BB936730 ( RCC09715 )

[UP]


[1][TOP]
>UniRef100_Q84QK1 Putative arabinagalactan protein n=1 Tax=Lotus japonicus
           RepID=Q84QK1_LOTJA
          Length = 149

 Score =  112 bits (279), Expect = 2e-23
 Identities = 63/110 (57%), Positives = 71/110 (64%), Gaps = 9/110 (8%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-PTATPPTATPPAPASSPATSP 177
           APT+ PT TP P   PPAAA      PP ATPP AATP PT TPP ATP     +P+ SP
Sbjct: 27  APTQAPTTTPPP---PPAAAP----APPPATPPPAATPAPTTTPPAATP-----APSASP 74

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPD--------SLGPGPSGADTPPPP 303
           PAPTP ++P+ APTPS A SPPAP P         + GPGP+ ADTPPPP
Sbjct: 75  PAPTPTASPTGAPTPS-ASSPPAPIPSGPASGPGPAAGPGPNSADTPPPP 123

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 44/90 (48%), Positives = 55/90 (61%), Gaps = 7/90 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPK-AQPPAAATP-PTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           P  PP A PAP  A PP AATP PT TPP ATP  +A+PP  TP TA+P    +  A+SP
Sbjct: 36  PPPPPAAAPAPPPATPPPAATPAPTTTPPAATPAPSASPPAPTP-TASPTGAPTPSASSP 94

Query: 178 PAPTPAST-----PSTAPTPSTAGSPPAPT 252
           PAP P+       P+  P P++A +PP P+
Sbjct: 95  PAPIPSGPASGPGPAAGPGPNSADTPPPPS 124

[2][TOP]
>UniRef100_UPI0001982E0B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982E0B
          Length = 222

 Score =  102 bits (253), Expect = 2e-20
 Identities = 57/114 (50%), Positives = 60/114 (52%), Gaps = 14/114 (12%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA---ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           P  PP ATP P   PPA    ATPP ATPP ATPP  ATPP ATPP ATPP     PAT 
Sbjct: 64  PATPPPATPPPATPPPATPPPATPPPATPPPATPP-PATPPPATPPPATPPPATPPPATP 122

Query: 175 PPA-PTPASTPSTAPTPSTAGSPPAPTP----------DSLGPGPSGADTPPPP 303
           PPA P PA+ P   P P+   SPPA  P           +L P P     P PP
Sbjct: 123 PPATPPPATPPPATPPPAHLASPPAAVPAPAPSTKVKSPALAPSPLTNSPPAPP 176

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 55/101 (54%), Positives = 61/101 (60%), Gaps = 1/101 (0%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           A T PP ++P P + PP A TPP ATPP ATPP  ATPP ATPP ATPP     PAT PP
Sbjct: 47  AVTSPPASSPPPVSAPPPA-TPPPATPPPATPP-PATPPPATPPPATPPPATPPPATPPP 104

Query: 181 A-PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           A P PA+ P   P P+T   PP  TP    P P+   TPPP
Sbjct: 105 ATPPPATPPPATPPPAT---PPPATPPPATPPPA---TPPP 139

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 61/115 (53%), Positives = 65/115 (56%), Gaps = 16/115 (13%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA---ATPPTATPPTATPPAA----ATPPTATPPTATPPAPASS 162
           P  PP ATP P   PPA    ATPP ATPP ATPP A    ATPP ATPP ATPP     
Sbjct: 79  PATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPP 138

Query: 163 PA--TSPPAPTPASTPST-------APTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           PA   SPPA  PA  PST       AP+P T  SPPAP  ++ GP  SG  +P P
Sbjct: 139 PAHLASPPAAVPAPAPSTKVKSPALAPSPLT-NSPPAPPAEAPGP-ISGGISPAP 191

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 50/102 (49%), Positives = 58/102 (56%), Gaps = 3/102 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           PT P  + P     PPA++ PP + PP ATPP A TPP ATPP ATPP     PAT PPA
Sbjct: 37  PTTPAASPPTAVTSPPASSPPPVSAPPPATPPPA-TPPPATPPPATPPPATPPPATPPPA 95

Query: 184 -PTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPP 300
            P PA+ P   P P+T    +PP  TP    P P+   TPPP
Sbjct: 96  TPPPATPPPATPPPATPPPATPPPATPPPATPPPA---TPPP 134

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/110 (49%), Positives = 61/110 (55%), Gaps = 10/110 (9%)
 Frame = +1

Query: 1   APTKPPTATPAPK------AQPPAAAT-PPTATPPTATPPAAATPPTATPPTATPPAPAS 159
           AP   PTATPAP       A PP A T PP ++PP  + P  ATPP ATPP ATPP    
Sbjct: 23  APAGGPTATPAPPTPTTPAASPPTAVTSPPASSPPPVSAPPPATPPPATPPPATPPPATP 82

Query: 160 SPATSPPA-PTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPP 300
            PAT PPA P PA+ P   P P+T    +PP  TP    P P+   TPPP
Sbjct: 83  PPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPA---TPPP 129

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 40/90 (44%), Positives = 44/90 (48%), Gaps = 3/90 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTA--TPPAAATPPTATPPTATPPAPASSPAT-S 174
           P  PP ATP P       ATPP ATPP A    P AA P  A       PA A SP T S
Sbjct: 119 PATPPPATPPP-------ATPPPATPPPAHLASPPAAVPAPAPSTKVKSPALAPSPLTNS 171

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSL 264
           PPAP     P+ AP P + G  PAP  + +
Sbjct: 172 PPAP-----PAEAPGPISGGISPAPAANDV 196

[3][TOP]
>UniRef100_Q39789 Proline-rich cell wall protein n=1 Tax=Gossypium hirsutum
           RepID=Q39789_GOSHI
          Length = 214

 Score =  102 bits (253), Expect = 2e-20
 Identities = 55/104 (52%), Positives = 66/104 (63%), Gaps = 8/104 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA---ATPPTATPPTATPPAA----ATPPTATPPTAT-PPAPAS 159
           P+ PP ATP P + PPA    A+PP ATPP A+PP A    ATPP ATPP AT PPAP +
Sbjct: 85  PSSPPPATPPPASPPPATPPPASPPPATPPPASPPPATPPPATPPPATPPPATPPPAPLA 144

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 291
           SP  + PA +P  TP T+P P+     PAPT  +  PGP+G DT
Sbjct: 145 SPPATVPAISPVQTPLTSP-PAPPTEAPAPTLGAATPGPAGTDT 187

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 51/105 (48%), Positives = 64/105 (60%), Gaps = 6/105 (5%)
 Frame = +1

Query: 7   TKPPTATPAP-KAQPPAAATPPTATPPTATPPAA----ATPPTATPPTATPPAPASSPAT 171
           T PPT++P P  A PP  +TPP ++PP ATPP A    ATPP A+PP ATPP  +  PAT
Sbjct: 63  TPPPTSSPPPVTASPPPVSTPPPSSPPPATPPPASPPPATPPPASPPPATPPPASPPPAT 122

Query: 172 SPPA-PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PPA P PA+ P   P P+   SPPA  P ++ P  +   +PP P
Sbjct: 123 PPPATPPPATPPPATPPPAPLASPPATVP-AISPVQTPLTSPPAP 166

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/106 (50%), Positives = 65/106 (61%), Gaps = 6/106 (5%)
 Frame = +1

Query: 1   APTKPPT--ATPAPKAQPPAAAT-PPTATPP--TATPPAAATPPTATPPTATPPAPASSP 165
           A T PPT  A P P A PP  +T PPT++PP  TA+PP  +TPP ++PP ATPP  +  P
Sbjct: 41  ASTPPPTTQAPPTPTATPPPVSTPPPTSSPPPVTASPPPVSTPPPSSPPPATPPPASPPP 100

Query: 166 ATSPPA-PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           AT PPA P PA+ P  +P P+T   PP  TP    P P+   TPPP
Sbjct: 101 ATPPPASPPPATPPPASPPPAT---PPPATPPPATPPPA---TPPP 140

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 45/97 (46%), Positives = 57/97 (58%), Gaps = 3/97 (3%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPP--TATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA-P 186
           PTATP P + PP  ++PP  TA+PP  + P  ++PP ATPP A+PP     PA+ PPA P
Sbjct: 54  PTATPPPVSTPPPTSSPPPVTASPPPVSTPPPSSPPPATPPPASPPPATPPPASPPPATP 113

Query: 187 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
            PAS P   P P+T   PP  TP    P P+   +PP
Sbjct: 114 PPASPPPATPPPAT---PPPATPPPATPPPAPLASPP 147

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 42/86 (48%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPT--ATP-PTATPPAPASSPATSPPAPTPASTPSTAPTP 222
           A + PPT+TP T TPPA+  PPT  A P PTATPP  ++ P TS P P  AS P  +  P
Sbjct: 25  APSNPPTSTPATPTPPASTPPPTTQAPPTPTATPPPVSTPPPTSSPPPVTASPPPVSTPP 84

Query: 223 STAGSPPAPTPDSLGPGPSGADTPPP 300
            +  SPP  TP    P P+   TPPP
Sbjct: 85  PS--SPPPATPPPASPPPA---TPPP 105

[4][TOP]
>UniRef100_Q39763 Proline-rich cell wall protein n=1 Tax=Gossypium barbadense
           RepID=Q39763_GOSBA
          Length = 214

 Score =  102 bits (253), Expect = 2e-20
 Identities = 55/104 (52%), Positives = 66/104 (63%), Gaps = 8/104 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA---ATPPTATPPTATPPAA----ATPPTATPPTAT-PPAPAS 159
           P+ PP ATP P + PPA    A+PP ATPP A+PP A    ATPP ATPP AT PPAP +
Sbjct: 85  PSSPPPATPPPASPPPATPPPASPPPATPPPASPPPATPPPATPPPATPPPATPPPAPLA 144

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 291
           SP  + PA +P  TP T+P P+     PAPT  +  PGP+G DT
Sbjct: 145 SPPATVPAISPVQTPLTSP-PAPPTEAPAPTLGAATPGPAGTDT 187

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 51/105 (48%), Positives = 64/105 (60%), Gaps = 6/105 (5%)
 Frame = +1

Query: 7   TKPPTATPAP-KAQPPAAATPPTATPPTATPPAA----ATPPTATPPTATPPAPASSPAT 171
           T PPT++P P  A PP  +TPP ++PP ATPP A    ATPP A+PP ATPP  +  PAT
Sbjct: 63  TPPPTSSPPPVTASPPPVSTPPPSSPPPATPPPASPPPATPPPASPPPATPPPASPPPAT 122

Query: 172 SPPA-PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PPA P PA+ P   P P+   SPPA  P ++ P  +   +PP P
Sbjct: 123 PPPATPPPATPPPATPPPAPLASPPATVP-AISPVQTPLTSPPAP 166

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 51/112 (45%), Positives = 64/112 (57%), Gaps = 12/112 (10%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQ---------PPAAATPPTATPP--TATPPAAATPPTATPPTATPP 147
           AP  PP +TP P  Q         PP +  PPT++PP  TA+PP  +TPP ++PP ATPP
Sbjct: 35  APPTPPASTPPPTTQAPPTPTATPPPVSTPPPTSSPPPVTASPPPVSTPPPSSPPPATPP 94

Query: 148 APASSPATSPPA-PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             +  PAT PPA P PA+ P  +P P+T   PP  TP    P P+   TPPP
Sbjct: 95  PASPPPATPPPASPPPATPPPASPPPAT---PPPATPPPATPPPA---TPPP 140

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 45/97 (46%), Positives = 57/97 (58%), Gaps = 3/97 (3%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPP--TATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA-P 186
           PTATP P + PP  ++PP  TA+PP  + P  ++PP ATPP A+PP     PA+ PPA P
Sbjct: 54  PTATPPPVSTPPPTSSPPPVTASPPPVSTPPPSSPPPATPPPASPPPATPPPASPPPATP 113

Query: 187 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
            PAS P   P P+T   PP  TP    P P+   +PP
Sbjct: 114 PPASPPPATPPPAT---PPPATPPPATPPPAPLASPP 147

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 41/86 (47%), Positives = 49/86 (56%), Gaps = 3/86 (3%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPT--ATP-PTATPPAPASSPATSPPAPTPASTPSTAPTP 222
           A + PPT+TP   TPPA+  PPT  A P PTATPP  ++ P TS P P  AS P  +  P
Sbjct: 25  APSNPPTSTPAPPTPPASTPPPTTQAPPTPTATPPPVSTPPPTSSPPPVTASPPPVSTPP 84

Query: 223 STAGSPPAPTPDSLGPGPSGADTPPP 300
            +  SPP  TP    P P+   TPPP
Sbjct: 85  PS--SPPPATPPPASPPPA---TPPP 105

[5][TOP]
>UniRef100_A7QW77 Chromosome chr3 scaffold_199, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7QW77_VITVI
          Length = 290

 Score =  102 bits (253), Expect = 2e-20
 Identities = 57/114 (50%), Positives = 60/114 (52%), Gaps = 14/114 (12%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA---ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           P  PP ATP P   PPA    ATPP ATPP ATPP  ATPP ATPP ATPP     PAT 
Sbjct: 132 PATPPPATPPPATPPPATPPPATPPPATPPPATPP-PATPPPATPPPATPPPATPPPATP 190

Query: 175 PPA-PTPASTPSTAPTPSTAGSPPAPTP----------DSLGPGPSGADTPPPP 303
           PPA P PA+ P   P P+   SPPA  P           +L P P     P PP
Sbjct: 191 PPATPPPATPPPATPPPAHLASPPAAVPAPAPSTKVKSPALAPSPLTNSPPAPP 244

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 55/101 (54%), Positives = 61/101 (60%), Gaps = 1/101 (0%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           A T PP ++P P + PP A TPP ATPP ATPP  ATPP ATPP ATPP     PAT PP
Sbjct: 115 AVTSPPASSPPPVSAPPPA-TPPPATPPPATPP-PATPPPATPPPATPPPATPPPATPPP 172

Query: 181 A-PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           A P PA+ P   P P+T   PP  TP    P P+   TPPP
Sbjct: 173 ATPPPATPPPATPPPAT---PPPATPPPATPPPA---TPPP 207

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 61/115 (53%), Positives = 65/115 (56%), Gaps = 16/115 (13%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA---ATPPTATPPTATPPAA----ATPPTATPPTATPPAPASS 162
           P  PP ATP P   PPA    ATPP ATPP ATPP A    ATPP ATPP ATPP     
Sbjct: 147 PATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPP 206

Query: 163 PA--TSPPAPTPASTPST-------APTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           PA   SPPA  PA  PST       AP+P T  SPPAP  ++ GP  SG  +P P
Sbjct: 207 PAHLASPPAAVPAPAPSTKVKSPALAPSPLT-NSPPAPPAEAPGP-ISGGISPAP 259

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 50/102 (49%), Positives = 58/102 (56%), Gaps = 3/102 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           PT P  + P     PPA++ PP + PP ATPP A TPP ATPP ATPP     PAT PPA
Sbjct: 105 PTTPAASPPTAVTSPPASSPPPVSAPPPATPPPA-TPPPATPPPATPPPATPPPATPPPA 163

Query: 184 -PTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPP 300
            P PA+ P   P P+T    +PP  TP    P P+   TPPP
Sbjct: 164 TPPPATPPPATPPPATPPPATPPPATPPPATPPPA---TPPP 202

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/110 (49%), Positives = 61/110 (55%), Gaps = 10/110 (9%)
 Frame = +1

Query: 1   APTKPPTATPAPK------AQPPAAAT-PPTATPPTATPPAAATPPTATPPTATPPAPAS 159
           AP   PTATPAP       A PP A T PP ++PP  + P  ATPP ATPP ATPP    
Sbjct: 91  APAGGPTATPAPPTPTTPAASPPTAVTSPPASSPPPVSAPPPATPPPATPPPATPPPATP 150

Query: 160 SPATSPPA-PTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPP 300
            PAT PPA P PA+ P   P P+T    +PP  TP    P P+   TPPP
Sbjct: 151 PPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPA---TPPP 197

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 40/90 (44%), Positives = 44/90 (48%), Gaps = 3/90 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTA--TPPAAATPPTATPPTATPPAPASSPAT-S 174
           P  PP ATP P       ATPP ATPP A    P AA P  A       PA A SP T S
Sbjct: 187 PATPPPATPPP-------ATPPPATPPPAHLASPPAAVPAPAPSTKVKSPALAPSPLTNS 239

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSL 264
           PPAP     P+ AP P + G  PAP  + +
Sbjct: 240 PPAP-----PAEAPGPISGGISPAPAANDV 264

[6][TOP]
>UniRef100_C0Z219 AT2G14890 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z219_ARATH
          Length = 171

 Score =  101 bits (251), Expect = 3e-20
 Identities = 57/123 (46%), Positives = 67/123 (54%), Gaps = 22/123 (17%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQ--PPAAATPP--TATPPTATPPAAATPPTATPPTATPPAPASSP- 165
           APT PPTATPAP     PP AATPP  +A PP ++PP A+ PP   PP A+PP P +SP 
Sbjct: 22  APTSPPTATPAPPTPTTPPPAATPPPVSAPPPVSSPPPASPPPATPPPVASPPPPVASPP 81

Query: 166 -------ATSPPAP---TPASTPSTAPT-------PSTAGSPPAPTPDSLGPGPSGADTP 294
                  AT PPAP    PA  P+ APT       PS + SPP P+ D+ GP        
Sbjct: 82  PATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSISPA 141

Query: 295 PPP 303
           P P
Sbjct: 142 PSP 144

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 51/109 (46%), Positives = 64/109 (58%), Gaps = 15/109 (13%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPP--TATPPTATPP---APASSPAT 171
           T PP ATP P + PP  ++PP A+PP ATPP  A+PP   A+PP ATPP    P  +P  
Sbjct: 38  TPPPAATPPPVSAPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLA 97

Query: 172 SPPAPTPASTPST---APTPSTAGSPP-------APTPDSLGPGPSGAD 288
           SPPA  PA  P+T   +P+PS + SPP        P+ DS+ P PS  D
Sbjct: 98  SPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSISPAPSPTD 146

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 32/77 (41%), Positives = 38/77 (49%), Gaps = 7/77 (9%)
 Frame = +1

Query: 91  TPPAAATPPTATP----PTATPPAPASSPATSPP---APTPASTPSTAPTPSTAGSPPAP 249
           T  A  +PPTATP    PT  PPA    P ++PP   +P PAS P   P P  +  PP  
Sbjct: 19  TGQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVSSPPPASPPPATPPPVASPPPPVA 78

Query: 250 TPDSLGPGPSGADTPPP 300
           +P    P P    TPPP
Sbjct: 79  SPPPATPPP--VATPPP 93

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 33/99 (33%), Positives = 41/99 (41%), Gaps = 29/99 (29%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTA---TPPTATP---------- 144
           P  PP ATP P A PP    PP A+PP ATPP  ATPP A   +PP   P          
Sbjct: 59  PASPPPATPPPVASPP----PPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDS 114

Query: 145 ----------------PAPASSPATSPPAPTPASTPSTA 213
                           P P++   +  P+PT  +  + A
Sbjct: 115 PSPSPSSSPPLPSSDAPGPSTDSISPAPSPTDVNDQNGA 153

[7][TOP]
>UniRef100_B7ZXA1 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B7ZXA1_MAIZE
          Length = 662

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 55/107 (51%), Positives = 65/107 (60%), Gaps = 11/107 (10%)
 Frame = +1

Query: 16  PTATPAPK--AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP--PA 183
           PTA PAP   + PPA AT P    P+A PPAA TPPT TPPT +PP+PA+ P + P  PA
Sbjct: 5   PTAAPAPTTPSAPPANATNPPPATPSAPPPAAPTPPTPTPPTPSPPSPAAPPPSPPSVPA 64

Query: 184 PTPASTPST--APTPSTAGSP-----PAPTPDSLGPGPSGADTPPPP 303
           P PASTP T  AP+PS+  SP     P+P  D+  P  SG     PP
Sbjct: 65  PAPASTPVTPSAPSPSSPSSPGTPATPSPPSDTPSPPSSGGGGRSPP 111

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/96 (53%), Positives = 62/96 (64%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAP 186
           T PP ATP+  A PPAA TPPT TPPT +PP+ A PP + PP+   PAPAS+P T P AP
Sbjct: 22  TNPPPATPS--APPPAAPTPPTPTPPTPSPPSPAAPPPS-PPSVPAPAPASTPVT-PSAP 77

Query: 187 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
           +P S+PS+  TP+T  SPP+ TP     G  G   P
Sbjct: 78  SP-SSPSSPGTPATP-SPPSDTPSPPSSGGGGRSPP 111

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 43/108 (39%), Positives = 56/108 (51%), Gaps = 9/108 (8%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT-SP 177
           APT PPT TP P   PP+ A PP + P    P  A+TP T + P+ + P+   +PAT SP
Sbjct: 36  APT-PPTPTP-PTPSPPSPAAPPPSPPSVPAPAPASTPVTPSAPSPSSPSSPGTPATPSP 93

Query: 178 PAPTPASTPSTA----PTPSTAGSPPAPT----PDSLGPGPSGADTPP 297
           P+ TP S PS+       PS+ G    P+    P S  PG  G  + P
Sbjct: 94  PSDTP-SPPSSGGGGRSPPSSGGGRSTPSSHSPPKSHSPGGGGGSSGP 140

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 38/89 (42%), Positives = 45/89 (50%), Gaps = 12/89 (13%)
 Frame = +1

Query: 73  ATPPTATPPAAATPPTATPPTAT--PPAPASSP---ATSPPAPTP--ASTPSTAPTPSTA 231
           ++ PTA P  A T P+A P  AT  PPA  S+P   A +PP PTP   S PS A  P + 
Sbjct: 2   SSSPTAAP--APTTPSAPPANATNPPPATPSAPPPAAPTPPTPTPPTPSPPSPAAPPPSP 59

Query: 232 GSPPAPTPDSL-----GPGPSGADTPPPP 303
            S PAP P S       P PS   +P  P
Sbjct: 60  PSVPAPAPASTPVTPSAPSPSSPSSPGTP 88

[8][TOP]
>UniRef100_B6UDN6 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6UDN6_MAIZE
          Length = 207

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 54/102 (52%), Positives = 65/102 (63%), Gaps = 6/102 (5%)
 Frame = +1

Query: 16  PTATPAPK--AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP--PA 183
           PTA PAP   + PPA AT P    P+A PPAA TPPT TPPT +PP+PA+ P + P  PA
Sbjct: 5   PTAAPAPTTPSAPPANATNPPPATPSAPPPAAPTPPTPTPPTPSPPSPAAPPPSPPSVPA 64

Query: 184 PTPASTPST--APTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P+STP+T  AP+PS+  SP  P      P P  +DTP PP
Sbjct: 65  PAPSSTPATPSAPSPSSPSSPSTPAT----PSPP-SDTPSPP 101

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 52/108 (48%), Positives = 65/108 (60%), Gaps = 9/108 (8%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT-SPPA 183
           T PP ATP+  A PPAA TPPT TPPT +PP+ A PP + PP+   PAP+S+PAT S P+
Sbjct: 22  TNPPPATPS--APPPAAPTPPTPTPPTPSPPSPAAPPPS-PPSVPAPAPSSTPATPSAPS 78

Query: 184 PTPASTPSTAPTPSTAGSPPAP--------TPDSLGPGPSGADTPPPP 303
           P+  S+PST  TPS     P+P        +P S G G S   +  PP
Sbjct: 79  PSSPSSPSTPATPSPPSDTPSPPSSGGGGRSPPSSGGGRSTPSSHSPP 126

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 43/108 (39%), Positives = 57/108 (52%), Gaps = 9/108 (8%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT-SP 177
           APT PPT TP P   PP+ A PP + P    P  ++TP T + P+ + P+  S+PAT SP
Sbjct: 36  APT-PPTPTP-PTPSPPSPAAPPPSPPSVPAPAPSSTPATPSAPSPSSPSSPSTPATPSP 93

Query: 178 PAPTPASTPSTA----PTPSTAGSPPAPT----PDSLGPGPSGADTPP 297
           P+ TP S PS+       PS+ G    P+    P S  PG  G  + P
Sbjct: 94  PSDTP-SPPSSGGGGRSPPSSGGGRSTPSSHSPPKSHSPGGGGGSSGP 140

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 38/89 (42%), Positives = 45/89 (50%), Gaps = 12/89 (13%)
 Frame = +1

Query: 73  ATPPTATPPAAATPPTATPPTAT--PPAPASSP---ATSPPAPTP--ASTPSTAPTPSTA 231
           ++ PTA P  A T P+A P  AT  PPA  S+P   A +PP PTP   S PS A  P + 
Sbjct: 2   SSSPTAAP--APTTPSAPPANATNPPPATPSAPPPAAPTPPTPTPPTPSPPSPAAPPPSP 59

Query: 232 GSPPAPTPDSL-----GPGPSGADTPPPP 303
            S PAP P S       P PS   +P  P
Sbjct: 60  PSVPAPAPSSTPATPSAPSPSSPSSPSTP 88

[9][TOP]
>UniRef100_C0Z3D3 AT2G14890 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z3D3_ARATH
          Length = 171

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 53/123 (43%), Positives = 64/123 (52%), Gaps = 22/123 (17%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQ--PPAAATPPTATPP--TATPPAAATPPTATPPTATPPAPASS-- 162
           APT PPTATPAP     PP AA PP A PP   ++PP A+ PP   PP A+PP P +S  
Sbjct: 22  APTSPPTATPAPPTPTTPPPAAAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASHP 81

Query: 163 -------------PATSPPAPTPASTPST---APTPSTAGSPPAPTPDSLGPGPSGADTP 294
                        P  SPPA  PA  P+T   +P+PS + SPP P+ D+ GP        
Sbjct: 82  PATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSISPA 141

Query: 295 PPP 303
           P P
Sbjct: 142 PSP 144

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 34/77 (44%), Positives = 36/77 (46%), Gaps = 7/77 (9%)
 Frame = +1

Query: 91  TPPAAATPPTATP----PTATPPAPASSPATSPP---APTPASTPSTAPTPSTAGSPPAP 249
           T  A  +PPTATP    PT  PPA A  PA  PP   +P PAS P   P P    SPP P
Sbjct: 19  TGQAPTSPPTATPAPPTPTTPPPAAAPPPANPPPPVSSPPPASPPPATPPP--VASPPPP 76

Query: 250 TPDSLGPGPSGADTPPP 300
                   P    TPPP
Sbjct: 77  VASHPPATPPPVATPPP 93

[10][TOP]
>UniRef100_A9P9Z1 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P9Z1_POPTR
          Length = 207

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 53/102 (51%), Positives = 57/102 (55%), Gaps = 3/102 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP ATP P   PPA  TPP ATPP ATPP A  PP   PP   PPAP +SP    PA
Sbjct: 78  PASPPPATPPPATPPPA--TPPPATPPPATPPPATPPPATPPPAVPPPAPLASPPALVPA 135

Query: 184 PTPASTPS--TAPTPSTAGSPPAPTPDSLGPGPS-GADTPPP 300
           P PA + S   AP PS   S P P P +  P PS GA +P P
Sbjct: 136 PAPAPSKSKLKAPAPSPLASSP-PAPPTGAPAPSLGASSPGP 176

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/116 (46%), Positives = 64/116 (55%), Gaps = 21/116 (18%)
 Frame = +1

Query: 1   APTKPPTATPAP-------KAQPPAAATPP--------TATPPTATPPAAATPPTATPPT 135
           AP   PTATPAP        + PPA +TPP        T +PP ATPP  + PP A+PP 
Sbjct: 24  APATSPTATPAPPTATTPTTSPPPATSTPPPVSAPPPVTQSPPPATPPPVSAPPPASPPP 83

Query: 136 ATPPAPASSPATSPPA-PTPASTPSTAPTPST---AGSPPAP--TPDSLGPGPSGA 285
           ATPP     PAT PPA P PA+ P   P P+T   A  PPAP  +P +L P P+ A
Sbjct: 84  ATPPPATPPPATPPPATPPPATPPPATPPPATPPPAVPPPAPLASPPALVPAPAPA 139

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 50/112 (44%), Positives = 57/112 (50%), Gaps = 13/112 (11%)
 Frame = +1

Query: 7   TKPPTATPAPKAQ-PPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           T PP + P P  Q PP A  PP + PP A+PP A TPP ATPP ATPP     PAT PPA
Sbjct: 51  TPPPVSAPPPVTQSPPPATPPPVSAPPPASPPPA-TPPPATPPPATPPPATPPPATPPPA 109

Query: 184 -PTPASTPSTAPTPSTAGSPPAPTP-----------DSLGPGPSGADTPPPP 303
            P PA+ P   P P+   SPPA  P            +  P P  +  P PP
Sbjct: 110 TPPPATPPPAVPPPAPLASPPALVPAPAPAPSKSKLKAPAPSPLASSPPAPP 161

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 48/99 (48%), Positives = 55/99 (55%), Gaps = 4/99 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA---ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           P  PP ATP P   PPA    ATPP ATPP A PP A   P A+PP A  PAPA +P+ S
Sbjct: 88  PATPPPATPPPATPPPATPPPATPPPATPPPAVPPPA---PLASPP-ALVPAPAPAPSKS 143

Query: 175 P-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
              AP P+   S+ P P T    PAP+  +  PGP G D
Sbjct: 144 KLKAPAPSPLASSPPAPPTGA--PAPSLGASSPGPVGTD 180

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 45/93 (48%), Positives = 52/93 (55%), Gaps = 10/93 (10%)
 Frame = +1

Query: 52  AAATPPTATP--PTATPPAAATPP-TATPPTATPPAPASS---PATSPP--APTPASTPS 207
           A AT PTATP  PTAT P  + PP T+TPP  + P P +    PAT PP  AP PAS P 
Sbjct: 24  APATSPTATPAPPTATTPTTSPPPATSTPPPVSAPPPVTQSPPPATPPPVSAPPPASPPP 83

Query: 208 TAPTPST--AGSPPAPTPDSLGPGPSGADTPPP 300
             P P+T    +PP  TP    P P+   TPPP
Sbjct: 84  ATPPPATPPPATPPPATPPPATPPPA---TPPP 113

[11][TOP]
>UniRef100_Q1QHE7 OmpA/MotB n=1 Tax=Nitrobacter hamburgensis X14 RepID=Q1QHE7_NITHX
          Length = 673

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 53/104 (50%), Positives = 57/104 (54%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSP--ATSP 177
           P  PP A   P A PP AA P    PP A  PAA  PP  TPPTATPP PA+ P  AT P
Sbjct: 72  PAPPPGAPERPAAPPPHAAPPHAPPPPAAARPAAPPPPHVTPPTATPPRPATPPPHATPP 131

Query: 178 PAP-TPASTPSTAP-TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            AP  P + P+  P TP  A  PPAP   +  P PS   TPPPP
Sbjct: 132 AAPAAPKAAPAPKPATPPVAPKPPAPPTAAPPPSPSKGTTPPPP 175

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 53/109 (48%), Positives = 56/109 (51%), Gaps = 8/109 (7%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPP-TATPPAAATPPTATPPTATPPAPASSPATSP 177
           AP  P  A PA  A PP   TPPTATPP  ATPP  ATPP A  P A   APA  PAT P
Sbjct: 94  APPPPAAARPA--APPPPHVTPPTATPPRPATPPPHATPPAA--PAAPKAAPAPKPATPP 149

Query: 178 PAPTPASTPSTAPTPS----TAGSPPAPT---PDSLGPGPSGADTPPPP 303
            AP P + P+ AP PS    T   PPA T   P +  P P       PP
Sbjct: 150 VAPKPPAPPTAAPPPSPSKGTTPPPPAATKSAPTTPAPQPQTTSPSTPP 198

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/108 (38%), Positives = 49/108 (45%), Gaps = 13/108 (12%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPT-------ATPPAAATPPTATP------PTATPPAP 153
           PP A   P A PP   TPPTATPP        ATPPAA   P A P      P   P  P
Sbjct: 96  PPPAAARPAAPPPPHVTPPTATPPRPATPPPHATPPAAPAAPKAAPAPKPATPPVAPKPP 155

Query: 154 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           A   A  PP+P+  +TP       +A + PAP P +  P    A+  P
Sbjct: 156 APPTAAPPPSPSKGTTPPPPAATKSAPTTPAPQPQTTSPSTPPANGEP 203

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/96 (41%), Positives = 47/96 (48%), Gaps = 2/96 (2%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTA--TPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           T P  ATP P A PPAA   P A   P  ATPP A  PP   PPTA PP P+ S  T+PP
Sbjct: 117 TPPRPATPPPHATPPAAPAAPKAAPAPKPATPPVAPKPP--APPTAAPP-PSPSKGTTPP 173

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
            P    +  T P P    + P+  P +  P  +  D
Sbjct: 174 PPAATKSAPTTPAPQPQTTSPSTPPANGEPNATRRD 209

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 41/97 (42%), Positives = 48/97 (49%), Gaps = 1/97 (1%)
 Frame = +1

Query: 13  PPTATPAPKAQP-PAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPT 189
           PP A  APKA P P  ATPP A  P A PP AA PP+ +  T  PP  A+  A + PAP 
Sbjct: 130 PPAAPAAPKAAPAPKPATPPVAPKPPA-PPTAAPPPSPSKGTTPPPPAATKSAPTTPAPQ 188

Query: 190 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P +T  +  TP   G P A   D  G    G +   P
Sbjct: 189 PQTT--SPSTPPANGEPNATRRDERGRSGPGREHGGP 223

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 43/101 (42%), Positives = 48/101 (47%), Gaps = 4/101 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAA----TPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P   TPAP +  PAA     T P ATP  ATP A    P ATPP+      A++P T P 
Sbjct: 235 PAQTTPAPGSTTPAAPDVTPTSPRATP--ATPSAPVASPAATPPSGAAAPAAATPPTGP- 291

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           A T A TP + P   TA  P AP     GP       PPPP
Sbjct: 292 AGTKAGTPPSTPGGQTALPPGAPV-SRHGPPTVTTPLPPPP 331

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 43/105 (40%), Positives = 47/105 (44%), Gaps = 13/105 (12%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPT-ATPPAAATPPTATPPT--ATPPA-PASSPA 168
           AP   PT+  A  A P A    P ATPP+ A  PAAATPPT    T   TPP+ P    A
Sbjct: 249 APDVTPTSPRATPATPSAPVASPAATPPSGAAAPAAATPPTGPAGTKAGTPPSTPGGQTA 308

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPT---------PDSLGPGP 276
             P AP     P T  TP     PP PT         PD+   GP
Sbjct: 309 LPPGAPVSRHGPPTVTTP----LPPPPTSAQALKPIAPDAARQGP 349

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 47/131 (35%), Positives = 59/131 (45%), Gaps = 32/131 (24%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTAT---------------------------PP 99
           A TK    TPAP+ Q  + +TPP    P AT                            P
Sbjct: 176 AATKSAPTTPAPQPQTTSPSTPPANGEPNATRRDERGRSGPGREHGGPGGPGDHRKGAAP 235

Query: 100 AAATP-PTATPPTA---TPPAPASSPAT-SPPAPTPASTPSTAPTPSTAGSPPAPTPDSL 264
           A  TP P +T P A   TP +P ++PAT S P  +PA+TP     PS A +P A TP + 
Sbjct: 236 AQTTPAPGSTTPAAPDVTPTSPRATPATPSAPVASPAATP-----PSGAAAPAAATPPT- 289

Query: 265 GPGPSGADTPP 297
           GP  + A TPP
Sbjct: 290 GPAGTKAGTPP 300

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 39/108 (36%), Positives = 45/108 (41%), Gaps = 12/108 (11%)
 Frame = +1

Query: 16  PTATPAPK-AQPPAAA---TPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P A PAPK A PP A     PPTA PP  +P    TPP      + P  PA  P T+ P+
Sbjct: 137 PKAAPAPKPATPPVAPKPPAPPTAAPP-PSPSKGTTPPPPAATKSAPTTPAPQPQTTSPS 195

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG--------ADTPPPP 303
             PA+    A      G    P  +  GPG  G        A T P P
Sbjct: 196 TPPANGEPNATRRDERGR-SGPGREHGGPGGPGDHRKGAAPAQTTPAP 242

[12][TOP]
>UniRef100_C4J5K1 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C4J5K1_MAIZE
          Length = 231

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 51/105 (48%), Positives = 59/105 (56%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   APTKPP----TATPAPKAQPPAAATPPTA-TPPTATPPAAATPPTATPPTATPPAPASSP 165
           APT PP    T  PAP   PPA  TPP A T P  +PPA+  P   TPP + P +P  +P
Sbjct: 71  APTTPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAP 130

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           AT PP+P  A  P+T P P+T   P APT     P PS A TPPP
Sbjct: 131 ATPPPSPPMAPPPATPPPPATPPPPAAPT-----PAPSVAPTPPP 170

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 48/104 (46%), Positives = 55/104 (52%), Gaps = 4/104 (3%)
 Frame = +1

Query: 1   APTKPP----TATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPA 168
           APT PP    T  P+P A PP A T P  +PP + PPA ATPP + PP A PPA    PA
Sbjct: 92  APTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPPS-PPMAPPPATPPPPA 150

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           T PP   P   PS APTP    +P A       P P+ A +P P
Sbjct: 151 TPPPPAAPTPAPSVAPTPPPVATPAASPKSPKTPSPAAATSPAP 194

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 55/119 (46%), Positives = 62/119 (52%), Gaps = 19/119 (15%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPP---TATPP---TATPPAAATPPTA--TP---PTATPPA 150
           P  PP   P P  Q P A  PP   TATPP   T  PPA  TPP A  TP   PT  PPA
Sbjct: 40  PQAPPAGNPPPAPQAPPAGNPPPAPTATPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPA 99

Query: 151 PA----SSPATSPPAP-TPASTPSTAPTPSTAGSPPAP---TPDSLGPGPSGADTPPPP 303
           P     S PA+ PPAP TP  +P  +P P+ A  PP+P    P +  P P+   TPPPP
Sbjct: 100 PTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPPSPPMAPPPATPPPPA---TPPPP 155

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 43/103 (41%), Positives = 47/103 (45%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           A  + P A P P    P A +PP A P    PPA   PP   PP A    P  +P T PP
Sbjct: 18  AAQQSPPAQPPPTPNAPPANSPPQAPPAGNPPPAPQAPPAGNPPPAPTATPPPAPTTPPP 77

Query: 181 APTPASTPSTAPTPSTAGSPPAPT--PDSLGPGPSGADTPPPP 303
           APT      T P P+    PPAPT  P S    P  A T PPP
Sbjct: 78  APTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPP 120

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 48/101 (47%), Positives = 60/101 (59%), Gaps = 4/101 (3%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTA---TPPTATPPAAATPPTATPPTATPPAPASSPAT 171
           APT PP + PA  + PPA ATPP +    PP ATPP  ATPP   PP A  PAP+ +P T
Sbjct: 114 APTTPPPSPPA--SPPPAPATPPPSPPMAPPPATPPPPATPP---PPAAPTPAPSVAP-T 167

Query: 172 SPPAPTPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSGADT 291
            PP  TPA++P +  TPS  A + PAP+    G  P+  D+
Sbjct: 168 PPPVATPAASPKSPKTPSPAAATSPAPSLSPAGT-PTNEDS 207

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 52/113 (46%), Positives = 56/113 (49%), Gaps = 13/113 (11%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTA--TPPAAATPP--TATPP---TATPPAPAS- 159
           P +PP    AP A  P  A PP   PP A   PPA   PP  TATPP   T  PPAP + 
Sbjct: 24  PAQPPPTPNAPPANSPPQA-PPAGNPPPAPQAPPAGNPPPAPTATPPPAPTTPPPAPTTP 82

Query: 160 --SPATSPPAP-TPASTPSTAPTPSTAGSPPAPT--PDSLGPGPSGADTPPPP 303
             +P T PPAP TP   P+T P    A  PPAPT  P S    P  A   PPP
Sbjct: 83  PPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPP 135

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 40/95 (42%), Positives = 51/95 (53%), Gaps = 3/95 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA--ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           P+ P +  PAP   PP+   A PP   PP ATPP  A  PT  P  A  P P ++PA SP
Sbjct: 120 PSPPASPPPAPATPPPSPPMAPPPATPPPPATPPPPAA-PTPAPSVAPTPPPVATPAASP 178

Query: 178 PAP-TPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 279
            +P TP+   +T+P PS +   PA TP +   G S
Sbjct: 179 KSPKTPSPAAATSPAPSLS---PAGTPTNEDSGAS 210

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 34/78 (43%), Positives = 41/78 (52%), Gaps = 6/78 (7%)
 Frame = +1

Query: 88  ATPPAAATPPTATPPTATPPAPASSPATSPPA----PTPASTPSTAPTPS-TAGSPPAP- 249
           A+  A  +PP   PPT   P PA+SP  +PPA    P P + P+  P P+ TA  PPAP 
Sbjct: 15  ASCAAQQSPPAQPPPTPNAP-PANSPPQAPPAGNPPPAPQAPPAGNPPPAPTATPPPAPT 73

Query: 250 TPDSLGPGPSGADTPPPP 303
           TP      P  A T PPP
Sbjct: 74  TPPPAPTTPPPAPTTPPP 91

[13][TOP]
>UniRef100_B8AG26 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8AG26_ORYSI
          Length = 218

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 54/107 (50%), Positives = 61/107 (57%), Gaps = 7/107 (6%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           APT PP   P+P +QPP A   P  +PP   PPA ATPP + PP A PPA    PAT PP
Sbjct: 88  APTTPP---PSPPSQPPPAPATPPPSPPATPPPAPATPPPS-PPLAPPPATPPPPATPPP 143

Query: 181 APTPASTPSTAPT--PSTAG-----SPPAPTPDSLGPGPSGADTPPP 300
           A  PA TPSTAPT  P+TA      SP  P P +  P PS + T  P
Sbjct: 144 ALAPAPTPSTAPTVAPTTAPTVSPISPKTPAPTAATPSPSLSPTATP 190

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 55/115 (47%), Positives = 63/115 (54%), Gaps = 17/115 (14%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTA--TP----------PTATPPAAATPPTATPPTATP 144
           +PT PP A PAP   PPA  TPP A  TP          P ATPP A T P  +PP+  P
Sbjct: 42  SPTTPPPAPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPATPPPAPTTPPPSPPSQPP 101

Query: 145 PAPA----SSPATSPPAP-TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
           PAPA    S PAT PPAP TP  +P  AP P+T   PPA  P +L P P+ +  P
Sbjct: 102 PAPATPPPSPPATPPPAPATPPPSPPLAPPPATP-PPPATPPPALAPAPTPSTAP 155

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 52/104 (50%), Positives = 60/104 (57%), Gaps = 4/104 (3%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATP-PTATPPAAATPPTA--TPPTATPPAPASSPAT 171
           AP  PP+ TP P   PP+  TPP A P PT  PPA  TPP A  TPP A    P S PAT
Sbjct: 27  APNAPPSNTPPP--TPPSPTTPPPAPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPAT 84

Query: 172 SPPAP-TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            PPAP TP  +P + P P+ A  PP+P P +  P P+   TPPP
Sbjct: 85  PPPAPTTPPPSPPSQPPPAPATPPPSP-PATPPPAPA---TPPP 124

