein isoform 2 n=1 Tax=Vitis vinifera
           RepID=UPI000198347D
          Length = 217

 Score =  115 bits (287), Expect = 2e-24
 Identities = 78/185 (42%), Positives = 97/185 (52%), Gaps = 27/185 (14%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPH-EKPPHEHSPPG-- 171
           P +  PP   PPPEY+P    P P Y+PP  ++P   P P Y+PP  EKPP E+ PP   
Sbjct: 37  PVYKSPPLGKPPPEYKP----PTPVYKPPPVEKP---PTPVYRPPPVEKPPPEYKPPTPV 89

Query: 172 YQPPH-EIPPPEHQPP---HEKPPHAKSPPEYQPP---HEHPPPEYLPPHEKPPHENPPP 330
           Y+PP  E PPPE++PP   ++ PP  K PPEY+PP      PPP++  P   P    PPP
Sbjct: 90  YKPPPVEKPPPEYKPPTPVYKPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPP 149

Query: 331 EYNPPH------EKPPHEHPSPE--YQPPHQKPPHENPP--PKFQPPN-EKPP------H 459
              PP         PP + PSP   + P H  PP E PP  P  +PP  EK P      H
Sbjct: 150 TPKPPTLPPIIVRPPPTKEPSPPQGHYPGH--PPVETPPSTPYKKPPTPEKKPWAPHHKH 207

Query: 460 EKSPP 474
            K+PP
Sbjct: 208 FKAPP 212

 Score =  104 bits (259), Expect = 3e-21
 Identities = 62/159 (38%), Positives = 76/159 (47%), Gaps = 14/159 (8%)
 Frame = +1

Query: 37  PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPPPEHQPP 216
           P     H+ PP E++PP     + +PP    PP  KPP     P Y+PP    PP   P 
Sbjct: 19  PSLANDHKPPPYEHKPP--LPVYKSPPLGKPPPEYKPP----TPVYKPPPVEKPP--TPV 70

Query: 217 HEKPPHAKSPPEYQPPH--------EHPPPEYLPP---HEKPPHENPPPEYNPP---HEK 354
           +  PP  K PPEY+PP         E PPPEY PP   ++ PP E PPPEY PP      
Sbjct: 71  YRPPPVEKPPPEYKPPTPVYKPPPVEKPPPEYKPPTPVYKPPPVEKPPPEYKPPTPVKPP 130

Query: 355 PPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSP 471
           PP +H +P   P   +PP    PP   P   +PP  K P
Sbjct: 131 PPPKHKTPTLPPRVVRPPPTPKPPTLPPIIVRPPPTKEP 169

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 58/130 (44%), Positives = 73/130 (56%), Gaps = 22/130 (16%)
 Frame = +1

Query: 151 HEHSPPGYQ----------PPHEIPPPEHQPP---HEKPPHAKSP-PEYQPPH-EHPPPE 285
           ++H PP Y+          PP   PPPE++PP   ++ PP  K P P Y+PP  E PPPE
Sbjct: 23  NDHKPPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEKPPPE 82

Query: 286 YLPP---HEKPPHENPPPEYNPP---HEKPPHEHPSPEYQPPHQ-KPPHENPPPKFQPPN 444
           Y PP   ++ PP E PPPEY PP   ++ PP E P PEY+PP   KPP   PPPK + P 
Sbjct: 83  YKPPTPVYKPPPVEKPPPEYKPPTPVYKPPPVEKPPPEYKPPTPVKPP---PPPKHKTPT 139

Query: 445 EKPPHEKSPP 474
             P   + PP
Sbjct: 140 LPPRVVRPPP 149

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 55/139 (39%), Positives = 68/139 (48%), Gaps = 20/139 (14%)
 Frame = +1

Query: 118 PQYQPPHEKPPHEHSPP---GYQPPHEIPPPEHQPPHE--KPPHAKSPPE--YQPPH-EH 273
           P     H+ PP+EH PP      PP   PPPE++PP    KPP  + PP   Y+PP  E 
Sbjct: 19  PSLANDHKPPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEK 78