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/102 (43%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP-PTATPPAPAS-SPATS 174
           A  +PPT +P     PP+   PPT   PT  PPA   P T  P PT  PPAP +  PA +
Sbjct: 16  AAQQPPTQSPPAPNAPPSNTPPPTPPSPTTPPPAPPAPTTPPPAPTTPPPAPTTPPPAPT 75

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P P+P +TP  APT      P  P P    P PS   TPPP
Sbjct: 76  TPPPSPPATPPPAPTTPPPSPPSQPPPAPATPPPSPPATPPP 117

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 52/109 (47%), Positives = 58/109 (53%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTA--TPPTA--TPPAAATPPTATPPTATPPAPA----S 159
           PT P   TP P   PPA  TPP A  TPP A  TPP A T P  +PP   PPAP     S
Sbjct: 38  PTPPSPTTPPPA--PPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPATPPPAPTTPPPS 95

Query: 160 SPATSPPAP-TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+  PPAP TP  +P   P P+ A  PP+P    L P P+   TPPPP
Sbjct: 96  PPSQPPPAPATPPPSPPATPPPAPATPPPSP---PLAPPPA---TPPPP 138

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 37/81 (45%), Positives = 45/81 (55%)
 Frame = +1

Query: 58  ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGS 237
           A+     PPT +PPA   PP+ TPP  TPP+P ++P  +PPAPT      T P P+    
Sbjct: 13  ASAAAQQPPTQSPPAPNAPPSNTPP-PTPPSP-TTPPPAPPAPTTPPPAPTTPPPAPTTP 70

Query: 238 PPAPTPDSLGPGPSGADTPPP 300
           PPAPT     P PS   TPPP
Sbjct: 71  PPAPTT----PPPSPPATPPP 87

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 42/91 (46%), Positives = 49/91 (53%), Gaps = 3/91 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAA-TPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P+ P T  PAP   PP+    PP ATPP    P  A  P  TP TA   AP ++P  SP 
Sbjct: 109 PSPPATPPPAPATPPPSPPLAPPPATPPPPATPPPALAPAPTPSTAPTVAPTTAPTVSPI 168

Query: 181 AP-TPASTPSTAPTPSTAGSPPA-PTPDSLG 267
           +P TPA    TA TPS + SP A PT D+ G
Sbjct: 169 SPKTPA---PTAATPSPSLSPTATPTTDNSG 196

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/90 (40%), Positives = 44/90 (48%), Gaps = 2/90 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAA--ATPPTATPPTATPPAPASSPATSP 177
           P  P T  P+P   PP A  PP ATPP A  PA   +T PT  P TA   +P S    +P
Sbjct: 116 PPAPATPPPSPPLAPPPATPPPPATPPPALAPAPTPSTAPTVAPTTAPTVSPISPKTPAP 175

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLG 267
            A TP+ + S   TP+T  S    T  + G
Sbjct: 176 TAATPSPSLSPTATPTTDNSGATTTARAAG 205

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 32/81 (39%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +1

Query: 1   APTKPPTATPA--PKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           AP  PP + P   P A PP  ATPP A  P  TP  A T    T PT +P +P  +PA +
Sbjct: 118 APATPPPSPPLAPPPATPPPPATPPPALAPAPTPSTAPTVAPTTAPTVSPISP-KTPAPT 176

Query: 175 PPAPTPASTPSTAPTPSTAGS 237
              P+P+ +P+  PT   +G+
Sbjct: 177 AATPSPSLSPTATPTTDNSGA 197

[14][TOP]
>UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2B5_EHV86
          Length = 2332

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 44/102 (43%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP+  P+P   PP +  PPT  PP   PPA    P  +PP + PP+P  SP  SPP 
Sbjct: 723  PLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPP 782

Query: 184  PT--PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PT  P + P   P PS   SPP PTP    P P     P PP
Sbjct: 783  PTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 824

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 40/101 (39%), Positives = 56/101 (55%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPT-ATPPAPASSPATSPP 180
            P+ PP   P+P + PP+ + PP   PP   PP    PP   PP+  +PP P+  P + PP
Sbjct: 1689 PSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPP 1748

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P+  P + P PS + SPP P+     P PS + +PPPP
Sbjct: 1749 SPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPP 1789

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 40/97 (41%), Positives = 54/97 (55%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
            PP+ +P P   PP    PP   PP   PP+  +PP  +PP  +PP P+  P+  PP+P P
Sbjct: 1703 PPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPP-PSPPPSPPPPSPPP 1761

Query: 193  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             S   + P PST+ SPP P+     P PS + +PPPP
Sbjct: 1762 PSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPP 1798

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 43/106 (40%), Positives = 48/106 (45%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP- 180
            P  PP   P P + PP    PP  +PP   PP    PP   PP + PP+P  SP  SPP 
Sbjct: 810  PPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPP 869

Query: 181  -----APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                  P P + P  AP PS   SPP PTP    P P     P PP
Sbjct: 870  SPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 915

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 43/106 (40%), Positives = 48/106 (45%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP- 180
            P  PP   P P + PP    PP  +PP   PP    PP   PP + PP+P  SP  SPP 
Sbjct: 988  PPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPP 1047

Query: 181  -----APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                  P P + P  AP PS   SPP PTP    P P     P PP
Sbjct: 1048 SPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 1093

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 43/106 (40%), Positives = 48/106 (45%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP- 180
            P  PP   P P + PP    PP  +PP   PP    PP   PP + PP+P  SP  SPP 
Sbjct: 1079 PPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPP 1138

Query: 181  -----APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                  P P + P  AP PS   SPP PTP    P P     P PP
Sbjct: 1139 SPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 1184

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/100 (42%), Positives = 50/100 (50%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP  TP P A PP    PP+  PP   PP   +PP   PP   PP P   P + PP+
Sbjct: 800  PPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPP-PPSPPPPLPPPPLPPPPLPPPPSPPPS 858

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P+  PS  P+P    +PP P P    P PS   +PPPP
Sbjct: 859  PPPSPPPSPPPSPPPP-TPPPPAPPPPAPPPSPPPSPPPP 897

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 41/104 (39%), Positives = 49/104 (47%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS--- 174
            P+ PP+  P+P   PP    PP A PP   PP +  PP   PP  +PP P   P      
Sbjct: 967  PSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPP 1026

Query: 175  -PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PP P+P  +P  +P PS   SPP PTP    P P      PPP
Sbjct: 1027 LPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPP 1070

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/100 (42%), Positives = 50/100 (50%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP  TP P A PP    PP+  PP   PP   +PP   PP   PP P   P + PP+
Sbjct: 978  PPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPP-PPSPPPPLPPPPLPPPPLPPPPSPPPS 1036

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P+  PS  P+P    +PP P P    P PS   +PPPP
Sbjct: 1037 PPPSPPPSPPPSPPPP-TPPPPAPPPPAPPPSPPPSPPPP 1075

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/100 (42%), Positives = 50/100 (50%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP  TP P A PP    PP+  PP   PP   +PP   PP   PP P   P + PP+
Sbjct: 1069 PPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPP-PPSPPPPLPPPPLPPPPLPPPPSPPPS 1127

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P+  PS  P+P    +PP P P    P PS   +PPPP
Sbjct: 1128 PPPSPPPSPPPSPPPP-TPPPPAPPPPAPPPSPPPSPPPP 1166

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 44/101 (43%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATP-PTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            P  PP  TP P A PP A  P P  +PP + PP+    P  +PP  TPP PA  P T PP
Sbjct: 738  PPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPP 797

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P+  P T P P    +PP P P    P P     PPPP
Sbjct: 798  SPPPSPPPPTPPPP----APPPPNPPPPSP-PPPLPLPPPP 833

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 41/101 (40%), Positives = 47/101 (46%), Gaps = 4/101 (3%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS----PP 180
            PPT  P+P   PP    PP A PP   PP +  PP   PP  +PP P   P       PP
Sbjct: 792  PPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPP 851

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+P  +P  +P PS   SPP PTP    P P      PPP
Sbjct: 852  PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPP 892

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 47/112 (41%), Positives = 58/112 (51%), Gaps = 12/112 (10%)
 Frame = +1

Query: 4    PTKPPTATPAPK----AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA---PASS 162
            PT PP + P P     A PP +  PP A  P++ PP+ + PP   PP   PP    P   
Sbjct: 1669 PTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLP 1728

Query: 163  PATSPPAPTPASTPSTAPTPSTAGSPPAPTP--DSLGPG---PSGADTPPPP 303
            P  SPP+P P S P  +P PS   SPP P+P   SL P    PS + +PPPP
Sbjct: 1729 PPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPP 1780

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 45/108 (41%), Positives = 52/108 (48%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP--PTATPPTATPPAPASSPATSP 177
            P  PP  +P+P   PP  + PP+  PP+  PP    P  P   PP + PP+P  SP  SP
Sbjct: 682  PPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSP 741

Query: 178  PAPTPAS------TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P PTP         P  AP PS   SPP   P S  P P    TPPPP
Sbjct: 742  PPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPP-PPTPPPP 788

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 44/116 (37%), Positives = 51/116 (43%), Gaps = 16/116 (13%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAA--TPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
            P  PP  TP P A PP A   +PP + PP   PP A  PP   PP+  PP P   P + P
Sbjct: 1046 PPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPP 1105

Query: 178  PA--------------PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P               P+P  +P  +P PS   SPP PTP    P P      PPP
Sbjct: 1106 PPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPP 1161

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/100 (43%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   P    +PP + PP+  PP    PP A PP A PPAP  SP  SPP 
Sbjct: 713 PLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTP--PPPAPPPPAPPPAPPPSPPPSPPP 770

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P S P + P P    +PP P P    P PS   +PPPP
Sbjct: 771 SPPPSPPPSPPPP----TPPPPAPPPPTPPPSPPPSPPPP 806

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 45/102 (44%), Positives = 50/102 (49%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPT--ATPPAAATPPTATPPTATPPAPASSPATSP 177
            PT PP A P P   P    +PP + PP+   +PP +  PPT  PP   PP P  SP  SP
Sbjct: 744  PTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSP 803

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P PTP   P  AP P     P  P P  L P PS    PPPP
Sbjct: 804  PPPTP---PPPAPPPPNPPPPSPPPPLPLPPPPS----PPPP 838

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 42/104 (40%), Positives = 50/104 (48%), Gaps = 5/104 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA----SSPAT 171
            P+ PP+  P+P   PP +  PPT  PP   PPA    P  +PP  TPP PA    + P  
Sbjct: 1031 PSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP 1090

Query: 172  SPPAPTPASTPSTAPTP-STAGSPPAPTPDSLGPGPSGADTPPP 300
            SPP P P   P + P P      PP P P    P PS   +PPP
Sbjct: 1091 SPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 1134

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 40/100 (40%), Positives = 46/100 (46%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P+ PP+  P+P   PP +  PPT  PP   PPA    P  +PP  TPP PA  P   PP 
Sbjct: 1122 PSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP 1181

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P   P     P     PP P P  + P PS    PPPP
Sbjct: 1182 SPPPPLPPPPSPPPPLPPPPLP-PPPVPPPPSPPPLPPPP 1220

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 42/114 (36%), Positives = 57/114 (50%), Gaps = 14/114 (12%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATP--PTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
            P+ PP+  P+P   PP + +P  P  TPP  +PP  + P  A PP + PP  A SP++ P
Sbjct: 1644 PSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMP 1703

Query: 178  PA------------PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+            P P + P   P P +  SPP P+P    P PS   +PPPP
Sbjct: 1704 PSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPP 1757

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 43/109 (39%), Positives = 54/109 (49%), Gaps = 8/109 (7%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPT--ATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           +P+ PP + P P   PP +  PP+   +PP  +PP    PP   PP   PP+P  SP  S
Sbjct: 677 SPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPS 736

Query: 175 ------PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                 PP P P + P  AP P+   SPP   P S  P PS   +PPPP
Sbjct: 737 PPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPS--PPPSPPPSPPPP 783

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 42/104 (40%), Positives = 50/104 (48%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA----SSPAT 171
            P+ PP+  P+P   PP +  PPT  PP   PPA    P  +PP  TPP PA    + P  
Sbjct: 853  PSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP 912

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            SPP P P   P + P P     PP   P  + P PS    PPPP
Sbjct: 913  SPPPPLPLPPPPSPPPPL---PPPPLPPPPVPPPPSPPPLPPPP 953

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 42/112 (37%), Positives = 47/112 (41%), Gaps = 12/112 (10%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP------------P 147
            P  PP  TP P A PP    PP+  PP   PP  + PP   PP   P            P
Sbjct: 891  PPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLP 950

Query: 148  APASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P   P   PP P+P  +P  +P PS   SPP PTP    P P     P PP
Sbjct: 951  PPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 1002

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 42/107 (39%), Positives = 52/107 (48%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA-------SS 162
            P+ PP+  P+P   PP +  PP   PP  +PP    PP   PP + PP P        S 
Sbjct: 1583 PSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSP 1642

Query: 163  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P + PP+P P+  PS  P+PS    PP P P S  P PS     PPP
Sbjct: 1643 PPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPS-PPLPSPPLPAPPP 1688

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 39/101 (38%), Positives = 49/101 (48%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-PTATPPTATPPAPASSPATSPP 180
            P  PP  +P P   PP +  PP   PP   PP    P P   PP   PP P   P + PP
Sbjct: 1175 PPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPP 1234

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P+  PS  P+P  +  PP P P +  P P+   +PPPP
Sbjct: 1235 SPPPSPPPSPPPSPPPSPPPPTPPPPA-PPPPTPPPSPPPP 1274

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 42/103 (40%), Positives = 59/103 (57%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS---PATS 174
            P  PP   P P   PP+  +PP  +PP  +PP +  PP+  PP+  PP+ + S   P+TS
Sbjct: 1716 PLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSP-PPSPPPPSPPPPSLSPSPPPPSTS 1774

Query: 175  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P  P P+++PS  P PS + SPP P+     P PS + +PPPP
Sbjct: 1775 PSPPPPSASPS-PPPPSASPSPPPPSLSPSPPPPSTSPSPPPP 1816

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 41/106 (38%), Positives = 59/106 (55%), Gaps = 5/106 (4%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTA-TPPAPASSPATSP 177
            +P  PP  +P P + PP+   PP + PP + PP + +P    P T+ +PP P++SP+  P
Sbjct: 1732 SPPSPPPPSPPPPSPPPS---PPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPP 1788

Query: 178  PA----PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+    P P S   + P PST+ SPP P      P PS + +PPPP
Sbjct: 1789 PSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPP 1834

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 41/109 (37%), Positives = 60/109 (55%), Gaps = 8/109 (7%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATP--PAAATPPTATPPTATP--PAPASSPA 168
            +P  P    P+P   PP +  PP+  PP+ +P  P  +T P+  PP+A+P  P P++SP+
Sbjct: 1735 SPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPS 1794

Query: 169  TSPPA----PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              PP+    P P ST  + P P  + SPP P+     P PS + +PPPP
Sbjct: 1795 PPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPP 1843

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 44/104 (42%), Positives = 49/104 (47%), Gaps = 5/104 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAA--ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
            P  PP  TP P A PP A   +PP + PP   PP A  PP   PP+  PP P   P + P
Sbjct: 868  PPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPP 927

Query: 178  P--APTPASTPSTAPTPSTAGSPPAP-TPDSLGPGPSGADTPPP 300
            P   P P   P   P PS    PP P  P  L P PS   +PPP
Sbjct: 928  PPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPP 971

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 44/113 (38%), Positives = 55/113 (48%), Gaps = 12/113 (10%)
 Frame = +1

Query: 1    APTKPPTATPAPK---------AQPPAAATPPTATPPTATPPAAATPPTATPPTATP--- 144
            +P  PP   P P          A PP +  PP A  P++ PP+ + PP   PP   P   
Sbjct: 1663 SPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPN 1722

Query: 145  PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P  SPP+P P S P  +P PS   SPP P+P    P PS + +PPPP
Sbjct: 1723 PPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSP----PPPSLSPSPPPP 1771

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 41/104 (39%), Positives = 49/104 (47%), Gaps = 5/104 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA----SSPAT 171
            P+ PP+  P+P   PP +  PPT  PP   PP     P  +PP  TPP PA    + P  
Sbjct: 762  PSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPP 821

Query: 172  SPPAPTPASTPSTAPTP-STAGSPPAPTPDSLGPGPSGADTPPP 300
            SPP P P   P + P P      PP P P    P PS   +PPP
Sbjct: 822  SPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 865

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 45/105 (42%), Positives = 48/105 (45%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATP-----PTATPPAAATPPTATPPTATPPAPASSPA 168
            P  PP   P P   PP    PP+  P     P  +PP +  PPT  PP   PPAP  SP 
Sbjct: 832  PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPP 891

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             SPP PTP   P  AP P     P  P P  L P PS    PPPP
Sbjct: 892  PSPPPPTP---PPPAPPPPNPPPPSPPPPLPLPPPPS----PPPP 929

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 45/105 (42%), Positives = 48/105 (45%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATP-----PTATPPAAATPPTATPPTATPPAPASSPA 168
            P  PP   P P   PP    PP+  P     P  +PP +  PPT  PP   PPAP  SP 
Sbjct: 1010 PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPP 1069

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             SPP PTP   P  AP P     P  P P  L P PS    PPPP
Sbjct: 1070 PSPPPPTP---PPPAPPPPNPPPPSPPPPLPLPPPPS----PPPP 1107

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 41/100 (41%), Positives = 47/100 (47%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP + P P   PP    PP   PP  +PP    PP   PP   PP+P  SP  SPP 
Sbjct: 1186 PLPPPPSPPPPLPPPPL---PPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 1242

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P S P + P P+    PPAP P +  P P     PPPP
Sbjct: 1243 SPPPSPPPSPPPPTP--PPPAPPPPTPPPSPPPPTPPPPP 1280

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 39/103 (37%), Positives = 48/103 (46%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTA--TPPTATPPAAATPPTATPPTATPPAPASSPATS 174
            +P+ PP + P P   PP +  PP+   +PP  +PP    PP   P    PP+P  SP  S
Sbjct: 1533 SPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPS 1592

Query: 175  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP   P S P   P P     PP   P  + P PS    PPPP
Sbjct: 1593 PPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPP 1635

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 44/107 (41%), Positives = 49/107 (45%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-----PTATPPTATPPAPASSPA 168
            P  PP + P P   PP    PP   PP   PP +  P     P  +PP  TPP PA  P 
Sbjct: 698  PPSPPPSPPPPSPPPPL---PPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPP 754

Query: 169  TSPPAPTPASTPS--TAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              PPAP P+  PS   +P PS   SPP PTP    P P      PPP
Sbjct: 755  APPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPP 801

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 42/102 (41%), Positives = 48/102 (47%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP--PTATPPTATPPAPASSPATSP 177
            P  PP  TP P A PP    PP+  PP   PP+   P  P   PP   PP P+  P   P
Sbjct: 1160 PPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPP 1219

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P P   P  +P PS    PP+P P    P PS   +PPPP
Sbjct: 1220 PLPPPPLPPPPSPPPSP---PPSPPPS---PPPSPPPSPPPP 1255

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 43/100 (43%), Positives = 47/100 (47%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            PT PP A P P   PP+   PP   PP + PP    PP   PP   PP+P   P   PP 
Sbjct: 1166 PTPPPPAPPPPNPPPPSP--PPPLPPPPSPPPPLPPPPLPPPPVPPPPSP--PPLPPPPL 1221

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P  +P PS   SPP   P S  P P    TPPPP
Sbjct: 1222 PPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPP-PPTPPPP 1260

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 41/100 (41%), Positives = 49/100 (49%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P+ PP   P P   PP    PP  +PP + PP+    P  +PP  TPP PA  P   PP+
Sbjct: 1102 PSPPPPLPPPPLPPPPL---PPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPS 1158

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P+  P T P P  A  PP P P S  P      +PPPP
Sbjct: 1159 PPPSPPPPTPPPP--APPPPNPPPPSPPPPLPPPPSPPPP 1196

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 40/100 (40%), Positives = 49/100 (49%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP+  P P + PP+    P  +PP + PP    PP  +PP   PP P   P + PP 
Sbjct: 1573 PPVPPSPLPPP-SPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPL 1631

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P  +P PS   SPP   P S  P PS +  PPPP
Sbjct: 1632 PPPPLPPPPSPPPSPPPSPPPSPPPS--PPPSPSPLPPPP 1669

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 45/108 (41%), Positives = 48/108 (44%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATP-----PTATPPAAATPPTATPPTATPPAPASSPA 168
            P  PP   P P   PP    PP+  P     P  +PP +  PPT  PP   PPAP  SP 
Sbjct: 1101 PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPP 1160

Query: 169  TSPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             SPP PT   PA  P   P PS    PP P P S  P       PPPP
Sbjct: 1161 PSPPPPTPPPPAPPPPNPPPPSP--PPPLPPPPSPPPPLPPPPLPPPP 1206

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAAT--PPTATPPTATPPAAATPPTATPPTATPPAPASS----- 162
            P  PP + P P   PP+ +   PP +T P+  PP+A+  P+  PP+A+P  P  S     
Sbjct: 1747 PPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSAS--PSPPPPSASPSPPPPSLSPSP 1804

Query: 163  --PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P+TSP  P P ++PS  P PS + SPP P+     P PS + +PPPP
Sbjct: 1805 PPPSTSPSPPPPPASPS-PPPPSASPSPPPPSSSPSPPPPSSSPSPPPP 1852

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 42/102 (41%), Positives = 46/102 (45%), Gaps = 3/102 (2%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAA--TPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
            P  PP  TP P A PP A   +PP + PP   PP A  PP   PP+  PP P       P
Sbjct: 1137 PPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPP 1196

Query: 178  PAPTPASTPSTAPTPSTAGSPPAP-TPDSLGPGPSGADTPPP 300
              P P   P   P PS    PP P  P  L P PS   +PPP
Sbjct: 1197 LPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPP 1238

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 39/100 (39%), Positives = 52/100 (52%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    P   +PP  +PP  + PP+  PP+  PP+P   P +  P+
Sbjct: 1711 PLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSP-PPSPPPPSP--PPPSLSPS 1767

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P ST  + P PS + SPP P+     P PS + +PPPP
Sbjct: 1768 PPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPP 1807

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 36/95 (37%), Positives = 51/95 (53%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPA 195
           P+ +P P + PP + +PP + PP + PP+   PP  +PP   PP P   P   PP+P P+
Sbjct: 676 PSPSPPPPSPPPPSPSPPPSPPPPSPPPS---PPPPSPPPPLPPPPLPPPPLPPPSPPPS 732

Query: 196 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             PS  P+P    +PP P P    P P+   +PPP
Sbjct: 733 PPPSPPPSPPPP-TPPPPAPPPPAPPPAPPPSPPP 766

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 42/103 (40%), Positives = 52/103 (50%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPP--APASSPATS 174
            +P  PP+  P+P   PP  + PP+  PP   PP  + PP   PP   PP   P   P   
Sbjct: 1578 SPLPPPSPPPSPPPSPP-PSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPL 1636

Query: 175  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP P+P  +P  +P PS   SPP P+P  L P P    TPPPP
Sbjct: 1637 PPPPSPPPSPPPSPPPSPPPSPP-PSPSPLPPPP----TPPPP 1674

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 42/102 (41%), Positives = 48/102 (47%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA--AATPPTATPPTATPPAPASSPATSP 177
            P  PP+  P+P   PP  + PP+  PPT  PPA    TPP + PP+  PP P   PA  P
Sbjct: 758  PAPPPSPPPSPPPSPP-PSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTP-PPPAPPP 815

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P P S P   P P     PP   P  L P P      PPP
Sbjct: 816  PNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPP 857

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 42/107 (39%), Positives = 51/107 (47%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP +  PP   PP   PP+    P  +PP + PP+P  SP+  PP 
Sbjct: 1610 PPSPPPPLPPPPVPPPPSP-PPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPP 1668

Query: 184  PTP-------ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PTP        S P  AP P +   P AP+P S+ P  S    PPPP
Sbjct: 1669 PTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQS----PPPP 1711

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 40/102 (39%), Positives = 48/102 (47%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQP--PAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
            P  PP + P P   P  P    PP  +PP + PP+    P  +PP  TPP PA  P   P
Sbjct: 828  PLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPP 887

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P P+  P T P P    +PP P P    P P     PPPP
Sbjct: 888  PSPPPSPPPPTPPPP----APPPPNPPPPSP-PPPLPLPPPP 924

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 40/100 (40%), Positives = 46/100 (46%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P+ PP   P P   PP    PP  +PP   PP    PP   PP+  P  P S P + PP+
Sbjct: 924  PSPPPPLPPPPLPPPPV---PPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPS 980

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P + P  AP P     P  P P  L P PS    PPPP
Sbjct: 981  PPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPS----PPPP 1016

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 40/102 (39%), Positives = 48/102 (47%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQP--PAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
            P  PP + P P   P  P    PP  +PP + PP+    P  +PP  TPP PA  P   P
Sbjct: 1006 PLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPP 1065

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P P+  P T P P    +PP P P    P P     PPPP
Sbjct: 1066 PSPPPSPPPPTPPPP----APPPPNPPPPSP-PPPLPLPPPP 1102

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 39/100 (39%), Positives = 43/100 (43%), Gaps = 1/100 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            PT PP A P P   P    +PP  TPP   PP    PP + PP   PP     P   PP 
Sbjct: 1143 PTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPL 1202

Query: 184  PTPASTPSTAPTP-STAGSPPAPTPDSLGPGPSGADTPPP 300
            P P   P  +P P      PP P P    P PS   +PPP
Sbjct: 1203 PPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 1242

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 43/105 (40%), Positives = 51/105 (48%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQP-PAAATPPTATPPTATPPAAATPPTATP--PTATPPAPASSPATS 174
            P  PP  TP P   P P   TPP + PP   PP   TPP  +P  P+  PP+P + P   
Sbjct: 2121 PPVPPPPTPPPSPPPLPPPPTPPPSPPPLPPPP---TPPPQSPPLPSPPPPSPPTPPPLP 2177

Query: 175  PPAPTPASTPSTAPTPSTAGSPP--APTPDSLGPGPSGADTPPPP 303
            PP+P+P   P   P PS    PP  +P P S  P P     PPPP
Sbjct: 2178 PPSPSPLPPPPIPPPPSPPPHPPPQSPLPPSPPPPPPPPPLPPPP 2222

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 37/100 (37%), Positives = 45/100 (45%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P    P    PP   PP  +PP    PP   PP+  P  P S P + PP+
Sbjct: 1598 PPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPS 1657

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P+ +P   P      SPP P+P    P P    +PPPP
Sbjct: 1658 PPPSPSPLPPPPTPPPPSPPLPSPPLPAPPP---PSPPPP 1694

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 39/97 (40%), Positives = 43/97 (44%), Gaps = 1/97 (1%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP-ASSPATSPPAPT 189
            PP   P+P   PP    PP A PP   PP +  PP   PP  +PP P    P   PP P 
Sbjct: 883  PPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPP 942

Query: 190  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P S P   P P     PP P P    P PS   +PPP
Sbjct: 943  PPSPPPLPPPP----LPPPPLPPPPSPPPSPPPSPPP 975

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 36/96 (37%), Positives = 49/96 (51%)
 Frame = +1

Query: 16   PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPA 195
            P+ +P P + PP + +PP + PP + PP   +PP  +PP   PP P       PP+P P+
Sbjct: 1532 PSPSPPPPSPPPPSPSPPPSPPPPSPPP---SPPPPSPPPPLPPPPVPPSPLPPPSPPPS 1588

Query: 196  STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              PS  P+P  +  PP P P    P P     PPPP
Sbjct: 1589 PPPSPPPSPPPSPPPPLPLPPPPSPPP---PLPPPP 1621

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 43/108 (39%), Positives = 51/108 (47%), Gaps = 11/108 (10%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATP-PAAATPPTATPPTATPPAPASSPATS-PPAP 186
            PP   P P + PP    PP   PP+  P P    PP  +PP + PP+P  SP  S PP+P
Sbjct: 1603 PPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSP 1662

Query: 187  TPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSGADTP--------PPP 303
            +P   P T P PS    SPP P P    P P  A +P        PPP
Sbjct: 1663 SPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPP 1710

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 38/101 (37%), Positives = 49/101 (48%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS-PATSPP 180
            P  PP   P P   P    +PP + PP+  P  +  PP  TPP  +PP P+   PA  PP
Sbjct: 1630 PLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPP 1689

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P + PS +  P +   PP   P  L P P+    PPPP
Sbjct: 1690 SPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPN----PPPP 1726

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 42/104 (40%), Positives = 49/104 (47%), Gaps = 5/104 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATP--PAAATPPTATPPTATP-PAPASSPATS 174
            PT PP+  P P    P  + PP   PPT  P  P   +PP  +PPT  P P P+ SP   
Sbjct: 2127 PTPPPSPPPLPPPPTPPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPP 2186

Query: 175  PPAPTPASTPSTAP--TPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            PP P P S P   P  +P     PP P P  L P PS   + PP
Sbjct: 2187 PPIPPPPSPPPHPPPQSPLPPSPPPPPPPPPLPPPPSPPPSQPP 2230

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 31  APKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPST 210
           AP   PP  + PP +  P  +PP  + PP+  PP+  PP P   P   PP P P  +P  
Sbjct: 675 APSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLP---PPPLPPPPLPPPSPPP 731

Query: 211 APTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P PS   SPP PTP    P P      PPP
Sbjct: 732 SPPPSPPPSPPPPTPPPPAPPPPAPPPAPPP 762

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 42/100 (42%), Positives = 47/100 (47%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  PP+  P P    P   TPP + PP   PP     P   PP  TPP P S P  SPP
Sbjct: 2108 SPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPPLPPPPTPP-PQSPPLPSPP 2166

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             P+P  TP   P PS +  PP P P    P PS    PPP
Sbjct: 2167 PPSP-PTPPPLPPPSPSPLPPPPIP----PPPSPPPHPPP 2201

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 42/103 (40%), Positives = 45/103 (43%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   P     PP  TPP + PP    PP  TPP  +PP P S P  SPP 
Sbjct: 2117 PLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPPL---PPPPTPPPQSPPLP-SPPPPSPPT 2172

Query: 184  PTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPPP 303
            P P   PS +P P     P   P P P    P P     PPPP
Sbjct: 2173 PPPLPPPSPSPLPPPPIPPPPSPPPHPPPQSPLPPSPPPPPPP 2215

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 38/102 (37%), Positives = 56/102 (54%), Gaps = 5/102 (4%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA--- 183
            PP+A+P+P     + + PP +  P+  PP+ +  P   P + +PP P++SP+  PP+   
Sbjct: 1779 PPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSP 1838

Query: 184  --PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P P+S+PS  P PS + SPP   P S  P PS    P PP
Sbjct: 1839 SPPPPSSSPSPPP-PSLSPSPPPSPPPSSPPPPSPPTPPAPP 1879

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 42/100 (42%), Positives = 49/100 (49%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P+ P ++   P   PP   +PP   PP   PP   TPP + PP   PP P  SP   PP 
Sbjct: 2095 PSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPP--TPPPSPPPLPPPPTPPPSPPPLPPP 2152

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PTP   P + P PS    P  PTP  L P PS +  PPPP
Sbjct: 2153 PTPP--PQSPPLPSPP-PPSPPTPPPLPP-PSPSPLPPPP 2188

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/102 (40%), Positives = 46/102 (45%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQP-PAAATPPTATPPTATPPAAATP-PTATPPTATPPAPASSPATSP 177
            P  PP  +P P   P P  + PP+  PPT  PPA   P P  +PP + PP     PA  P
Sbjct: 847  PPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPP 906

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P P S P   P P     PP   P  L P P     PPPP
Sbjct: 907  PNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPP----VPPPP 944

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 40/102 (39%), Positives = 45/102 (44%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQP-PAAATPPTATPPTATPPAAATP-PTATPPTATPPAPASSPATSP 177
            P  PP  +P P   P P  + PP+  PPT  PPA   P P  +PP + PP     PA  P
Sbjct: 1025 PPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPP 1084

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P P S P   P P     PP   P  L P P      PPP
Sbjct: 1085 PNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPP 1126

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 43/119 (36%), Positives = 65/119 (54%), Gaps = 19/119 (15%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQP--PAAATPPTATPPTATP---PAAATP--------PTATPPTATP 144
            P+ PP + P P   P  P  +T P+  PP+A+P   P +A+P        P+  PP+ +P
Sbjct: 1752 PSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSP 1811

Query: 145  --PAPASSPATSPPAPTPASTP-STAPTPSTAGSPPAPTPDSLGPGPSGA---DTPPPP 303
              P P +SP+  PP+ +P+  P S++P+P    S P+P P SL P P  +    +PPPP
Sbjct: 1812 SPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPPPPSLSPSPPPSPPPSSPPPP 1870

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 35/99 (35%), Positives = 55/99 (55%), Gaps = 2/99 (2%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAAT--PPTATPPTATPPAPASSPATSPPAP 186
           PP+ +P+P     + + PP +  P+  PP+ +   PP +  P+  PP+ + SP  SPP P
Sbjct: 246 PPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPP 305

Query: 187 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           + + +P   P PS + SPP P+     P PS + +PPPP
Sbjct: 306 STSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPP 344

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 34/99 (34%), Positives = 54/99 (54%), Gaps = 2/99 (2%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAAT--PPTATPPTATPPAPASSPATSPPAP 186
           PP+ +P+P     + + PP +  P+  PP+ +   PP+  PP+ +P  P   P ++ P+P
Sbjct: 264 PPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSP 323

Query: 187 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P S   + P PS + SPP P+     P PS + +PPPP
Sbjct: 324 PPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPP 362

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP--PAPASSPATSPPAP 186
           PP+ +P+P   P  + +PP + PP +T P+   PP   PP+A+P  P P+ SP+  PP+ 
Sbjct: 282 PPSLSPSPPP-PSLSPSPPPSPPPPSTSPS---PPPRPPPSASPSPPPPSLSPSPPPPSL 337

Query: 187 TPASTP-STAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P+  P S +P+P      P+P P SL P P  A  PP P
Sbjct: 338 SPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSP 377

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 40/105 (38%), Positives = 59/105 (56%), Gaps = 8/105 (7%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAAT---PPTATPPTATP--PAAATPPTATPPTATP--PAPASSPAT 171
           PP+ +P+P   PP  +T   PP   PP+A+P  P  +  P+  PP+ +P  P P+ SP+ 
Sbjct: 291 PPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSP 350

Query: 172 SPPAPTPASTP-STAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP+ +P+  P S +P+P  A  PP+P P S  P      +PPPP
Sbjct: 351 PPPSFSPSPPPPSLSPSPPPATPPPSPPPPSPPPPLPPPPSPPPP 395

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 39/104 (37%), Positives = 53/104 (50%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPP--AAATPPTATPPTATPP--APASSPAT 171
           P  PP+A+P+P     + + PP +  P+  PP  + + PP +  P+  PP  +P+  PAT
Sbjct: 313 PRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPAT 372

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP+P P S P   P P    SPP P P    P P     PPPP
Sbjct: 373 PPPSPPPPSPPPPLPPPP---SPPPPLPPPPIPPPPSPPPPPPP 413

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 36/100 (36%), Positives = 41/100 (41%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P    P+P   PP    PP   PP + PP+    P  +PP + PP     PA  PP 
Sbjct: 936  PPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPN 995

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S P   P P     PP   P  L P P      PPP
Sbjct: 996  PPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPP 1035

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 40/104 (38%), Positives = 47/104 (45%), Gaps = 5/104 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA----SSPAT 171
            P  PP   P P   PP    PP  +PP + PP+    P  +PP  TPP PA    + P  
Sbjct: 943  PPSPPPLPPPPLPPPPL---PPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPP 999

Query: 172  SPPAPTPASTPSTAPTP-STAGSPPAPTPDSLGPGPSGADTPPP 300
            SPP P P   P + P P      PP P P    P PS   +PPP
Sbjct: 1000 SPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 1043

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 38/101 (37%), Positives = 60/101 (59%), Gaps = 4/101 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAAT---PPTATP-PTATPPAPASSPATSPP 180
           PP+ +P+P     + + PP +  P+  PP+ +    PP+ +P P  +PP P++SP+  PP
Sbjct: 255 PPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSP-PP 313

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P+++PS  P PS + SPP P+     P PS + +PPPP
Sbjct: 314 RPPPSASPSPPP-PSLSPSPPPPSLSPSPPPPSLSPSPPPP 353

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 38/98 (38%), Positives = 44/98 (44%), Gaps = 1/98 (1%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATPPAAAT-PPTATPPTATPPAPASSPATSPPAPT 189
            PP   P P + PP    PP   PP   PP+    PP   PP   PP P S P + PP+P 
Sbjct: 916  PPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPP-PPSPPPSPPPSPP 974

Query: 190  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+  PS  P      +PP P P    P P     PPPP
Sbjct: 975  PSPPPSPPPPTPPPPAPPPPNPPPPSP-PPPLPLPPPP 1011

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 38/102 (37%), Positives = 46/102 (45%), Gaps = 3/102 (2%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAA--ATPPTATPPTATPPAPASSPATSP 177
            P  PP + P P   PP    PP   PP+  PP +   +PP + PP+  P  P   P   P
Sbjct: 1554 PPSPPPSPPPPSPPPPL---PPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPP 1610

Query: 178  PA-PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P+ P P   P   P PS    PP P P    P PS   +PPP
Sbjct: 1611 PSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPP 1652

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 3/100 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATP---PTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           PP+ +P+P  +PP +A+P   P +  P+  PP+ +  P     + +PP P+ SP+  PP+
Sbjct: 304 PPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPS 363

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P+  P+T P      SPP P P    P P     PPPP
Sbjct: 364 LSPSPPPATPPPSPPPPSPPPPLPPPPSPPP---PLPPPP 400

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/110 (36%), Positives = 47/110 (42%), Gaps = 13/110 (11%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATP------PAAATPPTATPPTATPPAPASSPATS 174
            PP  +P P   PP    PP   PP+  P      P    PP  +PP + PP+P  SP  S
Sbjct: 921  PPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPS 980

Query: 175  PPAPT-------PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP PT       P + P  +P P     PP   P  L P P     PPPP
Sbjct: 981  PPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPP----LPPPP 1026

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 36/100 (36%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           PP+ +P+P     + + PP +  P+  PP+ +  P     + +PP P+ SP+  PP+ +P
Sbjct: 237 PPSLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSP 296

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPG---PSGADTPPPP 303
            S P + P PST+ SPP   P S  P    PS + +PPPP
Sbjct: 297 -SPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPP 335

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 34/93 (36%), Positives = 43/93 (46%)
 Frame = +1

Query: 22   ATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPAST 201
            + P P + PP+  +   + PP + P   + PP   PP   PP P  SP   PP PTP  +
Sbjct: 2086 SVPPPPSPPPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPS 2145

Query: 202  PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P   P P T   PP  +P    P P    TPPP
Sbjct: 2146 PPPLPPPPT---PPPQSPPLPSPPPPSPPTPPP 2175

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 36/104 (34%), Positives = 55/104 (52%), Gaps = 3/104 (2%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP--PAPASSPATS 174
           +P  PP+    P   PP+A+  P     + +PP  +  P+  PP+ +P  P P+ SP+  
Sbjct: 204 SPPYPPSLPSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPP 263

Query: 175 PPAPTPASTP-STAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP+ +P+  P S +P+P      P+P P SL P P    +PPPP
Sbjct: 264 PPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPP--PSPPPP 305

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 35/108 (32%), Positives = 55/108 (50%), Gaps = 11/108 (10%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA--- 183
           PP+A+P+P     + + PP +  P+  PP+ +  P     + +PP P+ SP+  PP+   
Sbjct: 219 PPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSP 278

Query: 184 --PTPASTPSTAPTPSTAGSPPAPTPDSLGPG------PSGADTPPPP 303
             P P+ +PS  P   +   PP+P P S  P       PS + +PPPP
Sbjct: 279 SPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPP 326

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 2/97 (2%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATPPTATP--PAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           T  P+P   PP+  +PP+  PP+A+P  P  +  P+  PP+ +P  P  S + SPP P+ 
Sbjct: 200 TDIPSPP-YPPSLPSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSL 258

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           + +P   P PS + SPP P+     P PS + +PPPP
Sbjct: 259 SPSP---PPPSVSPSPPPPSLSPSPPPPSLSPSPPPP 292

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 36/102 (35%), Positives = 57/102 (55%), Gaps = 3/102 (2%)
 Frame = +1

Query: 4   PTKP-PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPP--APASSPATS 174
           P+ P P + P+P + PP +A+P +  PP+ +P   + PP +  P+  PP  +P+  P + 
Sbjct: 203 PSPPYPPSLPSPPSLPPPSASP-SPPPPSLSP---SPPPPSLSPSPPPPSISPSPPPPSL 258

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P+P P S   + P PS + SPP P+     P PS + +PPP
Sbjct: 259 SPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPP 300

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/104 (35%), Positives = 59/104 (56%), Gaps = 6/104 (5%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATP--PAAATPPTATPPTATP-PAPASSPAT 171
            +P+ PP +T      PPA+ +PP   PP+A+P  P  ++ P+  PP+++P P P S   +
Sbjct: 1801 SPSPPPPSTSPSPPPPPASPSPP---PPSASPSPPPPSSSPSPPPPSSSPSPPPPSLSPS 1857

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAP---TPDSLGPGPSGADTP 294
             PP+P P+S P   P+P T  +PP P   + D +   PS ++ P
Sbjct: 1858 PPPSPPPSSPP--PPSPPTPPAPPRPFLVSLDIIATQPSSSNPP 1899

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 32/87 (36%), Positives = 44/87 (50%), Gaps = 1/87 (1%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAA-TPPTATPPTATPPAPASSPATSPPAPT 189
           PP+ +P+P     + + PP +  P+  PP+ + +PP ATPP + PP     P   PP+P 
Sbjct: 334 PPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPSPPPPLPPPPSPP 393

Query: 190 PASTPSTAPTPSTAGSPPAPTPDSLGP 270
           P   P   P P    SPP P P  L P
Sbjct: 394 PPLPPPPIPPPP---SPPPPPPPPLAP 417

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/87 (40%), Positives = 41/87 (47%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            PT PP + P P   PP+  TPP   PP+ +P     PP   PP+  P  P  SP   PP+
Sbjct: 2153 PTPPPQSPPLPSPPPPSPPTPPPLPPPSPSP--LPPPPIPPPPSPPPHPPPQSPL--PPS 2208

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSL 264
            P P   P   P P    SPP   P SL
Sbjct: 2209 PPPPPPPPPLPPPP---SPPPSQPPSL 2232

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 29/72 (40%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATP-PTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            P  PP   P P   PP    P P  +PP + PP+    P  +PP  TPP PA  P T PP
Sbjct: 1210 PPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPP 1269

Query: 181  APTPASTPSTAP 216
            +P P + P   P
Sbjct: 1270 SPPPPTPPPPPP 1281

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 31/72 (43%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS-SPATSPP 180
            P  PP   P P   PP+    P  +PP + PP+   PP+  PPT  PPAP   +P  SPP
Sbjct: 1215 PLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSP--PPSPPPPTPPPPAPPPPTPPPSPP 1272

Query: 181  APTPASTPSTAP 216
             PTP   P  AP
Sbjct: 1273 PPTPPPPPPLAP 1284

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 33/88 (37%), Positives = 46/88 (52%), Gaps = 4/88 (4%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP----PAPTPASTPSTAPT 219
           A   P    PP+   P +  PP+A+P   +PP P+ SP+  P    P+P P S   + P 
Sbjct: 199 ATDIPSPPYPPSLPSPPSLPPPSASP---SPPPPSLSPSPPPPSLSPSPPPPSISPSPPP 255

Query: 220 PSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PS + SPP P+     P PS + +PPPP
Sbjct: 256 PSLSPSPPPPSVSPSPPPPSLSPSPPPP 283

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 29/88 (32%), Positives = 39/88 (44%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P+ PP + P P   PP +   P+  PP   PP  + PP   P +  PP+P   P   P  
Sbjct: 2163 PSPPPPSPPTPPPLPPPS---PSPLPPPPIPPPPSPPPHPPPQSPLPPSPPPPPPPPPLP 2219

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLG 267
            P P+  PS  P+   A     P   S+G
Sbjct: 2220 PPPSPPPSQPPSLENASQSLVPIFVSVG 2247

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 28/77 (36%), Positives = 37/77 (48%), Gaps = 1/77 (1%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATP-PTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPT 189
            PP+  P+P   PP +  P P  +PP  TPP  A PP   PP+  PP P   P  +P    
Sbjct: 1229 PPSPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPPTPPPPPPLAPFTCE 1288

Query: 190  PASTPSTAPTPSTAGSP 240
              ++ S AP    + SP
Sbjct: 1289 DRASRSLAPHGCASVSP 1305

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 30/86 (34%), Positives = 37/86 (43%)
 Frame = +1

Query: 46   PPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPS 225
            PP  A          + P   +PP + P ++  P P S P   PP+P P   P   P P+
Sbjct: 2071 PPGGAYSSIGGLQLMSVPPPPSPPPSLPSSSPSPPPPSPPL--PPSPPPLPPPPVPPPPT 2128

Query: 226  TAGSPPAPTPDSLGPGPSGADTPPPP 303
               SPP P P    P PS    PPPP
Sbjct: 2129 PPPSPP-PLPPPPTPPPSPPPLPPPP 2153

[15][TOP]
>UniRef100_A9P8J4 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P8J4_POPTR
          Length = 196

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 53/106 (50%), Positives = 59/106 (55%), Gaps = 13/106 (12%)
 Frame = +1

Query: 1   APTKPPTATPAPK---AQPPAAATPP--------TATPPTATPPAAATPPTATPPTATPP 147
           AP   PTATPAP    + PP A TPP        T +PP ATPP  + PP ATPP ATPP
Sbjct: 24  APATSPTATPAPPTPTSSPPPATTPPPVSAPPPVTQSPPPATPPPVSAPPPATPPPATPP 83

Query: 148 APASSPATSPPAPTPASTPSTAPTPSTAGSPPAP--TPDSLGPGPS 279
                PAT PPA  P +TP  A TP  A  PPAP   P +L P P+
Sbjct: 84  PATPPPATPPPATPPPATPPPA-TPPPAVPPPAPLAAPPALVPAPA 128

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 50/107 (46%), Positives = 54/107 (50%), Gaps = 6/107 (5%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQ-PPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           A T PP + P P  Q PP A  PP + PP ATPP A TPP ATPP ATPP     PAT P
Sbjct: 45  ATTPPPVSAPPPVTQSPPPATPPPVSAPPPATPPPA-TPPPATPPPATPPPATPPPATPP 103

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPD-----SLGPGPSGADTPPPP 303
           PA  P + P  AP  +     PAP P      S  P P     P PP
Sbjct: 104 PATPPPAVPPPAPLAAPPALVPAPAPSKPKLKSPAPSPLALSPPSPP 150

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 56/106 (52%), Positives = 62/106 (58%), Gaps = 10/106 (9%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAA----ATPPTATPPTATPPAAATPPTATPPTATPP--APASSPATS 174
           PP ATP P + PP A    ATPP ATPP ATPP  ATPP ATPP ATPP   P  +P  +
Sbjct: 61  PPPATPPPVSAPPPATPPPATPPPATPPPATPP-PATPPPATPPPATPPPAVPPPAPLAA 119

Query: 175 PPAPTPASTPSTAPTPSTAGSPPA---PTPDSLGPGPS-GADTPPP 300
           PPA  PA  PS     S A SP A   P+P +  P PS GA +P P
Sbjct: 120 PPALVPAPAPSKPKLKSPAPSPLALSPPSPPTGAPAPSLGASSPGP 165

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 47/98 (47%), Positives = 53/98 (54%), Gaps = 3/98 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPT--ATPPAPASSPATS- 174
           P  PP ATP P   PPA  TPP ATPP ATPP A  PP   PP   A PPA   +PA S 
Sbjct: 74  PATPPPATPPPATPPPA--TPPPATPPPATPPPATPPPAVPPPAPLAAPPALVPAPAPSK 131

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
           P   +PA +P     PS     PAP+  +  PGP+G D
Sbjct: 132 PKLKSPAPSPLALSPPSPPTGAPAPSLGASSPGPAGTD 169

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 45/98 (45%), Positives = 52/98 (53%), Gaps = 16/98 (16%)
 Frame = +1

Query: 52  AAATPPTATP----PTATPPAAATPP--------TATPPTAT-PPAPASSPATSPPA-PT 189
           A AT PTATP    PT++PP A TPP        T +PP AT PP  A  PAT PPA P 
Sbjct: 24  APATSPTATPAPPTPTSSPPPATTPPPVSAPPPVTQSPPPATPPPVSAPPPATPPPATPP 83

Query: 190 PASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPP 297
           PA+ P   P P+T    +PP  TP    P P+    PP
Sbjct: 84  PATPPPATPPPATPPPATPPPATPPPAVPPPAPLAAPP 121

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 38/87 (43%), Positives = 46/87 (52%), Gaps = 11/87 (12%)
 Frame = +1

Query: 73  ATPPTATP----PAAATPPTATPPTATPPAPASS---PATSPP--APTPASTPSTAPTPS 225
           AT PTATP    P ++ PP  TPP  + P P +    PAT PP  AP PA+ P   P P+
Sbjct: 26  ATSPTATPAPPTPTSSPPPATTPPPVSAPPPVTQSPPPATPPPVSAPPPATPPPATPPPA 85

Query: 226 T--AGSPPAPTPDSLGPGPSGADTPPP 300
           T    +PP  TP    P P+   TPPP
Sbjct: 86  TPPPATPPPATPPPATPPPA---TPPP 109

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 34/67 (50%), Positives = 36/67 (53%)
 Frame = +1

Query: 100 AAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 279
           A AT PTATP    PP P SSP   PPA TP   P +AP P T   PPA  P    P P+
Sbjct: 24  APATSPTATP---APPTPTSSP---PPATTP--PPVSAPPPVTQSPPPATPPPVSAPPPA 75

Query: 280 GADTPPP 300
              TPPP
Sbjct: 76  ---TPPP 79

[16][TOP]
>UniRef100_Q6K4A5 Putative uncharacterized protein OJ1595_D08.12-1 n=1 Tax=Oryza
           sativa Japonica Group RepID=Q6K4A5_ORYSJ
          Length = 131

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 50/95 (52%), Positives = 56/95 (58%), Gaps = 1/95 (1%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATPPTATPPAA-ATPPTATPPTATPPAPASSPATSPPAPTPA 195
           T TPAPKA PP A  PPT  P +A P  A ATPP A  P     APA +P  S PAP PA
Sbjct: 16  TPTPAPKASPPPATPPPTPAPVSAPPAQAPATPPPAPAPAPKASAPAPAPKASAPAPVPA 75

Query: 196 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           +    APTP  + SPPAP+P  L P P+   TPPP
Sbjct: 76  AA---APTPEIS-SPPAPSPAGLAPSPTAEVTPPP 106

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/78 (46%), Positives = 43/78 (55%)
 Frame = +1

Query: 70  TATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAP 249
           +A  P ATP  A   P A+PP ATPP P  +P ++PPA  PA TP  AP P+   S PAP
Sbjct: 9   SAQAPAATPTPA---PKASPPPATPP-PTPAPVSAPPAQAPA-TPPPAPAPAPKASAPAP 63

Query: 250 TPDSLGPGPSGADTPPPP 303
            P +  P P  A   P P
Sbjct: 64  APKASAPAPVPAAAAPTP 81

[17][TOP]
>UniRef100_B8BCN6 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8BCN6_ORYSI
          Length = 141

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 50/95 (52%), Positives = 56/95 (58%), Gaps = 1/95 (1%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATPPTATPPAA-ATPPTATPPTATPPAPASSPATSPPAPTPA 195
           T TPAPKA PP A  PPT  P +A P  A ATPP A  P     APA +P  S PAP PA
Sbjct: 26  TPTPAPKASPPPATPPPTPAPVSAPPAQAPATPPPAPAPAPKASAPAPAPKASAPAPVPA 85

Query: 196 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           +    APTP  + SPPAP+P  L P P+   TPPP
Sbjct: 86  AA---APTPEIS-SPPAPSPAGLAPSPTAEVTPPP 116

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/78 (46%), Positives = 43/78 (55%)
 Frame = +1

Query: 70  TATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAP 249
           +A  P ATP  A   P A+PP ATPP P  +P ++PPA  PA TP  AP P+   S PAP
Sbjct: 19  SAQAPAATPTPA---PKASPPPATPP-PTPAPVSAPPAQAPA-TPPPAPAPAPKASAPAP 73

Query: 250 TPDSLGPGPSGADTPPPP 303
            P +  P P  A   P P
Sbjct: 74  APKASAPAPVPAAAAPTP 91

[18][TOP]
>UniRef100_A9PGI2 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
           RepID=A9PGI2_POPTR
          Length = 196

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 50/107 (46%), Positives = 54/107 (50%), Gaps = 6/107 (5%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQ-PPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           A T PP + P P  Q PP A  PP + PP ATPP A TPP ATPP ATPP     PAT P
Sbjct: 45  ATTPPPVSAPPPVTQSPPPATPPPVSAPPPATPPPA-TPPPATPPPATPPPATPPPATPP 103

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPD-----SLGPGPSGADTPPPP 303
           PA  P + P  AP  +     PAP P      S  P P     P PP
Sbjct: 104 PATPPPAVPPPAPLAAPPALVPAPAPSKPKLKSPAPSPLALSPPSPP 150

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 56/106 (52%), Positives = 62/106 (58%), Gaps = 10/106 (9%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAA----ATPPTATPPTATPPAAATPPTATPPTATPP--APASSPATS 174
           PP ATP P + PP A    ATPP ATPP ATPP  ATPP ATPP ATPP   P  +P  +
Sbjct: 61  PPPATPPPVSAPPPATPPPATPPPATPPPATPP-PATPPPATPPPATPPPAVPPPAPLAA 119

Query: 175 PPAPTPASTPSTAPTPSTAGSPPA---PTPDSLGPGPS-GADTPPP 300
           PPA  PA  PS     S A SP A   P+P +  P PS GA +P P
Sbjct: 120 PPALVPAPAPSKPKLKSPAPSPLALSPPSPPTGAPAPSLGASSPGP 165

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/106 (49%), Positives = 58/106 (54%), Gaps = 13/106 (12%)
 Frame = +1

Query: 1   APTKPPTATPAPK---AQPPAAATPP--------TATPPTATPPAAATPPTATPPTATPP 147
           AP   PTA PAP    + PP A TPP        T +PP ATPP  + PP ATPP ATPP
Sbjct: 24  APATSPTAAPAPPTPTSSPPPATTPPPVSAPPPVTQSPPPATPPPVSAPPPATPPPATPP 83

Query: 148 APASSPATSPPAPTPASTPSTAPTPSTAGSPPAP--TPDSLGPGPS 279
                PAT PPA  P +TP  A TP  A  PPAP   P +L P P+
Sbjct: 84  PATPPPATPPPATPPPATPPPA-TPPPAVPPPAPLAAPPALVPAPA 128

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 47/98 (47%), Positives = 53/98 (54%), Gaps = 3/98 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPT--ATPPAPASSPATS- 174
           P  PP ATP P   PPA  TPP ATPP ATPP A  PP   PP   A PPA   +PA S 
Sbjct: 74  PATPPPATPPPATPPPA--TPPPATPPPATPPPATPPPAVPPPAPLAAPPALVPAPAPSK 131

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
           P   +PA +P     PS     PAP+  +  PGP+G D
Sbjct: 132 PKLKSPAPSPLALSPPSPPTGAPAPSLGASSPGPAGTD 169

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 44/98 (44%), Positives = 51/98 (52%), Gaps = 16/98 (16%)
 Frame = +1

Query: 52  AAATPPTATP----PTATPPAAATPP--------TATPPTAT-PPAPASSPATSPPA-PT 189
           A AT PTA P    PT++PP A TPP        T +PP AT PP  A  PAT PPA P 
Sbjct: 24  APATSPTAAPAPPTPTSSPPPATTPPPVSAPPPVTQSPPPATPPPVSAPPPATPPPATPP 83

Query: 190 PASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPP 297
           PA+ P   P P+T    +PP  TP    P P+    PP
Sbjct: 84  PATPPPATPPPATPPPATPPPATPPPAVPPPAPLAAPP 121

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 37/87 (42%), Positives = 45/87 (51%), Gaps = 11/87 (12%)
 Frame = +1

Query: 73  ATPPTATP----PAAATPPTATPPTATPPAPASS---PATSPP--APTPASTPSTAPTPS 225
           AT PTA P    P ++ PP  TPP  + P P +    PAT PP  AP PA+ P   P P+
Sbjct: 26  ATSPTAAPAPPTPTSSPPPATTPPPVSAPPPVTQSPPPATPPPVSAPPPATPPPATPPPA 85

Query: 226 T--AGSPPAPTPDSLGPGPSGADTPPP 300
           T    +PP  TP    P P+   TPPP
Sbjct: 86  TPPPATPPPATPPPATPPPA---TPPP 109

[19][TOP]
>UniRef100_B8GAZ4 Putative uncharacterized protein n=1 Tax=Chloroflexus aggregans DSM
           9485 RepID=B8GAZ4_CHLAD
          Length = 381

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 50/107 (46%), Positives = 56/107 (52%), Gaps = 10/107 (9%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTAT---PPTATPP----AAATPPTATP---PTATPPAPA 156
           T   T TP+P   P A   PPTAT   PPTATPP    A   PPTATP   PTATPP P 
Sbjct: 259 TPTATVTPSPMVTPTATPPPPTATPPPPPTATPPPPPTATPPPPTATPSPLPTATPPPPP 318

Query: 157 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           ++    PP  TP+  P+  P P    +PP PT     P PS   TPP
Sbjct: 319 TATPPPPPTATPSPPPTATPPPPPTATPPPPTATPSPPPPSPTATPP 365

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/101 (50%), Positives = 56/101 (55%), Gaps = 6/101 (5%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATP---PTATPPAAATPPTATPP---TATPPAPASSP 165
           P  PPTATP P   P A   PPTATP   PTATPP    PPTATPP   TATP    S P
Sbjct: 283 PPPPPTATPPPP--PTATPPPPTATPSPLPTATPPP---PPTATPPPPPTATP----SPP 333

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
            T+ P P P +TP   P P+   SPP P+P +  PG    D
Sbjct: 334 PTATPPPPPTATP---PPPTATPSPPPPSPTATPPGDDDDD 371

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 51/114 (44%), Positives = 58/114 (50%), Gaps = 13/114 (11%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQ--PPAAATPPTATPPTATPPAAATPPTAT---PPTATPPAPASS- 162
           AP+   T  P P     P A  TP     PTATPP    PPTAT   PPTATPP P ++ 
Sbjct: 243 APSHTATLQPTPTRTNTPTATVTPSPMVTPTATPP----PPTATPPPPPTATPPPPPTAT 298

Query: 163 --PATSPPAPTPASTPSTAPTPSTAGSPPAPT-----PDSLGPGPSGADTPPPP 303
             P T+ P+P P +TP   P P TA  PP PT     P +  P P    TPPPP
Sbjct: 299 PPPPTATPSPLPTATP---PPPPTATPPPPPTATPSPPPTATPPPPPTATPPPP 349

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 40/78 (51%), Positives = 45/78 (57%), Gaps = 10/78 (12%)
 Frame = +1

Query: 1   APTKPPTATPAP----KAQPPAAATPP---TATP---PTATPPAAATPPTATPPTATPPA 150
           A   PPTATP+P       PP  ATPP   TATP   PTATPP         PPTATPP 
Sbjct: 297 ATPPPPTATPSPLPTATPPPPPTATPPPPPTATPSPPPTATPP--------PPPTATPPP 348

Query: 151 PASSPATSPPAPTPASTP 204
           P ++P  SPP P+P +TP
Sbjct: 349 PTATP--SPPPPSPTATP 364

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 37/100 (37%), Positives = 44/100 (44%), Gaps = 5/100 (5%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTAT-PPAPASSPATSPPAPTPA 195
           + TP P    P  A       P+ T     TP     PTAT  P+P  +P  +PP PT  
Sbjct: 226 STTPQPS---PTTALATNTPAPSHTATLQPTPTRTNTPTATVTPSPMVTPTATPPPPT-- 280

Query: 196 STPSTAPTPSTAGSPPAPT----PDSLGPGPSGADTPPPP 303
              +T P P TA  PP PT    P +  P P    TPPPP
Sbjct: 281 ---ATPPPPPTATPPPPPTATPPPPTATPSPLPTATPPPP 317

[20][TOP]
>UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK5_CHLRE
          Length = 853

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 40/100 (40%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP+   PP  +PP   PP+P   P  SPP 
Sbjct: 395 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 454

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P   P      SPP P+P    P P     PPPP
Sbjct: 455 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 494

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 40/100 (40%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP   +PP   PP+  PP P S P   PP+
Sbjct: 400 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 459

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   PS  P      SPP P+P    P P    +PPPP
Sbjct: 460 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 499

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 42/104 (40%), Positives = 53/104 (50%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA----SSPAT 171
           P+ PP + P P   PP   +PP   PP+  PP   +PP  +PP  +PP P+    S P  
Sbjct: 362 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 421

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           SPP P+P   P  +P P    SPP P P S  P P  +  PPPP
Sbjct: 422 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 465

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 41/100 (41%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP + P P   PP+   PP  +PP  +PP  + PP   PP+  PP P S P   PP+
Sbjct: 238 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPP-PPSPPPPPPPSPPPPPPPS 296

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     PPPP
Sbjct: 297 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPP 336

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 42/100 (42%), Positives = 53/100 (53%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP+   PP  +PP  +PP P S P   PP+
Sbjct: 204 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP-PPSPPPPPPPS 262

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P P S  P P    +PPPP
Sbjct: 263 PPPPSPPPPSPPPPPPPSPPPPPPPS--PPPPPPPSPPPP 300

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 43/113 (38%), Positives = 54/113 (47%), Gaps = 12/113 (10%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS-- 174
           +P  PP  +P P + PP +  PP+  PP+  PP   +PP   PP+  PP P S P  S  
Sbjct: 345 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 404

Query: 175 ----------PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                     PP+P P S P  +P P    SPP P P S  P P  +  PPPP
Sbjct: 405 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 457

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 43/102 (42%), Positives = 52/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS--P 177
           P+ PP + P P   PP   +PP   PP+  PP   +PP   PP+  PP P S P  S  P
Sbjct: 416 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 475

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P P S P  +P P    SPP P P S  P P    +PPPP
Sbjct: 476 PSPPPPSPPPPSPPPPPPPSPPPPPPPS--PPPPPPPSPPPP 515

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 41/102 (40%), Positives = 52/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPT--ATPPAAATPPTATPPTATPPAPASSPATSP 177
           P  PP  +P P + PP +  PP+  PP+    PP +  PP+  PP+  PP P S P  SP
Sbjct: 209 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 268

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P+P   P  +P P    SPP P P S  P      +PPPP
Sbjct: 269 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 310

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 41/100 (41%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP  +PP   PP+   PP  +PP  +PP P S P  SPP 
Sbjct: 313 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP-PPSPPPPSPPP 371

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   P  +P P    SPP P P S  P      +PPPP
Sbjct: 372 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 411

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 42/102 (41%), Positives = 54/102 (52%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP + PP + PP +  PP+  PP+  PP P S P  SPP 
Sbjct: 195 PSPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 252

Query: 184 PTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   P  +P P +    SPP P P S  P P  +  PPPP
Sbjct: 253 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 41/100 (41%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP+  P P   PP  + PP + PP + PP +  PP+  PP+  PP P S P   PP+
Sbjct: 384 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 443

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   PS  P P    SPP P P S  P      +PPPP
Sbjct: 444 PPPPPPPSPPPPPPP--SPPPPPPPSPPPPSPPPPSPPPP 481

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 38/100 (38%), Positives = 47/100 (47%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP  +PP   PP+   PP  +PP   PP+P   P  SPP 
Sbjct: 411 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 470

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P       P+P     PP P P    P P     PPPP
Sbjct: 471 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 510

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 41/100 (41%), Positives = 54/100 (54%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP + PP + PP +  PP+  PP+  PP+P   P  SPP 
Sbjct: 190 PSPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 247

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   PS  P P  +  PP+P P S  P P  +  PPPP
Sbjct: 248 PSP-PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 286

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 40/101 (39%), Positives = 51/101 (50%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  P    P+P   PP +  PP+  PP+  PP   +PP   PP+  PP P S P  SPP
Sbjct: 244 SPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 303

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P   P  +P P    SPP P+P    P P    +PPPP
Sbjct: 304 PPSPPPPPPPSPPPP---SPPPPSPPPPSPPPPPPPSPPPP 341

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 40/100 (40%), Positives = 52/100 (52%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP   P+P   PP +  PP+  PP+  PP   +PP  +PP  +PP P S P   PP+
Sbjct: 279 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP-PPSPPPPPPPS 337

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   PS  P P  +  PP+P P S  P      +PPPP
Sbjct: 338 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 377

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 39/101 (38%), Positives = 48/101 (47%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP  +P P   P     PP + PP + PP +  PP+  PP+  PP P S P   PP
Sbjct: 443 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 502

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P   PS  P      SPP P+P    P P     PPPP
Sbjct: 503 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 543

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 38/100 (38%), Positives = 48/100 (48%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP  +P P + PP +  PP+  PP+  PP   +PP   PP+  PP P S P  SPP
Sbjct: 459 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 518

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P+P       P+P     PP P P    P P     PPP
Sbjct: 519 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 41/100 (41%), Positives = 52/100 (52%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP   +PP   PP+  PP   +PP  +PP  +PP P   P+  PP+
Sbjct: 261 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP-PSPPPPS 319

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P P S  P P    +PPPP
Sbjct: 320 PPPPSPPPPSPPPPPPPSPPPPPPPS--PPPPPPPSPPPP 357

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 40/101 (39%), Positives = 51/101 (50%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP  +P P + PP +  PP   PP + PP +  PP+  PP+  PP P S P   PP
Sbjct: 288 SPPPPPPPSPPPPSPPPPSPPPP---PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 344

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P   PS  P      SPP P+P    P P    +PPPP
Sbjct: 345 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 385

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/102 (41%), Positives = 53/102 (51%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP   +PP  +PP  +PP   +PP   PP+  PP P S P   PP+
Sbjct: 295 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP-PPSPPPPPPPSPPPPPPPSPPPPPPPS 353

Query: 184 PTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P +    SPP P P S  P P  +  PPPP
Sbjct: 354 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 40/103 (38%), Positives = 53/103 (51%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPA--AATPPTATPPTATPPAPASSPATS 174
           +P  PP  +P P + PP +  PP+  PP+  PP+    +PP   PP+  PP P S P   
Sbjct: 389 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 448

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP+P P   PS  P P  +  PP+P P S  P      +PPPP
Sbjct: 449 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 491

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/100 (42%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP + P P   PP+   PP  +PP   PP+   PP  +PP  +PP P S P   PP+
Sbjct: 256 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP-PPSPPPPPPPS 314

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P P S  P P  +  PPPP
Sbjct: 315 PPPPSPPPPSPPPP---SPPPPPPPSPPPPPPPSPPPPPP 351

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 41/102 (40%), Positives = 52/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA--TPPTATPPTATPPAPASSPATSP 177
           P+ PP   P+P   PP +  PP+  PP+  PP+    +PP   PP+  PP P S P   P
Sbjct: 336 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P P S P  +P P    SPP P+P    P P     PPPP
Sbjct: 396 PSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPPPP 434

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 40/104 (38%), Positives = 52/104 (50%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA----SSPAT 171
           P+ PP + P P   PP   +PP   PP+  PP   +PP  +PP  +PP P+    S P  
Sbjct: 318 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 377

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP+P P   PS  P P  +  PP+P P S  P      +PPPP
Sbjct: 378 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 421

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 42/102 (41%), Positives = 52/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP   +PP   PP+  PP   +PP   PP+  PP P S P   PP+
Sbjct: 410 PPSPPPPSPPPPSPPP--PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 467

Query: 184 PTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P +    SPP P P S  P P  +  PPPP
Sbjct: 468 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 41/100 (41%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP+  P P   PP  + PP + PP + PP   +PP   PP+  PP P S P   PP+
Sbjct: 454 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPPPPSPPPPPPPSPPPPPPPS 511

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P    +PPPP
Sbjct: 512 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPPPPSPPPP 548

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 42/103 (40%), Positives = 52/103 (50%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS-- 174
           +P  P    P P + PP +  PP+  PP+  PP   +PP   PP+  PP P S P  S  
Sbjct: 301 SPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 360

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP+P P S P  +P P    SPP P P S  P P    +PPPP
Sbjct: 361 PPSPPPPSPPPPSPPPPPPPSPPPPPPPS--PPPPPPPSPPPP 401

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 38/100 (38%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP  +PP  +PP  + PP   PP+  PP+P       PP 
Sbjct: 220 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPP-PPSPPPPSPPPPSPPPPPP 278

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   P  +P P    SPP P+P    P P    +PPPP
Sbjct: 279 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 318

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 37/101 (36%), Positives = 47/101 (46%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  P    P+P   PP +  PP+  PP+  PP+   PP  +PP   PP+P   P  SPP
Sbjct: 296 SPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 355

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P       P+P     PP P P    P P     PPPP
Sbjct: 356 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 396

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 38/101 (37%), Positives = 47/101 (46%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP  +P P   P     PP + PP + PP +  PP+  PP+  PP P S P   PP
Sbjct: 329 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 388

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P   PS  P      SPP P+P    P P     P PP
Sbjct: 389 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 429

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 39/107 (36%), Positives = 50/107 (46%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA-------TPPTATPPTATPPAPASS 162
           P+ PP + P P   PP   +PP  +PP  +PP          +PP  +PP   PP+P   
Sbjct: 225 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 284

Query: 163 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P  SPP P P S P  +P P +   PP P+P    P P     P PP
Sbjct: 285 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 331

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 40/100 (40%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP   P+P   PP +  PP   PP + PP +  PP+  PP    P P S P  SPP 
Sbjct: 271 PSPPPPPPPSPPPPPPPSPPPP---PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 327

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   P  +P P    SPP P P S  P      +PPPP
Sbjct: 328 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 367

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 41/102 (40%), Positives = 52/102 (50%), Gaps = 3/102 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP- 180
           P+ PP + P P   PP+   PP  +PP   PP+   PP  +PP  +PP P+  P + PP 
Sbjct: 357 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 416

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGP--SGADTPPP 300
           +P P S P  +P P    SPP P P S  P P  S    PPP
Sbjct: 417 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 458

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 39/100 (39%), Positives = 48/100 (48%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP   P+P   PP +  PP   PP + PP +  PP+  PP+  PP+P   P  SPP 
Sbjct: 328 PSPPPPPPPSPPPPPPPSPPPP---PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 384

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P   P      SPP P+P    P P     P PP
Sbjct: 385 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 424

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 39/100 (39%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  P    P P + PP +  PP+  PP+  PP+   PP  +PP   PP+P   P  SPP 
Sbjct: 341 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 400

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   PS  P      SPP P+P    P P    +PPPP
Sbjct: 401 PSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 439

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/101 (40%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTA-TPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P+ PP   P+P   PP +  PP   +PP   PP+   PP  +PP  +PP P S P  SPP
Sbjct: 426 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP-PPSPPPPSPP 484

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P   P  +P P    SPP P P S  P      +PPPP
Sbjct: 485 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 525

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 38/101 (37%), Positives = 49/101 (48%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP  +P P   P     PP + PP + PP +  PP+  PP+  PP+P       PP
Sbjct: 373 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 432

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P   P  +P P    SPP P P S  P P    +PPPP
Sbjct: 433 PPSPPPPPPPSPPPPPPPSPPPPPPPS--PPPPPPPSPPPP 471

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 39/97 (40%), Positives = 50/97 (51%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           P   +P P + PP +  PP+  PP+  PP   +PP  +PP  +PP P S P  SPP P P
Sbjct: 187 PGIPSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSPPPPSPP-PPSPPPPSPPPPPP 242

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            S P  +P P +   PP P+P    P P     PPPP
Sbjct: 243 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 279

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 36/96 (37%), Positives = 47/96 (48%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPA 195
           P +TP   + PP +  PP+  PP+  PP+   PP + PP + PP     P+  PP+P P 
Sbjct: 183 PISTPGIPSPPPPSPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPP 240

Query: 196 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PS  P      SPP P P S  P      +PPPP
Sbjct: 241 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 276

[21][TOP]
>UniRef100_Q3EC03 Uncharacterized protein At2g14890.2 n=1 Tax=Arabidopsis thaliana
           RepID=Q3EC03_ARATH
          Length = 176

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 46/103 (44%), Positives = 55/103 (53%), Gaps = 4/103 (3%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTAT---PPAAATPPTATPPTAT-PPAPASSPATS 174
           T PP A P P    P  A+PP ATPP      PP A+ PP   PP AT PPAP +SP   
Sbjct: 63  TAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQ 122

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PAP P + P  +P+PS + SPP P+ D+ GP        P P
Sbjct: 123 VPAPAPTTKPD-SPSPSPSSSPPLPSSDAPGPSTDSISPAPSP 164

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/125 (41%), Positives = 61/125 (48%), Gaps = 24/125 (19%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQ---PPAAATPPTATPP----------TATPPAAATPPTATPPTAT 141
           APT PPTATPAP      PPAA  PP + PP          TA PPA   PP ++PP A+
Sbjct: 22  APTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPAS 81

Query: 142 PPAPASSPATSPPAPTPASTPST-----APTPSTAGSP------PAPTPDSLGPGPSGAD 288
           PP     P  SPP P  +  P+T      P P+   SP      PAPT     P PS + 
Sbjct: 82  PPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSS 141

Query: 289 TPPPP 303
           +PP P
Sbjct: 142 SPPLP 146

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 48/97 (49%), Positives = 59/97 (60%), Gaps = 2/97 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA--PASSPATSP 177
           P  PP ATP P A PP    PP A+PP ATPP  ATPP A  P A+PPA  PA +P T P
Sbjct: 79  PASPPPATPPPVASPP----PPVASPPPATPPPVATPPPA--PLASPPAQVPAPAPTTKP 132

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
            +P+P  +PS++P P  +   P P+ DS+ P PS  D
Sbjct: 133 DSPSP--SPSSSP-PLPSSDAPGPSTDSISPAPSPTD 166

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 40/89 (44%), Positives = 44/89 (49%), Gaps = 11/89 (12%)
 Frame = +1

Query: 70  TATPPTATPPAAATPPTAT--PPTATPPAPASSP---ATSPP----APTPASTPSTAPTP 222
           T   PT+ P A   PPT T  PP ATPP P S+P    TSPP    AP PA+ P    +P
Sbjct: 19  TGQAPTSPPTATPAPPTPTTPPPAATPP-PVSAPPPVTTSPPPVTTAPPPANPPPPVSSP 77

Query: 223 STAGSPPAPTPDSLGPGPSGADTPP--PP 303
             A  PPA  P    P P  A  PP  PP
Sbjct: 78  PPASPPPATPPPVASPPPPVASPPPATPP 106

[22][TOP]
>UniRef100_B9QEP3 Chloride channel protein k, putative n=1 Tax=Toxoplasma gondii VEG
           RepID=B9QEP3_TOXGO
          Length = 1733

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 44/122 (36%), Positives = 78/122 (63%), Gaps = 25/122 (20%)
 Frame = +1

Query: 13  PPTATPAPKAQP-----PAAATPPTATPPT-------------ATPPAAATPPTATPPTA 138
           PP++ P+P + P     P+ ++PP+++PP+             ++PP+ ++PP ++PP++
Sbjct: 204 PPSSPPSPSSAPSSSTSPSPSSPPSSSPPSPSSAPSSSTSPSPSSPPSPSSPPPSSPPSS 263

Query: 139 TPPAPASSPATSPPAPTPA-----STPSTAPTPSTA--GSPPAPTPDSLGPGPSGADTPP 297
           +PP+P+S P++SPP+P+P      S+ ST+P+PS+A   SPP+ +P S  P PS +  PP
Sbjct: 264 SPPSPSSPPSSSPPSPSPPPSSPPSSSSTSPSPSSAPSSSPPSSSPSSSSPPPSSSPPPP 323

Query: 298 PP 303
            P
Sbjct: 324 SP 325

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 38/101 (37%), Positives = 73/101 (72%), Gaps = 1/101 (0%)
 Frame = +1

Query: 1   APTKPPTATPAPK-AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           +P+  P+++ +P  + PP+ ++PP ++PP+++PP+ ++PP+++PP+ +PP P+S P++S 
Sbjct: 233 SPSSAPSSSTSPSPSSPPSPSSPPPSSPPSSSPPSPSSPPSSSPPSPSPP-PSSPPSSSS 291

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            +P+P+S PS++P PS++ S  +P P S  P PS   + PP
Sbjct: 292 TSPSPSSAPSSSP-PSSSPSSSSPPPSSSPPPPSPPSSSPP 331

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 36/102 (35%), Positives = 69/102 (67%), Gaps = 1/102 (0%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP-PTATPPAPASSPATSP 177
           +P+ PP+ +  P + PP+++ P  ++PP+++PP+ + PP++ P  ++T P+P+S+P++SP
Sbjct: 245 SPSSPPSPSSPPPSSPPSSSPPSPSSPPSSSPPSPSPPPSSPPSSSSTSPSPSSAPSSSP 304

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+ +P+   S++P PS++  PP+P P S  P  S   + P P
Sbjct: 305 PSSSPS---SSSPPPSSSPPPPSP-PSSSPPSSSSPSSSPSP 342

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 36/101 (35%), Positives = 66/101 (65%), Gaps = 4/101 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           P +++ +P + P +++ PP+++PP ++PP+    P++ P ++T P+P+S P++SPP+P+ 
Sbjct: 181 PSSSSSSPSSSPSSSSPPPSSSPPPSSPPS----PSSAPSSSTSPSPSSPPSSSPPSPSS 236

Query: 193 ASTPSTAPTPSTAGS----PPAPTPDSLGPGPSGADTPPPP 303
           A + ST+P+PS+  S    PP+  P S  P PS   +  PP
Sbjct: 237 APSSSTSPSPSSPPSPSSPPPSSPPSSSPPSPSSPPSSSPP 277

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 30/90 (33%), Positives = 61/90 (67%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P+ PP++ P+  +  P+ ++ P+++PP+++P +++ PP+++PP   PP+P   P++SPP
Sbjct: 278 SPSPPPSSPPSSSSTSPSPSSAPSSSPPSSSPSSSSPPPSSSPP---PPSP---PSSSPP 331

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGP 270
           +   +S+PS++P+PS   S  A  P +  P
Sbjct: 332 S---SSSPSSSPSPSADLSERAQGPANEAP 358

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 27/74 (36%), Positives = 49/74 (66%)
 Frame = +1

Query: 79  PPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPD 258
           P  + P ++++ P+++P +++PP  +S P +SPP+P+ A + ST+P+PS   SPP+ +P 
Sbjct: 176 PFLSPPSSSSSSPSSSPSSSSPPPSSSPPPSSPPSPSSAPSSSTSPSPS---SPPSSSPP 232

Query: 259 SLGPGPSGADTPPP 300
           S    PS + +P P
Sbjct: 233 SPSSAPSSSTSPSP 246

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 28/96 (29%), Positives = 54/96 (56%), Gaps = 4/96 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAA--TPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           P+ PP+    P +  P+++   P   +P +++  ++++P     P   P +P+ S A+SP
Sbjct: 586 PSSPPSVPVPPSSPSPSSSLSAPVPPSPSSSSSHSSSSPSVLPLPPHVPSSPSPSSASSP 645

Query: 178 --PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 279
             P PT +S+P ++P+PS+   P + +  S+ P PS
Sbjct: 646 SMPLPTSSSSPPSSPSPSSPSVPLSSSSPSVPPSPS 681

[23][TOP]
>UniRef100_Q9C5S0 Classical arabinogalactan protein 9 n=1 Tax=Arabidopsis thaliana
           RepID=AGP9_ARATH
          Length = 191

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 46/103 (44%), Positives = 55/103 (53%), Gaps = 4/103 (3%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTAT---PPAAATPPTATPPTAT-PPAPASSPATS 174
           T PP A P P    P  A+PP ATPP      PP A+ PP   PP AT PPAP +SP   
Sbjct: 63  TAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQ 122

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PAP P + P  +P+PS + SPP P+ D+ GP        P P
Sbjct: 123 VPAPAPTTKPD-SPSPSPSSSPPLPSSDAPGPSTDSISPAPSP 164

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/125 (41%), Positives = 61/125 (48%), Gaps = 24/125 (19%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQ---PPAAATPPTATPP----------TATPPAAATPPTATPPTAT 141
           APT PPTATPAP      PPAA  PP + PP          TA PPA   PP ++PP A+
Sbjct: 22  APTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPAS 81

Query: 142 PPAPASSPATSPPAPTPASTPST-----APTPSTAGSP------PAPTPDSLGPGPSGAD 288
           PP     P  SPP P  +  P+T      P P+   SP      PAPT     P PS + 
Sbjct: 82  PPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSS 141

Query: 289 TPPPP 303
           +PP P
Sbjct: 142 SPPLP 146

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 48/97 (49%), Positives = 59/97 (60%), Gaps = 2/97 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA--PASSPATSP 177
           P  PP ATP P A PP    PP A+PP ATPP  ATPP A  P A+PPA  PA +P T P
Sbjct: 79  PASPPPATPPPVASPP----PPVASPPPATPPPVATPPPA--PLASPPAQVPAPAPTTKP 132

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
            +P+P  +PS++P P  +   P P+ DS+ P PS  D
Sbjct: 133 DSPSP--SPSSSP-PLPSSDAPGPSTDSISPAPSPTD 166

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 40/89 (44%), Positives = 44/89 (49%), Gaps = 11/89 (12%)
 Frame = +1

Query: 70  TATPPTATPPAAATPPTAT--PPTATPPAPASSP---ATSPP----APTPASTPSTAPTP 222
           T   PT+ P A   PPT T  PP ATPP P S+P    TSPP    AP PA+ P    +P
Sbjct: 19  TGQAPTSPPTATPAPPTPTTPPPAATPP-PVSAPPPVTTSPPPVTTAPPPANPPPPVSSP 77

Query: 223 STAGSPPAPTPDSLGPGPSGADTPP--PP 303
             A  PPA  P    P P  A  PP  PP
Sbjct: 78  PPASPPPATPPPVASPPPPVASPPPATPP 106

[24][TOP]
>UniRef100_A5E8N9 Putative uncharacterized protein n=1 Tax=Bradyrhizobium sp. BTAi1
           RepID=A5E8N9_BRASB
          Length = 727

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 50/114 (43%), Positives = 58/114 (50%), Gaps = 15/114 (13%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT---- 171
           P  PP   P P+A+PP AA PP+   P A PP+   PP A PP  TPP PA  PA+    
Sbjct: 104 PAAPPPPPPPPRAEPPHAAPPPSRAEPPAPPPSRPAPPVAAPPVHTPPPPAPPPASPHEP 163

Query: 172 ----SPPAPTPASTPSTAPTPST--AGSPPAPTPDSLGPG-----PSGADTPPP 300
               +PPAP PA+ P   PTP T  A +P  P P S  P      P    TPPP
Sbjct: 164 ARPATPPAPPPAAAP-VRPTPPTPPAATPAPPPPSSSAPNQRPGTPPSPVTPPP 216

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 48/102 (47%), Positives = 50/102 (49%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP A P   A  PA A PP   PP A PP  A PP   PP A PP PA+ P   PP 
Sbjct: 55  PAPPPPAPPPAAAPRPAPAPPPPPPPPRAEPPRPAPPPPPPPPRAEPPRPAAPP--PPPP 112

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG--ADTPPPP 303
           P  A  P  AP PS A  PPAP P    P  +     TPPPP
Sbjct: 113 PPRAEPPHAAPPPSRA-EPPAPPPSRPAPPVAAPPVHTPPPP 153

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 46/110 (41%), Positives = 56/110 (50%), Gaps = 13/110 (11%)
 Frame = +1

Query: 13  PPTATPAPKAQPPA-AATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS----- 174
           PP   P P+A+PP  AA PP   PP A PP AA PP+   P A PP+  + P  +     
Sbjct: 90  PPPPPPPPRAEPPRPAAPPPPPPPPRAEPPHAAPPPSRAEPPAPPPSRPAPPVAAPPVHT 149

Query: 175 --PPAPTPAS-----TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PPAP PAS      P+T P P  A +P  PTP +    P+    PPPP
Sbjct: 150 PPPPAPPPASPHEPARPATPPAPPPAAAPVRPTPPT---PPAATPAPPPP 196

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 45/92 (48%), Positives = 48/92 (52%)
 Frame = +1

Query: 28  PAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPS 207
           P P A PP  A PP   PP A PPAAA  P A PP A PPA A  PA +PP P P   P 
Sbjct: 29  PGPGAPPPHQAAPP---PPPAPPPAAAPRP-APPPPAPPPAAAPRPAPAPPPPPP---PP 81

Query: 208 TAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            A  P  A  PP P P +  P P+    PPPP
Sbjct: 82  RAEPPRPAPPPPPPPPRAEPPRPAAPPPPPPP 113

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 42/99 (42%), Positives = 44/99 (44%), Gaps = 2/99 (2%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPP--APASSPATSPPAP 186
           P  A P P   PP AA P  A PP A PPAAA  P   PP   PP  A    PA  PP P
Sbjct: 36  PHQAAPPPPPAPPPAAAPRPAPPPPAPPPAAAPRPAPAPPPPPPPPRAEPPRPAPPPPPP 95

Query: 187 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P + P     P     PP   P    P PS A+ P PP
Sbjct: 96  PPRAEPPRPAAPPPPPPPPRAEPPHAAPPPSRAEPPAPP 134

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/107 (41%), Positives = 53/107 (49%), Gaps = 9/107 (8%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATP--PAAATPPTATPPTATP--PAPASSPAT 171
           P  PP + PAP    P   TPP   PP A+P  PA    P A PP A P  P P + PA 
Sbjct: 130 PPAPPPSRPAPPVAAPPVHTPPPPAPPPASPHEPARPATPPAPPPAAAPVRPTPPTPPAA 189

Query: 172 SPPAPTPAST-----PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           +P  P P+S+     P T P+P T    P P+P + G  P  A TPP
Sbjct: 190 TPAPPPPSSSAPNQRPGTPPSPVT----PPPSPPAAGNAPPPAHTPP 232