Query: 274 PPPEYLPP---HEKPPHENPPPEYNPP---------HEKPPHEHPSPEYQPPHQKPPHEN 417
           PPPEY PP   ++ PP E PPPEY PP          + PP   P    +PP   PP ++
Sbjct: 79  PPPEYKPPTPVYKPPPVEKPPPEYKPPTPVYKPPPVEKPPPEYKPPTPVKPP---PPPKH 135

Query: 418 PPPKFQPPNEKPPHEKSPP 474
             P   P   +PP    PP
Sbjct: 136 KTPTLPPRVVRPPPTPKPP 154

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 42/116 (36%), Positives = 53/116 (45%), Gaps = 22/116 (18%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPP----------HE---------KPPPEYQPPHGKQPHVNPPPQ 123
           P +  PP E PPPEY+PP          H+         +PPP  +PP      V PPP 
Sbjct: 107 PVYKPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPKPPTLPPIIVRPPPT 166

Query: 124 YQPPHEKPPHEHSPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEH---PPP 282
            +P    PP  H P    PP E PP     P++KPP  +  P + P H+H   PPP
Sbjct: 167 KEP---SPPQGHYPG--HPPVETPP---STPYKKPPTPEKKP-WAPHHKHFKAPPP 213

[110][TOP]
>UniRef100_UPI00006A09B7 UPI00006A09B7 related cluster n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI00006A09B7
          Length = 269

 Score =  114 bits (286), Expect = 3e-24
 Identities = 64/170 (37%), Positives = 82/170 (48%), Gaps = 12/170 (7%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHE-------KPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEH 159
           P+   PPY  PP    PPH           P  Q PH + PH   PP   PP+ KPP   
Sbjct: 6   PNTQCPPYAVPP--ILPPHTGETVAPIHSTPHTQCPHTQSPHTQSPPNTVPPYTKPPIHR 63

Query: 160 SPPGYQPPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN 339
           +PP Y  PH    P   P   K P+ +SPP  +PPH   PP  +PP+ +PP    P    
Sbjct: 64  APP-YTVPHTQCSPNTVPSIHKAPYTQSPPYTEPPHTQCPPNTVPPNTEPPKHRAPHTQC 122

Query: 340 PPHEKPPHEHPSPEYQ-PPHQKPPHENP----PPKFQPPNEKPPHEKSPP 474
           PP+ +PP  H +P  Q PP+  PP+  P    PPK   P+ + PH +S P
Sbjct: 123 PPYTEPP-IHSAPHTQIPPYTVPPNTEPPYTEPPKHSAPHTQCPHTQSLP 171

 Score =  113 bits (283), Expect = 6e-24
 Identities = 64/182 (35%), Positives = 82/182 (45%), Gaps = 25/182 (13%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P+   PPY  PP    PP+  PP   +PP  + PH   PP  +PP    PH   PP   P
Sbjct: 86  PYTQSPPYTEPPHTQCPPNTVPP-NTEPPKHRAPHTQCPPYTEPPIHSAPHTQIPPYTVP 144

Query: 181 PHEIPP----PEHQPPHEKPPHAKSPPEYQPPHEHPPPE-YLPPHEKPPHENP------- 324
           P+  PP    P+H  PH + PH +S P Y  PH+H  P    P  + PP+  P       
Sbjct: 145 PNTEPPYTEPPKHSAPHTQCPHTQSLP-YTVPHKHRAPHTQCPQTQSPPYTEPTIHRAPQ 203

Query: 325 --------PPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPP----PKFQ-PPNEKPPHEK 465
                   PP   PP  + PH    P   PP+  PP+  PP    P  Q PPN +PP  +
Sbjct: 204 TQCPTNTEPPYTVPPKHRAPHTQSPPNTVPPYTVPPYTEPPIHSAPHTQCPPNTEPPIHR 263

Query: 466 SP 471
           +P
Sbjct: 264 AP 265

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/168 (33%), Positives = 77/168 (45%), Gaps = 9/168 (5%)
 Frame = +1