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 49/117 (41%), Positives = 54/117 (46%), Gaps = 18/117 (15%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQP-------PAAATPPTATPPTATPPAAA-TPPTAT--PPTATPPA 150
           AP+  PT  P P   P       P A  PP   P  A PP  A TPP  T  P   TPP+
Sbjct: 236 APSPQPTPAPTPPGGPGQRPPIQPGAGAPPPGAPQGAPPPRGAPTPPAGTVAPGPGTPPS 295

Query: 151 PASSPA--TSPP-----APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPP 297
           PA+ PA  T PP      P+P   P T PTP  A  P PA  P + GPGP  A   P
Sbjct: 296 PATPPAAQTPPPNAQPGTPSPGPRPGTPPTPPPAAGPGPAAGPGAAGPGPGTAAPGP 352

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 46/104 (44%), Positives = 51/104 (49%), Gaps = 7/104 (6%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPT--ATPPTATPPAAATPPTA-TPPTATP-PAPASSPATSPP 180
           PP  TP P A PPA+   P   ATPP   P AA   PT  TPP ATP P P SS A +  
Sbjct: 145 PPVHTPPPPAPPPASPHEPARPATPPAPPPAAAPVRPTPPTPPAATPAPPPPSSSAPNQR 204

Query: 181 APTPASTPSTAPTPSTAGSPPAPT---PDSLGPGPSGADTPPPP 303
             TP S  +  P+P  AG+ P P    P S  P P     P PP
Sbjct: 205 PGTPPSPVTPPPSPPAAGNAPPPAHTPPRSAAPSPQPTPAPTPP 248

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 51/129 (39%), Positives = 63/129 (48%), Gaps = 30/129 (23%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAA-------TPPTATPPTATPPAA--ATPPTATPPTATPPAPA 156
           P  PP ATPAP   PP+++       TPP+   P  +PPAA  A PP  TPP +  P+P 
Sbjct: 183 PPTPPAATPAP--PPPSSSAPNQRPGTPPSPVTPPPSPPAAGNAPPPAHTPPRSAAPSPQ 240

Query: 157 SSPATSPP--------------APTPASTPSTAPTPSTAGSPPAPTPDSLGPG------- 273
            +PA +PP              AP P + P  AP P  A +PPA T  + GPG       
Sbjct: 241 PTPAPTPPGGPGQRPPIQPGAGAPPPGA-PQGAPPPRGAPTPPAGTV-APGPGTPPSPAT 298

Query: 274 PSGADTPPP 300
           P  A TPPP
Sbjct: 299 PPAAQTPPP 307

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/103 (42%), Positives = 48/103 (46%), Gaps = 6/103 (5%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTAT--PPTATPPAAATPPTAT--PPTATP--PAPASSPATS 174
           PP   P     P  A TPP  T  P   TPP+ ATPP A   PP A P  P+P   P T 
Sbjct: 264 PPPGAPQGAPPPRGAPTPPAGTVAPGPGTPPSPATPPAAQTPPPNAQPGTPSPGPRPGT- 322

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP P PA+ P  A  P  AG    P P +  PGP G    P P
Sbjct: 323 PPTPPPAAGPGPAAGPGAAG----PGPGTAAPGPGGPAATPAP 361

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 44/119 (36%), Positives = 53/119 (44%), Gaps = 19/119 (15%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPT-------------ATPPTAT 141
           +P  PP + PA    PP A TPP +  P+  P  A TPP              A PP A 
Sbjct: 210 SPVTPPPSPPAAGNAPPPAHTPPRSAAPSPQPTPAPTPPGGPGQRPPIQPGAGAPPPGAP 269

Query: 142 PPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPD------SLGPGPSGADTPPP 300
             AP    A +PPA T A  P T P+P+T  +   P P+      S GP P    TPPP
Sbjct: 270 QGAPPPRGAPTPPAGTVAPGPGTPPSPATPPAAQTPPPNAQPGTPSPGPRPGTPPTPPP 328

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 41/90 (45%), Positives = 44/90 (48%)
 Frame = +1

Query: 34  PKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTA 213
           PK QP      P    P A PP  A PP   PP A PPA A  PA  PPAP PA+ P  A
Sbjct: 18  PKQQPQGQ---PQRPGPGAPPPHQAAPP---PPPAPPPAAAPRPAPPPPAPPPAAAPRPA 71

Query: 214 PTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P     PP P P +  P P+    PPPP
Sbjct: 72  PAP----PPPPPPPRAEPPRPAPPPPPPPP 97

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 51/118 (43%), Positives = 57/118 (48%), Gaps = 19/118 (16%)
 Frame = +1

Query: 4   PTKPPT-----ATPAPKAQPPAAATPPTATPPTATPPAAA---TPPTATPPT---ATPPA 150
           P  PP      A PA    PP AA P   TPP  TPPAA     PP+++ P     TPP+
Sbjct: 153 PAPPPASPHEPARPATPPAPPPAAAPVRPTPP--TPPAATPAPPPPSSSAPNQRPGTPPS 210

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPG-----PSGADTPPP 300
           P  +P  SPPA   A  P+  P  S A SP   PAPTP   GPG       GA  PPP
Sbjct: 211 PV-TPPPSPPAAGNAPPPAHTPPRSAAPSPQPTPAPTPPG-GPGQRPPIQPGAGAPPP 266

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 52/132 (39%), Positives = 59/132 (44%), Gaps = 34/132 (25%)
 Frame = +1

Query: 4   PTKPPTATP-------APKAQPPAAA-------TPPTATPPTATPPAAA------TPPT- 120
           P  PP A+P        P A PPAAA       TPP ATP    P ++A      TPP+ 
Sbjct: 152 PPAPPPASPHEPARPATPPAPPPAAAPVRPTPPTPPAATPAPPPPSSSAPNQRPGTPPSP 211

Query: 121 ATPPTATP-----PAPASSP---ATSPPAPTPASTP-----STAPTPSTAGSPPAPTPDS 261
            TPP + P     P PA +P   A   P PTPA TP        P    AG+PP   P  
Sbjct: 212 VTPPPSPPAAGNAPPPAHTPPRSAAPSPQPTPAPTPPGGPGQRPPIQPGAGAPPPGAPQG 271

Query: 262 LGPGPSGADTPP 297
             P P GA TPP
Sbjct: 272 -APPPRGAPTPP 282

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 43/98 (43%), Positives = 47/98 (47%), Gaps = 2/98 (2%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAAT-PPTATPPTATP-PAAATPPTATPPTATPPAPASSPATSPPAP 186
           P   TP   A PPAA T PP A P T +P P   TPP  TPP A  P PA+ P  + P P
Sbjct: 288 PGPGTPPSPATPPAAQTPPPNAQPGTPSPGPRPGTPP--TPPPAAGPGPAAGPGAAGPGP 345

Query: 187 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             A     AP P    + PAP P S GPG       PP
Sbjct: 346 GTA-----APGPGGPAATPAPGPGS-GPGAGAQGAVPP 377

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 39/107 (36%), Positives = 47/107 (43%), Gaps = 6/107 (5%)
 Frame = +1

Query: 1   APTKPPTA-TPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           +P  PP A TP P AQP   +  P    P   PPAA   P A P  A P    ++P    
Sbjct: 295 SPATPPAAQTPPPNAQPGTPSPGPRPGTPPTPPPAAGPGPAAGPGAAGPGPGTAAPGPGG 354

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSL--GPGPSGA---DTPPPP 303
           PA TPA  P + P     G+ P   P ++   P P  A     PPPP
Sbjct: 355 PAATPAPGPGSGPGAGAQGAVPPAGPPAMTNRPPPQVAAPIPAPPPP 401

[25][TOP]
>UniRef100_A7R0E9 Chromosome undetermined scaffold_306, whole genome shotgun sequence
           n=1 Tax=Vitis vinifera RepID=A7R0E9_VITVI
          Length = 177

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 57/117 (48%), Positives = 69/117 (58%), Gaps = 21/117 (17%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTATPPT--ATPPAAATPPTATPPTATPPAPASS--------- 162
           P+ +PA    PP+ ATPPTATPPT  ATPP +   P ATPPT+  P+P +S         
Sbjct: 25  PSTSPA---SPPSTATPPTATPPTTMATPPPSVATP-ATPPTSISPSPTTSISPSPTTSI 80

Query: 163 ---PATSP-PAPTPASTPSTAPTPS---TAGSPPAPTPDSLGPGPSGADTP---PPP 303
              P TSP  +P PA+TPS +P+P+   TA SPPAP P    PGPS A  P   PPP
Sbjct: 81  SPSPTTSPVSSPPPAATPSMSPSPASSPTAISPPAPPPSEGSPGPSTASPPATSPPP 137

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 50/130 (38%), Positives = 61/130 (46%), Gaps = 29/130 (22%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAA-ATPPT-----ATPPTA----------------------TP 96
           +P  PP+    P A PP   ATPP      ATPPT+                      T 
Sbjct: 28  SPASPPSTATPPTATPPTTMATPPPSVATPATPPTSISPSPTTSISPSPTTSISPSPTTS 87

Query: 97  PAAATPPTATPPTATPPAPASSP-ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG 273
           P ++ PP ATP  +  P+PASSP A SPPAP P+     +P PSTA  P    P + GPG
Sbjct: 88  PVSSPPPAATP--SMSPSPASSPTAISPPAPPPS---EGSPGPSTASPPATSPPPAGGPG 142

Query: 274 PSGADTPPPP 303
            S   +P PP
Sbjct: 143 SSPPPSPTPP 152

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 36/94 (38%), Positives = 50/94 (53%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +PT   + +P     P    +P ++ PP ATP  + +P  A+ PTA  P PA  P+   P
Sbjct: 67  SPTTSISPSPTTSISPSPTTSPVSSPPPAATP--SMSPSPASSPTAISP-PAPPPSEGSP 123

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG 282
            P+ AS P+T+P P  AG P +  P S  P PSG
Sbjct: 124 GPSTASPPATSPPP--AGGPGSSPPPSPTPPPSG 155

[26][TOP]
>UniRef100_B9PLD5 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1
           RepID=B9PLD5_TOXGO
          Length = 1112

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/104 (46%), Positives = 64/104 (61%), Gaps = 8/104 (7%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPASSPATSPP 180
           PP  +P+P +  P A +PP  +PP+ +PPA    A +PP  +PP+  PPAP S P+ SPP
Sbjct: 270 PPAPSPSPPSVSPPAPSPPAPSPPSVSPPAPSPPAPSPPAPSPPSVAPPAP-SPPSVSPP 328

Query: 181 APTPAS-TPSTAPTPSTAG---SPPAPTPDSLGPGPSGADTPPP 300
           AP+P S  P   P PS A    SPPAP+P S+ P P+ +  PPP
Sbjct: 329 APSPPSVAPPAPPAPSVAPPSLSPPAPSPPSVSP-PAPSAAPPP 371

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 48/126 (38%), Positives = 66/126 (52%), Gaps = 26/126 (20%)
 Frame = +1

Query: 4   PTKPPTATPAPK---AQPPAAATPPTAT-------------PPTATPPAAA-TPPTATPP 132
           P KP +A+PA +   A PP A    +A+             PP  +PPA + +PP+ +PP
Sbjct: 224 PRKPQSASPASRVSFAPPPEAKVKSSASSLQGVSPVQLPPSPPAPSPPAPSPSPPSVSPP 283

Query: 133 TATPPAPA---------SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA 285
             +PPAP+         S PA SPPAP+P S    AP+P +  SPPAP+P S+ P    A
Sbjct: 284 APSPPAPSPPSVSPPAPSPPAPSPPAPSPPSVAPPAPSPPSV-SPPAPSPPSVAPPAPPA 342

Query: 286 DTPPPP 303
            +  PP
Sbjct: 343 PSVAPP 348

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 36/87 (41%), Positives = 50/87 (57%), Gaps = 6/87 (6%)
 Frame = +1

Query: 1   APTKPPTATPAPK--AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP----ASS 162
           AP+ P  + PAP   A  P A +PP+  PP  +PP + +PP  +PP+  PPAP     + 
Sbjct: 289 APSPPSVSPPAPSPPAPSPPAPSPPSVAPPAPSPP-SVSPPAPSPPSVAPPAPPAPSVAP 347

Query: 163 PATSPPAPTPASTPSTAPTPSTAGSPP 243
           P+ SPPAP+P   PS +P   +A  PP
Sbjct: 348 PSLSPPAPSP---PSVSPPAPSAAPPP 371

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 39/99 (39%), Positives = 50/99 (50%), Gaps = 3/99 (3%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPT---ATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAP 186
           P  TP P  +P +A+       A PP A   ++A+      P   PP+P   PA SPPAP
Sbjct: 217 PATTPVPPRKPQSASPASRVSFAPPPEAKVKSSASSLQGVSPVQLPPSP---PAPSPPAP 273

Query: 187 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P S PS +P    A SPPAP+P S+ P       P PP
Sbjct: 274 SP-SPPSVSPP---APSPPAPSPPSVSPPAPSPPAPSPP 308

[27][TOP]
>UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2Z7_EHV86
          Length = 516

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 39/100 (39%), Positives = 55/100 (55%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+  +PP + PP + PP +  PP+  PP+  PP+P  SP   PP+
Sbjct: 70  PSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSP---PPS 126

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P S P  +P P +    P P P      PS + +PPPP
Sbjct: 127 PSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPP 166

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 41/100 (41%), Positives = 55/100 (55%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP+   PP+  PP+  PP+  +PP + PP + PP     P+  PP+
Sbjct: 55  PPSPPPPLPPPSPSPPSPP-PPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPS 113

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   PS  P+P  + SPP+P P S  P PS + +PPPP
Sbjct: 114 PPP---PSPPPSPPPSPSPPSPPPPS-PPPPSISPSPPPP 149

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 41/101 (40%), Positives = 54/101 (53%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA-PASSPATSPP 180
           P+ PP   P P   PP  + PP+  PP   PP + +PP+  PP+  PP+ P  SP + PP
Sbjct: 35  PSPPPLPPPLPPPSPPPPSPPPSPPPPL--PPPSPSPPSPPPPSPPPPSPPPPSPPSPPP 92

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P S P  +P P    SPP P+P    P PS   +P PP
Sbjct: 93  SPPPPSPPPPSPPPP---SPPPPSPPPPSPPPSPPPSPSPP 130

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 40/110 (36%), Positives = 57/110 (51%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  P    +P   +PP  +PP P+ SP+  PP 
Sbjct: 91  PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPP 150

Query: 184 P----TPASTPSTAPTP----STAGSPPAPTPDSLGPGP--SGADTPPPP 303
           P     P+++PS  P P        + P+P P S+ P P  S + TPPPP
Sbjct: 151 PPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPP 200

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 43/108 (39%), Positives = 59/108 (54%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P+P   PP  + PP + PP + PP +  PP+  PP + PP+P S P+  PP+
Sbjct: 80  PSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPSPPPSP-SPPSPPPPS 136

Query: 184 PTPAS-TPSTAP-------TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S +PS  P        PS + SPP P P      PS + +PPPP
Sbjct: 137 PPPPSISPSPPPPPPPWWQAPSASPSPP-PPPPPWWQAPSASPSPPPP 183

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 41/103 (39%), Positives = 52/103 (50%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA--SSPATSP 177
           P+ PP + P P   P     PP + PP + PP+   PP   PP+ +PP+P   S P  SP
Sbjct: 25  PSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSP--PPPLPPPSPSPPSPPPPSPPPPSP 82

Query: 178 PAPTPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P+P S P + P PS    SPP P+P    P P      PPP
Sbjct: 83  PPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP 125

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 40/100 (40%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+    P   PP + PP +  PP + PP   PP+P S P+  PP+
Sbjct: 20  PSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPS--PPPSPPPPLPPPSP-SPPSPPPPS 76

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P PS   SPP P+P    P P     P PP
Sbjct: 77  PPPPSPPPPSP-PSPPPSPPPPSPPPPSPPPPSPPPPSPP 115

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 37/94 (39%), Positives = 53/94 (56%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPA 195
           P+A+P+P   PP     P+A+P    P  + +PP++  PT  PP P++SP+  PP+P P 
Sbjct: 157 PSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPT--PPPPSASPSPPPPSPPPP 214

Query: 196 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           S P   P P     PP P+P S  P PS + +PP
Sbjct: 215 SPPPPPPPPP----PPPPSPPSPNPPPSASPSPP 244

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 42/110 (38%), Positives = 59/110 (53%), Gaps = 9/110 (8%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATP-PTATPPAAATPPTATPPTATPP-----APASS 162
           +P   P  +P+P + PP +  PP+ +P P   PP     P+A+P    PP     AP++S
Sbjct: 118 SPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSAS 177

Query: 163 PATSPP--APTPASTPS-TAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+  PP  +P+P S+ S T P PS + SPP P+P    P P     PPPP
Sbjct: 178 PSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPP 227

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 43/111 (38%), Positives = 61/111 (54%), Gaps = 11/111 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPP----APASSPAT 171
           P  PP  +P P + PP+   PP+ +PP+  PP+   P  +  P   PP    AP++SP+ 
Sbjct: 106 PPSPPPPSPPPPSPPPSP--PPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSP 163

Query: 172 SPPAP----TPASTPSTAPTPSTAGSPP---APTPDSLGPGPSGADTPPPP 303
            PP P     P+++PS  P PS + SPP   +PTP    P PS + +PPPP
Sbjct: 164 PPPPPPWWQAPSASPS-PPPPSISPSPPSSASPTP----PPPSASPSPPPP 209

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 36/97 (37%), Positives = 47/97 (48%), Gaps = 3/97 (3%)
 Frame = +1

Query: 22  ATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTA---TPPAPASSPATSPPAPTP 192
           A   P + PP +  PP+  PP+  P     PP + PP +   +PP P   P+ SPP+P P
Sbjct: 15  AYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPP 74

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            S P  +P P +  SPP   P    P PS     PPP
Sbjct: 75  PSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPP 111

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 38/96 (39%), Positives = 51/96 (53%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPA 195
           P+A+P+P   P  + +PP++  PT  PP+A+     +PP  +PP P+  P   PP P P 
Sbjct: 174 PSASPSPPP-PSISPSPPSSASPTPPPPSASP----SPPPPSPPPPSPPPPPPPPPPPPP 228

Query: 196 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           S PS  P PS + SPP     SL   P     PPPP
Sbjct: 229 SPPSPNPPPSASPSPPFGR--SLRSPPPPPPPPPPP 262

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 33/92 (35%), Positives = 47/92 (51%), Gaps = 1/92 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATP-PAAATPPTATPPTATPPAPASSPATSP 177
           AP+  P+  P   +  P ++  PT  PP+A+P P   +PP  +PP   PP P   P+   
Sbjct: 173 APSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPS 232

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG 273
           P P P+++PS  P   +  SPP P P    PG
Sbjct: 233 PNPPPSASPS-PPFGRSLRSPPPPPPPPPPPG 263

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 25/69 (36%), Positives = 33/69 (47%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           PP+A+P+P    P   +PP   PP   PP +   P   PP+A+P  P      SPP P P
Sbjct: 199 PPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNP-PPSASPSPPFGRSLRSPPPPPP 257

Query: 193 ASTPSTAPT 219
              P   P+
Sbjct: 258 PPPPPGLPS 266

[28][TOP]
>UniRef100_Q1HH32 Putative uncharacterized protein n=1 Tax=Antheraea pernyi
           nucleopolyhedrovirus RepID=Q1HH32_NPVAP
          Length = 211

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 41/88 (46%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query: 43  QPPAAATPPTATPPTATPPAAA-TPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPT 219
           QP    TPPT TPP + PP+   TPPT TPP + PP+P  +P T  P+PTP +     P+
Sbjct: 32  QPLPTPTPPTPTPPPSPPPSPTPTPPTPTPPPSPPPSPTPTPPTPTPSPTPPTPTPPPPS 91

Query: 220 PSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+    PP+PTP +  P PS   +PPPP
Sbjct: 92  PTPTPPPPSPTPPTPTPPPSPPPSPPPP 119

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 45/90 (50%), Positives = 52/90 (57%), Gaps = 5/90 (5%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPA-AATPPT----ATPPTATPPAPASSPATSP 177
           PPT TP P   P    TPPT TPP + PP+   TPPT     TPPT TPP P+ +P   P
Sbjct: 39  PPTPTPPPSPPPSPTPTPPTPTPPPSPPPSPTPTPPTPTPSPTPPTPTPPPPSPTPTPPP 98

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLG 267
           P+PTP   P+  P PS   SPP P P+ LG
Sbjct: 99  PSPTP---PTPTPPPSPPPSPPPPNPEPLG 125

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 34/78 (43%), Positives = 41/78 (52%), Gaps = 3/78 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPA---AATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           PT PP+  P+P   PP    + TPPT TPP  +P     PP+ TPPT TPP P+  P+  
Sbjct: 59  PTPPPSPPPSPTPTPPTPTPSPTPPTPTPPPPSPTPTPPPPSPTPPTPTPP-PSPPPSPP 117

Query: 175 PPAPTPASTPSTAPTPST 228
           PP P P   P   P   T
Sbjct: 118 PPNPEPLGEPMYFPADIT 135

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 36/80 (45%), Positives = 40/80 (50%), Gaps = 4/80 (5%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATP----PTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           PPT TP P   P    TPPT TP    PT TPP  +  PT  PP+ TPP P     T PP
Sbjct: 56  PPTPTPPPSPPPSPTPTPPTPTPSPTPPTPTPPPPSPTPTPPPPSPTPPTP-----TPPP 110

Query: 181 APTPASTPSTAPTPSTAGSP 240
           +P P+  P   P P   G P
Sbjct: 111 SPPPSPPP---PNPEPLGEP 127

[29][TOP]
>UniRef100_C3ZT83 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae
           RepID=C3ZT83_BRAFL
          Length = 602

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/112 (48%), Positives = 65/112 (58%), Gaps = 11/112 (9%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTA-TPPTA-TPPAAATPPTA-TPPTATPPAPASSP-- 165
           A T P  +TP   + PPAA+TPP A TPP A TPP A+TPP A TPP A+ P  AS+P  
Sbjct: 381 ASTPPVASTPLAASTPPAASTPPVASTPPAASTPPVASTPPAASTPPVASTPPAASTPPV 440

Query: 166 ATSPPAPTPASTPSTAPTPST------AGSPPAPTPDSLGPGPSGADTPPPP 303
           A +PPAP+    PST P PST      A +PP  +   +   P  A TPP P
Sbjct: 441 ANTPPAPSTPPAPSTPPAPSTTRPQKAASTPPVASTPPVASTPLVASTPPVP 492

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 59/118 (50%), Positives = 66/118 (55%), Gaps = 17/118 (14%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTA-TPPTA-TPPAAATPPTA-TPPTA-TPPAPASSPA 168
           A T P  +TP   + PPAA+TPP A TPP A TPP A+TPP A TPP A TPPAP++ PA
Sbjct: 393 ASTPPAASTPPVASTPPAASTPPVASTPPAASTPPVASTPPAASTPPVANTPPAPSTPPA 452

Query: 169 TS-PPAP----------TP--ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            S PPAP          TP  ASTP  A TP  A +PP P        P    TPP P
Sbjct: 453 PSTPPAPSTTRPQKAASTPPVASTPPVASTPLVASTPPVPITPPAPITPPAPSTPPAP 510

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 53/113 (46%), Positives = 64/113 (56%), Gaps = 14/113 (12%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTA-TPPTA-TPPAAATPPTA-------TPPTATPPAP 153
           A T P  +TP   + PP A+TPP A TPP A TPPAA+TPP A       TPP A+ P  
Sbjct: 315 ASTPPALSTPPVASTPPVASTPPAASTPPAASTPPAASTPPAASTPLVASTPPAASTPPA 374

Query: 154 ASSP--ATSPP---APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           AS+P  A++PP    P  ASTP  A TP  A +PPA +   +   P  A TPP
Sbjct: 375 ASTPPVASTPPVASTPLAASTPPAASTPPVASTPPAASTPPVASTPPAASTPP 427

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 58/115 (50%), Positives = 67/115 (58%), Gaps = 14/115 (12%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTA-------TPPTA-TPPAAATPPTA-TPPTATPPAP 153
           A T P  +TP   + PPAA+TPP A       TPP A TP AA+TPP A TPP A+ P  
Sbjct: 351 ASTPPAASTPLVASTPPAASTPPAASTPPVASTPPVASTPLAASTPPAASTPPVASTPPA 410

Query: 154 ASSP--ATSPPA---PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           AS+P  A++PPA   P  ASTP  A TP  A +PPAP   S  P PS   TPP P
Sbjct: 411 ASTPPVASTPPAASTPPVASTPPAASTPPVANTPPAP---STPPAPS---TPPAP 459

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 53/121 (43%), Positives = 65/121 (53%), Gaps = 20/121 (16%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTA-------------TPPTA-TPPAAATPPTATPPTA 138
           A T P  +TP   + PPAA+TPP A             TPP A TPP A+TPP A+ P A
Sbjct: 333 ASTPPAASTPPAASTPPAASTPPAASTPLVASTPPAASTPPAASTPPVASTPPVASTPLA 392

Query: 139 --TPPAPASSP-ATSPPA---PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             TPPA ++ P A++PPA   P  ASTP  A TP  A +PPA +   +   P    TPP 
Sbjct: 393 ASTPPAASTPPVASTPPAASTPPVASTPPAASTPPVASTPPAASTPPVANTPPAPSTPPA 452

Query: 301 P 303
           P
Sbjct: 453 P 453

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 50/104 (48%), Positives = 59/104 (56%), Gaps = 5/104 (4%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTA-TPPTA-TPPAAATPPTA-TPPTATPPAPASSP-- 165
           A T P  +TP   + P AA+TPP A TPP A TPPAA+TPP A TPP A+ P  AS+P  
Sbjct: 375 ASTPPVASTPPVASTPLAASTPPAASTPPVASTPPAASTPPVASTPPAASTPPVASTPPA 434

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           A++PP       PST P PST  +P    P      P  A TPP
Sbjct: 435 ASTPPVANTPPAPSTPPAPSTPPAPSTTRPQKAASTPPVASTPP 478

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 52/110 (47%), Positives = 62/110 (56%), Gaps = 11/110 (10%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTA--TPPAAATPPTA-TPPTATPPAPASSP-- 165
           A T P  +TP   + PP A+TPP A+ P A  TPPAA+TPP A TPP A+ P  AS+P  
Sbjct: 363 ASTPPAASTPPAASTPPVASTPPVASTPLAASTPPAASTPPVASTPPAASTPPVASTPPA 422

Query: 166 -ATSPPAPTP--ASTP---STAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
            +T P A TP  ASTP   +T P PST  +P  P   S       A TPP
Sbjct: 423 ASTPPVASTPPAASTPPVANTPPAPSTPPAPSTPPAPSTTRPQKAASTPP 472

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 50/107 (46%), Positives = 62/107 (57%), Gaps = 14/107 (13%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTA-TPPTAT-PPAAATPPTA-TPPTATPPAPASSP--ATSPPA 183
           T+ P   + PPA +TPP A TPP A+ PPAA+TPP A TPP A+ P  AS+P  A++PPA
Sbjct: 309 TSIPPVASTPPALSTPPVASTPPVASTPPAASTPPAASTPPAASTPPAASTPLVASTPPA 368

Query: 184 ---------PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
                    P  ASTP  A TP  A +PPA +   +   P  A TPP
Sbjct: 369 ASTPPAASTPPVASTPPVASTPLAASTPPAASTPPVASTPPAASTPP 415

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 45/105 (42%), Positives = 58/105 (55%), Gaps = 10/105 (9%)
 Frame = +1

Query: 10  KPPTATPAPK---AQPPAAATPPTATPPTA-TPPAAATPPTA-TPPTATPPAPASSP--A 168
           K P+ T A +   A+     +  T+ PP A TPPA +TPP A TPP A+ P  AS+P  A
Sbjct: 286 KRPSTTDASELHSAKRRCTGSGNTSIPPVASTPPALSTPPVASTPPVASTPPAASTPPAA 345

Query: 169 TSPPA---PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
           ++PPA   P  ASTP  A TP  A +PPA +   +   P  A TP
Sbjct: 346 STPPAASTPPAASTPLVASTPPAASTPPAASTPPVASTPPVASTP 390

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 40/84 (47%), Positives = 47/84 (55%), Gaps = 8/84 (9%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPT-ATPP----TATPPAAATPPTA-TPPTATPPAPASS 162
           A T P  +TP     PPA +TPP  +TPP    T    AA+TPP A TPP A+ P  AS+
Sbjct: 429 ASTPPAASTPPVANTPPAPSTPPAPSTPPAPSTTRPQKAASTPPVASTPPVASTPLVAST 488

Query: 163 PAT--SPPAPTPASTPSTAPTPST 228
           P    +PPAP     PST P PST
Sbjct: 489 PPVPITPPAPITPPAPSTPPAPST 512

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 42/94 (44%), Positives = 49/94 (52%), Gaps = 8/94 (8%)
 Frame = +1

Query: 1   APTKPPTAT--PAPKAQPP--AAATPPTA-TPPTA-TPPAAATPPTATPPTA--TPPAPA 156
           AP+ PP  +  PAP    P  AA+TPP A TPP A TP  A+TPP    P A  TPPAP+
Sbjct: 446 APSTPPAPSTPPAPSTTRPQKAASTPPVASTPPVASTPLVASTPPVPITPPAPITPPAPS 505

Query: 157 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPD 258
           + PA S   P  A         S+AG   A  PD
Sbjct: 506 TPPAPSTTRPQKAVPLMLRRLHSSAGWLAAQKPD 539

[30][TOP]
>UniRef100_Q9LIE9 Similarity to cell wall-plasma membrane linker protein n=1
           Tax=Arabidopsis thaliana RepID=Q9LIE9_ARATH
          Length = 334

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 46/96 (47%), Positives = 50/96 (52%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PPT TP P    P   TPP  TPPT TPP   TPPT TPP  TPP P + P  +PP 
Sbjct: 162 PCPPPTPTPTPPVVTPPTPTPPVITPPTPTPP-VVTPPTPTPPVITPPTP-TPPVITPPT 219

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 291
           PTP       PTP    +PP PTP +  P     DT
Sbjct: 220 PTPPVVTPPTPTPPVV-TPPTPTPPTPIPETCPIDT 254

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 47/107 (43%), Positives = 52/107 (48%), Gaps = 9/107 (8%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAA---------TPPTATPPTATPPAAATPPTATPPTATPPAPAS 159
           TKPP +TP P    P            TPP  TPPT TPP   TPPT TPP  TPP P +
Sbjct: 144 TKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVI-TPPTPTPPVVTPPTP-T 201

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P  +PP PTP       PTP    +PP PTP  + P      TP P
Sbjct: 202 PPVITPPTPTPPVITPPTPTPPVV-TPPTPTPPVVTPPTPTPPTPIP 247

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/104 (42%), Positives = 51/104 (49%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP-P 180
           PTKP      P  +PP    P T  PPT  PP+   PPT  PP +TP  P   P  +P P
Sbjct: 105 PTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCP 164

Query: 181 APTPASTPS--TAPTPS-TAGSPPAPTPDSLGPGPSGADTPPPP 303
            PTP  TP   T PTP+    +PP PTP  + P      TP PP
Sbjct: 165 PPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTP-----PTPTPP 203

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 39/98 (39%), Positives = 43/98 (43%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPT 189
           KPPT  P P  +PP    P    P T  PP    P T  PPT  PP     P    P PT
Sbjct: 103 KPPTK-PHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPT 161

Query: 190 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P   P+  PTP    +PP PTP  + P      TP PP
Sbjct: 162 PCPPPTPTPTPPVV-TPPTPTPPVITP-----PTPTPP 193

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 42/119 (35%), Positives = 48/119 (40%), Gaps = 21/119 (17%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTATPPAAATP---------------------PTAT 126
           KPP   P P   PP+   PPT  PP+   P    P                     PT T
Sbjct: 113 KPPIVKP-PTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPT 171

Query: 127 PPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP  TPP P + P  +PP PTP       PTP    +PP PTP  + P      TP PP
Sbjct: 172 PPVVTPPTP-TPPVITPPTPTPPVVTPPTPTPPVI-TPPTPTPPVITP-----PTPTPP 223

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 43/111 (38%), Positives = 44/111 (39%), Gaps = 11/111 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATP-PAAAT------PPTA----TPPTATPPA 150
           P KPP   PA K   P A  PPT  PPT  P P   T      PPT      PPT  PP 
Sbjct: 43  PVKPPKP-PAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPH 101

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P       P    P   P T P PST   P  P P +    P    T PPP
Sbjct: 102 PKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPST----PKPPTTKPPP 148

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 43/112 (38%), Positives = 44/112 (39%), Gaps = 12/112 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAAT---PPTATP----PTATP---PAAATPPTATPPTATPPAP 153
           P KPP   P P  +PP       PPT  P    PT  P   P    PP   PPT   P P
Sbjct: 54  PPKPPAVKP-PTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHP 112

Query: 154 ASSPATSPPAPTPASTPS--TAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P   PP   P STP   T P PST   PP   P    P P     PP P
Sbjct: 113 -KPPIVKPPTKPPPSTPKPPTKPPPSTP-KPPTTKPPPSTPKPPHHKPPPTP 162

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 38/115 (33%), Positives = 42/115 (36%), Gaps = 18/115 (15%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPA--AATPPTATPPTATP-PAPAS-------- 159
           PP  +PAP   P     PP   PP   PP   A  PPT  PPT  P P P +        
Sbjct: 29  PPKPSPAPHKPPKHPVKPPK--PPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPP 86

Query: 160 -------SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                   P   PP P P + P   P P     P  P P +  P      T PPP
Sbjct: 87  TVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKP-----PTKPPP 136

[31][TOP]
>UniRef100_Q9LIE8 Similarity to cell wall-plasma membrane linker protein n=1
           Tax=Arabidopsis thaliana RepID=Q9LIE8_ARATH
          Length = 1480

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/110 (49%), Positives = 58/110 (52%), Gaps = 13/110 (11%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAA----ATPPTATPPTATPPAA---------ATPPTATPPTATPPAP 153
           PPTATP P A PP A    ATPPTATPP ATPP A          TPPTATPP A PP  
Sbjct: 518 PPTATP-PIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVA 576

Query: 154 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
               AT P A  P STP  + +P    +PPA TP    P P+      PP
Sbjct: 577 TPPIATPPTAKPPISTPPISKSP--VATPPAATPPITTPPPAKPPVATPP 624

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 56/110 (50%), Positives = 61/110 (55%), Gaps = 13/110 (11%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAA----ATPPTATPPTATPPAA----ATPPTATPPTATPPA---PAS 159
            PPTATP P A PP A    ATPPTATPP ATPP A    ATPPT  PPTATPP    P +
Sbjct: 768  PPTATP-PIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVA 826

Query: 160  SP--ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P  AT P A  P  TP  +  P    +PPA TP    P P+      PP
Sbjct: 827  TPPIATPPTAKPPILTPPISKPP--VATPPAATPPITTPPPAKPPVATPP 874

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 57/112 (50%), Positives = 63/112 (56%), Gaps = 14/112 (12%)
 Frame = +1

Query: 7    TKPPTATPAPKAQPPAA----ATPPTATPPTATPPAA----ATPPTATPPTATPPAPASS 162
            T PPTATP P A+PP A    ATPPTA PP  TPP +    ATPP ATPP  TPP PA  
Sbjct: 811  TAPPTATP-PVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPP-PAKP 868

Query: 163  PATSPPAPT------PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P  +PP  T      P +TP TA TP  A SP A  P ++ P      TPPP
Sbjct: 869  PVATPPIATPPIAKPPVATPPTA-TPPIATSPVAKPPVAIPP----IKTPPP 915

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 52/108 (48%), Positives = 58/108 (53%), Gaps = 9/108 (8%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAA---------ATPPTATPPTATPPAPAS 159
           T PPTATP P A+PP A TPP ATPPTA PP +         ATPP ATPP  TPP PA 
Sbjct: 561 TTPPTATP-PVAKPPVA-TPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPP-PAK 617

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P  +PP  TP        TP TA  P A +P +  P  +     PPP
Sbjct: 618 PPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPP 665

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/101 (49%), Positives = 53/101 (52%), Gaps = 3/101 (2%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPA---AATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           KPP ATP  K  PPA    A PP ATPP A PP A TPPTATPP ATPP       T P 
Sbjct: 652 KPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVA-TPPTATPPIATPPIATPPVVTPPT 710

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           A  P +TP  A  P+T   PP  TP    P  +   T  PP
Sbjct: 711 ATPPVATPPIAKPPTTI--PPTATPPVAMPPIATPPTAKPP 749

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 52/109 (47%), Positives = 55/109 (50%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPA---------AATPPTATPPTATPPAPA 156
           P KPP ATP P A+ P A TPPTATPP ATPP            TPPTATPP A PP   
Sbjct: 400 PAKPPVATP-PIAKSPIA-TPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVET 457

Query: 157 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              AT P A  P STP  +  P    +PPA TP    P P       PP
Sbjct: 458 PPIATPPTAKPPISTPPISKPP--VATPPAATPPITTPTPVKPPVATPP 504

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 52/100 (52%), Positives = 55/100 (55%), Gaps = 4/100 (4%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAA----ATPPTATPPTATPPAPASSPATSPP 180
           PP ATP P A+PP  ATPPTATPP ATPP A     TPPTATPP ATPP  A  P T PP
Sbjct: 673 PPIATP-PVAKPP-VATPPTATPPIATPPIATPPVVTPPTATPPVATPPI-AKPPTTIPP 729

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             TP        TP TA  P A  P ++ P        PP
Sbjct: 730 TATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPP 769

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/108 (48%), Positives = 56/108 (51%), Gaps = 9/108 (8%)
 Frame = +1

Query: 7    TKPPTATPAPKAQPPAAATPPTATPPTATPPAA---------ATPPTATPPTATPPAPAS 159
            T PPTATP P A PP A TPPTA PP ATPP A          TPPTATPP ATPP   S
Sbjct: 726  TIPPTATP-PVAMPPIA-TPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKS 783

Query: 160  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              AT P A  P +TP  A  P    +PP   P +  P  +      PP
Sbjct: 784  PVATPPTATPPVATPPIAKPP--VATPPTTAPPTATPPVAKPPVATPP 829

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 51/106 (48%), Positives = 57/106 (53%), Gaps = 9/106 (8%)
 Frame = +1

Query: 13  PPTATP---APKAQPPAAATPPTATPPTATPPAAA----TPPTATPPTATPPAPASSPAT 171
           PPTATP    P  + P  ATPPT TPPTATPP A     TPP ATPPTA PP  ++ P +
Sbjct: 418 PPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPI-STPPIS 476

Query: 172 SPPAPTP--ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP  TP  A+ P T PTP     PP  TP    P  +      PP
Sbjct: 477 KPPVATPPAATPPITTPTPV---KPPVATPPLAIPPVAKPPVVTPP 519

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 53/104 (50%), Positives = 54/104 (51%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA----ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT 171
           P KPP ATP P A PP A    ATPPTATPP AT P  A PP ATPP  TPP PA  P  
Sbjct: 615 PAKPPVATP-PIATPPIAKPPVATPPTATPPIATSP-VAKPPVATPPIKTPP-PAKPPVA 671

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP  TP        TP TA +PP  TP    P      T  PP
Sbjct: 672 IPPIATPPVAKPPVATPPTA-TPPIATPPIATPPVVTPPTATPP 714

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 50/100 (50%), Positives = 53/100 (53%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P KPP A P P A PP A  PP ATPPTATPP  AT P ATPP  TPP   S  AT P A
Sbjct: 915  PAKPPVAIP-PIATPPVAK-PPVATPPTATPP-IATSPIATPPVVTPPTATSPVATPPIA 971

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P +TP TA  P     PP  TP +  P  +      PP
Sbjct: 972  KPPTTTPPTATPP--VAMPPIATPPTAKPPVATPPIANPP 1009

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/105 (45%), Positives = 51/105 (48%), Gaps = 8/105 (7%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTATPPAA----ATPPTATPPTATPPAP----ASSP 165
           KPP  TP P    P  ATPPT  PP ATPP A    ATPP ATPPTATPP      A+ P
Sbjct: 192 KPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPP 251

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            T+PP   P        TP  A  P    P S  P  +   T PP
Sbjct: 252 ITTPPIANPPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPP 296

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 52/104 (50%), Positives = 55/104 (52%), Gaps = 8/104 (7%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAA----ATPPTATPPTATPPAA----ATPPTATPPTATPPAPASSP 165
           KPP ATP P A PP A    ATPP  TPPTATPP A    A PPT  PPTATPP      
Sbjct: 682 KPPVATP-PTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPI 740

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           AT P A  P +TP  A  P     PP  TP +  P  +   TPP
Sbjct: 741 ATPPTAKPPIATPPIAIPP--VAKPPVVTPPTATPPIA---TPP 779

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 52/109 (47%), Positives = 58/109 (53%), Gaps = 12/109 (11%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAA----ATPPTATPPTATPPAAATPPTATPPTATPPAP----ASSPA 168
            PPTATP P A PP A    ATPPT  PPTATPP A  PP ATPP ATPP       + P 
Sbjct: 788  PPTATP-PVATPPIAKPPVATPPTTAPPTATPPVAK-PPVATPPIATPPTAKPPILTPPI 845

Query: 169  TSPPAPTP--ASTPSTAPTPS--TAGSPPAPTPDSLGPGPSGADTPPPP 303
            + PP  TP  A+ P T P P+     +PP  TP    P  +   T  PP
Sbjct: 846  SKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPP 894

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 48/101 (47%), Positives = 53/101 (52%), Gaps = 3/101 (2%)
 Frame = +1

Query: 10   KPPTATPAPKAQPPA---AATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            KPP A P  K  PPA    A PP ATPP A PP A TPPTATPP AT P       T P 
Sbjct: 902  KPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVA-TPPTATPPIATSPIATPPVVTPPT 960

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            A +P +TP  A  P+T  +PP  TP    P  +   T  PP
Sbjct: 961  ATSPVATPPIAKPPTT--TPPTATPPVAMPPIATPPTAKPP 999

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 46/92 (50%), Positives = 50/92 (54%), Gaps = 7/92 (7%)
 Frame = +1

Query: 10   KPPTATPAPKAQP---PAAATPPTATPPTATPPAA----ATPPTATPPTATPPAPASSPA 168
            KPP ATP P   P   P  ATPPT TPP ATPP A    A PP ATPP ATPP  A SP 
Sbjct: 1303 KPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPPGARPPVATPPVATPPI-AKSPV 1361

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL 264
             +PP   P    S   TP  A +P A  P ++
Sbjct: 1362 ATPPMTKPPVASSPIATPPIAKTPIATPPTTM 1393

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 52/110 (47%), Positives = 56/110 (50%), Gaps = 13/110 (11%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATPPAA----ATPPTATPPTATPPAP--------- 153
            PPTATP P A PP A  PPT  PPTATPP A    ATPPTA PP ATPP           
Sbjct: 708  PPTATP-PVATPPIAK-PPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPV 765

Query: 154  ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             + P  +PP  TP    S   TP TA +PP  TP    P  +   T  PP
Sbjct: 766  VTPPTATPPIATPPIAKSPVATPPTA-TPPVATPPIAKPPVATPPTTAPP 814

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/106 (44%), Positives = 52/106 (49%), Gaps = 7/106 (6%)
 Frame = +1

Query: 7   TKPPTATPAPKAQP---PAAATPPTATPPTATPPAA----ATPPTATPPTATPPAPASSP 165
           +KPP ATP     P   P    PP ATPP A PP A     TPPTATPP ATPP   S  
Sbjct: 476 SKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPV 535

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           AT P A  P +TP  A  P    +PP  TP +  P  +      PP
Sbjct: 536 ATPPTATPPVATPPIAKPPVV--TPPTTTPPTATPPVAKPPVATPP 579

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 53/107 (49%), Positives = 55/107 (51%), Gaps = 8/107 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAA----ATPPTATPPTATPPAA----ATPPTATPPTATPPAPAS 159
            P KPP ATP P A PP A    ATPPTATPP AT P A    A PP  TPP A PP    
Sbjct: 865  PAKPPVATP-PIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIP 923

Query: 160  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
              AT P A  P +TP TA TP  A SP A  P    P  +     PP
Sbjct: 924  PIATPPVAKPPVATPPTA-TPPIATSPIATPPVVTPPTATSPVATPP 969

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 51/101 (50%), Positives = 53/101 (52%), Gaps = 4/101 (3%)
 Frame = +1

Query: 10   KPPTATPAPKAQPPAA----ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
            KPP ATP P A PP A    A PP ATPP ATPP  A PP ATPPT TPP      A  P
Sbjct: 1283 KPPVATP-PTATPPVATSPIAKPPVATPPPATPP-VAKPPVATPPTVTPPVATPPIAKPP 1340

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             A  P +TP  A TP  A SP A  P +  P  S     PP
Sbjct: 1341 GARPPVATPPVA-TPPIAKSPVATPPMTKPPVASSPIATPP 1380

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 53/111 (47%), Positives = 57/111 (51%), Gaps = 13/111 (11%)
 Frame = +1

Query: 10  KPPTATP----APKAQPPAA----ATPPTATPPTATPPAA----ATPPTATPPTATPPAP 153
           KPP +TP    +P A PPAA     TPP A PP ATPP A    A PP ATPPTATPP  
Sbjct: 587 KPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPI- 645

Query: 154 ASSPATSPPAPT-PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           A+SP   PP  T P  TP  A  P     PP  TP    P  +   T  PP
Sbjct: 646 ATSPVAKPPVATPPIKTPPPAKPP--VAIPPIATPPVAKPPVATPPTATPP 694

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 49/95 (51%), Positives = 50/95 (52%), Gaps = 8/95 (8%)
 Frame = +1

Query: 10   KPPTATPAPKAQPPAA----ATPPTATPPTATPPAA----ATPPTATPPTATPPAPASSP 165
            KPP ATP P A PP A    ATPP  TPPTAT P A    A PPT TPPTATPP      
Sbjct: 932  KPPVATP-PTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPI 990

Query: 166  ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP 270
            AT P A  P +TP  A  P     PP  TP    P
Sbjct: 991  ATPPTAKPPVATPPIANPP--VEKPPVATPPIAKP 1023

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 50/103 (48%), Positives = 52/103 (50%), Gaps = 4/103 (3%)
 Frame = +1

Query: 7    TKPPTATPAPKAQPPAA----ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
            +KPP ATP P A PP      A PP ATPP ATPP  A PP ATPPTATPP   S  A  
Sbjct: 846  SKPPVATP-PAATPPITTPPPAKPPVATPPIATPP-IAKPPVATPPTATPPIATSPVAKP 903

Query: 175  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P A  P  TP  A  P     PP  TP    P  +   T  PP
Sbjct: 904  PVAIPPIKTPPPAKPP--VAIPPIATPPVAKPPVATPPTATPP 944

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 49/106 (46%), Positives = 53/106 (50%), Gaps = 8/106 (7%)
 Frame = +1

Query: 10   KPPTATPAPKAQPPAA----ATPPTATPPTATPPAA----ATPPTATPPTATPPAPASSP 165
            KPP ATP P A+PP A    ATPP   PP ATPP      ATPP ATPP A PP   S  
Sbjct: 1173 KPPVATP-PMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPI 1231

Query: 166  ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             T P A  P +TP  A  P     PP  TP    P  + +   PPP
Sbjct: 1232 ETPPVAKPPVTTPPVATPPIV--KPPIVTPPIATPPIAKSPIAPPP 1275

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/119 (45%), Positives = 60/119 (50%), Gaps = 19/119 (15%)
 Frame = +1

Query: 4   PTKPPTA-----TP--APKAQPPAA----ATPPTATPPTATPPAA----ATPPTATPPTA 138
           P KPP A     TP   P AQPP A    ATPP ATPP ATPP +    +TPP +  P A
Sbjct: 327 PAKPPVAISPIVTPPVTPIAQPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPVA 386

Query: 139 TPPAPASSPATSPPAPTPASTP----STAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           TPP   S   T PPA  P +TP    S   TP TA +PP  TP    P  +   T  PP
Sbjct: 387 TPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTA-TPPVATPPIEKPPVATPPTTTPP 444

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 47/109 (43%), Positives = 53/109 (48%), Gaps = 8/109 (7%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAA----TPPTATPPTATPPAA----ATPPTATPPTATPPAPA 156
           +P   P  + +P A PP A     TPP A PP ATPP A    ATPPTATPP ATPP   
Sbjct: 373 SPISTPPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEK 432

Query: 157 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              AT P    P +TP  A  P    +PP  TP +  P  S      PP
Sbjct: 433 PPVATPPTTTPPTATPPVAKPP--VETPPIATPPTAKPPISTPPISKPP 479

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 46/105 (43%), Positives = 53/105 (50%), Gaps = 7/105 (6%)
 Frame = +1

Query: 7   TKPPTATPA---PKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           T PPTATP    P  + P  ATPPTA PP +TPP +  PP ATPP ATPP    +P   P
Sbjct: 441 TTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISK-PPVATPPAATPPITTPTPVKPP 499

Query: 178 PAPTPASTPSTAP----TPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            A  P + P  A     TP TA  P A  P +  P  +     PP
Sbjct: 500 VATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPP 544

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 50/116 (43%), Positives = 54/116 (46%), Gaps = 19/116 (16%)
 Frame = +1

Query: 13  PPTATPAPKAQP--------PAAATPPTATPPTATPPAA----ATPPTATPPTATPPAPA 156
           PP ATP   A P        P   TPPT TPP A PP A    +TPP ATPP ATPP   
Sbjct: 265 PPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITT 324

Query: 157 SSPATSPPAPTPASTPSTAP-------TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PA  P A +P  TP   P       TP TA +PP  TP    P  S +    PP
Sbjct: 325 LPPAKPPVAISPIVTPPVTPIAQPPVATPPTA-TPPVATPPIATPPTSKSPISTPP 379

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 51/110 (46%), Positives = 55/110 (50%), Gaps = 12/110 (10%)
 Frame = +1

Query: 10   KPPTATPA----PKAQPPAA----ATPPTATPPTATPPAAATPPTATPPTATPPAP---- 153
            KPP ATP     P A+PP      ATPP ATPP A  P  ATPPTATPP ATPP      
Sbjct: 747  KPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSP-VATPPTATPPVATPPIAKPPV 805

Query: 154  ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            A+ P T+PP  TP        TP  A +PP   P  L P  S      PP
Sbjct: 806  ATPPTTAPPTATPPVAKPPVATPPIA-TPPTAKPPILTPPISKPPVATPP 854

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 49/104 (47%), Positives = 55/104 (52%), Gaps = 9/104 (8%)
 Frame = +1

Query: 13   PPTATP----APKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP----ASSPA 168
            PPTATP    +P A+PP A TPP ATPP A PP  ATPPT TPP ATPP      A  P 
Sbjct: 1289 PPTATPPVATSPIAKPPVA-TPPPATPPVAKPP-VATPPTVTPPVATPPIAKPPGARPPV 1346

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP-GPSGADTPP 297
             +PP  TP    S   TP     P A +P +  P   +   TPP
Sbjct: 1347 ATPPVATPPIAKSPVATPPMTKPPVASSPIATPPIAKTPIATPP 1390

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 51/110 (46%), Positives = 54/110 (49%), Gaps = 12/110 (10%)
 Frame = +1

Query: 7    TKPPTATPA----PKAQPPAAA----TPPTATPPTATPPAAATPPTATPPTATPPAPASS 162
            TKPP ATP     P A+PP A     TPP A PP  TPP A TPP   PP  TPP     
Sbjct: 1207 TKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVA-TPPIVKPPIVTPPIATPP 1265

Query: 163  PATSPPAPTPASTPSTA----PTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             A SP AP P  TP  A     TP TA  P A +P +  P      TPPP
Sbjct: 1266 IAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPP----VATPPP 1311

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 49/101 (48%), Positives = 51/101 (50%), Gaps = 4/101 (3%)
 Frame = +1

Query: 10   KPPTATPAPKAQPPAA----ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
            KPP  TP P A PP A    A PP  TPP A PP A TPPTATPP AT P      AT P
Sbjct: 1253 KPPIVTP-PIATPPIAKSPIAPPPIGTPPIAKPPVA-TPPTATPPVATSPIAKPPVATPP 1310

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            PA  P + P  A TP T   P A  P +  PG       PP
Sbjct: 1311 PATPPVAKPPVA-TPPTVTPPVATPPIAKPPGARPPVATPP 1350

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 50/120 (41%), Positives = 58/120 (48%), Gaps = 22/120 (18%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP----------------------PT 120
           T PPT TP P A+PP A TPP +TPP ATPPAA  P                      P 
Sbjct: 288 TTPPTTTP-PIAKPPIA-TPPISTPPAATPPAATPPITTLPPAKPPVAISPIVTPPVTPI 345

Query: 121 ATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           A PP ATPP  A+ P  +PP  TP ++ S   TP  + SP A  P +  P      TPPP
Sbjct: 346 AQPPVATPPT-ATPPVATPPIATPPTSKSPISTPPISESPVATPPTATSP----IKTPPP 400

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 49/102 (48%), Positives = 57/102 (55%), Gaps = 5/102 (4%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAA----ATPPTATPPTATPPAPASSPATSPP 180
           PPTATP P A PP  ATPPT+  P +TPP +    ATPPTAT P  TPP PA  P  +PP
Sbjct: 353 PPTATP-PVATPP-IATPPTSKSPISTPPISESPVATPPTATSPIKTPP-PAKPPVATPP 409

Query: 181 -APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            A +P +TP TA  P    +PP   P    P  +   T  PP
Sbjct: 410 IAKSPIATPPTATPP--VATPPIEKPPVATPPTTTPPTATPP 449

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 50/111 (45%), Positives = 52/111 (46%), Gaps = 12/111 (10%)
 Frame = +1

Query: 7    TKPPTATPAPKAQPPAAATPPTATPPTATPPAA---------ATPPTATPPTATPPAPAS 159
            T PPTATP P A PP A TPPTA PP ATPP A         ATPP A PPT  PP    
Sbjct: 976  TTPPTATP-PVAMPPIA-TPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKP 1033

Query: 160  SPATSPPAPTPASTPSTAPTP---STAGSPPAPTPDSLGPGPSGADTPPPP 303
               TSP A  P +TP  A  P        PP   P    P  +   T  PP
Sbjct: 1034 PVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPP 1084

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 49/107 (45%), Positives = 57/107 (53%), Gaps = 12/107 (11%)
 Frame = +1

Query: 13  PPTATPA----PKAQPPAAATP-------PTATPPTATPPAAATPPTATPPTATPPAPAS 159
           PP ATP     P A+PP A +P       P A PP ATPP A TPP ATPP ATPP   S
Sbjct: 315 PPAATPPITTLPPAKPPVAISPIVTPPVTPIAQPPVATPPTA-TPPVATPPIATPPTSKS 373

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP-GPSGADTPP 297
             +T P + +P +TP TA +P     PPA  P +  P   S   TPP
Sbjct: 374 PISTPPISESPVATPPTATSPIKT-PPPAKPPVATPPIAKSPIATPP 419

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/104 (44%), Positives = 52/104 (50%), Gaps = 4/104 (3%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAA----ATPPTATPPTATPPAPASSPA 168
            +P  PP     P A+PP  ATPPTATPP AT P A    ATPP ATPP A PP  A+ P 
Sbjct: 1269 SPIAPPPIGTPPIAKPP-VATPPTATPPVATSPIAKPPVATPPPATPPVAKPPV-ATPPT 1326

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             +PP  TP         P  A  P A  P +  P  +   T PP
Sbjct: 1327 VTPPVATPPIAKPPGARPPVATPPVATPPIAKSPVATPPMTKPP 1370

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 50/114 (43%), Positives = 53/114 (46%), Gaps = 17/114 (14%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAA----ATPPTATPPTATPPAA---------ATPPTATPPTATPPAP 153
            PP  TP P   PP A    ATPP +TPP A PP A         A PP ATPPTA PP  
Sbjct: 1083 PPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVA 1142

Query: 154  ASSPATSPPAPTPASTPSTAPTPSTA----GSPPAPTPDSLGPGPSGADTPPPP 303
                A SP A  P +TP TA  PS A    G PP  TP    P  +      PP
Sbjct: 1143 NPPIAKSPIAKPPIATPPTA-MPSIATPPIGKPPVATPPMAKPPVASPPIATPP 1195

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 46/103 (44%), Positives = 51/103 (49%), Gaps = 4/103 (3%)
 Frame = +1

Query: 7    TKPPTATPAPKAQPPAAATPPTATPPTA----TPPAAATPPTATPPTATPPAPASSPATS 174
            T PP ATP P  +PP   TPP ATPP A     PP   TPP A PP ATPP      ATS
Sbjct: 1242 TTPPVATP-PIVKPPIV-TPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATS 1299

Query: 175  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P A  P +TP  A  P     PP  TP ++ P  +      PP
Sbjct: 1300 PIAKPPVATPPPATPP--VAKPPVATPPTVTPPVATPPIAKPP 1340

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 47/103 (45%), Positives = 50/103 (48%), Gaps = 7/103 (6%)
 Frame = +1

Query: 10   KPPTATPA---PKAQPPAAATPPTATPPTATPPAAATP----PTATPPTATPPAPASSPA 168
            KPP ATP    P  + P  ATPP A PPT  PP A  P    PTATPPTATPP  A  P 
Sbjct: 997  KPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPV-AIPPV 1055

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
              PP   P  T     TP    +PP   P  + P P    TPP
Sbjct: 1056 VKPPVAIPPITKPPVATPPVT-NPPTAMPPIVTPPP--IVTPP 1095

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 46/111 (41%), Positives = 51/111 (45%), Gaps = 12/111 (10%)
 Frame = +1

Query: 7    TKPPTATPA----PKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
            TKPP ATP     P A PP    PP  TPP A  P A TPP +TPP A PP      AT+
Sbjct: 1066 TKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIA-TPPVSTPPIAKPPIATPPVATT 1124

Query: 175  PPAPTPASTPSTAPTP--------STAGSPPAPTPDSLGPGPSGADTPPPP 303
            P A  P +TP TA  P        S    PP  TP +  P  +      PP
Sbjct: 1125 PIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPP 1175

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 45/103 (43%), Positives = 50/103 (48%), Gaps = 7/103 (6%)
 Frame = +1

Query: 13   PPTATP---APKAQPPAAATPPTATPPTATPPAA----ATPPTATPPTATPPAPASSPAT 171
            PPTA P    P    P  ATPP ATPP  TPP A    ATPP ATPP A PP      AT
Sbjct: 833  PPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTAT 892

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             P A +P + P  A  P     PPA  P ++ P  +     PP
Sbjct: 893  PPIATSPVAKPPVA-IPPIKTPPPAKPPVAIPPIATPPVAKPP 934

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 42/93 (45%), Positives = 47/93 (50%), Gaps = 6/93 (6%)
 Frame = +1

Query: 10  KPPTATPAPKAQ--PPAAATPPTATPPTATP-PAAATPPTATPPTATPPAPASSPATSPP 180
           KPP +TP P     PP+   PPT  PP  TP P  A+PP ATPPT  PP      A SP 
Sbjct: 168 KPPPSTPKPPTTNPPPSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPV 227

Query: 181 APTPASTPSTAPTPST---AGSPPAPTPDSLGP 270
           A  P +TP TA  P T     +PP  TP    P
Sbjct: 228 ATPPIATPPTATPPITIPPVATPPITTPPIANP 260

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/110 (42%), Positives = 54/110 (49%), Gaps = 14/110 (12%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAA--------------ATPPTATPPTATPPA 150
           PP ATP P A+PP + TPP + PP ATPPAA              ATPP A PP A PP 
Sbjct: 458 PPIATP-PTAKPPIS-TPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPV 515

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             + P  +PP  TP    S   TP TA  P A  P +  P  +   T PP
Sbjct: 516 -VTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPP 564

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 50/105 (47%), Positives = 54/105 (51%), Gaps = 9/105 (8%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAA----ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            PPTAT +P A PP A     TPPTATPP A PP  ATPPTA PP ATPP  A+ P   PP
Sbjct: 958  PPTAT-SPVATPPIAKPPTTTPPTATPPVAMPP-IATPPTAKPPVATPPI-ANPPVEKPP 1014

Query: 181  APTP--ASTPSTAP---TPSTAGSPPAPTPDSLGPGPSGADTPPP 300
              TP  A  P+  P    P    SP A  P +  P        PP
Sbjct: 1015 VATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPP 1059

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 46/105 (43%), Positives = 49/105 (46%), Gaps = 8/105 (7%)
 Frame = +1

Query: 13   PPTA----TPAPKAQPPAAATPPTATPPTATPPAA----ATPPTATPPTATPPAPASSPA 168
            PP A     P P   PP  A PP ATPPTATPP A    A PP ATPP ATPP      A
Sbjct: 1264 PPIAKSPIAPPPIGTPP-IAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVA 1322

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            T P    P +TP  A  P     PP  TP    P  + +    PP
Sbjct: 1323 TPPTVTPPVATPPIAKPP--GARPPVATPPVATPPIAKSPVATPP 1365

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 47/105 (44%), Positives = 50/105 (47%), Gaps = 8/105 (7%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAAT----PPTATPPTATPPAAATP----PTATPPTATPPAPASSPA 168
            PP A P P A PP A T    PP ATPPTA PP A  P    P A PP ATPP    S A
Sbjct: 1109 PPIAKP-PIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIA 1167

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            T P    P +TP  A  P    SPP  TP  + P  +      PP
Sbjct: 1168 TPPIGKPPVATPPMAKPP--VASPPIATPPIIKPPVATPPITKPP 1210

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 49/113 (43%), Positives = 54/113 (47%), Gaps = 14/113 (12%)
 Frame = +1

Query: 4   PTK-PPTATP----APKAQPPAAATPPTATPPTATPPAA---------ATPPTATPPTAT 141
           PT+ PP ATP    +P A PP A TPPTATPP   PP A         A PP   PP AT
Sbjct: 211 PTQMPPIATPPIAKSPVATPPIA-TPPTATPPITIPPVATPPITTPPIANPPIIMPPIAT 269

Query: 142 PPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           PP  A+ P T+PP   P  T     TP  A  P A  P S  P  +     PP
Sbjct: 270 PPV-AAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPP 321

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 46/110 (41%), Positives = 51/110 (46%), Gaps = 11/110 (10%)
 Frame = +1

Query: 7   TKPPTATPAPKAQ--PPAAATPPTATPPTATPPAA----ATPPTATPPTATP----PAPA 156
           T PP +TP P     PP   TPP A+PP ATPP      ATPP A  P ATP    P  A
Sbjct: 179 TNPPPSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTA 238

Query: 157 SSPATSPPAPT-PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           + P T PP  T P +TP  A  P     PP  TP    P  +      PP
Sbjct: 239 TPPITIPPVATPPITTPPIANPPII--MPPIATPPVAAPPITNPPISKPP 286

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/109 (44%), Positives = 53/109 (48%), Gaps = 12/109 (11%)
 Frame = +1

Query: 13   PPTATP----APKAQPPAA----ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPA 168
            PPTATP    +P A PP      AT P ATPP A PP   TPPTATPP A PP  A+ P 
Sbjct: 938  PPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPP-TTTPPTATPPVAMPPI-ATPPT 995

Query: 169  TSPPAPTP--ASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPPP 303
              PP  TP  A+ P   P  +T     PP   P    P    + T  PP
Sbjct: 996  AKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPP 1044

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/113 (42%), Positives = 51/113 (45%), Gaps = 17/113 (15%)
 Frame = +1

Query: 10   KPPTATPAPKAQPPAA---------ATPPTATPPTATP----PAAATPPTATPPTATPPA 150
            KPP ATP P A PP A         A PP ATPPTA P    P    PP ATPP A PP 
Sbjct: 1128 KPPIATP-PTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPV 1186

Query: 151  P----ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
                 A+ P   PP  TP  T     TP  A  P A  P +  P     +TPP
Sbjct: 1187 ASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSP----IETPP 1235

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 47/103 (45%), Positives = 51/103 (49%), Gaps = 6/103 (5%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATP----PAAATPPTATPPTATPPAPASSPATSPP 180
           PPTATP P   PP A TPP  TPP A P    P  ATPP A PP   PP  +  P T+PP
Sbjct: 235 PPTATP-PITIPPVA-TPPITTPPIANPPIIMPPIATPPVAAPPITNPPI-SKPPVTTPP 291

Query: 181 APTP--ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             TP  A  P   P  ST   PPA TP +  P  +      PP
Sbjct: 292 TTTPPIAKPPIATPPIST---PPAATPPAATPPITTLPPAKPP 331

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 39/87 (44%), Positives = 43/87 (49%)
 Frame = +1

Query: 10   KPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPT 189
            KPP A P P  +PP A TPP   PPTA PP    PP  TPP A  P      +T P A  
Sbjct: 1057 KPPVAIP-PITKPPVA-TPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKP 1114

Query: 190  PASTPSTAPTPSTAGSPPAPTPDSLGP 270
            P +TP  A TP     PP  TP +  P
Sbjct: 1115 PIATPPVATTP--IAKPPIATPPTANP 1139

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 45/100 (45%), Positives = 48/100 (48%), Gaps = 4/100 (4%)
 Frame = +1

Query: 13   PPTATPA---PKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSP-ATSPP 180
            PPTATP    P    P  A PP   PP ATPP    PPTA PP  TPP   + P A SP 
Sbjct: 1043 PPTATPPVAIPPVVKPPVAIPPITKPPVATPPVT-NPPTAMPPIVTPPPIVTPPIAKSPI 1101

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            A  P STP  A  P  A  P A TP +  P  +     PP
Sbjct: 1102 ATPPVSTPPIA-KPPIATPPVATTPIAKPPIATPPTANPP 1140

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 46/110 (41%), Positives = 50/110 (45%), Gaps = 12/110 (10%)
 Frame = +1

Query: 10   KPPTATP----APKAQPPAA----ATPPTATPPTATPPAA----ATPPTATPPTATPPAP 153
            KPP ATP     P A+PP A    A PP A PP A  P A    ATPPTA P  ATPP  
Sbjct: 1113 KPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIG 1172

Query: 154  ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                AT P A  P ++P  A  P     PP  TP    P  +      PP
Sbjct: 1173 KPPVATPPMAKPPVASPPIATPPII--KPPVATPPITKPPVATPPVATPP 1220

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 37/105 (35%), Positives = 43/105 (40%), Gaps = 9/105 (8%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATP---------PTATPPTATPPAAATPPTATPPTATPPAPASS 162
           KPP   P P  +PP    P         P   PPT  PP    PP+  PP +TP  P ++
Sbjct: 123 KPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPPPK--PPSVKPPPSTPKPPTTN 180

Query: 163 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           P  S P P     P   PTP  A  P A  P  + P      TPP
Sbjct: 181 PPPSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPP----IATPP 221

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 39/112 (34%), Positives = 44/112 (39%), Gaps = 13/112 (11%)
 Frame = +1

Query: 4   PTKP-----PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPA 168
           PTKP     P     P  +PP    PP   P    PP+   PPT  PP +TP  P   P 
Sbjct: 136 PTKPHPHPKPPTKHHPHPKPP-TIKPPPKPPSVKPPPSTPKPPTTNPPPSTPQPPTHKPP 194

Query: 169 TSPPAPTPASTPSTAP--------TPSTAGSPPAPTPDSLGPGPSGADTPPP 300
              P P  AS P   P        TP  A SP A  P +  P  +   T PP
Sbjct: 195 PCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPP 246

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 35/100 (35%), Positives = 39/100 (39%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P KPP  +  P  +PPA    P   PPT  PP     P   PPT  P      P    P 
Sbjct: 36  PHKPPKHSVVP-PKPPAVKPHPHPKPPTIKPPPPKRHPHPKPPTVKPHPHPKPPTKPHPH 94

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P + P   P P T   PP P P    P P   +  P P
Sbjct: 95  PKPPTKPHPHPKPPTIKPPPHPKP---RPHPKPPNVKPHP 131

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 34/99 (34%), Positives = 38/99 (38%), Gaps = 1/99 (1%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPT 189
           KPPT  P P  +P     PP   P     P     P   PPT   P P       PP P 
Sbjct: 106 KPPTIKPPPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPPPKPP 165

Query: 190 PASTPSTAPTPSTAGSPPA-PTPDSLGPGPSGADTPPPP 303
               P + P P T   PP+ P P +  P P    TP PP
Sbjct: 166 SVKPPPSTPKPPTTNPPPSTPQPPTHKPPPC---TPTPP 201

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 39/108 (36%), Positives = 42/108 (38%), Gaps = 10/108 (9%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATP---------PTATPPTATPPAAATPPTATPPTATPPAPASS 162
           KPPT  P P  +PP    P         P   PPT  PP    P     P    P P   
Sbjct: 75  KPPTVKPHPHPKPPTKPHPHPKPPTKPHPHPKPPTIKPPPHPKPRPHPKPPNVKPHPHPK 134

Query: 163 PATSP-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P T P P P P +     P P T    P P P S+ P PS   TP PP
Sbjct: 135 PPTKPHPHPKPPTKHHPHPKPPTI--KPPPKPPSVKPPPS---TPKPP 177

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 36/104 (34%), Positives = 41/104 (39%), Gaps = 7/104 (6%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATP----PTATPPTATPP--APASSPATS 174
           PP   P P  +PP     P   PPT   P    P    P   PPT  PP   P+  P  S
Sbjct: 113 PPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPPPKPPSVKPPPS 172

Query: 175 PPAPTPASTPSTAPTPSTAGSPP-APTPDSLGPGPSGADTPPPP 303
            P P   + P + P P T   PP  PTP    P  +   T  PP
Sbjct: 173 TPKPPTTNPPPSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPP 216

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 38/126 (30%), Positives = 41/126 (32%), Gaps = 26/126 (20%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPT--------ATPPAPAS 159
           P KPP   P P  +PP    PP    P   PP     P   PPT         T P P  
Sbjct: 46  PPKPPAVKPHPHPKPPTIKPPPPKRHPHPKPPTVKPHPHPKPPTKPHPHPKPPTKPHPHP 105

Query: 160 SPATSPPAPTPASTPSTA---------PTPSTAGSP---------PAPTPDSLGPGPSGA 285
            P T  P P P   P            P P T   P         P P P ++ P P   
Sbjct: 106 KPPTIKPPPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPPPKPP 165

Query: 286 DTPPPP 303
              PPP
Sbjct: 166 SVKPPP 171

[32][TOP]
>UniRef100_UPI0001925A99 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra
           magnipapillata RepID=UPI0001925A99
          Length = 373

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 55/106 (51%), Positives = 60/106 (56%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAA---ATPPTATPPTATPPAPASSP-AT 171
           P   P A P+P A PPA   PPT TPP A+PPAA   A PP A P  A PP  A SP A 
Sbjct: 127 PATLPPAAPSPAAPPPAP--PPTVTPPAASPPAAPSPAAPPPAAPSPAAPPLAAPSPTAP 184

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG--PSGADTPPPP 303
           SP AP PA+ PS A  PS A SP AP+P +  P   P  A  P PP
Sbjct: 185 SPAAPLPAA-PSPAAPPSAAPSPAAPSPAAPPPAAPPPAAPKPTPP 229

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 52/105 (49%), Positives = 59/105 (56%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA---PASSPATS 174
           P  PP A P   A PP A  PP A  P A PPA   PPT TPP A+PPA   PA+ P   
Sbjct: 111 PAIPPPAAPCSLAAPPPATLPPAAPSPAAPPPAP--PPTVTPPAASPPAAPSPAAPP--- 165

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG--PSGADTPPPP 303
           P AP+PA+ P  AP+P TA SP AP P +  P   PS A +P  P
Sbjct: 166 PAAPSPAAPPLAAPSP-TAPSPAAPLPAAPSPAAPPSAAPSPAAP 209

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 50/116 (43%), Positives = 56/116 (48%), Gaps = 16/116 (13%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATP------------PTATPPAAATPPTATPPTATPP 147
           P   P ATP P A PP AA PP   P            P   PPAA TPPTA P  A PP
Sbjct: 29  PAASPLATPPPAAPPPPAAPPPVTLPSPLVLSLPVVPPPAKPPPAALTPPTAPPSPAAPP 88

Query: 148 APASSPATSPP---APTPASTPSTAPTPSTAGSPPAPTPDSLGP-GPSGADTPPPP 303
           +PA  P+ + P    P PA+ P   P P+   S  AP P +L P  PS A  PP P
Sbjct: 89  SPAVPPSPAAPPLIEPPPATLPPAIPPPAAPCSLAAPPPATLPPAAPSPAAPPPAP 144

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 50/111 (45%), Positives = 56/111 (50%), Gaps = 10/111 (9%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATP---------PTATPPTATPPAAATPPTATPPT-ATPPA 150
           +P  P  A P P A PPAA  P         P A PP  TPP AA P  A PPT A PP 
Sbjct: 205 SPAAPSPAAPPPAAPPPAAPKPTPPSPVALIPPAAPPPVTPPPAAPPSPAVPPTPAAPPT 264

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PA+ P  + P PTPA+ P+ A  P  A  PPA  P +  P P  A  PP P
Sbjct: 265 PAAPPTPAAP-PTPAAPPTPAAPPPPAKPPPAKPPPATPPIPPAA--PPSP 312

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 51/119 (42%), Positives = 59/119 (49%), Gaps = 18/119 (15%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAA--------ATPPTATPPTATPPAAATPPTATPPTATPPAPA 156
           +P  PP A P+P A  PAA        A PP+A P  A P  AA PP A PP A  P P 
Sbjct: 170 SPAAPPLAAPSPTAPSPAAPLPAAPSPAAPPSAAPSPAAPSPAAPPPAAPPPAAPKPTPP 229

Query: 157 SSPATSPPA------PTPASTPSTA--PTPSTAGSPPAPTPDSLGPGPSGADTP--PPP 303
           S  A  PPA      P PA+ PS A  PTP+   +P AP   +  P P+   TP  PPP
Sbjct: 230 SPVALIPPAAPPPVTPPPAAPPSPAVPPTPAAPPTPAAPPTPAAPPTPAAPPTPAAPPP 288

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 52/108 (48%), Positives = 59/108 (54%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA---ATPPTATPPTATPPAAATPPTATPPTATPPA---PASSP 165
           P  PPT TP P A PPAA   A PP A P  A PP AA  PTA  P A  PA   PA+ P
Sbjct: 142 PAPPPTVTP-PAASPPAAPSPAAPPPAAPSPAAPPLAAPSPTAPSPAAPLPAAPSPAAPP 200

Query: 166 --ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             A SP AP+PA+ P  AP P+ A  P  P+P +L P  +     PPP
Sbjct: 201 SAAPSPAAPSPAAPPPAAPPPA-APKPTPPSPVALIPPAAPPPVTPPP 247

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/122 (40%), Positives = 58/122 (47%), Gaps = 21/122 (17%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATP----PTATPPTATPPAA--------------ATPPTAT 126
           +P  P  A P+P A P AA +P    P A PP A PPAA              A PP  T
Sbjct: 185 SPAAPLPAAPSPAAPPSAAPSPAAPSPAAPPPAAPPPAAPKPTPPSPVALIPPAAPPPVT 244

Query: 127 PPTATPPAPASSPA-TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPP 297
           PP A PP+PA  P   +PP P    TP+  PTP+   +P AP P +  P   P  A  P 
Sbjct: 245 PPPAAPPSPAVPPTPAAPPTPAAPPTPAAPPTPAAPPTPAAPPPPAKPPPAKPPPATPPI 304

Query: 298 PP 303
           PP
Sbjct: 305 PP 306

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 49/112 (43%), Positives = 56/112 (50%), Gaps = 12/112 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPT-ATPPTATPPAPASSPATSPP 180
           P  PP A P     PPAA TPPTA P  A PP+ A PP+ A PP   PP     PA  PP
Sbjct: 62  PVVPPPAKP-----PPAALTPPTAPPSPAAPPSPAVPPSPAAPPLIEPPPATLPPAIPPP 116

Query: 181 -------APTPASTPSTAPTPSTAGSPPAP----TPDSLGPGPSGADTPPPP 303
                  AP PA+ P  AP+P  A  PPAP    TP +  P  + +   PPP
Sbjct: 117 AAPCSLAAPPPATLPPAAPSP--AAPPPAPPPTVTPPAASPPAAPSPAAPPP 166

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 50/112 (44%), Positives = 56/112 (50%), Gaps = 12/112 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA---ATPPTATP-PTATPPAA---ATPPTATPPTATPPAPASS 162
           P   P A P+P A PPAA   A PP A P PTA  PAA   A P  A PP+A P   A S
Sbjct: 151 PAASPPAAPSPAAPPPAAPSPAAPPLAAPSPTAPSPAAPLPAAPSPAAPPSAAPSPAAPS 210

Query: 163 PATSPP-APTPASTPSTAPTP----STAGSPPAPTPDSLGPGPSGADTPPPP 303
           PA  PP AP PA+   T P+P      A  PP   P +  P P+   TP  P
Sbjct: 211 PAAPPPAAPPPAAPKPTPPSPVALIPPAAPPPVTPPPAAPPSPAVPPTPAAP 262

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 49/102 (48%), Positives = 53/102 (51%), Gaps = 4/102 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPT-ATPPT-ATPPAAATPPT-ATPPT-ATPPAPASSPAT 171
           P  PP  TP P A PP+ A PPT A PPT A PP  A PPT A PPT A PP PA  P  
Sbjct: 237 PAAPPPVTP-PPAAPPSPAVPPTPAAPPTPAAPPTPAAPPTPAAPPTPAAPPPPAKPPPA 295

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
            PP  TP   P+  P+P    +PP  TP    P      TPP
Sbjct: 296 KPPPATPPIPPAAPPSPV---APPLETPFPAIPPRLPEATPP 334

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/91 (45%), Positives = 45/91 (49%), Gaps = 2/91 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPT-ATPPT-ATPPAPASSPATSP 177
           PT P      P A PP    PP A P  A PP  A PPT A PPT A PP PA+ P  + 
Sbjct: 226 PTPPSPVALIPPAAPPPVTPPPAAPPSPAVPPTPAAPPTPAAPPTPAAPPTPAAPPTPAA 285

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGP 270
           P P PA  P   P P+T   PPA  P  + P
Sbjct: 286 P-PPPAKPPPAKPPPATPPIPPAAPPSPVAP 315

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 47/116 (40%), Positives = 58/116 (50%), Gaps = 15/116 (12%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAA---ATPPTATP------PTATPPA- 150
           +P  PP A P+P A PP AA  PTA  P A  PAA   A PP+A P      P A PPA 
Sbjct: 160 SPAAPPPAAPSPAA-PPLAAPSPTAPSPAAPLPAAPSPAAPPSAAPSPAAPSPAAPPPAA 218

Query: 151 -PASSPATSPPAPT----PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P ++P  +PP+P     PA+ P   P P+   SP  P   +  P P+   TP  P
Sbjct: 219 PPPAAPKPTPPSPVALIPPAAPPPVTPPPAAPPSPAVPPTPAAPPTPAAPPTPAAP 274

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 41/97 (42%), Positives = 48/97 (49%), Gaps = 5/97 (5%)
 Frame = +1

Query: 4   PTKPPT-ATPAPKAQPPAAATPPT--ATPPTATPPAAATPPTATP-PTATPPAPASSPAT 171
           P  PPT A P   A PP  A PPT  A PP A PP A  PP   P P A PP+P + P  
Sbjct: 259 PAAPPTPAAPPTPAAPPTPAAPPTPAAPPPPAKPPPAKPPPATPPIPPAAPPSPVAPPLE 318

Query: 172 SP-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 279
           +P PA  P    +T P    A   PAP P+ +   P+
Sbjct: 319 TPFPAIPPRLPEATPPLMPLASPVPAPIPEPIAIIPA 355

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 45/117 (38%), Positives = 51/117 (43%), Gaps = 22/117 (18%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP--ASSPATSPPA-- 183
           P A P P   P + A    A  P ATPP AA PP A PP  T P+P   S P   PPA  
Sbjct: 11  PPAAPPPATLPSSVAPSLPAASPLATPPPAAPPPPAAPPPVTLPSPLVLSLPVVPPPAKP 70

Query: 184 -----------PTPASTPSTAPTPSTAG-----SPPAPTPDSLGP--GPSGADTPPP 300
                      P+PA+ PS A  PS A       PPA  P ++ P   P     PPP
Sbjct: 71  PPAALTPPTAPPSPAAPPSPAVPPSPAAPPLIEPPPATLPPAIPPPAAPCSLAAPPP 127

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 39/100 (39%), Positives = 45/100 (45%), Gaps = 10/100 (10%)
 Frame = +1

Query: 34  PKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS---------PPAP 186
           P A  P AA PP   P +  P   A  P ATPP A PP PA+ P  +         P  P
Sbjct: 6   PLAILPPAAPPPATLPSSVAPSLPAASPLATPPPAAPPPPAAPPPVTLPSPLVLSLPVVP 65

Query: 187 TPASTPSTAPTPSTA-GSPPAPTPDSLGPGPSGADTPPPP 303
            PA  P  A TP TA  SP AP   ++ P P+      PP
Sbjct: 66  PPAKPPPAALTPPTAPPSPAAPPSPAVPPSPAAPPLIEPP 105

[33][TOP]
>UniRef100_Q8B9G6 Putative uncharacterized protein n=1 Tax=Rachiplusia ou MNPV
           RepID=Q8B9G6_NPVRO
          Length = 237

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 46/100 (46%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           PT PPT TP+P   PP+   PPT  PPT TP     PPT  PPT TP  P   P   PP 
Sbjct: 51  PTPPPTPTPSP---PPSPTPPPTPIPPTPTP---TPPPTPIPPTPTPTPP---PTPIPPT 101

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PTP   PS  P   T   PP+P P +  P P  +  PP P
Sbjct: 102 PTPTPPPSPIPPTPTPSPPPSPIPPTPTPSPPPSPIPPTP 141

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 45/106 (42%), Positives = 51/106 (48%), Gaps = 10/106 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATP----PTATPPAAATPPTAT---PPTATPPAPASS 162
           P+ PP+ TP P   PP     P  TP    PT TPP    PPT T   PP+  PP P  S
Sbjct: 59  PSPPPSPTPPPTPIPPTPTPTPPPTPIPPTPTPTPPPTPIPPTPTPTPPPSPIPPTPTPS 118

Query: 163 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG---PSGADT 291
           P  SP  PTP  +P  +P P T    P P+P  LG     PS  DT
Sbjct: 119 PPPSPIPPTPTPSPPPSPIPPTPTPSPPPSPSPLGEPMYYPSNIDT 164

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 41/103 (39%), Positives = 49/103 (47%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTAT---PPTATPPAPASSPATS 174
           P  PP  +P     P    TP  + PP+ TPP    PPT T   PPT  PP P  +P  +
Sbjct: 37  PIVPPPTSPPIVPLPTPPPTPTPSPPPSPTPPPTPIPPTPTPTPPPTPIPPTPTPTPPPT 96

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P  PTP  TP  +P P T    P P+P    P PS   +P PP
Sbjct: 97  PIPPTPTPTPPPSPIPPTPTPSPPPSPIPPTPTPSPPPSPIPP 139

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 43/94 (45%), Positives = 47/94 (50%), Gaps = 14/94 (14%)
 Frame = +1

Query: 1   APTKPPTATP-APKAQPPAAATPPTATP----------PTATPPAAATPPTATP---PTA 138
           +PT PPT  P  P   PP    PPT TP          PT TPP +  PPT TP   P+ 
Sbjct: 64  SPTPPPTPIPPTPTPTPPPTPIPPTPTPTPPPTPIPPTPTPTPPPSPIPPTPTPSPPPSP 123

Query: 139 TPPAPASSPATSPPAPTPASTPSTAPTPSTAGSP 240
            PP P  SP  SP  PTP  TPS  P+PS  G P
Sbjct: 124 IPPTPTPSPPPSPIPPTP--TPSPPPSPSPLGEP 155

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 35/93 (37%), Positives = 42/93 (45%), Gaps = 1/93 (1%)
 Frame = +1

Query: 28  PAPKAQPPAAATPPTATPPTATPPAAATPPTAT-PPTATPPAPASSPATSPPAPTPASTP 204
           P P   PP  + P    P     P  + PP+ T PPT  PP P  +P  +P  PTP  TP
Sbjct: 34  PNPPIVPPPTSPPIVPLPTPPPTPTPSPPPSPTPPPTPIPPTPTPTPPPTPIPPTPTPTP 93

Query: 205 STAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P P T    P P+P    P PS   +P PP
Sbjct: 94  PPTPIPPTPTPTPPPSPIPPTPTPSPPPSPIPP 126

[34][TOP]
>UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S9_EHV86
          Length = 621

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 40/100 (40%), Positives = 55/100 (55%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP  +PP +  PP+  PP+  PP+P   P+  PP+
Sbjct: 346 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSP-PPPSPPPPS 404

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P  +  PP+P P S  P P    +PPPP
Sbjct: 405 PPPPSPPPPSPPPPPSPPPPSPPPPS--PPPPSPPSPPPP 442

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 38/100 (38%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P+P   PP  + PP + PP + PP +  PP+  PP+  PP+P   P+  PP+
Sbjct: 366 PPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPS 425

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P      SPP P+P    P P     P PP
Sbjct: 426 PPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 465

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 39/100 (39%), Positives = 53/100 (53%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP  + PP+  PP+  PP+P   P+  PP+
Sbjct: 285 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPP-PSPPPPS 343

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P +   P  P P    P PS   +PPPP
Sbjct: 344 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPP 383

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 41/102 (40%), Positives = 53/102 (51%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA--PASSPATSP 177
           P  PP  +P P + PP +  PP  +PP + PP +  PP+  PP+  PP+  P S P  SP
Sbjct: 351 PPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 410

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P+P   PS  P      SPP P+P S  P      +PPPP
Sbjct: 411 PPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPP 452

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 40/100 (40%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP +  PP+  PP+  PP+P S P  SPP 
Sbjct: 387 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPP 446

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   PS  P      SPP P+P    P P     P PP
Sbjct: 447 PSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 485

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 39/104 (37%), Positives = 53/104 (50%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP----ASSPAT 171
           P  PP  +P P + PP +  PP  +PP + PP +  PP+  PP+  PP+P       P+ 
Sbjct: 295 PPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 354

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP+P P S P  +P P     PP+P P S  P      +PPPP
Sbjct: 355 PPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPP 398

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 39/104 (37%), Positives = 54/104 (51%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS----PAT 171
           P  PP  +P P + PP   +PP + PP + PP +  PP+  PP+  PP+P       P+ 
Sbjct: 300 PPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 359