Query: 7   HAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPH 186
           H + P+   PP   PP+ KPP    PP+   PH    P   P   K P+  SPP  +PPH
Sbjct: 40  HTQSPHTQSPPNTVPPYTKPPIHRAPPY-TVPHTQCSPNTVPSIHKAPYTQSPPYTEPPH 98

Query: 187 EIPPPEHQPPHEKPP-----HAKSPPEYQPPHEHPPPEYLPPHEKPPHENP----PPEYN 339
              PP   PP+ +PP     H + PP  +PP    P   +PP+  PP+  P    PP+++
Sbjct: 99  TQCPPNTVPPNTEPPKHRAPHTQCPPYTEPPIHSAPHTQIPPYTVPPNTEPPYTEPPKHS 158

Query: 340 PPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPHEKSPPASC 483
            PH + PH    P   P   + PH   P    PP  +P   ++P   C
Sbjct: 159 APHTQCPHTQSLPYTVPHKHRAPHTQCPQTQSPPYTEPTIHRAPQTQC 206

 Score =  108 bits (269), Expect = 2e-22
 Identities = 60/176 (34%), Positives = 82/176 (46%), Gaps = 23/176 (13%)
 Frame = +1

Query: 1   PHHAKPPYENPP----PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPH----E 156
           PH   PP   PP    P+++ PH + PP  +PP    PH   PP   PP+ +PP+    +
Sbjct: 97  PHTQCPPNTVPPNTEPPKHRAPHTQCPPYTEPPIHSAPHTQIPPYTVPPNTEPPYTEPPK 156

Query: 157 HSPPGYQPPH--EIP---PPEHQPPHEKPPHAKSPPEYQP----------PHEHPPPEYL 291
           HS P  Q PH   +P   P +H+ PH + P  +SPP  +P          P    PP  +
Sbjct: 157 HSAPHTQCPHTQSLPYTVPHKHRAPHTQCPQTQSPPYTEPTIHRAPQTQCPTNTEPPYTV 216

Query: 292 PPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPHENPPPKFQPPNEKPPH 459
           PP  + PH   PP   PP+  PP+       +PP    PH   PP  +PP  + PH
Sbjct: 217 PPKHRAPHTQSPPNTVPPYTVPPYT------EPPIHSAPHTQCPPNTEPPIHRAPH 266

 Score =  104 bits (260), Expect = 3e-21
 Identities = 59/182 (32%), Positives = 76/182 (41%), Gaps = 24/182 (13%)
 Frame = +1

Query: 1   PHHAKPPYENPP----PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P +  PPY  PP    P Y  PH +  P   P   K P+   PP  +PPH + P    PP
Sbjct: 49  PPNTVPPYTKPPIHRAPPYTVPHTQCSPNTVPSIHKAPYTQSPPYTEPPHTQCPPNTVPP 108

Query: 169 GYQPP-HEIP---------PPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHE 318
             +PP H  P         PP H  PH + P    PP  +PP+   PP++  PH + PH 
Sbjct: 109 NTEPPKHRAPHTQCPPYTEPPIHSAPHTQIPPYTVPPNTEPPYTE-PPKHSAPHTQCPHT 167

Query: 319 NPPPEYNPPHEKPPHEHPSPEYQPPHQKP----------PHENPPPKFQPPNEKPPHEKS 468
              P   P   + PH        PP+ +P          P    PP   PP  + PH +S
Sbjct: 168 QSLPYTVPHKHRAPHTQCPQTQSPPYTEPTIHRAPQTQCPTNTEPPYTVPPKHRAPHTQS 227

Query: 469 PP 474
           PP
Sbjct: 228 PP 229

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 51/141 (36%), Positives = 61/141 (43%), Gaps = 11/141 (7%)
 Frame = +1

Query: 85  PHGKQPHVNPPPQYQPPHEKPPHE-------HSPPGYQPPHEIPPPEHQPPHEKPPHAKS 243
           PH K P+   PP Y  P   PPH        HS P  Q PH   P    PP+  PP+ K 
Sbjct: 1   PHRKCPNTQCPP-YAVPPILPPHTGETVAPIHSTPHTQCPHTQSPHTQSPPNTVPPYTKP 59