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP+P P S P   P+P  +  PP+P P S  P      +PPPP
Sbjct: 360 PPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPP 403

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 38/100 (38%), Positives = 52/100 (52%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP + PP + PP +  PP+  PP+  PP P+  P+  PP+
Sbjct: 327 PSPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPS 384

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P +   P  P P    P P    +PPPP
Sbjct: 385 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPP 424

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 40/102 (39%), Positives = 50/102 (49%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA--PASSPATSP 177
           P  PP   P+P   PP  + PP + PP + PP +  PP+  PP+  PP+  P S P  SP
Sbjct: 310 PPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 369

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P P+  PS  P      SPP P+P    P P     P PP
Sbjct: 370 PPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 411

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 38/100 (38%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP + PP + PP +  PP+  PP+  PP+P   P + PP+
Sbjct: 322 PSPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPS 379

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P +   P  P P    P P     PPPP
Sbjct: 380 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 419

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 41/105 (39%), Positives = 54/105 (51%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA--SSPATSP 177
           P  PP  +P P + PP   +PP + PP + PP +  PP+  PP+  PP+P   S P  SP
Sbjct: 356 PPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 415

Query: 178 P---APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P   +P P S P  +P P +  SPP P+P    P P     P PP
Sbjct: 416 PPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPP 460

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 40/100 (40%), Positives = 52/100 (52%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP+   PP+  PP+  PP+P   P  SPP+
Sbjct: 382 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSP---PPPSPPS 438

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 439 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 475

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 38/100 (38%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+  +PP  +PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 419 PSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 478

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 479 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 515

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 39/101 (38%), Positives = 53/101 (52%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA-SSPATSPP 180
           P+ PP + P P   PP +  PP+  PP+  PP+  +PP  +PP  +PP P+   P+  PP
Sbjct: 403 PSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPP 462

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 463 SPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 500

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 38/101 (37%), Positives = 53/101 (52%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  P    P+P   PP  + PP + PP + PP +  PP+  PP+  PP+P   P+  PP
Sbjct: 248 SPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPP 306

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P S P   P+P  +  PP+P P S  P      +PPPP
Sbjct: 307 SPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPP 347

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 39/100 (39%), Positives = 52/100 (52%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP + PP + PP +  PP+  PP+  PP+P   P + PP+
Sbjct: 266 PSPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPS 323

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 324 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 360

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 39/100 (39%), Positives = 52/100 (52%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP + PP + PP +  PP+  PP+  PP P+  P+  PP+
Sbjct: 271 PSPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPS 328

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 329 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 365

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 38/101 (37%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTA-TPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P+ PP + P P   PP+   PP   +PP  +PP  + PP + PP + PP     P+  PP
Sbjct: 242 PSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 301

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P S P  +P P     PP+P P S  P      +PPPP
Sbjct: 302 SPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPP 342

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 39/100 (39%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP  +PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 172 PSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 228

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     PPPP
Sbjct: 229 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPPPP 265

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 39/102 (38%), Positives = 52/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPA--AATPPTATPPTATPPAPASSPATSP 177
           P  PP  +P P + PP +  PP+  PP+  PP+    +PP  +PP  +PP P+  P + P
Sbjct: 201 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 260

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 261 PPPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 299

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 39/100 (39%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP+   PP  +PP  +PP P+  P   PP+
Sbjct: 211 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPSPPPPPPPPS 267

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 268 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 304

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 39/100 (39%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP+   PP  +PP  +PP P   P+  PP+
Sbjct: 216 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPPPPPSPPPPS 272

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 273 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 309

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 39/100 (39%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP + PP +  PP+  PP+   P P S P  SPP 
Sbjct: 392 PPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPP 451

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   PS  P      SPP P+P    P P     P PP
Sbjct: 452 PSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 490

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 39/100 (39%), Positives = 52/100 (52%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP  +PP  +PP    PP+  PP+  PP+P   P+  PP+
Sbjct: 232 PSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPPPPPSPPPPSPPPPSP-PPPSPPPPS 287

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P +   P  P P    P PS   +PPPP
Sbjct: 288 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPP 327

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 40/100 (40%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP   +PP  +PP    P P S P  SPP 
Sbjct: 377 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSPPPPPSPPPPSPPPPSPPP 433

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P S P  +P P    SPP P+P    P P     P PP
Sbjct: 434 PSPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 470

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 39/103 (37%), Positives = 49/103 (47%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA--PASSPATS 174
           +P  P    P P   PP  + PP + PP + PP +  PP+  PP+  PP+  P S P  S
Sbjct: 253 SPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 312

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP P P+  PS  P      SPP P+P    P P     P PP
Sbjct: 313 PPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 355

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 37/100 (37%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP  + PP + PP + PP +  PP+  PP  +PP     P+  PP+
Sbjct: 276 PSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPS 333

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P +   P  P P    P P     PPPP
Sbjct: 334 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 373

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 39/103 (37%), Positives = 51/103 (49%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS---PATS 174
           P+ PP + P P   PP+   PP + PP + PP +  PP+  PP+  PP P  S   P+  
Sbjct: 217 PSPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPP 274

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP+P P S P  +P P +   P  P P    P P     PPPP
Sbjct: 275 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 317

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 37/100 (37%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P+P    P   +PP  +PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 429 PSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 488

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P      PPP
Sbjct: 489 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPSPPP 525

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 37/100 (37%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P    P   +PP  +PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 424 PSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 483

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 484 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 520

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 38/102 (37%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP- 180
           P  PP  +P P + PP +  PP+  PP+  PP   +PP  +PP  +PP P+  P + PP 
Sbjct: 186 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPP 242

Query: 181 -APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P P+  P + P PS    PP P+P    P P     P PP
Sbjct: 243 SPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPP 284

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 38/102 (37%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP- 180
           P  PP  +P P + PP +  PP+  PP+  PP   +PP  +PP  +PP P+  P + PP 
Sbjct: 191 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPP 247

Query: 181 -APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P P+  P + P P    SPP P+P    P P     P PP
Sbjct: 248 SPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 289

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 38/101 (37%), Positives = 52/101 (51%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA-SSPATSPP 180
           P+ PP + P P + PP +  PP+  PP+   P   +PP  +PP  +PP P+   P+  PP
Sbjct: 408 PSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 467

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 468 SPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 505

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 40/100 (40%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           PT PP + P P   PP+   PP  +PP  +PP  + PP + PP  +PP P   P+  PP+
Sbjct: 113 PTTPPPSPP-PSQPPPS---PPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPS 168

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 169 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 205

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 37/101 (36%), Positives = 49/101 (48%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP+  P P    P   +PP  +PP  +PP  + PP + PP + PP     P+  PP
Sbjct: 148 SPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 207

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 208 SPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 245

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 40/100 (40%), Positives = 52/100 (52%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP  +PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 177 PSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 233

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P PS    PPPP
Sbjct: 234 PPPPSPPPPSPPPP---SPPPPSP----PPPSPPPPPPPP 266

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 39/100 (39%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP  +PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 182 PSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 238

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P PS     PPP
Sbjct: 239 PPPPSPPPPSPPPP---SPPPPSPPPPPPPPSPPPPSPPP 275

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 39/100 (39%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP  +PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 197 PSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 253

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P   P PS    PP+P P S  P      +PPPP
Sbjct: 254 PPPPSPPPPPPPPSP--PPPSPPPPSPPPPSPPPPSPPPP 291

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 38/101 (37%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA-SSPATSPP 180
           P+ PP + P P   PP+   PP+  PP+  PP+   P   +PP  +PP P+   P+  PP
Sbjct: 398 PSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPP 457

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 458 SPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 495

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 38/100 (38%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P++PP + P P   PP+   PP  +PP  +PP   +PP   PP + PP     P+  PP+
Sbjct: 122 PSQPPPSPPPPSPPPPS---PPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPS 178

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 179 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 215

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 39/102 (38%), Positives = 52/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA--PASSPATSP 177
           P+ PP + P P   PP+   PP + PP + PP +  PP+  PP+  PP+  P S P  SP
Sbjct: 202 PSPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 259

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P P  +P     P  +  PP+P P S  P      +PPPP
Sbjct: 260 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 301

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 39/102 (38%), Positives = 54/102 (52%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPT--ATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           P+ PP  +P P + PP +  PP+  + PP + PP +  PP+  PP+  PP+P   P+  P
Sbjct: 413 PSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPP 471

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 472 PSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 510

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 38/100 (38%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P + PP    PP  +PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 142 PSPPPPSPPPPPSPPPP---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 198

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 199 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 235

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 38/100 (38%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP  +P P   PP+   PP  +PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 147 PSPPPPPSPPPPPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 203

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 204 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 240

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 38/101 (37%), Positives = 50/101 (49%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP     P   PP  + PP + PP + PP +  PP+  PP+  PP+P   P+  PP
Sbjct: 154 SPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPP 212

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 213 SPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 250

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP + PP    PP + PP + PP     P+  PP+
Sbjct: 126 PPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPP--PPPPPSPPPPSPPPPSPPPPSPPPPS 183

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 184 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 220

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP+  PP   PP  + PP + PP + PP     P+  PP+
Sbjct: 132 PSPPPPSPPPPSPPPPSPPPPPSPPPP---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 188

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 189 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 225

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP +  PP   PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 137 PSPPPPSPPPPSPPPPPSPPPP---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 193

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     P PP
Sbjct: 194 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 230

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 37/100 (37%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP   PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 241 PPSPPPPSPPPPSPPPPSPPPP---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 297

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P +   PP   P S  P      +PPPP
Sbjct: 298 PPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPP 337

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 52/100 (52%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP  +P P + PP +  PP+  PP+  PP+   PP + PP + PP     P+  PP
Sbjct: 435 SPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPP 492

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           +P P S P  +P P    SPP P+P    P PS   + PP
Sbjct: 493 SPPPPSPPPPSPPPP---SPPPPSPPPPSPPPSPPPSHPP 529

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 38/99 (38%), Positives = 51/99 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP  +PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 442 PSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 498

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P P S P  +P P    SPP P+P    P PS   + PP
Sbjct: 499 PPPPSPPPPSPPPP---SPPPPSPPP-SPPPSHPPSHPP 533

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 32/88 (36%), Positives = 44/88 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP   +PP  +PP  +PP P+  P + PP+
Sbjct: 466 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPS 522

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLG 267
           P P+  PS  P       P  P   S G
Sbjct: 523 PPPSHPPSHPPMHPPMHPPFLPPTTSTG 550

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 31/84 (36%), Positives = 43/84 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP+   PP  +PP  +PP P+  P + PP 
Sbjct: 456 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPP 512

Query: 184 PTPASTPSTAPTPSTAGSPPAPTP 255
             P  +P  +P PS   S P   P
Sbjct: 513 SPPPPSPPPSPPPSHPPSHPPMHP 536

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 30/84 (35%), Positives = 41/84 (48%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP  +PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 457 PSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 513

Query: 184 PTPASTPSTAPTPSTAGSPPAPTP 255
           P P S P + P       PP   P
Sbjct: 514 PPPPSPPPSPPPSHPPSHPPMHPP 537

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 29/82 (35%), Positives = 41/82 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP  +PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 462 PSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 518

Query: 184 PTPASTPSTAPTPSTAGSPPAP 249
           P P+  PS  P+      P  P
Sbjct: 519 PPPSPPPSHPPSHPPMHPPMHP 540

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 32/88 (36%), Positives = 43/88 (48%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP + PP + PP +  PP+  PP+  P  P S P + PP 
Sbjct: 477 PSPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSHPPSHPPM 534

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLG 267
             P   P   PT ST  +    T  S+G
Sbjct: 535 HPPMHPPFLPPTTSTGLNKTQITFISIG 562

[35][TOP]
>UniRef100_C5BID0 Putative uncharacterized protein n=1 Tax=Teredinibacter turnerae
           T7901 RepID=C5BID0_TERTT
          Length = 890

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 46/105 (43%), Positives = 66/105 (62%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP---PAPASSPAT 171
           +PT  P+ TP+P   P  + TP  +  P+ TPP + TP  +  P+ +P   P+P  SP+ 
Sbjct: 140 SPTPSPSPTPSPSPTPSLSPTPSLSPTPSPTPPPSPTPSPSPTPSMSPTPSPSPTPSPSP 199

Query: 172 SP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPP 300
           +P P+PTP+ TPS +PTPS + +P P+PTP S  P PS + TPPP
Sbjct: 200 TPSPSPTPSPTPSPSPTPSPSPTPSPSPTP-SPSPTPSPSPTPPP 243

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 46/113 (40%), Positives = 63/113 (55%), Gaps = 13/113 (11%)
 Frame = +1

Query: 1   APTKPPTATPA--PKAQPPAAATPPTATPPTATPPAAATP-PTATPPTATPPAPASSPAT 171
           AP+ PP ATP+  P  +P  A  P     P+  P A+ TP P+ TP  +  P+P+ +P+ 
Sbjct: 99  APSNPP-ATPSTGPSLEPTLAPQPSMEPMPSLAPSASPTPSPSPTPSPSPTPSPSPTPSL 157

Query: 172 SP---------PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPP 300
           SP         P P P+ TPS +PTPS + +P P+PTP S  P PS + TP P
Sbjct: 158 SPTPSLSPTPSPTPPPSPTPSPSPTPSMSPTPSPSPTP-SPSPTPSPSPTPSP 209

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 38/103 (36%), Positives = 62/103 (60%), Gaps = 4/103 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP---PTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           P+  P+A+P P   P  + +P   P+ TP  +  P+ +  P+ TPP +  P+P+ +P+ S
Sbjct: 127 PSLAPSASPTPSPSPTPSPSPTPSPSPTPSLSPTPSLSPTPSPTPPPSPTPSPSPTPSMS 186

Query: 175 PPAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPP 300
           P   TP+ +P+ +P+P+ + SP P+PTP S  P PS + TP P
Sbjct: 187 P---TPSPSPTPSPSPTPSPSPTPSPTP-SPSPTPSPSPTPSP 225

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 36/90 (40%), Positives = 51/90 (56%), Gaps = 1/90 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASSPATSP 177
           +PT PP+ TP+P   P  + TP     P+ TP  + TP  +  P+ TP P+P  SP+   
Sbjct: 168 SPTPPPSPTPSPSPTPSMSPTP----SPSPTPSPSPTPSPSPTPSPTPSPSPTPSPS--- 220

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLG 267
           P P+P+ TPS +PTPS + +PP    D  G
Sbjct: 221 PTPSPSPTPSPSPTPSPSPTPPPIPGDDAG 250

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 39/101 (38%), Positives = 54/101 (53%), Gaps = 10/101 (9%)
 Frame = +1

Query: 28  PAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP---PAPTP-- 192
           PAP   P   +T P+  P  A  P+    P+  P  +  P+P+ +P+ SP   P+PTP  
Sbjct: 98  PAPSNPPATPSTGPSLEPTLAPQPSMEPMPSLAPSASPTPSPSPTPSPSPTPSPSPTPSL 157

Query: 193 ASTPSTAPTPSTAGSPPAPTPD-----SLGPGPSGADTPPP 300
           + TPS +PTPS    PP+PTP      S+ P PS + TP P
Sbjct: 158 SPTPSLSPTPSPT-PPPSPTPSPSPTPSMSPTPSPSPTPSP 197

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 40/102 (39%), Positives = 51/102 (50%), Gaps = 3/102 (2%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAP 186
           T   T TP   A P     P  + PP       +  PT  P  +  P P+ +P+ SP  P
Sbjct: 79  TLATTPTPVVSAVPTLFPLPAPSNPPATPSTGPSLEPTLAPQPSMEPMPSLAPSASP-TP 137

Query: 187 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP---PPP 303
           +P+ TPS +PTPS     P+PTP SL P PS + TP   PPP
Sbjct: 138 SPSPTPSPSPTPS-----PSPTP-SLSPTPSLSPTPSPTPPP 173

[36][TOP]
>UniRef100_Q39353 Cell wall-plasma membrane linker protein n=1 Tax=Brassica napus
           RepID=Q39353_BRANA
          Length = 376

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 49/112 (43%), Positives = 52/112 (46%), Gaps = 12/112 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPP---TATPPAAA--TPPTATPPTATPPAPASSPA 168
           PTKPPT  P P    P    PPT  PP   T TPP     TPPT TPP  TPP PA  P 
Sbjct: 146 PTKPPTVKPPPSTPKPPTHKPPTVCPPPTPTPTPPVVTPPTPPTPTPPVVTPPTPA-PPV 204

Query: 169 TSPPAPTPASTPSTAPTPSTAG-------SPPAPTPDSLGPGPSGADTPPPP 303
            +PP PTP       PTP           +PP PTP  + P      TPP P
Sbjct: 205 VTPPTPTPPVVTPPTPTPPVVTPPTPPVVTPPTPTPPVVTPPTPPVVTPPTP 256

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 50/100 (50%), Positives = 53/100 (53%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PPT TP P   PP  A PP  TPPT TPP   TPPT TPP  TPP P   P  +PP 
Sbjct: 184 PPTPPTPTP-PVVTPPTPA-PPVVTPPTPTPPVV-TPPTPTPPVVTPPTP---PVVTPPT 237

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PTP     T PTP    +PP PTP  + P      TPP P
Sbjct: 238 PTPPVV--TPPTPPVV-TPPTPTPPVVTPPTPPVVTPPTP 274

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 46/102 (45%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           PTKPPT  P P + P     PPT  PP +TP     PPT  PP +TP  P   P T  P 
Sbjct: 114 PTKPPTVKP-PPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTHKPPTVCPP 172

Query: 184 PTPASTPS--TAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PTP  TP   T PTP T  +PP  TP +  P      TP PP
Sbjct: 173 PTPTPTPPVVTPPTPPTP-TPPVVTPPTPAPPVVTPPTPTPP 213

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 47/110 (42%), Positives = 53/110 (48%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPT-----ATPAPKAQPPAAATPP-TATPPTATPPAAATP--PTATPPTATPPAP-- 153
           PTKPPT     +TP P  +PP    PP T  PPT  PP    P  PT TPP  TPP P  
Sbjct: 130 PTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTHKPPTVCPPPTPTPTPPVVTPPTPPT 189

Query: 154 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            + P  +PP P P       PTP    +PP PTP  + P      TPP P
Sbjct: 190 PTPPVVTPPTPAPPVVTPPTPTPPVV-TPPTPTPPVVTPPTPPVVTPPTP 238

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/115 (35%), Positives = 49/115 (42%), Gaps = 17/115 (14%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAAT---------------PPTATPPTATPPAAATPPTATPPTA 138
           PTKPPT  P P  +PP                   PPT  PP +TP     PPT  PP +
Sbjct: 66  PTKPPTLKPHPHPKPPTVRPHPHPKPPTKPHPIPKPPTIKPPPSTPKPPTKPPTVKPPPS 125

Query: 139 TPPAPASSPATSPP--APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           TP  P   P   PP   P P + P T   P +   PP   P ++ P P+   TPP
Sbjct: 126 TPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTHKPPTVCPPPTPTPTPP 180

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 47/97 (48%), Positives = 50/97 (51%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           PPT TP P   PP   TPP  TPPT   P   TPPT TPP  TPP P   P  +PP PTP
Sbjct: 207 PPTPTP-PVVTPPTP-TPPVVTPPT---PPVVTPPTPTPPVVTPPTP---PVVTPPTPTP 258

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                T PTP    +PP PTP  + P      TP PP
Sbjct: 259 PVV--TPPTPPVV-TPPTPTPPVVTP-----PTPTPP 287

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 40/105 (38%), Positives = 46/105 (43%), Gaps = 7/105 (6%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPT 189
           KPPT  P P    P    PPT  PP +TP     PPT  PP +TP  P   P   PP  T
Sbjct: 100 KPPTIKPPPSTPKPPTK-PPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPST 158

Query: 190 PA----STPSTAPTPSTAGSPPA---PTPDSLGPGPSGADTPPPP 303
           P       P+  P P+   +PP    PTP +  P      TP PP
Sbjct: 159 PKPPTHKPPTVCPPPTPTPTPPVVTPPTPPTPTPPVVTPPTPAPP 203

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 39/83 (46%), Positives = 41/83 (49%), Gaps = 3/83 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQP-PAAATPPTATPPTATPPA--AATPPTATPPTATPPAPASSPATSPPA 183
           PPT TP     P P   TPPT TPP  TPP     TPPT TPP  TPP P   P  +PP 
Sbjct: 217 PPTPTPPVVTPPTPPVVTPPTPTPPVVTPPTPPVVTPPTPTPPVVTPPTP---PVVTPPT 273

Query: 184 PTPASTPSTAPTPSTAGSPPAPT 252
           PTP       PTP    + P  T
Sbjct: 274 PTPPVVTPPTPTPPKPETCPIDT 296

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 38/102 (37%), Positives = 42/102 (41%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           PTKP      P  +PP +   P   PPT  PP +   P   PPT  PP     P T PP 
Sbjct: 92  PTKPHPIPKPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPT 151

Query: 184 PTPASTPSTAPT--PSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P  +    PT  P T   PP PTP      P    TP PP
Sbjct: 152 VKPPPSTPKPPTHKPPTVCPPPTPTPTPPVVTPPTPPTPTPP 193

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 37/73 (50%), Positives = 39/73 (53%), Gaps = 2/73 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAA--TPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           P  PP  TP P   PP     TPP  TPPT TPP   TPP  TPP  TPP P + P  +P
Sbjct: 227 PPTPPVVTP-PTPTPPVVTPPTPPVVTPPTPTPP-VVTPP--TPPVVTPPTP-TPPVVTP 281

Query: 178 PAPTPASTPSTAP 216
           P PTP   P T P
Sbjct: 282 PTPTPPK-PETCP 293

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 40/105 (38%), Positives = 46/105 (43%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPA--PKAQPPAAAT-PPTATP-PTATPPAAATPPTATPPTATPPAPASSPAT 171
           P KPP A P   P  +PP   T PPT  P P   PP     P   PPT   P P      
Sbjct: 46  PPKPPAAKPPKPPAVKPPKPPTKPPTLKPHPHPKPPTVRPHPHPKPPTKPHPIPKPPTIK 105

Query: 172 SPPA-PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP+ P P + P T   P +   PP   P ++ P PS   TP PP
Sbjct: 106 PPPSTPKPPTKPPTVKPPPSTPKPPT-KPPTVKPPPS---TPKPP 146

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 40/108 (37%), Positives = 45/108 (41%), Gaps = 7/108 (6%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-PTATPPTATPPAPASSPATSP 177
           +P KP      P   P     PP A PP   PPA   P P   PPT  P      P   P
Sbjct: 28  SPPKPSPRPHKPPKHPVKPPKPPAAKPPK--PPAVKPPKPPTKPPTLKPHPHPKPPTVRP 85

Query: 178 -PAPTPASTPSTAPTPSTAGSPPA----PT-PDSLGPGPSGADTPPPP 303
            P P P + P   P P T   PP+    PT P ++ P PS   TP PP
Sbjct: 86  HPHPKPPTKPHPIPKPPTIKPPPSTPKPPTKPPTVKPPPS---TPKPP 130

[37][TOP]
>UniRef100_A3BZS2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A3BZS2_ORYSJ
          Length = 141

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 49/95 (51%), Positives = 55/95 (57%), Gaps = 1/95 (1%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATPPTATPPAA-ATPPTATPPTATPPAPASSPATSPPAPTPA 195
           T TPAPKA PP A  PPT  P +A P  A ATPP A  P     APA +P  S PAP PA
Sbjct: 26  TPTPAPKASPPPATPPPTPAPVSAPPAQAPATPPPAPAPAPKASAPAPAPKASAPAPVPA 85

Query: 196 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           +    APTP  + SPPAP+P  L P P+   TP P
Sbjct: 86  AA---APTPEIS-SPPAPSPAGLAPSPTAEVTPSP 116

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/78 (46%), Positives = 43/78 (55%)
 Frame = +1

Query: 70  TATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAP 249
           +A  P ATP  A   P A+PP ATPP P  +P ++PPA  PA TP  AP P+   S PAP
Sbjct: 19  SAQAPAATPTPA---PKASPPPATPP-PTPAPVSAPPAQAPA-TPPPAPAPAPKASAPAP 73

Query: 250 TPDSLGPGPSGADTPPPP 303
            P +  P P  A   P P
Sbjct: 74  APKASAPAPVPAAAAPTP 91

[38][TOP]
>UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK6_CHLRE
          Length = 738

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 40/100 (40%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP+   PP  +PP   PP+P   P   PP 
Sbjct: 227 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPP 286

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P+P    P P     PPPP
Sbjct: 287 PPPPSPPPPSPPPP---SPPPPSPPPPSPPPPPPPRPPPP 323

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 40/100 (40%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP  +PP  +PP  + PP + PP + PP     P+  PP+
Sbjct: 193 PSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 249

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P    SPP P P S  P P     PPPP
Sbjct: 250 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPP 289

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 39/100 (39%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP  +PP   PP+   PP   PP   PP+P   P+  PP+
Sbjct: 243 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPP-PSPPPPS 301

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P     PP P+P    P P    +PPPP
Sbjct: 302 PPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPP 341

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 39/100 (39%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP + PP + PP +  PP+  PP+  PP P S P   PP+
Sbjct: 218 PSPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 275

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P  +  PP+P P S  P      +PPPP
Sbjct: 276 PPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 315

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 39/103 (37%), Positives = 49/103 (47%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP   +PP   PP+  PP P   P   PP+
Sbjct: 232 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPS 291

Query: 184 PTPASTPSTA---PTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +   P+P     PP P P    P P     PPPP
Sbjct: 292 PPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPP 334

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 38/100 (38%), Positives = 48/100 (48%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP   P+P   P     PP   PP + PP +  PP+  PP+  PP P S P   PP 
Sbjct: 328 PSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPR 387

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P +   PP P+P    P      +PPPP
Sbjct: 388 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPP 427

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 37/100 (37%), Positives = 47/100 (47%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP    PP  +PP  +PP P       PP+
Sbjct: 284 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPS 343

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P      SPP P+P    P P    +PPPP
Sbjct: 344 PPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 383

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 39/102 (38%), Positives = 48/102 (47%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA--PASSPATSP 177
           P+ PP + P P   PP   +PP   PP+  PP    PP   PP+  PP+  P S P  SP
Sbjct: 248 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSP 307

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P+P   P   P P +   P  P P    P P  +  PPPP
Sbjct: 308 PPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPP 349

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 39/100 (39%), Positives = 47/100 (47%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP   PP  +PP  + PP   PP  +PP P S P   PP 
Sbjct: 295 PSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPP---PPPPSPPPPPSPPPPPPPR 351

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P +   P  P P    P P     PPPP
Sbjct: 352 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPP 391

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 40/102 (39%), Positives = 49/102 (48%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP-- 177
           P+ PP + P P   PP+   PP  +PP   PP+   PP  +PP   PP P   P  SP  
Sbjct: 238 PSPPPPSPPPPSPPPPS---PPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPP 294

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P P S P  +P P +   PP P P    P P     PPPP
Sbjct: 295 PSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPP 336

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 38/101 (37%), Positives = 48/101 (47%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP   P P + PP +  PP+  PP+  PP   +PP   PP   PP+P   P  SPP
Sbjct: 343 SPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSP---PPPSPP 399

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P   P  +P P     PP P+P    P P     P PP
Sbjct: 400 PPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPP 440

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 41/100 (41%), Positives = 52/100 (52%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+  PP+  PP   +PP  +PP  +PP P S P  SPP 
Sbjct: 202 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSPPPPSPP-PPSPPPPSPPP 257

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   P  +P P    SPP P P    P P    +PPPP
Sbjct: 258 PSPPPPPPPSPPPPPPPSPPPPPPPR--PPPPPPPSPPPP 295

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 36/100 (36%), Positives = 46/100 (46%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP   P P   PP +  PP+  PP+  PP+   P    PP   PP P+  P + PP 
Sbjct: 274 PSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPP 333

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P+  P  +P P     PP P+P    P P     P PP
Sbjct: 334 PPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPP 373

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 40/100 (40%), Positives = 47/100 (47%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP+   PP  +PP   PP+   PP   PP  +PP P S P  SPP 
Sbjct: 313 PPPPPPRPPPPSPPPPSPPPPPPPSPPP--PPSPPPPPPPRPPPPSPPPP-SPPPPSPPP 369

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   P  +P P     PP P+P    P P     PPPP
Sbjct: 370 PSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPP 409

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 39/100 (39%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP + P P   PP   +PP   PP+  PP    PP  +PP  +PP P+  P + PP 
Sbjct: 318 PRPPPPSPPPPSPPPPPPPSPPP--PPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPP 375

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P+  P   P P    SPP P+P    P P    +PPPP
Sbjct: 376 PPPSPPPPPPPRPPPP-SPPPPSPPPPSPPPPPPPSPPPP 414

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 39/101 (38%), Positives = 47/101 (46%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASSPATSPP 180
           P  PP+  P P   PP    PP  +PP  +PP  + PP + PP   P P P   P   PP
Sbjct: 332 PPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPP 391

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P S P  +P P    SPP P P    P      +PPPP
Sbjct: 392 SPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPP 432

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 38/100 (38%), Positives = 47/100 (47%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP   P+P   PP +  PP   PP   PP   +PP  +PP  +PP P+  P + PP 
Sbjct: 258 PSPPPPPPPSPPPPPPPSPPPPP--PPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 315

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P + P PS    PP   P    P P     PPPP
Sbjct: 316 PPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPP 355

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 38/100 (38%), Positives = 47/100 (47%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P +PP   P P + PP +  PP+  PP+  PP+   PP   PP  +PP P+  P   P  
Sbjct: 281 PPRPPP--PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSP 338

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P   P      SPP P+P    P P     PPPP
Sbjct: 339 PPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPP 378

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 37/100 (37%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP+   PP + PP + PP +  PP+  PP+  PP+P       PP 
Sbjct: 208 PSPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 265

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   P  +P P     PP P P S  P      +PPPP
Sbjct: 266 PSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPP 305

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 39/102 (38%), Positives = 47/102 (46%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP    PP  +PP  +PP    P    PP+  PP P   P  SPP 
Sbjct: 300 PSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPP 359

Query: 184 PT--PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+  P S P  +P P    SPP P P    P      +PPPP
Sbjct: 360 PSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPP 401

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 46/100 (46%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP  + PP + PP + PP   +PP   PP   PP+P       PP 
Sbjct: 278 PPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPPPPRPPPPSPPPPSPPPPPP 335

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   PS  P P     PP+P P S  P      +PPPP
Sbjct: 336 PSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPP 375

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 37/97 (38%), Positives = 45/97 (46%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           PP+  P P   PP   +PP   PP   PP+   PP+  PP+  PP+P   P  SPP P P
Sbjct: 327 PPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPP-PPSPPPPSPPPPSPPPPPPPSPPPPPP 385

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P  +P P +   P  P P    P P     PPPP
Sbjct: 386 PRPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPP 422

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 38/102 (37%), Positives = 50/102 (49%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P         P   PP  + PP + PP + PP +  PP+  PP+  PP+P   P+  PP+
Sbjct: 181 PLSQANVPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPS 239

Query: 184 PTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P  +P P +    SPP P P S  P P  +  PPPP
Sbjct: 240 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 281

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 34/100 (34%), Positives = 43/100 (43%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP + P P    P    PP   PP    P   +PP  +PP  +PP P+  P   P  
Sbjct: 261 PPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRP 320

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P+  P + P P     PP P+P    P      +PPPP
Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPP 360

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 26/60 (43%), Positives = 33/60 (55%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P +PP  +P P + PP +  PP   PP+  PP    PP  +PP  +PP P S P  SPPA
Sbjct: 385 PPRPPPPSPPPPSPPPPSPPPPP--PPSPPPPPPPRPPPPSPPPPSPPPP-SPPPPSPPA 441

[39][TOP]
>UniRef100_C6TDP6 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TDP6_SOYBN
          Length = 233

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 55/122 (45%), Positives = 66/122 (54%), Gaps = 22/122 (18%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPP----------AAATPPTATPPTATPPA-------AATPPTATP 129
           AP+KP   +PAP A P           A ATPP ++P  A+PP+       A TPP ATP
Sbjct: 38  APSKPKPKSPAPVASPTSSPPASSPNAATATPPVSSPTVASPPSKAAAPAPATTPPVATP 97

Query: 130 PTATPPA---PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTP 294
           P ATPPA   PA +P +SPPAP P S+P   P P    SPPA  P +  P   PS A+ P
Sbjct: 98  PAATPPAATPPAVTPVSSPPAPVPVSSP---PAPVPVSSPPALAPTTPAPVVAPS-AEVP 153

Query: 295 PP 300
            P
Sbjct: 154 AP 155

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 50/109 (45%), Positives = 64/109 (58%), Gaps = 10/109 (9%)
 Frame = +1

Query: 1   APT----KPPTATPAPKAQPPAAATPPTATPPTATPPAA-ATPPTATPPTATPP--APAS 159
           APT     P TA   PK + PA    PT++PP ++P AA ATPP ++P  A+PP  A A 
Sbjct: 27  APTTSSASPATAPSKPKPKSPAPVASPTSSPPASSPNAATATPPVSSPTVASPPSKAAAP 86

Query: 160 SPATSPPAPT-PASTP--STAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           +PAT+PP  T PA+TP  +T P  +   SPPAP P S  P P    +PP
Sbjct: 87  APATTPPVATPPAATPPAATPPAVTPVSSPPAPVPVSSPPAPVPVSSPP 135

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 54/119 (45%), Positives = 60/119 (50%), Gaps = 19/119 (15%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATP-PTATPPTATPPAAATPPTATPPTATPPA--PASSPAT 171
           A   PP ++P   + P  AA P P  TPP ATPPAA TPP ATPP  TP +  PA  P +
Sbjct: 65  ATATPPVSSPTVASPPSKAAAPAPATTPPVATPPAA-TPPAATPPAVTPVSSPPAPVPVS 123

Query: 172 SPPAPTPASTP----STAPTPSTAGSP--PAPTPDS----------LGPGPSGADTPPP 300
           SPPAP P S+P     T P P  A S   PAP P S            P PS A   PP
Sbjct: 124 SPPAPVPVSSPPALAPTTPAPVVAPSAEVPAPAPKSKKKTKKSKKHTAPAPSPALLGPP 182

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 41/106 (38%), Positives = 51/106 (48%), Gaps = 10/106 (9%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTATPPTATPPAAAT--PPTATPPTATPPAPASSPATSPP--- 180
           P A P   +  PA A P    P +  P A+ T  PP ++P  AT   P SSP  + P   
Sbjct: 24  PAAAPTTSSASPATA-PSKPKPKSPAPVASPTSSPPASSPNAATATPPVSSPTVASPPSK 82

Query: 181 --APTPASTPSTAPTPST---AGSPPAPTPDSLGPGPSGADTPPPP 303
             AP PA+TP  A  P+    A +PPA TP S  P P    +PP P
Sbjct: 83  AAAPAPATTPPVATPPAATPPAATPPAVTPVSSPPAPVPVSSPPAP 128

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 49/125 (39%), Positives = 60/125 (48%), Gaps = 30/125 (24%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPA-------AATPPTATPPTATP--PAPAS 159
           T PP ATP P A PPAA TPP  TP  ++PPA        A  P ++PP   P  PAP  
Sbjct: 90  TTPPVATP-PAATPPAA-TPPAVTP-VSSPPAPVPVSSPPAPVPVSSPPALAPTTPAPVV 146

Query: 160 SPATSPPAPTPASTPST---------APTPSTAGSP------PAPTPDSLGPGP------ 276
           +P+   PAP P S   T         AP+P+  G P      P  + D+  PGP      
Sbjct: 147 APSAEVPAPAPKSKKKTKKSKKHTAPAPSPALLGPPAPPVGAPGSSQDASSPGPAVSEDE 206

Query: 277 SGADT 291
           SGA+T
Sbjct: 207 SGAET 211

[40][TOP]
>UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum
           bicolor RepID=C5XPK9_SORBI
          Length = 613

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 41/103 (39%), Positives = 56/103 (54%), Gaps = 3/103 (2%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP + P P   PP+ + PP + PP + PP + +PP  +PP  +PP P S P  SPP
Sbjct: 406 SPPLPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPP-PPSPPPPSPP 464

Query: 181 APTPASTPSTAPTPS---TAGSPPAPTPDSLGPGPSGADTPPP 300
            P+P+  P + P PS    + SPP P+P    P P     PPP
Sbjct: 465 PPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPP 507

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 40/111 (36%), Positives = 57/111 (51%), Gaps = 10/111 (9%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P+ PP + P P   PP+ + PP + PP + PP +  PP+  PP+ +PP P S P  SPP
Sbjct: 423 SPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPP-SPPPPSPP 481

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSL----------GPGPSGADTPPPP 303
            P+P+  P + P PS     P+P P              P P+  + PPPP
Sbjct: 482 PPSPSPPPPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPPP 532

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 34/87 (39%), Positives = 47/87 (54%), Gaps = 3/87 (3%)
 Frame = +1

Query: 49  PAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS---PATSPPAPTPASTPSTAPT 219
           P+   PP + PP + PP + +PP  +PP  +PP P+ S   P+  PP+P P S P  +P 
Sbjct: 405 PSPPLPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPP 464

Query: 220 PSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P +  SPP P+P    P P     PPP
Sbjct: 465 PPSP-SPPPPSPPPPSPPPPSPSPPPP 490

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 42/119 (35%), Positives = 57/119 (47%), Gaps = 19/119 (15%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P + PP +  PP+ +PP  +PP    PP+  PP+ +PP P S P  SPP 
Sbjct: 445 PPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPP----PPSPPPPSPSPP-PPSPPPPSPPP 499

Query: 184 PTPASTPS-----------TAPTPSTAGSPPAP----TPD----SLGPGPSGADTPPPP 303
           P+P+  P            + P P+    PP P    +P+    S  P P   D PPPP
Sbjct: 500 PSPSPPPPYYEVSPEERYLSPPPPAYTEVPPPPYYEVSPEDRYLSPPPPPVHHDPPPPP 558

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
 Frame = +1

Query: 28  PAPKAQPPAAATPPTATP--PTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPAST 201
           P+P   PP+   PP  +P  P+ +PP  + PP + PP +  P P S P  SPP P+P   
Sbjct: 405 PSPPLPPPS---PPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSP--P 459

Query: 202 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P + P PS +  PP+P P S  P PS +  PP P
Sbjct: 460 PPSPPPPSPSPPPPSPPPPS-PPPPSPSPPPPSP 492

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 33/111 (29%), Positives = 47/111 (42%), Gaps = 11/111 (9%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPP---------TATPPAP 153
           +P+ PP + P P   PP+ + PP + PP + PP + +PP   PP           +PP P
Sbjct: 467 SPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPP---PPYYEVSPEERYLSPPPP 523

Query: 154 ASSPATSPP--APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           A +    PP    +P     + P P     PP P    + P       PPP
Sbjct: 524 AYTEVPPPPYYEVSPEDRYLSPPPPPVHHDPPPPPYYEVSPEDRYLSPPPP 574

[41][TOP]
>UniRef100_B6KAY2 Putative uncharacterized protein n=2 Tax=Toxoplasma gondii
           RepID=B6KAY2_TOXGO
          Length = 1112

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 48/107 (44%), Positives = 65/107 (60%), Gaps = 7/107 (6%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQP---PAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT 171
           AP+ P  + PAP   P   P A +PP+ +PP  +PP+ + PP  +PP+ +PPAP   P+ 
Sbjct: 272 APSPPAPSPPAPSPSPASAPPAPSPPSVSPPAPSPPSVS-PPAPSPPSVSPPAP-PPPSV 329

Query: 172 SPPAPTPAS-TPSTAPTPSTAG---SPPAPTPDSLGPGPSGADTPPP 300
           SPPAP+P S  P   P PS A    SPPAP+P S+ P P+ +  PPP
Sbjct: 330 SPPAPSPPSVAPPAPPAPSVAPPSLSPPAPSPPSVSP-PAPSAAPPP 375

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 43/97 (44%), Positives = 57/97 (58%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           P    P+P A  P A +PP  +PP  +P  A+ PP  +PP+ +PPAP S P+ SPPAP+P
Sbjct: 258 PVQLPPSPPAPSPPAPSPPAPSPPAPSPSPASAPPAPSPPSVSPPAP-SPPSVSPPAPSP 316

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            S    AP P +  SPPAP+P S+ P    A +  PP
Sbjct: 317 PSVSPPAPPPPSV-SPPAPSPPSVAPPAPPAPSVAPP 352

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 47/110 (42%), Positives = 64/110 (58%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPK---AQPPAAATPPTATP-----PTATPPA--AATPPTATPPTATPPAP 153
           P KP +A+PA +   A PP A    +A+      P   PP+  A +PP  +PP  +PPAP
Sbjct: 224 PRKPQSASPASRVSFAPPPEAKVKSSASSLQGVSPVQLPPSPPAPSPPAPSPPAPSPPAP 283

Query: 154 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           + SPA++PPAP+P S    AP+P +  SPPAP+P S+ P       PPPP
Sbjct: 284 SPSPASAPPAPSPPSVSPPAPSPPSV-SPPAPSPPSVSP-----PAPPPP 327

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 39/99 (39%), Positives = 52/99 (52%), Gaps = 4/99 (4%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPT---ATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAP 186
           P  TP P  +P +A+       A PP A   ++A+      P   PP+P   PA SPPAP
Sbjct: 217 PATTPVPPRKPQSASPASRVSFAPPPEAKVKSSASSLQGVSPVQLPPSP---PAPSPPAP 273

Query: 187 TPASTPSTAPTPSTAGSPPAPTPDSLGP-GPSGADTPPP 300
           +P +    AP+PS A +PPAP+P S+ P  PS     PP
Sbjct: 274 SPPAPSPPAPSPSPASAPPAPSPPSVSPPAPSPPSVSPP 312

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 34/86 (39%), Positives = 42/86 (48%), Gaps = 1/86 (1%)
 Frame = +1

Query: 49  PAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPS- 225
           P AA P T TP     P +A+P +       P A   S A+S    +P   P + P PS 
Sbjct: 212 PEAAKPAT-TPVPPRKPQSASPASRVSFAPPPEAKVKSSASSLQGVSPVQLPPSPPAPSP 270

Query: 226 TAGSPPAPTPDSLGPGPSGADTPPPP 303
            A SPPAP+P +  P PS A  PP P
Sbjct: 271 PAPSPPAPSPPA--PSPSPASAPPAP 294

[42][TOP]
>UniRef100_Q95JC9 Parotid hormone n=1 Tax=Sus scrofa RepID=PRP_PIG
          Length = 676

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/103 (42%), Positives = 45/103 (43%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 317 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 376

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PPPP
Sbjct: 377 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPPP 419

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 45/104 (43%), Positives = 47/104 (45%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPK-AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P  PP+  PAP  A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP
Sbjct: 449 PPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 508

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
            P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 509 GPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 552

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 41/100 (41%), Positives = 42/100 (42%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 576 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 635

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P   GP P      PPP
Sbjct: 636 PPPPGPPPPGPAPPGARPPPGPPPPPPGPSPPRPPPGPPP 675

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 86  PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 145

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 146 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 188

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 107 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 166

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 167 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 209

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 128 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 187

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 188 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 230

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 149 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 208

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 209 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 251

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 191 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 250

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 251 PPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 293

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 45/104 (43%), Positives = 46/104 (44%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPK-AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P  PP   PAP  A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP
Sbjct: 253 PLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 312