Query: 244 P----PEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPHEKPPHEHPSPEYQPPHQKPPH 411
           P    P Y  PH    P  +P   K P+   PP   PPH + P     P  +PP  + PH
Sbjct: 60  PIHRAPPYTVPHTQCSPNTVPSIHKAPYTQSPPYTEPPHTQCPPNTVPPNTEPPKHRAPH 119

Query: 412 ENPPPKFQPPNEKPPHEKSPP 474
              PP  +PP    PH + PP
Sbjct: 120 TQCPPYTEPPIHSAPHTQIPP 140

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/130 (37%), Positives = 62/130 (47%), Gaps = 13/130 (10%)
 Frame = +1

Query: 133 PHEKPPHEHSPPGYQPPHEIPP-------PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYL 291
           PH K P+   PP Y  P  +PP       P H  PH + PH +S      PH   PP  +
Sbjct: 1   PHRKCPNTQCPP-YAVPPILPPHTGETVAPIHSTPHTQCPHTQS------PHTQSPPNTV 53

Query: 292 PPHEKPPHENPPPEYNPPHEK-----PPHEHPSPEYQ-PPHQKPPHENPPPKFQPPNEKP 453
           PP+ KPP    PP Y  PH +      P  H +P  Q PP+ +PPH   PP   PPN +P
Sbjct: 54  PPYTKPPIHRAPP-YTVPHTQCSPNTVPSIHKAPYTQSPPYTEPPHTQCPPNTVPPNTEP 112

Query: 454 PHEKSPPASC 483
           P  ++P   C
Sbjct: 113 PKHRAPHTQC 122

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 30/84 (35%), Positives = 38/84 (45%), Gaps = 4/84 (4%)
 Frame = +1

Query: 1   PHHAKPPYENPP----PEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPP 168
           P    PPY  P     P+ Q P    PP   PP  + PH   PP   PP+  PP+   PP
Sbjct: 186 PQTQSPPYTEPTIHRAPQTQCPTNTEPPYTVPPKHRAPHTQSPPNTVPPYTVPPYTE-PP 244

Query: 169 GYQPPHEIPPPEHQPPHEKPPHAK 240
            +  PH   PP  +PP  + PH +
Sbjct: 245 IHSAPHTQCPPNTEPPIHRAPHTQ 268

[111][TOP]
>UniRef100_UPI00006A01B5 UPI00006A01B5 related cluster n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI00006A01B5
          Length = 336

 Score =  114 bits (286), Expect = 3e-24
 Identities = 67/183 (36%), Positives = 82/183 (44%), Gaps = 25/183 (13%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQP 180
           P H+ PPY  PP    P H  P     P H   P  + PP   PP+  PP   SPP   P
Sbjct: 6   PIHSAPPYTVPPYTVPPIHSAPSYTVPPIHSAPPIHSGPPYTVPPYTVPPIHSSPPCTVP 65

Query: 181 PHEIP-----PPEH-QPPHEKPPHAKSPPEYQPP-------------HEHPP----PEYL 291
           P+ +P     PP H  PP+  PPH + PP +  P             H  PP    P Y 
Sbjct: 66  PYTVPPHTQSPPIHSSPPYTVPPHTQCPPIHSAPPYTVALLTQCPPIHSSPPIHSSPPYT 125

Query: 292 PPHEKPPH-ENPPPEYNPPHEKPPHEHPSPEYQPPH-QKPPHENPPPKFQPPNEKPPHEK 465
           PP+  PPH ++PP   +PP+  PPH    P +  PH Q PP+  PP    PP   PP   
Sbjct: 126 PPYTVPPHTQSPPIHSSPPYTVPPHTQFPPIHSAPHTQCPPYTVPPIGTVPPYTVPPIGT 185

Query: 466 SPP 474
            PP
Sbjct: 186 VPP 188

 Score =  104 bits (259), Expect = 3e-21
 Identities = 56/160 (35%), Positives = 69/160 (43%), Gaps = 8/160 (5%)
 Frame = +1

Query: 19  PYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQPPHEKPPHEHSPPGYQPPHEIPP 198
           P E+ P    PP+  PP    P H    +  PP      H  PP    PP   PP+ +PP
Sbjct: 1   PIESAPIHSAPPYTVPPYTVPPIHSAPSYTVPPI-----HSAPPIHSGPPYTVPPYTVPP 55

Query: 199 PEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN-------PPHEKP 357
               PP   PP+   P    PP    PP  +PPH + P  +  P Y        PP    
Sbjct: 56  IHSSPPCTVPPYTVPPHTQSPPIHSSPPYTVPPHTQCPPIHSAPPYTVALLTQCPPIHSS 115

Query: 358 PHEHPSPEYQPPHQKPPH-ENPPPKFQPPNEKPPHEKSPP 474
           P  H SP Y PP+  PPH ++PP    PP   PPH + PP
Sbjct: 116 PPIHSSPPYTPPYTVPPHTQSPPIHSSPPYTVPPHTQFPP 155

 Score =  100 bits (250), Expect = 4e-20
 Identities = 59/184 (32%), Positives = 71/184 (38%), Gaps = 28/184 (15%)
 Frame = +1

Query: 16  PPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQ--------PPHEKPPHEHSPPG 171
           PPY  PP    PP    PP   PPH + P ++  P Y         P H  PP   SPP 
Sbjct: 65  PPYTVPPHTQSPPIHSSPPYTVPPHTQCPPIHSAPPYTVALLTQCPPIHSSPPIHSSPP- 123

Query: 172 YQPPHEIPPPEHQPP-HEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYNPPH 348
           Y PP+ +PP    PP H  PP+   P    PP    P    PP+  PP    PP   PP 
Sbjct: 124 YTPPYTVPPHTQSPPIHSSPPYTVPPHTQFPPIHSAPHTQCPPYTVPPIGTVPPYTVPPI 183

Query: 349 EKPPHEHPSPEYQPPHQKPPHENPPPKFQPPN-------------------EKPPHEKSP 471
              P  H +P +  P+  PP    PP    PN                   + PPH + P
Sbjct: 184 GTVPPIHSAPIHSAPYTVPPIGTVPPIHSAPNWDSAPNWDSAPNWDSAPNWDSPPHTQCP 243

Query: 472 PASC 483
              C
Sbjct: 244 HTQC 247

 Score =  100 bits (249), Expect = 5e-20
 Identities = 56/182 (30%), Positives = 79/182 (43%), Gaps = 21/182 (11%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQ------------PPHGKQPHVNPPPQYQPPHEK 144
           PH   PP  + PP   PPH + PP +             PP    P ++  P Y PP+  
Sbjct: 71  PHTQSPPIHSSPPYTVPPHTQCPPIHSAPPYTVALLTQCPPIHSSPPIHSSPPYTPPYTV 130

Query: 145 PPHEHSPPGYQ-PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHEN 321
           PPH  SPP +  PP+ +PP    PP    PH + PP   PP    PP  +PP    P  +
Sbjct: 131 PPHTQSPPIHSSPPYTVPPHTQFPPIHSAPHTQCPPYTVPPIGTVPPYTVPPIGTVPPIH 190

Query: 322 PPPEYNPPHEKPP-------HEHPSPEYQPPHQKPPHENPPPKFQ-PPNEKPPHEKSPPA 477
             P ++ P+  PP       H  P+ +  P     P+ +  P +  PP+ + PH + P  
Sbjct: 191 SAPIHSAPYTVPPIGTVPPIHSAPNWDSAPNWDSAPNWDSAPNWDSPPHTQCPHTQCPHT 250

Query: 478 SC 483
            C
Sbjct: 251 QC 252

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 55/162 (33%), Positives = 69/162 (42%), Gaps = 4/162 (2%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPP-HGKQPHVNPPPQYQPPHEKPPHEHSPPGYQ 177
           P H+ PP  + PP Y PP+  PP    PP H   P+  PP    PP    PH   PP   
Sbjct: 111 PIHSSPPIHSSPP-YTPPYTVPPHTQSPPIHSSPPYTVPPHTQFPPIHSAPHTQCPPYTV 169