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
            P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 313 GPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 356

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 275 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 334

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 335 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 377

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 296 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 355

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 356 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 398

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 471 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 530

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 531 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 573

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 492 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 551

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 552 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 594

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 513 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 572

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 573 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 615

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 534 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 593

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 594 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 636

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 555 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 614

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 615 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 657

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 170 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 229

Query: 184 PTPASTPSTAPTPSTAGSPPAPT---PDSLGPGPSGADTPPPP 303
           P P   P   P P  A  PP P    P   GP P GA  PP P
Sbjct: 230 PPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPPPGP 272

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/107 (41%), Positives = 46/107 (42%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 338 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 397

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS----LGPGPSG---ADTPPPP 303
           P P   P   P P  A  PP P P +     GP PSG      PPPP
Sbjct: 398 PPPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPP 444

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 45/110 (40%), Positives = 46/110 (41%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 359 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPP 418

Query: 184 PTP-ASTPSTAPTPS---------TAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P A  P   P PS             PP P P S GP P GA  PP P
Sbjct: 419 PPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPSPGPAPPGARPPPGP 468

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 44/104 (42%), Positives = 45/104 (43%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPK-AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P   P   PAP  A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP
Sbjct: 64  PGDGPEQGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 123

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
            P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 124 GPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 167

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 42/103 (40%), Positives = 43/103 (41%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   P    PP PA   A  PP 
Sbjct: 212 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPPPG 271

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 272 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 314

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 42/103 (40%), Positives = 43/103 (41%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    P    PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 233 PGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 292

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 293 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 335

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 44/110 (40%), Positives = 44/110 (40%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPAP-------KAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS 162
           P   P   PAP       K  PPA   PP    P   PP A  PP   PP   PP PA  
Sbjct: 422 PADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPP 481

Query: 163 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
            A  PP P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 482 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 531

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 44/115 (38%), Positives = 46/115 (40%), Gaps = 15/115 (13%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATP----------PAAATPPTATPPTATPPAP 153
           P  PP   P P   PP A  PP   PP   P          P    PP A PP   PP+P
Sbjct: 396 PGPPPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPSP 455

Query: 154 ASSP--ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL---GPGPSGADTPPPP 303
             +P  A  PP P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 456 GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 510

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 47/115 (40%), Positives = 47/115 (40%), Gaps = 15/115 (13%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA--PASSPATS- 174
           P  PP   P P   PP A  PP   PP   PP  A P    PP   PPA  P   PA S 
Sbjct: 375 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSG 434

Query: 175 --------PPA-PTPASTPSTAPTPSTAGSPPAPTPDSL---GPGPSGADTPPPP 303
                   PPA P P   PS  P P  A  PP P P      GP P GA  PP P
Sbjct: 435 DKPKKKPPPPAGPPPPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 489

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 42/107 (39%), Positives = 44/107 (41%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P    P  A PP   PP   PP    PP A PP   PP     P  +PP 
Sbjct: 164 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 223

Query: 184 --PTPASTPSTAPTPSTA--GSPPAPTPDSLGPGPSGADTP---PPP 303
             P P   P   P P  A  G+ P P P  LGP P G   P   PPP
Sbjct: 224 ARPPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPPP 270

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 40/111 (36%), Positives = 43/111 (38%), Gaps = 13/111 (11%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAAT---------PPTATPPTA-TPPAAATPPTATPPTATPPAPAS 159
           +PP     P+  PP  +          PP   P     PP A  PP   PP   PP PA 
Sbjct: 36  RPPPGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAP 95

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
             A  PP P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 96  PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 146

[43][TOP]
>UniRef100_Q9XIV1 Arabinogalactan protein n=1 Tax=Cucumis sativus RepID=Q9XIV1_CUCSA
          Length = 243

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 51/108 (47%), Positives = 64/108 (59%), Gaps = 7/108 (6%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATP---PTATPPTATPPA----AATPPTATPPTATPPAPAS 159
           AP KP  ATPAP + PPA+A P   P A+PP +TPP     A++PP A+ P ++PPA A+
Sbjct: 61  APQKP--ATPAPVSTPPASAPPAVAPVASPPASTPPTASVPASSPPAASVPPSSPPA-AT 117

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PA+SPP P P S+P   P      SPP PTP    P P    +PP P
Sbjct: 118 VPASSPPVPVPVSSP---PVSVPVSSPPVPTPTESPPAPE--SSPPAP 160

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/105 (46%), Positives = 60/105 (57%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKP-PTATPAPKAQPPAAATPPTATPPTATP---PAAATPPTATPPTATPPAPASSPAT 171
           PT P P A P   A P   +TPP + PP   P   P A+TPPTA+ P ++PPA AS P +
Sbjct: 53  PTNPSPAAAPQKPATPAPVSTPPASAPPAVAPVASPPASTPPTASVPASSPPA-ASVPPS 111

Query: 172 SPPAPT-PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           SPPA T PAS+P   P P    SPP   P S  P P+  ++PP P
Sbjct: 112 SPPAATVPASSP---PVPVPVSSPPVSVPVSSPPVPTPTESPPAP 153

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 45/120 (37%), Positives = 62/120 (51%), Gaps = 23/120 (19%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATP------------PTATPPTATPPAPA 156
           PPTA+  P + PPAA+ PP++ PP AT PA++ P            P ++PP  TP    
Sbjct: 93  PPTAS-VPASSPPAASVPPSS-PPAATVPASSPPVPVPVSSPPVSVPVSSPPVPTPTESP 150

Query: 157 SSPATSPPAPT---PASTPSTAPT--PSTAGSPPAPTPDSLGP------GPSGADTPPPP 303
            +P +SPPAP    P   P+ AP+   S     PAP+P  LGP       P+G++  P P
Sbjct: 151 PAPESSPPAPVASPPVEVPAPAPSKKKSKKHRAPAPSPALLGPPAPPSEAPAGSEEGPAP 210

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 46/97 (47%), Positives = 53/97 (54%), Gaps = 10/97 (10%)
 Frame = +1

Query: 43  QPPAAATPPTATPPTATPPAAAT-PPTATPPTATP--PAPASSPATSPPAPTPASTPSTA 213
           Q PAAA  PT TP  ATPP AAT PP A  P +TP  P+PA++P   P  P P STP  +
Sbjct: 22  QSPAAA--PTTTP-AATPPVAATYPPPAASPVSTPTNPSPAAAP-QKPATPAPVSTPPAS 77

Query: 214 PTPSTA--GSPPAPTPDSL---GPGPSGADTPP--PP 303
             P+ A   SPPA TP +       P  A  PP  PP
Sbjct: 78  APPAVAPVASPPASTPPTASVPASSPPAASVPPSSPP 114

[44][TOP]
>UniRef100_Q6SSE6 Plus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE6_CHLRE
          Length = 3409

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 46/110 (41%), Positives = 60/110 (54%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA----SSPAT 171
            P+ PP  +PAP +  P +  PP+  PP +  P +  PP+ TPP+  PP+PA      P+ 
Sbjct: 927  PSPPPPPSPAPPSPAPPSPEPPSPPPPPSPAPPSPAPPSPTPPSPVPPSPAPPSPDPPSP 986

Query: 172  SPPAPTPAST--PSTAPTPSTAGSPPAPTPDSLGP----GPSGADTPPPP 303
            +PP+P P S   PS AP      SP  PTP S GP     PS A +PPPP
Sbjct: 987  APPSPDPPSPAPPSPAPPSPNPPSPVPPTPPSPGPPSPEPPSPAPSPPPP 1036

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 42/102 (41%), Positives = 59/102 (57%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P+ PP  +PAP +  P + TPP+  PP+  PP +  PP+  PP+  PP+PA  P+ +PP+
Sbjct: 948  PSPPPPPSPAPPSPAPPSPTPPSPVPPSPAPP-SPDPPSPAPPSPDPPSPA-PPSPAPPS 1005

Query: 184  PTPAS-TPSTAPTPS-TAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S  P T P+P   +  PP+P P    P P  +  PPPP
Sbjct: 1006 PNPPSPVPPTPPSPGPPSPEPPSPAPSPPPPTPPTSPPPPPP 1047

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 37/99 (37%), Positives = 51/99 (51%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +PAP +  P +  PP+  PP+  PP +  PP+  PP+  PP+P   P+ +PP+
Sbjct: 901  PPSPAPPSPAPPSPQPPSPEPPSPEPPSPPPPPSPAPPSPAPPSPEPPSPPPPPSPAPPS 960

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P P S    +P P    SP  P+PD   P P   D P P
Sbjct: 961  PAPPSPTPPSPVPP---SPAPPSPDPPSPAPPSPDPPSP 996

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/102 (42%), Positives = 54/102 (52%), Gaps = 1/102 (0%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA-TPPTATPPTATPPAPASSPATSP 177
            +P  P  A P+P    P   TPP+  PP+  PP+ A +PP  TPPT+ PP P   P+  P
Sbjct: 995  SPAPPSPAPPSPNPPSPVPPTPPSPGPPSPEPPSPAPSPPPPTPPTSPPPPPPEPPSPEP 1054

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P P   PS  P PS A  PP+P P S  P      +P PP
Sbjct: 1055 PSPAPPLPPSPEP-PSPA--PPSPAPPSPQPPSPAPPSPAPP 1093

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 39/100 (39%), Positives = 55/100 (55%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +PAP +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  P+ +PP+
Sbjct: 856  PPSPAPPSPAPPSPEPPSPEPPSPAPPSLEPPSPA-PPSPAPPSPEPPSPA-PPSPAPPS 913

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S    +P P +   PP+P P S  P      +PPPP
Sbjct: 914  PQPPSPEPPSPEPPSPPPPPSPAPPSPAPPSPEPPSPPPP 953

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 42/104 (40%), Positives = 56/104 (53%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +PAP +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  P+ +PP+
Sbjct: 953  PPSPAPPSPAPPSPTPPSPVPPSPAPPSPDPPSPA-PPSPDPPSPAPPSPA-PPSPNPPS 1010

Query: 184  PTPASTPSTAP----TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P + PS  P     PS A SPP PTP +  P P      P P
Sbjct: 1011 PVPPTPPSPGPPSPEPPSPAPSPPPPTPPTSPPPPPPEPPSPEP 1054

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 39/102 (38%), Positives = 54/102 (52%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATP--PAAATPPTATPPTATPPAPASSPATSP 177
            PT PP+  P P   PP+   PP+  PP+  P  P +  PP+  PP+  PP+PA  P+  P
Sbjct: 1152 PTSPPSPEPVPPTPPPSPPAPPSPAPPSPQPLEPPSPEPPSPAPPSPAPPSPA-PPSPEP 1210

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1211 PSPEPPSPEPPSPAPPSP-APPSPAPPSPAPPSPAPPSPAPP 1251

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 43/118 (36%), Positives = 62/118 (52%), Gaps = 17/118 (14%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATP--PAAATPPTATPPTATPPAPASS---- 162
            AP  P   +PAP +  P +  PP+  PP+  P  P +  PP+  PP+ TPPAPA +    
Sbjct: 1274 APPSPAPPSPAPPSPAPPSPAPPSPEPPSPAPPQPPSPVPPSPAPPSPTPPAPAPAAALP 1333

Query: 163  ---PATSPPAPTPASTPSTAPTP-------STAGSPPAPTPDS-LGPGPSGADTPPPP 303
               P+ +PP P P ++P+ +P+P       + A  PP+P P S   P P+    PPPP
Sbjct: 1334 PLPPSPAPPLPVPPASPAPSPSPLRPPQPQTPAMPPPSPAPPSPAPPSPAPPGVPPPP 1391

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 39/101 (38%), Positives = 54/101 (53%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  P   +P P +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  P+  PP
Sbjct: 860  APPSPAPPSPEPPSPEPPSPAPPSLEPPSPAPPSPA-PPSPEPPSPAPPSPA-PPSPQPP 917

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P P  + +PP+P P    P P     PPPP
Sbjct: 918  SPEPPSPEPPSPPPPPSPAPPSPAP----PSPEPPSPPPPP 954

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 44/105 (41%), Positives = 59/105 (56%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA----SSPA 168
            AP  P   +PAP +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA    + P+
Sbjct: 1239 APPSPAPPSPAPPSPQPPSPAPPSPEPPSPAPPSPA-PPSPAPPSPAPPSPAPPSPAPPS 1297

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              PP+P P   PS  P PS A  PP+PTP +  P P+ A  P PP
Sbjct: 1298 PEPPSPAPPQPPSPVP-PSPA--PPSPTPPA--PAPAAALPPLPP 1337

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 41/104 (39%), Positives = 54/104 (51%), Gaps = 3/104 (2%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP--PTATPPTATPPAPAS-SPAT 171
            AP  P   +PAP +  P +  PP+  PP+  PPA  +P  P+  PP+  PP+PA  SPA 
Sbjct: 706  APPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPEPPSPAPPSPAP 765

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              PAP   + PS AP    +  PP+P P S  P      +P PP
Sbjct: 766  PSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPEPPSPAPPSPAPP 809

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQP-------PAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS 162
            P  PPT+ P P  +P       PA   PP+  PP+  PP+ A PP+  PP+  PP+PA  
Sbjct: 1035 PPTPPTSPPPPPPEPPSPEPPSPAPPLPPSPEPPSPAPPSPA-PPSPQPPSPAPPSPA-P 1092

Query: 163  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+ +PP+P P S    +P P +   P  P+P+   P P    +P PP
Sbjct: 1093 PSPAPPSPAPPSPEPPSPAPPSPSPPAPPSPEPPSPAPLLPPSPDPP 1139

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 39/103 (37%), Positives = 55/103 (53%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA--SSPATS 174
            +P  P  A PAP +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  + P+  
Sbjct: 729  SPAPPSPAPPAPPSPEPPSPAPPSPEPPSPAPPSPA-PPSPAPPSPAPPSPAPPAPPSPE 787

Query: 175  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP+P P S    +P P    SP  P+P+   P P    +P PP
Sbjct: 788  PPSPAPPSPEPPSPAPP---SPAPPSPEPPSPSPPAPPSPEPP 827

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 38/103 (36%), Positives = 53/103 (51%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA--SSPATS 174
            AP  P   +P P +  P +  PP+  PP+  PP+ A PP+  PP+  PP+P   + P+  
Sbjct: 962  APPSPTPPSPVPPSPAPPSPDPPSPAPPSPDPPSPA-PPSPAPPSPNPPSPVPPTPPSPG 1020

Query: 175  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP+P P S   + P P+   SPP P P+   P P     P PP
Sbjct: 1021 PPSPEPPSPAPSPPPPTPPTSPPPPPPEPPSPEPPSPAPPLPP 1063

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 40/103 (38%), Positives = 57/103 (55%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS--PATS 174
            +P  P  A PAP +  P +  PP+  PP+  PP+ A PP+  PP+ +PPAP S   P+ +
Sbjct: 772  SPAPPSPAPPAPPSPEPPSPAPPSPEPPSPAPPSPA-PPSPEPPSPSPPAPPSPEPPSPA 830

Query: 175  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP+P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 831  PPSPFPPSPQPPSPEPPSP-APPSPVPPSPAPPSPAPPSPEPP 872

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 38/102 (37%), Positives = 52/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS--PATSP 177
            P  P   +PAP +  P +  PP+  PP+  PP+ A PP+  PP+  PP P S   P+  P
Sbjct: 968  PPSPVPPSPAPPSPDPPSPAPPSPDPPSPAPPSPA-PPSPNPPSPVPPTPPSPGPPSPEP 1026

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P P+  P T PT      P  P+P+   P P    +P PP
Sbjct: 1027 PSPAPSPPPPTPPTSPPPPPPEPPSPEPPSPAPPLPPSPEPP 1068

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 41/109 (37%), Positives = 51/109 (46%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS--SPATSP 177
            P  PP+  P     P  A +PP  TPPT+ PP    PP+  PP+  PP P S   P+ +P
Sbjct: 1013 PPTPPSPGPPSPEPPSPAPSPPPPTPPTSPPPPPPEPPSPEPPSPAPPLPPSPEPPSPAP 1072

Query: 178  PAPTPAS-------TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P P S        PS AP      SP  P+P+   P P     P PP
Sbjct: 1073 PSPAPPSPQPPSPAPPSPAPPSPAPPSPAPPSPEPPSPAPPSPSPPAPP 1121

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 40/99 (40%), Positives = 52/99 (52%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +PAP +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  P+ SPPA
Sbjct: 1062 PPSPEPPSPAPPSPAPPSPQPPSPAPPSPAPPSPA-PPSPAPPSPEPPSPAP-PSPSPPA 1119

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P     PS AP    +  PP+P P S  P P     P P
Sbjct: 1120 PPSPEPPSPAPLLPPSPDPPSPAPPSPMPPPLPTSPPSP 1158

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 39/101 (38%), Positives = 56/101 (55%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  P   +PAP +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  P+ +PP
Sbjct: 1194 APPSPAPPSPAPPSPEPPSPEPPSPEPPSPAPPSPA-PPSPAPPSPAPPSPA-PPSPAPP 1251

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1252 SPQPPSPAPPSPEPPSP-APPSPAPPSPAPPSPAPPSPAPP 1291

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 41/109 (37%), Positives = 54/109 (49%), Gaps = 8/109 (7%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-------PTATPPTATPPAPAS 159
           AP  PP  +PAP +  P +  PP+  PP+  PP   +P       P+  PP+  PP+PA 
Sbjct: 615 APPSPPPPSPAPPSPAPPSPAPPSPQPPSPVPPQPPSPVPPSPKPPSPAPPSPVPPSPAP 674

Query: 160 -SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            SPA   PAP   + PS AP    +  PP+P P S  P      +P PP
Sbjct: 675 PSPAPPSPAPPNPAPPSPAPPLPPSPEPPSPAPPSPEPPSPAPPSPAPP 723

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 43/112 (38%), Positives = 55/112 (49%), Gaps = 11/112 (9%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA--TPPTATPPTATPPAPASS---- 162
            AP  P   +PAP +  P +  PP+  PP+  PP+    TPP+  PP+  PP+PA S    
Sbjct: 977  APPSPDPPSPAPPSPDPPSPAPPSPAPPSPNPPSPVPPTPPSPGPPSPEPPSPAPSPPPP 1036

Query: 163  -PATSPPAPTP----ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P TSPP P P       PS AP    +  PP+P P S  P      +P PP
Sbjct: 1037 TPPTSPPPPPPEPPSPEPPSPAPPLPPSPEPPSPAPPSPAPPSPQPPSPAPP 1088

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 41/101 (40%), Positives = 55/101 (54%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  P  A P+P    PA   PP+  PP+  PP+   PP+  PP+  PP+PA  P+ +PP
Sbjct: 719  SPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPE-PPSPAPPSPAPPSPAP-PSPAPP 776

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P + PS  P PS A  PP+P P S  P      +P PP
Sbjct: 777  SPAPPAPPSPEP-PSPA--PPSPEPPSPAPPSPAPPSPEPP 814

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 39/101 (38%), Positives = 51/101 (50%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  P  A P+P    P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  P+ +PP
Sbjct: 724  SPAPPSPAPPSPAPPAPPSPEPPSPAPPSPEPPSPA-PPSPAPPSPAPPSPA-PPSPAPP 781

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            AP     PS AP      SP  P+P    P P     P PP
Sbjct: 782  APPSPEPPSPAPPSPEPPSPAPPSPAPPSPEPPSPSPPAPP 822

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 37/109 (33%), Positives = 54/109 (49%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA---------TPPTATPPTATPPAPA 156
            P  P   +PAP +  P +  PP+  PP+  PP+ A          PP+  PP+  PP+P 
Sbjct: 871  PPSPEPPSPAPPSLEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPQPPSPEPPSPEPPSPP 930

Query: 157  SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P+ +PP+P P S    +P P  + +PP+P P S  P      +P PP
Sbjct: 931  PPPSPAPPSPAPPSPEPPSPPPPPSPAPPSPAPPSPTPPSPVPPSPAPP 979

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 38/101 (37%), Positives = 54/101 (53%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  P   +P P +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  P+  PP
Sbjct: 1199 APPSPAPPSPEPPSPEPPSPEPPSPAPPSPAPPSPA-PPSPAPPSPAPPSPA-PPSPQPP 1256

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1257 SPAPPSPEPPSPAPPSP-APPSPAPPSPAPPSPAPPSPAPP 1296

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 39/101 (38%), Positives = 52/101 (51%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP-ASSPATSPP 180
            P  P   +PAP +  P +  PP+  PP+  PP+ A PP+  PP+  PP+P   SPA   P
Sbjct: 1215 PPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPSPA-PPSPQPPSPAPPSPEPPSPAPPSP 1273

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            AP   + PS AP      SP  P+P+   P P    +P PP
Sbjct: 1274 APPSPAPPSPAPPSPAPPSPAPPSPEPPSPAPPQPPSPVPP 1314

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA----SSPA 168
            AP  P   +PAP +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA    + P+
Sbjct: 1224 APPSPAPPSPAPPSPAPPSPAPPSPAPPSPQPPSPA-PPSPEPPSPAPPSPAPPSPAPPS 1282

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             +PP+P P S    +P P +   P  P+P    P P  + TPP P
Sbjct: 1283 PAPPSPAPPSPAPPSPEPPSPAPPQPPSPVPPSPAPP-SPTPPAP 1326

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 40/104 (38%), Positives = 52/104 (50%), Gaps = 3/104 (2%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP--PTATPPTATPPAPAS-SPAT 171
           AP  P   +PAP +  P +  PP   PP+  PP   +P  P+  PP+  PP+PA  SPA 
Sbjct: 663 APPSPVPPSPAPPSPAPPSPAPPNPAPPSPAPPLPPSPEPPSPAPPSPEPPSPAPPSPAP 722

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PAP   + PS AP    +  PP+P P S  P      +P PP
Sbjct: 723 PSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPEPPSPAPPSPAPP 766

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 38/100 (38%), Positives = 54/100 (54%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +PAP +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  P+ +PP+
Sbjct: 1190 PPSPAPPSPAPPSPAPPSPEPPSPEPPSPEPPSPA-PPSPAPPSPAPPSPA-PPSPAPPS 1247

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S    +P P +   PP+P P S  P      +P PP
Sbjct: 1248 PAPPSPQPPSPAPPSP-EPPSPAPPSPAPPSPAPPSPAPP 1286

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 42/108 (38%), Positives = 55/108 (50%), Gaps = 7/108 (6%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQP---PAAATPPTATPPTATPPAAATPPTATPPTATPPAPA--SSP 165
            AP  P   +PAP   P   P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  + P
Sbjct: 683  APPNPAPPSPAPPLPPSPEPPSPAPPSPEPPSPAPPSPA-PPSPAPPSPAPPSPAPPAPP 741

Query: 166  ATSPPAPTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +  PP+P P S   PS AP      SP  P+P    P P    +P PP
Sbjct: 742  SPEPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPAPPSPEPP 789

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 42/107 (39%), Positives = 58/107 (54%), Gaps = 6/107 (5%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP--PTATPPTATPPAPA----SS 162
            AP  P   +PAP +  P +  PP+  PP+  PPA  +P  P+  PP+  PP+PA    + 
Sbjct: 749  APPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPEPPSPAPPSPAP 808

Query: 163  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+  PP+P+P + PS  P PS A  PP+P P S  P      +P PP
Sbjct: 809  PSPEPPSPSPPAPPSPEP-PSPA--PPSPFPPSPQPPSPEPPSPAPP 852

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA----SSPA 168
            AP  P   +P P +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA      P+
Sbjct: 830  APPSPFPPSPQPPSPEPPSPAPPSPVPPSPAPPSPA-PPSPEPPSPEPPSPAPPSLEPPS 888

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             +PP+P P S    +P P +  +PP+P P S  P      +PPPP
Sbjct: 889  PAPPSPAPPSPEPPSPAPPSP-APPSPQPPSPEPPSPEPPSPPPP 932

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 37/101 (36%), Positives = 54/101 (53%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  P   +P P +  P +  PP+  PP+  PP+ A PP+  PP+  PP+P   P+ +PP
Sbjct: 1204 APPSPEPPSPEPPSPEPPSPAPPSPAPPSPAPPSPA-PPSPAPPSPAPPSP-QPPSPAPP 1261

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1262 SPEPPSPAPPSPAPPSP-APPSPAPPSPAPPSPAPPSPEPP 1301

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 41/101 (40%), Positives = 54/101 (53%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  P  A P P    PA   PP+  PP+  PP+   PP+  PP+  PP+PA  P+ +PP
Sbjct: 676 SPAPPSPAPPNPAPPSPAPPLPPSPEPPSPAPPSPE-PPSPAPPSPAPPSPAP-PSPAPP 733

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P + PS  P PS A  PP+P P S  P      +P PP
Sbjct: 734 SPAPPAPPSPEP-PSPA--PPSPEPPSPAPPSPAPPSPAPP 771

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 37/100 (37%), Positives = 49/100 (49%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P+  P A P+P+   PA   PP+  PP+  PP+   PP  T P +  P P  +P  SPPA
Sbjct: 1113 PSPSPPAPPSPEPPSPAPLLPPSPDPPSPAPPSPMPPPLPTSPPSPEPVP-PTPPPSPPA 1171

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P   + PS  P    +  PP+P P S  P      +P PP
Sbjct: 1172 PPSPAPPSPQPLEPPSPEPPSPAPPSPAPPSPAPPSPEPP 1211

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 39/102 (38%), Positives = 56/102 (54%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAA--TPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           P +PP+  P P   PP A   +PP   P   +PPA++ PP+  PP+  PP+PA  P+ +P
Sbjct: 558 PPQPPSPPPPPPRPPPRAPRPSPPFHPPSPDSPPASSVPPSPEPPSPKPPSPAP-PSPAP 616

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P P S    +P P +  +PP+P P S  P    +  PP P
Sbjct: 617 PSPPPPSPAPPSPAPPSP-APPSPQPPSPVPPQPPSPVPPSP 657

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 34/101 (33%), Positives = 51/101 (50%), Gaps = 2/101 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA--TPPTATPPTATPPAPASSPATSP 177
            P  P   +P P +  P +  PP+  PP+  PP+ A   PP+  PP+  PP+P   P+ +P
Sbjct: 702  PPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPSP-EPPSPAP 760

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P+P P S    +P P +   P  P+P+   P P   + P P
Sbjct: 761  PSPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPEPPSP 801

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTA--TPPTATPPAPASSPATS 174
            AP  P   +PAP +  P +  PP+  PP+  PP+ A P  A   PP+  PP+PA  P+  
Sbjct: 739  APPSPEPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAP-PSPE 797

Query: 175  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            PP+P P S    +P P +   P  P+P+   P P     P P
Sbjct: 798  PPSPAPPSPAPPSPEPPSPSPPAPPSPEPPSPAPPSPFPPSP 839

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 38/101 (37%), Positives = 54/101 (53%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  P  A P+P+   P+   PP+  PP+  PP +  PP+  PP+  PP+PA  P+  PP
Sbjct: 800  SPAPPSPAPPSPEPPSPSPPAPPSPEPPSPAPP-SPFPPSPQPPSPEPPSPA-PPSPVPP 857

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P P +   PP+P P SL P      +P PP
Sbjct: 858  SPAPPSPAPPSPEPPSP-EPPSPAPPSLEPPSPAPPSPAPP 897

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 39/102 (38%), Positives = 54/102 (52%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +PAP +  P +  PP+  PP+  PP+   PP+  PP+  PP+PA  P+ +PP+
Sbjct: 841  PPSPEPPSPAPPSPVPPSPAPPSPAPPSPEPPSPE-PPSPAPPSLEPPSPAP-PSPAPPS 898

Query: 184  PTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S   PS AP      SP  P+P+   P P  +  PP P
Sbjct: 899  PEPPSPAPPSPAPPSPQPPSPEPPSPEPPSPPPPPSPAPPSP 940

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/110 (37%), Positives = 56/110 (50%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKA--------QPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS 159
           P +PP   P P           PPA++ PP+  PP+  PP+ A PP+  PP+  PP+PA 
Sbjct: 568 PPRPPPRAPRPSPPFHPPSPDSPPASSVPPSPEPPSPKPPSPA-PPSPAPPSPPPPSPAP 626

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSP--PAPTPDSLGPGPSGADTPPPP 303
            P+ +PP+P P S    +P P    SP  P+P P S  P      +P PP
Sbjct: 627 -PSPAPPSPAPPSPQPPSPVPPQPPSPVPPSPKPPSPAPPSPVPPSPAPP 675

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 34/101 (33%), Positives = 50/101 (49%), Gaps = 2/101 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA--TPPTATPPTATPPAPASSPATSP 177
           P  P   +P P +  P +  PP+  PP   PP+ A   PP+  PP+  PP+P   P+ +P
Sbjct: 659 PPSPAPPSPVPPSPAPPSPAPPSPAPPNPAPPSPAPPLPPSPEPPSPAPPSP-EPPSPAP 717

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P+P P S    +P P +   P  P+P+   P P   + P P
Sbjct: 718 PSPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPEPPSP 758

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 37/100 (37%), Positives = 54/100 (54%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +PAP +  P +  PP+  PP+  PP +  PP+  PP+  PP+PA  P+ +PP+
Sbjct: 1185 PPSPEPPSPAPPSPAPPSPAPPSPEPPSPEPP-SPEPPSPAPPSPAPPSPA-PPSPAPPS 1242

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1243 PAPPSPAPPSPQPPSP-APPSPEPPSPAPPSPAPPSPAPP 1281

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 39/106 (36%), Positives = 53/106 (50%), Gaps = 6/106 (5%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA----TPPTATPPTATPPAPA--SS 162
            AP  P   +PAP +  P +  PP+  PP+  PP+ A     PP+  PP+  PP+PA    
Sbjct: 1249 APPSPQPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPEPPSPAPPQP 1308

Query: 163  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P+  PP+P P S    AP P+ A  P  P+P    P P  +  P P
Sbjct: 1309 PSPVPPSPAPPSPTPPAPAPAAALPPLPPSPAPPLPVPPASPAPSP 1354

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 38/107 (35%), Positives = 54/107 (50%), Gaps = 6/107 (5%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS--PATS 174
           +P  P   +P P +  P +  PP+  PP+  PP+ A PP+  PP   PP+PA    P+  
Sbjct: 643 SPVPPQPPSPVPPSPKPPSPAPPSPVPPSPAPPSPA-PPSPAPPNPAPPSPAPPLPPSPE 701

Query: 175 PPAPTPASTPSTAPTPSTAG----SPPAPTPDSLGPGPSGADTPPPP 303
           PP+P P S    +P P +      +PP+P P S  P P    +P PP
Sbjct: 702 PPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPS--PAPPAPPSPEPP 746

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 41/101 (40%), Positives = 54/101 (53%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  P  A P+P    P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  P+ +PP
Sbjct: 681 SPAPPNPAPPSPAPPLPPSPEPPSPAPPSPEPPSPA-PPSPAPPSPAPPSPAP-PSPAPP 738

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           AP     PS AP PS    PP+P P S  P      +P PP
Sbjct: 739 APPSPEPPSPAP-PSP--EPPSPAPPSPAPPSPAPPSPAPP 776

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 38/100 (38%), Positives = 49/100 (49%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  P  A P+P    PA   PP+  PP+  PP+   PP+  PP+  PP+P   P+ SPP
Sbjct: 762  SPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPE-PPSPAPPSPAPPSP-EPPSPSPP 819

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            AP     PS AP      SP  P+P+   P P     P P
Sbjct: 820  APPSPEPPSPAPPSPFPPSPQPPSPEPPSPAPPSPVPPSP 859

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 35/100 (35%), Positives = 51/100 (51%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +PAP +  P +  PP+  PP+  PP +  PP+  PP+  PP   + P+ +PP+
Sbjct: 886  PPSPAPPSPAPPSPEPPSPAPPSPAPPSPQPP-SPEPPSPEPPSPPPPPSPAPPSPAPPS 944

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S P        + +PP+PTP S  P      +P PP
Sbjct: 945  PEPPSPPPPPSPAPPSPAPPSPTPPSPVPPSPAPPSPDPP 984

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 37/100 (37%), Positives = 54/100 (54%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P  A P+P+   P +  PP+  PP+  PP+ A PP+  PP+  PP+P   P+ +PP+
Sbjct: 1170 PAPPSPAPPSPQPLEPPSPEPPSPAPPSPAPPSPA-PPSPEPPSPEPPSP-EPPSPAPPS 1227

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1228 PAPPSPAPPSPAPPSP-APPSPAPPSPQPPSPAPPSPEPP 1266

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 40/104 (38%), Positives = 51/104 (49%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS--SPATSP 177
           P  P   +PAP +  P +  PP+  PP+  PP+ A PP+  PP+  PP P S   P+  P
Sbjct: 601 PPSPKPPSPAPPSPAPPSPPPPSPAPPSPAPPSPA-PPSPQPPSPVPPQPPSPVPPSPKP 659

Query: 178 PAPTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P P S   PS AP      SP  P P    P P    +P PP
Sbjct: 660 PSPAPPSPVPPSPAPPSPAPPSPAPPNPAPPSPAPPLPPSPEPP 703

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 11/110 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPA-------AATPPTATPPTATPPAPAS- 159
           P  P   +PAP + PP +  PP+  PP+  PP+          PP+  PP+  PP+PA  
Sbjct: 606 PPSPAPPSPAPPSPPPPSPAPPSPAPPSPAPPSPQPPSPVPPQPPSPVPPSPKPPSPAPP 665

Query: 160 ---SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
               P+ +PP+P P S     P P +   P  P+P+   P P   + P P
Sbjct: 666 SPVPPSPAPPSPAPPSPAPPNPAPPSPAPPLPPSPEPPSPAPPSPEPPSP 715

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 37/101 (36%), Positives = 53/101 (52%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  P   +PAP +  P +  PP+  PP+  PP +  PP+  PP+  PP+P   P+  PP
Sbjct: 820  APPSPEPPSPAPPSPFPPSPQPPSPEPPSPAPP-SPVPPSPAPPSPAPPSP-EPPSPEPP 877

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 878  SPAPPSLEPPSPAPPSP-APPSPEPPSPAPPSPAPPSPQPP 917

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 37/101 (36%), Positives = 51/101 (50%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  P   +P P +  P +  PP+  PP+  PP +  PP+  PP+  PP+P   P+  PP
Sbjct: 865  APPSPEPPSPEPPSPAPPSLEPPSPAPPSPAPP-SPEPPSPAPPSPAPPSP-QPPSPEPP 922

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S P        + +PP+P P S  P PS A   P P
Sbjct: 923  SPEPPSPPPPPSPAPPSPAPPSPEPPSPPPPPSPAPPSPAP 963

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 35/100 (35%), Positives = 52/100 (52%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P+  P +   P  +PP+   PP+  PP+  PP+   P    PP+  PP+PA  P+ +PP+
Sbjct: 912  PSPQPPSPEPPSPEPPSPPPPPSPAPPSPAPPSPEPPSPPPPPSPAPPSPAP-PSPTPPS 970

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 971  PVPPSPAPPSPDPPSP-APPSPDPPSPAPPSPAPPSPNPP 1009

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 40/112 (35%), Positives = 55/112 (49%), Gaps = 11/112 (9%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP----------PTATPPTATPPA 150
            AP  P   +PAP +  P +  PP+  PP+ +PPA  +P          P+  PP+  PP+
Sbjct: 1086 APPSPAPPSPAPPSPAPPSPEPPSPAPPSPSPPAPPSPEPPSPAPLLPPSPDPPSPAPPS 1145

Query: 151  PASSP-ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P   P  TSPP+P P   P+  P+P    SP  P+P  L P      +P PP
Sbjct: 1146 PMPPPLPTSPPSPEPV-PPTPPPSPPAPPSPAPPSPQPLEPPSPEPPSPAPP 1196

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 38/108 (35%), Positives = 53/108 (49%), Gaps = 8/108 (7%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA--TPPTATPPTATPPAP----ASS 162
            AP  P   +PAP +  P +  PP+  PP+  PP+ +   PP+  PP+  PP+P       
Sbjct: 782  APPSPEPPSPAPPSPEPPSPAPPSPAPPSPEPPSPSPPAPPSPEPPSPAPPSPFPPSPQP 841

Query: 163  PATSPPAPTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P+  PP+P P S   PS AP      SP  P+P+   P P   + P P
Sbjct: 842  PSPEPPSPAPPSPVPPSPAPPSPAPPSPEPPSPEPPSPAPPSLEPPSP 889

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/101 (36%), Positives = 54/101 (53%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  P  + PAP +  P +  PP+  PP+  PP +  PP+  PP+  PP+PA  P+ +PP
Sbjct: 810  SPEPPSPSPPAPPSPEPPSPAPPSPFPPSPQPP-SPEPPSPAPPSPVPPSPA-PPSPAPP 867

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P P +   PP+P P S  P      +P PP
Sbjct: 868  SPEPPSPEPPSPAPPSL-EPPSPAPPSPAPPSPEPPSPAPP 907

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 39/103 (37%), Positives = 50/103 (48%), Gaps = 4/103 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS----SPAT 171
            P  P   +P P +  P +  PP+  PP+  PP +  PP+  PPT   P P S    SPA 
Sbjct: 973  PPSPAPPSPDPPSPAPPSPDPPSPAPPSPAPP-SPNPPSPVPPTPPSPGPPSPEPPSPAP 1031

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            SPP PTP ++P   P    +  PP+P P  L P P      PP
Sbjct: 1032 SPPPPTPPTSPPPPPPEPPSPEPPSPAP-PLPPSPEPPSPAPP 1073

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 39/102 (38%), Positives = 54/102 (52%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPT--ATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
            PT PP+  A P+P    P    PP+  PP+  PP+ A PP+  PP+  PP+P   P+  P
Sbjct: 1163 PTPPPSPPAPPSPAPPSPQPLEPPSPEPPSPAPPSPA-PPSPAPPSPEPPSP-EPPSPEP 1220

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1221 PSPAPPSPAPPSPAPPSP-APPSPAPPSPAPPSPQPPSPAPP 1261

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 39/101 (38%), Positives = 54/101 (53%), Gaps = 2/101 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA--SSPATSP 177
            P  P   +PAP +  P +  PP+  PP+  PP+ A PP+  PP+  PP+P+  + P+  P
Sbjct: 1067 PPSPAPPSPAPPSPQPPSPAPPSPAPPSPAPPSPA-PPSPEPPSPAPPSPSPPAPPSPEP 1125

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P+P P   PS  P PS A  PP+P P  L   P   +  PP
Sbjct: 1126 PSPAPLLPPSPDP-PSPA--PPSPMPPPLPTSPPSPEPVPP 1163

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 41/109 (37%), Positives = 54/109 (49%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAAT---PPTATPPTATPPAAATP--PTATPPTATPPAPA---- 156
            P  P   +PAP   PP   T   PP   PP+  PP+ A P  P+  PP+  PP+PA    
Sbjct: 1021 PPSPEPPSPAPSPPPPTPPTSPPPPPPEPPSPEPPSPAPPLPPSPEPPSPAPPSPAPPSP 1080

Query: 157  SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P+ +PP+P P S    +P P +   PP+P P S  P P    +P PP
Sbjct: 1081 QPPSPAPPSPAPPSPAPPSPAPPSP-EPPSPAPPS--PSPPAPPSPEPP 1126

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 39/109 (35%), Positives = 53/109 (48%), Gaps = 13/109 (11%)
 Frame = +1

Query: 13  PPTATPAPKA-------------QPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP 153
           PP   P P+A              PPA++ PP+  PP+  PP+ A PP+  PP+  PP+P
Sbjct: 566 PPPPRPPPRAPRPSPPFHPPSPDSPPASSVPPSPEPPSPKPPSPA-PPSPAPPSPPPPSP 624

Query: 154 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           A  P+ +PP+P P S    +P P    SP  P+P    P P     P P
Sbjct: 625 A-PPSPAPPSPAPPSPQPPSPVPPQPPSPVPPSPKPPSPAPPSPVPPSP 672

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 40/108 (37%), Positives = 54/108 (50%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA----SSPAT 171
           P  PP+    P +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA    + P+ 
Sbjct: 581 PFHPPSPDSPPASSVPPSPEPPSPKPPSPAPPSPA-PPSPPPPSPAPPSPAPPSPAPPSP 639

Query: 172 SPPAPTPASTPSTAP----TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP+P P   PS  P     PS A  PP+P P S  P      +P PP
Sbjct: 640 QPPSPVPPQPPSPVPPSPKPPSPA--PPSPVPPSPAPPSPAPPSPAPP 685

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 37/101 (36%), Positives = 50/101 (49%), Gaps = 2/101 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P+  P +   P  +PP+   P    PP+  PP+ A PP+  PP+  PP   + P+ +PP+
Sbjct: 907  PSPAPPSPQPPSPEPPSPEPPSPPPPPSPAPPSPA-PPSPEPPSPPPPPSPAPPSPAPPS 965

Query: 184  PTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            PTP S   PS AP      SP  P+PD   P P     P P
Sbjct: 966  PTPPSPVPPSPAPPSPDPPSPAPPSPDPPSPAPPSPAPPSP 1006

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 39/104 (37%), Positives = 50/104 (48%), Gaps = 3/104 (2%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  P   +PAP +  P +  PP+  PP+  PP+ A PP+ +PP    P P S     PP
Sbjct: 1076 APPSPQPPSPAPPSPAPPSPAPPSPAPPSPEPPSPA-PPSPSPPAPPSPEPPSPAPLLPP 1134

Query: 181  APTPAS--TPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPPP 303
            +P P S   PS  P P     P P P P +  P P    +P PP
Sbjct: 1135 SPDPPSPAPPSPMPPPLPTSPPSPEPVPPTPPPSPPAPPSPAPP 1178

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 37/105 (35%), Positives = 52/105 (49%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTA--TPPTATPPAAATPPTATPPTATPPAPAS--SPA 168
            +P  P    P P +  P +  PP+   +PP  TPP +  PP   PP+  PP+PA    P+
Sbjct: 1005 SPNPPSPVPPTPPSPGPPSPEPPSPAPSPPPPTPPTSPPPPPPEPPSPEPPSPAPPLPPS 1064

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              PP+P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1065 PEPPSPAPPSPAPPSPQPPSP-APPSPAPPSPAPPSPAPPSPEPP 1108

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 40/106 (37%), Positives = 55/106 (51%), Gaps = 6/106 (5%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPA--AATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
            +P  P  A P+P+   PA  +  PP+  PP+  PP+ A PP+  PP+  PP+PA     S
Sbjct: 1252 SPQPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPA-PPSPAPPSPEPPSPAPPQPPS 1310

Query: 175  PPAPTPASTPSTAPTPSTAGS----PPAPTPDSLGPGPSGADTPPP 300
            P  P+PA    T P P+ A +    PP+P P    P  S A +P P
Sbjct: 1311 PVPPSPAPPSPTPPAPAPAAALPPLPPSPAPPLPVPPASPAPSPSP 1356

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 46/111 (41%), Positives = 55/111 (49%), Gaps = 10/111 (9%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAAT-------PPTATPPTATPPA--- 150
            AP  P   +PAP  QPP+   PP+  PP+ TPPA A        PP+  PP   PPA   
Sbjct: 1294 APPSPEPPSPAPP-QPPSPV-PPSPAPPSPTPPAPAPAAALPPLPPSPAPPLPVPPASPA 1351