Query: 178 PPHEIPPPEHQPPHEKPPHAKSPPEYQPPHEHPPPEYLPPHEKPPHENPPPEYN--PPHE 351
           PP    PP   PP    P   S P +  P+  PP   +PP    P+ +  P ++  P  +
Sbjct: 170 PPIGTVPPYTVPPIGTVPPIHSAPIHSAPYTVPPIGTVPPIHSAPNWDSAPNWDSAPNWD 229

Query: 352 KPPHEHPSPEYQPPHQKPPHENPPPKFQ-PPNEKPPHEKSPP 474
             P+    P  Q PH + PH   P   Q PP   PP    PP
Sbjct: 230 SAPNWDSPPHTQCPHTQCPHTQCPQLGQCPPYTVPPIGTVPP 271

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 61/201 (30%), Positives = 79/201 (39%), Gaps = 49/201 (24%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQ-PPHGKQPHVNPPPQYQPPHEK-PPHEHSPPGY 174
           P H+ PPY   PP   PPH + PP +  PP+   PH   PP +  PH + PP+   P G 
Sbjct: 117 PIHSSPPYT--PPYTVPPHTQSPPIHSSPPYTVPPHTQFPPIHSAPHTQCPPYTVPPIGT 174

Query: 175 QPPHEIPP----------PEHQPPHEKPPHAKSPPEYQPPHEHPPPEY------------ 288
            PP+ +PP          P H  P+  PP    PP +  P+    P +            
Sbjct: 175 VPPYTVPPIGTVPPIHSAPIHSAPYTVPPIGTVPPIHSAPNWDSAPNWDSAPNWDSAPNW 234

Query: 289 -LPPHEKPPHENPP----------PEYN-------------PPHEKPPHEHPSPEYQPPH 396
             PPH + PH   P          P Y              PP    P  H +  + PPH
Sbjct: 235 DSPPHTQCPHTQCPHTQCPQLGQCPPYTVPPIGTVPPIGTVPPIGTVPPIHSAAIHSPPH 294

Query: 397 -QKPPHENPPPKFQPPNEKPP 456
            Q P  ++PPP   PP E  P
Sbjct: 295 TQCPILDSPPPYTVPPIETVP 315

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 61/201 (30%), Positives = 79/201 (39%), Gaps = 44/201 (21%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGK-QPHVNPPPQYQPPHEKPPHE-----HS 162
           PH   PP  + PP   PPH + PP +  PH +  P+  PP    PP+  PP       HS
Sbjct: 132 PHTQSPPIHSSPPYTVPPHTQFPPIHSAPHTQCPPYTVPPIGTVPPYTVPPIGTVPPIHS 191

Query: 163 PPGYQPPHEIPP----------------------------------PEHQPPHEKPPHAK 240
            P +  P+ +PP                                  P  Q PH + PH +
Sbjct: 192 APIHSAPYTVPPIGTVPPIHSAPNWDSAPNWDSAPNWDSAPNWDSPPHTQCPHTQCPHTQ 251

Query: 241 SPPEYQ-PPHEHPPPEYLPP-HEKPPHENPPPEYNPPHEKPPHEH-PSPEYQPPHQKPPH 411
            P   Q PP+  PP   +PP    PP    PP ++     PPH   P  +  PP+  PP 
Sbjct: 252 CPQLGQCPPYTVPPIGTVPPIGTVPPIGTVPPIHSAAIHSPPHTQCPILDSPPPYTVPPI 311

Query: 412 ENPPPKFQPPNEK-PPHEKSP 471
           E  PP   P  E  PPH + P
Sbjct: 312 ETVPPCTVPLIETVPPHTQCP 332

[112][TOP]
>UniRef100_B5DR37 GA28529 n=1 Tax=Drosophila pseudoobscura pseudoobscura
           RepID=B5DR37_DROPS
          Length = 449

 Score =  114 bits (286), Expect = 3e-24
 Identities = 63/174 (36%), Positives = 75/174 (43%), Gaps = 16/174 (9%)
 Frame = +1

Query: 1   PHHAKPPYENPPPEYQPPHEKPPPEYQPPHGKQPHVNPPPQYQP