Query: 151  PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+ SP   P   TPA  P +   PS A  PP+P P  + P P    TP PP
Sbjct: 1352 PSPSPLRPPQPQTPAMPPPSPAPPSPA--PPSPAPPGVPPPP---PTPTPP 1397

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 38/104 (36%), Positives = 54/104 (51%), Gaps = 3/104 (2%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQP---PAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT 171
            AP  P   +P P   P   P +  PP+  PP+  PP +  PP+  PP+  PP+PA  P+ 
Sbjct: 1171 APPSPAPPSPQPLEPPSPEPPSPAPPSPAPPSPAPP-SPEPPSPEPPSPEPPSPA-PPSP 1228

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +PP+P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1229 APPSPAPPSPAPPSPAPPSP-APPSPQPPSPAPPSPEPPSPAPP 1271

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 39/116 (33%), Positives = 54/116 (46%), Gaps = 15/116 (12%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATP-------------PTATPPAAATPPTATPPTAT 141
           +P  PP + P P + PP   +PP+ TP             P+  PP+   P   +PP   
Sbjct: 509 SPPSPPPSPPEPPSPPPLPPSPPSPTPVARCIQVGGICDSPSPMPPSPRPPQPPSPPPPP 568

Query: 142 PPAPASSPATSPP--APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P  P  +P  SPP   P+P S P+++  PS    PP+P P S  P      +PPPP
Sbjct: 569 PRPPPRAPRPSPPFHPPSPDSPPASSVPPSP--EPPSPKPPSPAPPSPAPPSPPPP 622

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 39/102 (38%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAAT-PPTATP-PTATPPAPASSPATSP 177
            P  P    P+P    P +  PP+  PP+  PP   T PP+  P P   PP+P + P+ +P
Sbjct: 1118 PAPPSPEPPSPAPLLPPSPDPPSPAPPSPMPPPLPTSPPSPEPVPPTPPPSPPAPPSPAP 1177

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P P   PS  P PS A  PP+P P S  P      +P PP
Sbjct: 1178 PSPQPLEPPSPEP-PSPA--PPSPAPPSPAPPSPEPPSPEPP 1216

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 39/104 (37%), Positives = 56/104 (53%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTA--TPPTATPPA--AATPPTATPPTATPPAPASSPAT 171
            P   PT+ P+P+  PP   TPP +   PP+  PP+     PP+  PP+  PP+PA  P+ 
Sbjct: 1148 PPPLPTSPPSPEPVPP---TPPPSPPAPPSPAPPSPQPLEPPSPEPPSPAPPSPA-PPSP 1203

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +PP+P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1204 APPSPEPPSPEPPSPEPPSP-APPSPAPPSPAPPSPAPPSPAPP 1246

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 6/107 (5%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA----TPPTATPPTATPPAPA--SS 162
           A + PP+  P P  +PP+ A PP+  PP+  PP+ A     PP+  PP+  PP+P     
Sbjct: 592 ASSVPPSPEP-PSPKPPSPA-PPSPAPPSPPPPSPAPPSPAPPSPAPPSPQPPSPVPPQP 649

Query: 163 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+  PP+P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 650 PSPVPPSPKPPSPAPPSPVPPSP-APPSPAPPSPAPPNPAPPSPAPP 695

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 38/105 (36%), Positives = 50/105 (47%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTA--TPPTATPPAPA--SSPA 168
            AP  PP+  P P   PP+   PP  T P +  P   TPP +   PP+  PP+P     P+
Sbjct: 1129 APLLPPSPDP-PSPAPPSPMPPPLPTSPPSPEPVPPTPPPSPPAPPSPAPPSPQPLEPPS 1187

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              PP+P P S    +P P +   PP+P P S  P      +P PP
Sbjct: 1188 PEPPSPAPPSPAPPSPAPPSP-EPPSPEPPSPEPPSPAPPSPAPP 1231

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 35/100 (35%), Positives = 48/100 (48%), Gaps = 3/100 (3%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATP-PTATPPAAATPPTATPPTATPPAPAS--SPATSPPA 183
            PP+  P     PP   +PP+  P P   PP+   PP+  PP+  P  P S   P+ +PP+
Sbjct: 1138 PPSPAPPSPMPPPLPTSPPSPEPVPPTPPPSPPAPPSPAPPSPQPLEPPSPEPPSPAPPS 1197

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S    +P P +   PP+P P S  P      +P PP
Sbjct: 1198 PAPPSPAPPSPEPPSP-EPPSPEPPSPAPPSPAPPSPAPP 1236

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 36/101 (35%), Positives = 49/101 (48%), Gaps = 4/101 (3%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATP----PAAATPPTATPPTATPPAPASSPATSPP 180
            PP+  P P    P +  P   TPP + P    PA  +P    PP+  PP+PA  P+ +PP
Sbjct: 1143 PPSPMPPPLPTSPPSPEPVPPTPPPSPPAPPSPAPPSPQPLEPPSPEPPSPA-PPSPAPP 1201

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P P +   PP+P P S  P      +P PP
Sbjct: 1202 SPAPPSPEPPSPEPPSP-EPPSPAPPSPAPPSPAPPSPAPP 1241

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 38/102 (37%), Positives = 51/102 (50%), Gaps = 5/102 (4%)
 Frame = +1

Query: 13  PPTATPAPKA-QPPAAATPPTATPPTA---TPPAAATPPTATPPTATPPAPASSPATSPP 180
           P    P+P+  QPP+   PP   PP A   +PP     P + P ++ PP+P   P+  PP
Sbjct: 549 PSPMPPSPRPPQPPSPPPPPPRPPPRAPRPSPPFHPPSPDSPPASSVPPSP-EPPSPKPP 607

Query: 181 APTPAS-TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P S  P + P PS A  PP+P P S  P      +P PP
Sbjct: 608 SPAPPSPAPPSPPPPSPA--PPSPAPPSPAPPSPQPPSPVPP 647

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 36/90 (40%), Positives = 40/90 (44%), Gaps = 6/90 (6%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPP---TATPPTATPPAAATP---PTATPPTATPPAPASSP 165
            P  P   +P P A  PAAA PP   +  PP   PPA+  P   P   P   TP  P  SP
Sbjct: 1313 PPSPAPPSPTPPAPAPAAALPPLPPSPAPPLPVPPASPAPSPSPLRPPQPQTPAMPPPSP 1372

Query: 166  ATSPPAPTPASTPSTAPTPSTAGSPPAPTP 255
            A   PAP   + P   P P T   P AP P
Sbjct: 1373 APPSPAPPSPAPPGVPPPPPTPTPPLAPLP 1402

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 33/96 (34%), Positives = 45/96 (46%), Gaps = 3/96 (3%)
 Frame = +1

Query: 25  TPAPKAQPPAAATPPTATPPTATPPAAA---TPPTATPPTATPPAPASSPATSPPAPTPA 195
           +P+P    P    PP+  PP   PP  A   +PP   P   +PPA +  P+  PP+P P 
Sbjct: 548 SPSPMPPSPRPPQPPSPPPPPPRPPPRAPRPSPPFHPPSPDSPPASSVPPSPEPPSPKPP 607

Query: 196 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           S    +P P +   PP+P P S  P      +P PP
Sbjct: 608 SPAPPSPAPPSP-PPPSPAPPSPAPPSPAPPSPQPP 642

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 37/125 (29%), Positives = 51/125 (40%), Gaps = 28/125 (22%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATP----PTATPPAAATPPTAT------------------ 126
           PP   P+P   PP+  +PP+  P    P + PP   +PP+ T                  
Sbjct: 493 PPLLPPSPPVPPPSPPSPPSPPPSPPEPPSPPPLPPSPPSPTPVARCIQVGGICDSPSPM 552

Query: 127 PPTATPPAPASSPATSP------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
           PP+  PP P S P   P      P P+P   P +  +P  +  PP+P P S  P      
Sbjct: 553 PPSPRPPQPPSPPPPPPRPPPRAPRPSPPFHPPSPDSPPASSVPPSPEPPSPKPPSPAPP 612

Query: 289 TPPPP 303
           +P PP
Sbjct: 613 SPAPP 617

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 34/102 (33%), Positives = 45/102 (44%), Gaps = 1/102 (0%)
 Frame = +1

Query: 1   APTKPPTA-TPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           AP  PP+  +P P   PP   +PP   PP   P     PP+   P + PP+P   P+  P
Sbjct: 469 APPPPPSPPSPRPPRPPPLPPSPP---PPLLPPSPPVPPPSPPSPPSPPPSPPEPPSPPP 525

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+P S    A      G   +P+P    P P    +PPPP
Sbjct: 526 LPPSPPSPTPVARCIQVGGICDSPSPMPPSPRPPQPPSPPPP 567

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 40/123 (32%), Positives = 54/123 (43%), Gaps = 23/123 (18%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQ--PPAAATPPTATP-PTATPPAAATPPTATPPTATPPAP------- 153
           P +PP   P+P     PP+   PP + P P + PP+   PP+  P   +PP+P       
Sbjct: 481 PPRPPPLPPSPPPPLLPPSPPVPPPSPPSPPSPPPSPPEPPSPPPLPPSPPSPTPVARCI 540

Query: 154 -----ASSPATSPPAPTPASTPSTAPTP------STAGSPP--APTPDSLGPGPSGADTP 294
                  SP+  PP+P P   PS  P P      +   SPP   P+PDS    P  +  P
Sbjct: 541 QVGGICDSPSPMPPSPRPPQPPSPPPPPPRPPPRAPRPSPPFHPPSPDS----PPASSVP 596

Query: 295 PPP 303
           P P
Sbjct: 597 PSP 599

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 37/112 (33%), Positives = 48/112 (42%), Gaps = 14/112 (12%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP-PTATPPAPASSPATSP--- 177
           +PP   P P + PP    P    PP + PP+  +PP + P P + PP P S P+ +P   
Sbjct: 480 RPPRPPPLPPSPPPPLLPPSPPVPPPS-PPSPPSPPPSPPEPPSPPPLPPSPPSPTPVAR 538

Query: 178 ----------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                     P+P P   PS  P    +  PP P P    P PS    PP P
Sbjct: 539 CIQVGGICDSPSPMP---PSPRPPQPPSPPPPPPRPPPRAPRPSPPFHPPSP 587

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 37/107 (34%), Positives = 47/107 (43%), Gaps = 11/107 (10%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP-PAPT 189
           PP + P+P+  PP     P + PP   PP+   PP + P   +PP+P  SP   P P P 
Sbjct: 472 PPPSPPSPR--PPRPPPLPPSPPPPLLPPSPPVPPPSPP---SPPSPPPSPPEPPSPPPL 526

Query: 190 PASTPSTAPTP----------STAGSPPAPTPDSLGPGPSGADTPPP 300
           P S PS  P            S +  PP+P P    P P     PPP
Sbjct: 527 PPSPPSPTPVARCIQVGGICDSPSPMPPSPRP----PQPPSPPPPPP 569

[45][TOP]
>UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1
            Tax=Ostreococcus tauri RepID=Q010M7_OSTTA
          Length = 1449

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 42/103 (40%), Positives = 58/103 (56%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAAT-PPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            P+ PP  +P P   PP A T PP  +PP + PP+   PP+  PP + PP+P+  P+++PP
Sbjct: 848  PSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPP 907

Query: 181  --APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              +P P S+P    +P    SPP P+P  L P P     PPPP
Sbjct: 908  LSSPPPLSSPPPLSSPPPPSSPPPPSP-PLPPSPPLPPNPPPP 949

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/103 (42%), Positives = 53/103 (51%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP-- 177
            P+ PP  +P P   PP+   PP   PPT  PP+   PP+  PP ++PP P+ SP  SP  
Sbjct: 797  PSPPPPPSPPPPPPPPSPPPPPN--PPT--PPSPPPPPSPPPPPSSPPPPSPSPPPSPPP 852

Query: 178  -PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+P P   P  APTP    SPP   P S  P PS    P PP
Sbjct: 853  APSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPP 895

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/115 (38%), Positives = 58/115 (50%), Gaps = 15/115 (13%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTA-TPPAPASSPATSPP 180
            P+ PP  +P P   PP++  PP+ +PP + PPA + PP   PP A TPP P S P + PP
Sbjct: 824  PSPPPPPSPPP---PPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPP 880

Query: 181  APTPASTPSTAPTPSTAGSPP--------------APTPDSLGPGPSGADTPPPP 303
            +P P  +P   P+P  + SPP              +P P S  P PS    P PP
Sbjct: 881  SPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSPP 935

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 38/102 (37%), Positives = 52/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  PP+  P P + PP + +PP + PP  +PP    PP A  P   P  P S P + PP
Sbjct: 825  SPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPP 884

Query: 181  APTPASTPSTAPTPS--TAGSPPAPTPDSLGPGPSGADTPPP 300
             P+P   PS  P+PS   + +PP  +P  L   P  +  PPP
Sbjct: 885  PPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPP 926

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 43/105 (40%), Positives = 53/105 (50%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS--- 174
            P+ PP   P+P   P     PP  +PP   PP   TPP+  PP + PP P+S P  S   
Sbjct: 789  PSPPPPLPPSPPPPPSPPPPPPPPSPPP--PPNPPTPPSPPPPPSPPPPPSSPPPPSPSP 846

Query: 175  PPAPTPASTPSTAPTPSTAGSPPAP--TPDSLGPGPSGADTPPPP 303
            PP+P PA +P   P P  A +PP P   P S  P P    +PPPP
Sbjct: 847  PPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPP 891

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 41/102 (40%), Positives = 53/102 (51%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTA--TPPAAATPPTATPPTATPPAPASSPATSP 177
            P+ PP   P     PP   TPP+  PP +   PP++  PP+ +PP + PPAP+  P   P
Sbjct: 803  PSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPP---P 859

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P PA TP   P+P  +  P  P P S  P PS   +P PP
Sbjct: 860  PNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPP 901

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 36/102 (35%), Positives = 48/102 (47%), Gaps = 4/102 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTAT----PPTATPPAAATPPTATPPTATPPAPASSPAT 171
            P  PP  +P P   PP   +PP       PP++ PP + +PP + PP  +PP P + P  
Sbjct: 806  PPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPA 865

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
              P P P+  PS  P+P    SPP P      P P  +  PP
Sbjct: 866  PTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPP 907

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/109 (37%), Positives = 57/109 (52%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPT-ATPPAPASSPATSPP 180
            P+ PP+  P P   PP +  P  + PP++ PP ++ PP ++PP  ++PP P+S P  SPP
Sbjct: 876  PSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSPP 935

Query: 181  AP-TPASTPSTAPTPSTA-------GSPPAPTPDSLGPGPSGADTPPPP 303
             P +P   P+  P PS +         P  PTP    P PS    PPPP
Sbjct: 936  LPPSPPLPPNPPPPPSPSPXXXXXXXPPRLPTPSP--PPPSPPLPPPPP 982

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 41/100 (41%), Positives = 48/100 (48%), Gaps = 7/100 (7%)
 Frame = +1

Query: 25   TPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS---PATSPPAPTPA 195
            +P P   PP   +PP    P   PP  + PP   PPT   P P  S   P +SPP P+P+
Sbjct: 786  SPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPS 845

Query: 196  STPSTAPTPS---TAGSPPAPT-PDSLGPGPSGADTPPPP 303
              PS  P PS       PPAPT P    P PS   +PPPP
Sbjct: 846  PPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPP 885

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 36/98 (36%), Positives = 51/98 (52%), Gaps = 11/98 (11%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPP--TATPPAAATPPTATPPTATPPAPASSPATSP 177
            P+ PP  +P P   PP ++ PP ++PP  ++ PP ++ PP ++PP  +PP P S P    
Sbjct: 886  PSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSPPLPPSPPLPPN 945

Query: 178  PAPTPASTPSTA--------PTPSTAG-SPPAPTPDSL 264
            P P P+ +P           PTPS    SPP P P  L
Sbjct: 946  PPPPPSPSPXXXXXXXPPRLPTPSPPPPSPPLPPPPPL 983

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 38/94 (40%), Positives = 50/94 (53%), Gaps = 3/94 (3%)
 Frame = +1

Query: 31   APKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPST 210
            A ++ PP+   PP   PP + PP  + PP   PP+  PP    +P + PP P+P   PS+
Sbjct: 783  ARQSPPPS---PPPPLPP-SPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSS 838

Query: 211  APTPSTA---GSPPAPTPDSLGPGPSGADTPPPP 303
             P PS +     PPAP+P    P P  A TPPPP
Sbjct: 839  PPPPSPSPPPSPPPAPSPPP-PPNPPPAPTPPPP 871

[46][TOP]
>UniRef100_C5X8F7 Putative uncharacterized protein Sb02g032910 n=1 Tax=Sorghum
           bicolor RepID=C5X8F7_SORBI
          Length = 493

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/112 (47%), Positives = 64/112 (57%), Gaps = 12/112 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQP-PAAATPPTATPPT--ATPPAAATP-PTATPPTATPPAPASSPAT 171
           P  PP +TP P  +P P+ +TPP A+PP   +TPP A+ P P +TPP A+PP P + P  
Sbjct: 152 PMNPPPSTPPPVPEPTPSPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPLTPPEA 211

Query: 172 SPPAP--TPASTPSTAPTPST--AGSPPAP--TPDSLGPGPSGADTPP--PP 303
           SPP P  TP   P   P+PST  A SPP P  TP    P P    TPP  PP
Sbjct: 212 SPPEPPSTPPPVPEPTPSPSTPPAASPPEPPSTPPEASP-PEPPSTPPEAPP 262

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/109 (47%), Positives = 64/109 (58%), Gaps = 10/109 (9%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQP-PAAATPPTATPPT--ATPPAAATP-PTATPPTATPPAPASSPA 168
           +P +PP+ TP P  +P P+ +TPP A+PP   +TPP A+ P P +TPP A PP P + P 
Sbjct: 212 SPPEPPS-TPPPVPEPTPSPSTPPAASPPEPPSTPPEASPPEPPSTPPEAPPPEPLTPPE 270

Query: 169 TSPPAP--TPASTPSTAPTPST--AGSPPAP--TPDSLGPGPSGADTPP 297
            SPP P  TP S P   P+PST  A SPP P  TP    P P    TPP
Sbjct: 271 ASPPEPPSTPPSVPEPTPSPSTPPAASPPEPPSTPPEASP-PEPPSTPP 318

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 48/111 (43%), Positives = 63/111 (56%), Gaps = 12/111 (10%)
 Frame = +1

Query: 4   PTKPPTATPA------PKAQPPAA-ATPPTATPPT--ATPPAAATP-PTATPPTATPPAP 153
           P+ PP A+P       P+A PP   +TPP A+PP   +TPP A+ P P +TPP A+PP P
Sbjct: 302 PSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEP 361

Query: 154 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAP--TPDSLGPGPSGADTPPP 300
            S+P  S P   P++ P+T+P    A SPP P  TP +  P P     PPP
Sbjct: 362 PSTPPASSPPEPPSTPPATSPPEPPAASPPEPPSTPPAASP-PESPSVPPP 411

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 49/110 (44%), Positives = 62/110 (56%), Gaps = 11/110 (10%)
 Frame = +1

Query: 4   PTKPPTATPA------PKAQPPAA-ATPPTATPPT--ATPPAAATP-PTATPPTATPPAP 153
           P+ PP A+P       P+A PP   +TPP A+PP   +TPP A+ P P +TPP ++PP P
Sbjct: 314 PSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPASSPPEP 373

Query: 154 ASSP-ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            S+P ATSPP P  AS P    TP  A  P +P+     P P    TPPP
Sbjct: 374 PSTPPATSPPEPPAASPPEPPSTPPAASPPESPSV----PPPESQSTPPP 419

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 47/110 (42%), Positives = 59/110 (53%), Gaps = 9/110 (8%)
 Frame = +1

Query: 1   APTKPPTATPA-PKAQPPAAATP-PTATPPTATPPAAATPPTATP--PTATPPA---PAS 159
           +P+ PP A+P  P + PP A+ P P +TPP A PP   TPP A+P  P +TPP+   P  
Sbjct: 229 SPSTPPAASPPEPPSTPPEASPPEPPSTPPEAPPPEPLTPPEASPPEPPSTPPSVPEPTP 288

Query: 160 SPATSPPA--PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           SP+T P A  P P STP  A  P    +PP  +P      P  A  P PP
Sbjct: 289 SPSTPPAASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPP 338

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 41/104 (39%), Positives = 57/104 (54%), Gaps = 3/104 (2%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPT--ATPPAAATP-PTATPPTATPPAPASSPAT 171
           +P +PP+  P+     P+ +TPP A+PP   +TPP A+ P P +TPP A+PP P S+P  
Sbjct: 272 SPPEPPSTPPSVPEPTPSPSTPPAASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPE 331

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           + P P P STP  A  P    +PP  +P      P  +  P PP
Sbjct: 332 ASP-PEPPSTPPEASPPEPPSTPPEASPPEPPSTPPASSPPEPP 374

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 42/106 (39%), Positives = 58/106 (54%), Gaps = 5/106 (4%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPT--ATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           +P +PP+  PA     P AA+PP   +TPP A+PP + + P     +  PP PA +P  S
Sbjct: 369 SPPEPPSTPPATSPPEPPAASPPEPPSTPPAASPPESPSVPPPESQSTPPPTPAMAPPES 428

Query: 175 PPAPTPASTPSTAP-TP--STAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP+  P  +PST P TP  S   +PP  +P +  P  S +D PP P
Sbjct: 429 PPSTPPPESPSTPPRTPPESPPSTPPPESPSTTPPPESPSDPPPTP 474

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 45/110 (40%), Positives = 57/110 (51%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPA------PKAQPPAAATPPTATP--PTATPPAA--ATPPTATPPTATPPAP 153
           P+ PP A+P       P+A PP   TPP A+P  P +TPP+    TP  +TPP A+PP P
Sbjct: 242 PSTPPEASPPEPPSTPPEAPPPEPLTPPEASPPEPPSTPPSVPEPTPSPSTPPAASPPEP 301

Query: 154 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            S+P  + P P P STP  A  P    +PP  +P      P  A  P PP
Sbjct: 302 PSTPPEASP-PEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPP 350

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 47/111 (42%), Positives = 61/111 (54%), Gaps = 10/111 (9%)
 Frame = +1

Query: 1   APTKPPTATPA-PKAQPPAAATP-PTATPPTA-------TPPAAATP-PTATPPTATPPA 150
           +P+ PP A+P  P + PP A+ P P +TPP A       TPP A+ P P +TPP A+PP 
Sbjct: 289 SPSTPPAASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPE 348

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P S+P  + P P P STP  +  P    +PPA +P    P P  A  P PP
Sbjct: 349 PPSTPPEASP-PEPPSTPPASSPPEPPSTPPATSP----PEPPAASPPEPP 394

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATP--PTATPPAAATP-PTATPPTATPPAPASSPAT 171
           +P +PP +TP   + P   +TPP A+P  P +TPPA++ P P +TPP  +PP P ++   
Sbjct: 333 SPPEPP-STPPEASPPEPPSTPPEASPPEPPSTPPASSPPEPPSTPPATSPPEPPAASPP 391

Query: 172 SPPAPTPASTPSTAPT--PSTAGSPPAPTPDSLGPGPSGADTPPP 300
            PP+  PA++P  +P+  P  + S P PTP ++ P  S   TPPP
Sbjct: 392 EPPSTPPAASPPESPSVPPPESQSTPPPTP-AMAPPESPPSTPPP 435

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 43/108 (39%), Positives = 53/108 (49%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTA-------TPPAAATP-PTATPPTATPPAPAS 159
           P   P  TP+P   P A+   P +TPP A       TPP A+ P P +TPP A+PP P S
Sbjct: 280 PPSVPEPTPSPSTPPAASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPS 339

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P  + P P P STP  A  P    +PPA +P      P     P PP
Sbjct: 340 TPPEASP-PEPPSTPPEASPPEPPSTPPASSPPEPPSTPPATSPPEPP 386

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 50/115 (43%), Positives = 64/115 (55%), Gaps = 16/115 (13%)
 Frame = +1

Query: 4   PTKPPTATPA-PKAQPPAAATP-PTATPPTATP--PAAATP--PTATPPTATPP-----A 150
           P+ PP A+P  P + PPA++ P P +TPP  +P  P AA+P  P +TPP A+PP      
Sbjct: 350 PSTPPEASPPEPPSTPPASSPPEPPSTPPATSPPEPPAASPPEPPSTPPAASPPESPSVP 409

Query: 151 PASSPATSPPAPT---PASTPSTAP--TPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P  S +T PP P    P S PST P  +PST    P  +P S  P  S + TPPP
Sbjct: 410 PPESQSTPPPTPAMAPPESPPSTPPPESPSTPPRTPPESPPSTPPPESPSTTPPP 464

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 45/110 (40%), Positives = 56/110 (50%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAA------TPPTATPPT---ATPPAAATP-PTATPPTATPPAP 153
           P+ PP A P     PP A+      TPP+   PT   +TPPAA+ P P +TPP A+PP P
Sbjct: 254 PSTPPEAPPPEPLTPPEASPPEPPSTPPSVPEPTPSPSTPPAASPPEPPSTPPEASPPEP 313

Query: 154 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            S+P  + P P P STP  A  P    +PP  +P      P  A  P PP
Sbjct: 314 PSTPPEASP-PEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPP 362

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 46/114 (40%), Positives = 60/114 (52%), Gaps = 13/114 (11%)
 Frame = +1

Query: 1   APTKPPTATPA-PKAQPPAAATP-PTATPPTATPPAAATPPTA-------TPPTATPPAP 153
           +P+ PP A+P  P + PP A+ P P +TPP A+PP   TPP A       TPP    P P
Sbjct: 169 SPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPLTPPEASPPEPPSTPPPVPEPTP 228

Query: 154 ASS--PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP--PP 303
           + S  PA SPP P P++ P  +P    +  P AP P+ L P  +    PP  PP
Sbjct: 229 SPSTPPAASPPEP-PSTPPEASPPEPPSTPPEAPPPEPLTPPEASPPEPPSTPP 281

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 44/112 (39%), Positives = 58/112 (51%), Gaps = 11/112 (9%)
 Frame = +1

Query: 1   APTKPPTATPA-PKAQPPAAATP--PTATPP----TATPPAAATPPTATPPTATPPAPAS 159
           +P +PP A+P  P + PPAA+ P  P+  PP    T  P  A  PP + P T  P +P++
Sbjct: 381 SPPEPPAASPPEPPSTPPAASPPESPSVPPPESQSTPPPTPAMAPPESPPSTPPPESPST 440

Query: 160 SPAT---SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP-GPSGADTPPPP 303
            P T   SPP+  P  +PST P P +   PP PTP +  P  PS     P P
Sbjct: 441 PPRTPPESPPSTPPPESPSTTPPPESPSDPP-PTPAATSPESPSDPPATPSP 491

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 34/99 (34%), Positives = 48/99 (48%), Gaps = 7/99 (7%)
 Frame = +1

Query: 4   PTKPPTATP--APKAQPPAAATPPTATP---PTATPPAAATPPTATPPTATPPA--PASS 162
           P+ PP A+P  +P   PP + + P  TP   P  +PP+   P + + P  TPP   P++ 
Sbjct: 394 PSTPPAASPPESPSVPPPESQSTPPPTPAMAPPESPPSTPPPESPSTPPRTPPESPPSTP 453

Query: 163 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 279
           P  SP    P  +PS  P    A SP +P+     P PS
Sbjct: 454 PPESPSTTPPPESPSDPPPTPAATSPESPSDPPATPSPS 492

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 30/78 (38%), Positives = 40/78 (51%), Gaps = 4/78 (5%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAA--ATPPTATPPTATPPAPASSPATSPP 180
           T PPT   AP   PP+   P + + P  TPP +  +TPP  +P T  PP   S P  +P 
Sbjct: 416 TPPPTPAMAPPESPPSTPPPESPSTPPRTPPESPPSTPPPESPSTTPPPESPSDPPPTPA 475

Query: 181 APTPAST--PSTAPTPST 228
           A +P S   P   P+PS+
Sbjct: 476 ATSPESPSDPPATPSPSS 493

[47][TOP]
>UniRef100_C7J1V0 Os04g0545250 protein n=2 Tax=Oryza sativa RepID=C7J1V0_ORYSJ
          Length = 298

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 48/106 (45%), Positives = 54/106 (50%), Gaps = 6/106 (5%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPP--AAATPPTATPPTATPPAA----ATPPTATPPTATPPAPASS 162
           A   PPTAT +P    P  A A PP ATPPT   P A    ATPP A PP   PP  A +
Sbjct: 135 AAASPPTATSSPPVSAPTLAVAAPPLATPPTVAAPVASPPLATPPAALPPATAPPTSAPA 194

Query: 163 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P  + P   P +TP+ AP P+     PAP P S  P P  A TP P
Sbjct: 195 PLLAAPVLAPVATPTLAPAPAPVS--PAPAPVSPAPAPIVAPTPAP 238

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 51/111 (45%), Positives = 58/111 (52%), Gaps = 18/111 (16%)
 Frame = +1

Query: 1   APTKPPTATP----APKAQPPAAATPPTATPPTATPPAAATPP-TATP---PTATPP-AP 153
           A   PP ATP    AP A PP A TPP A PP   PP +A  P  A P   P ATP  AP
Sbjct: 154 AVAAPPLATPPTVAAPVASPPLA-TPPAALPPATAPPTSAPAPLLAAPVLAPVATPTLAP 212

Query: 154 ASSPATSPPAP-TPASTPSTAPTPSTAGSP---PAPTPD-----SLGPGPS 279
           A +P +  PAP +PA  P  APTP+   +P   P   P+     SL PGPS
Sbjct: 213 APAPVSPAPAPVSPAPAPIVAPTPAPILAPELSPLMAPELSPLGSLSPGPS 263

[48][TOP]
>UniRef100_Q18DZ3 Probable cell surface glycoprotein n=1 Tax=Haloquadratum walsbyi
           DSM 16790 RepID=Q18DZ3_HALWD
          Length = 1358

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 51/119 (42%), Positives = 64/119 (53%), Gaps = 19/119 (15%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATP---PTATP-PTATPPAAATP-----------PTATPPT 135
           +PT  PT+TP P   P   +TP   PT +P PT TPPA ATP           PT TPP 
Sbjct: 303 SPTPSPTSTPTPSPTPSPTSTPTPSPTPSPTPTPTPPATATPTPTPTPSPTPAPTNTPPP 362

Query: 136 ATPPAPASSPATSP-PAPTPASTPSTAPTPS---TAGSPPAPTPDSLGPGPSGADTPPP 300
            + P P ++P  +P P PTP +TP+  PTP+   TA   P PTP +  P P+   TP P
Sbjct: 363 TSAPTPTATPTPTPTPTPTPTATPTPTPTPTPTPTATPTPTPTP-TPSPTPTATPTPTP 420

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 54/120 (45%), Positives = 66/120 (55%), Gaps = 20/120 (16%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP-PTATP-----PTATPPAAATP-PTATP-PTATP-PAPA 156
           PT  PT +P P   PPA ATP PT TP     PT TPP  + P PTATP PT TP P P 
Sbjct: 324 PTPSPTPSPTPTPTPPATATPTPTPTPSPTPAPTNTPPPTSAPTPTATPTPTPTPTPTPT 383

Query: 157 SSPATSP-PAPTPASTPSTAPTPSTAGSP-------PAPTPD---SLGPGPSGADTPPPP 303
           ++P  +P P PTP +TP+  PTP+ + +P       P PTP    +  P  +   TP PP
Sbjct: 384 ATPTPTPTPTPTPTATPTPTPTPTPSPTPTATPTPTPTPTPSPTPTATPTATATSTPTPP 443

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 49/116 (42%), Positives = 60/116 (51%), Gaps = 17/116 (14%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP-------PTATP---PTATPPAAATPPTATPPTATP-PA 150
           PT  PT+TP P   P   +TP       PT+TP   PT +P    TPP    PT TP P+
Sbjct: 292 PTLTPTSTPTPSPTPSPTSTPTPSPTPSPTSTPTPSPTPSPTPTPTPPATATPTPTPTPS 351

Query: 151 PASSPATSPP---APTPASTPSTAPTPS---TAGSPPAPTPDSLGPGPSGADTPPP 300
           P  +P  +PP   APTP +TP+  PTP+   TA   P PTP    P P+   TP P
Sbjct: 352 PTPAPTNTPPPTSAPTPTATPTPTPTPTPTPTATPTPTPTPT---PTPTATPTPTP 404

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 49/113 (43%), Positives = 62/113 (54%), Gaps = 14/113 (12%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQP-PAAATPPTATP-----PTATPPAAATP---PTATPPTATPPAPA 156
           PT+ PT TP+P   P P     PT TP     PT TP    TP   PT+TP  +  P+P 
Sbjct: 250 PTQTPTPTPSPTPSPTPTPTQTPTPTPLPTPSPTPTPTQTPTPTLTPTSTPTPSPTPSPT 309

Query: 157 SSPATSP-PAPTPASTPSTAPTPSTAGSPPA---PTP-DSLGPGPSGADTPPP 300
           S+P  SP P+PT   TPS  P+P+   +PPA   PTP  +  P P+  +TPPP
Sbjct: 310 STPTPSPTPSPTSTPTPSPTPSPTPTPTPPATATPTPTPTPSPTPAPTNTPPP 362

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 50/114 (43%), Positives = 60/114 (52%), Gaps = 14/114 (12%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-PTATP---------PTATPPA 150
           +PT  PT TP P   P +  TP     PT+TP  + TP PT+TP         PT TPPA
Sbjct: 281 SPTPTPTQTPTPTLTPTSTPTPSPTPSPTSTPTPSPTPSPTSTPTPSPTPSPTPTPTPPA 340

Query: 151 PASSPATSPPAPTPAST----PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            A+   T  P+PTPA T    P++APTP TA   P PTP    P P+   TP P
Sbjct: 341 TATPTPTPTPSPTPAPTNTPPPTSAPTP-TATPTPTPTPT---PTPTATPTPTP 390

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 47/114 (41%), Positives = 61/114 (53%), Gaps = 14/114 (12%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATP-PTATP-----PTATPPAAATP-PTATPPTATPPAPAS 159
           +PT  PT TP P   P  + TP PT TP     PT+TP  + TP PT+TP  +  P+P S
Sbjct: 263 SPTPTPTQTPTPTPLPTPSPTPTPTQTPTPTLTPTSTPTPSPTPSPTSTPTPSPTPSPTS 322

Query: 160 SPATSP-PAPTPA------STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           +P  SP P+PTP       +TP+  PTPS   +P    P +  P P+   TP P
Sbjct: 323 TPTPSPTPSPTPTPTPPATATPTPTPTPSPTPAPTNTPPPTSAPTPTATPTPTP 376

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 47/97 (48%), Positives = 57/97 (58%), Gaps = 7/97 (7%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-PTATP-PTATP-PAPASSPAT 171
           +PT  PT TP P + P   ATP     PT TP A  TP PT TP PTATP P P  +P+ 
Sbjct: 351 SPTPAPTNTPPPTSAPTPTATPTPTPTPTPTPTATPTPTPTPTPTPTATPTPTPTPTPSP 410

Query: 172 SPPA-PTPASTPSTAPTPS---TAGSPPAPTPDSLGP 270
           +P A PTP  TP+ +PTP+   TA +   PTP S+ P
Sbjct: 411 TPTATPTPTPTPTPSPTPTATPTATATSTPTPPSVEP 447

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 51/129 (39%), Positives = 63/129 (48%), Gaps = 28/129 (21%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATP-----------------PTATP-PTATPPAAATPPTAT 126
           +PT  PTATP   A P A +TP                 PT TP PT +P  + TP    
Sbjct: 211 SPTATPTATPTATATPTATSTPTATATATITSTPVSTSTPTQTPTPTPSPTPSPTPTPTQ 270

Query: 127 PPTATP---PAPASSPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPD-----SLGPGP 276
            PT TP   P+P  +P  +P P  TP STP+ +PTPS   +P P+PTP      +  P P
Sbjct: 271 TPTPTPLPTPSPTPTPTQTPTPTLTPTSTPTPSPTPSPTSTPTPSPTPSPTSTPTPSPTP 330

Query: 277 SGADTPPPP 303
           S   TP PP
Sbjct: 331 SPTPTPTPP 339

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 39/91 (42%), Positives = 46/91 (50%), Gaps = 2/91 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP-PTATP-PTATPPAAATPPTATPPTATPPAPASSPATSP 177
           PT  PT TP P   P A  TP PT TP PTATP    TP  +  PTATP        T  
Sbjct: 368 PTATPTPTPTPTPTPTATPTPTPTPTPTPTATPTPTPTPTPSPTPTATP--------TPT 419

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGP 270
           P PTP+ TP+  PT +   +P  P+ +   P
Sbjct: 420 PTPTPSPTPTATPTATATSTPTPPSVEPTTP 450

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 41/90 (45%), Positives = 49/90 (54%), Gaps = 7/90 (7%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPTATPPTATPPAP------ASSPATSPPAPTPASTPSTA 213
           +A   PTATP TATP A ATP   + PTAT  A       ++S  T  P PTP+ TPS  
Sbjct: 207 SAQNSPTATP-TATPTATATPTATSTPTATATATITSTPVSTSTPTQTPTPTPSPTPSPT 265

Query: 214 PTPSTAGSP-PAPTPDSLGPGPSGADTPPP 300
           PTP+   +P P PTP    P P+   TP P
Sbjct: 266 PTPTQTPTPTPLPTP---SPTPTPTQTPTP 292

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 41/111 (36%), Positives = 47/111 (42%), Gaps = 12/111 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           PT  PT TP P A P    TP  +  PTATP    TP  +  PTATP A A+S  T P  
Sbjct: 386 PTPTPTPTPTPTATPTPTPTPTPSPTPTATPTPTPTPTPSPTPTATPTATATSTPTPPSV 445

Query: 184 --PTPAST----------PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
              TP  T           S + T S+ GS     PD      +   TP P
Sbjct: 446 EPTTPVDTEDENESDSDSSSGSSTDSSGGSNSNNKPDKQSTPKAPTPTPTP 496

[49][TOP]
>UniRef100_Q9ASK4 Os01g0110500 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q9ASK4_ORYSJ
          Length = 698

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 51/108 (47%), Positives = 61/108 (56%), Gaps = 7/108 (6%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATP--PAAATPPTA--TPPTATPPAP---AS 159
           A   P TATP P  QP A    P+ TPP A+P  P+AATPP    +PP + PPAP     
Sbjct: 17  AAAAPSTATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPDSPPPSPPPAPPVAVP 76

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PAT PP P P ++P   PTPS    PP+P P S+   P+ A TPP P
Sbjct: 77  PPATVPPPPVPVASP--PPTPSATLPPPSP-PASVPVPPTPATTPPKP 121

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 41/106 (38%), Positives = 53/106 (50%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-PTATPPTATPPAPAS---SPAT 171
           P +P +  P+P   PP A  PP   PP   P A+  P P+AT P  +PPA      +PAT
Sbjct: 57  PPQPDSPPPSPPPAPPVAVPPPATVPPPPVPVASPPPTPSATLPPPSPPASVPVPPTPAT 116

Query: 172 SPPAPTPASTPSTA--PTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +PP P+P   P  A  P PS+    P P P +    P    +PPPP
Sbjct: 117 TPPKPSPVQQPPVAASPPPSSPADLPPPNPPARSDTPPVVQSPPPP 162

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/110 (42%), Positives = 56/110 (50%), Gaps = 11/110 (10%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP-ASSPATSP 177
           +P  P  ATP P+   P  + PP   PP A PP A  PP   P  + PP P A+ P  SP
Sbjct: 47  SPPLPSAATPPPQPDSPPPSPPPA--PPVAVPPPATVPPPPVPVASPPPTPSATLPPPSP 104

Query: 178 PA-----PTPAST---PSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPP 297
           PA     PTPA+T   PS    P  A SPP  +P  L P   P+ +DTPP
Sbjct: 105 PASVPVPPTPATTPPKPSPVQQPPVAASPPPSSPADLPPPNPPARSDTPP 154

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 46/121 (38%), Positives = 55/121 (45%), Gaps = 21/121 (17%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPP----AAATPPT--ATPPTATPPAA-------ATPPTATPPTATP 144
           P  PP A P P   PP     A+ PPT  AT P  +PPA+       AT P    P   P
Sbjct: 68  PPAPPVAVPPPATVPPPPVPVASPPPTPSATLPPPSPPASVPVPPTPATTPPKPSPVQQP 127

Query: 145 PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAP------TP--DSLGPGPSGADTPPP 300
           P  AS P +SP    P + P+ + TP    SPP P      TP    + P PSG+ T P 
Sbjct: 128 PVAASPPPSSPADLPPPNPPARSDTPPVVQSPPPPHRRSPRTPWAPPMAPSPSGSPTKPS 187

Query: 301 P 303
           P
Sbjct: 188 P 188

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 36/84 (42%), Positives = 45/84 (53%), Gaps = 2/84 (2%)
 Frame = +1

Query: 58  ATPPTATPPTATPP-AAATPPTATPPTATPP-APASSPATSPPAPTPASTPSTAPTPSTA 231
           A+ P+ +P TATP  AAA P TATP  AT P A  + P+ +PPA +P    +  P P   
Sbjct: 2   ASSPSPSPGTATPATAAAAPSTATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPD 61

Query: 232 GSPPAPTPDSLGPGPSGADTPPPP 303
             PP+P P      P  A  PPPP
Sbjct: 62  SPPPSPPPAPPVAVPPPATVPPPP 85

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 38/86 (44%), Positives = 49/86 (56%), Gaps = 6/86 (6%)
 Frame = +1

Query: 61  TPPTATPPTATP-PAAATPPTATPPTATPPAPA-SSPATSPPAPTPASTP--STAPTPST 228
           +P TATP TA   P+ ATP  AT P ATP  P+ + PA SPP P+ A+ P    +P PS 
Sbjct: 8   SPGTATPATAAAAPSTATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPDSPPPSP 67

Query: 229 AGSPP--APTPDSLGPGPSGADTPPP 300
             +PP   P P ++ P P    +PPP
Sbjct: 68  PPAPPVAVPPPATVPPPPVPVASPPP 93

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 34/101 (33%), Positives = 46/101 (45%), Gaps = 4/101 (3%)
 Frame = +1

Query: 4   PTKPPTAT----PAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT 171
           P  P  AT    P+P  QPP AA+PP ++P    PP         P   +PP P      
Sbjct: 109 PVPPTPATTPPKPSPVQQPPVAASPPPSSPADLPPPNPPARSDTPPVVQSPPPPHRRSPR 168

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
           +P AP  A +PS +PT  +  SP     D + P P+   +P
Sbjct: 169 TPWAPPMAPSPSGSPTKPSPASPSPIAGDPIIPTPNNPSSP 209

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 33/94 (35%), Positives = 42/94 (44%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +PTKP  A+P+P A  P   TP   + P ATP A    P +  P  TP AP S P     
Sbjct: 182 SPTKPSPASPSPIAGDPIIPTPNNPSSPLATPSA----PGSGTPVVTPSAPVSGP----- 232

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG 282
            P+P + P+TA   S     P     S+     G
Sbjct: 233 -PSPGTAPATAADRSNKSLSPNTQDGSVSSSDGG 265

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 40/109 (36%), Positives = 50/109 (45%), Gaps = 13/109 (11%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPP---TATPPTATPPAPASSPATSPPA 183
           P  A+P P +  PA   PP     + TPP   +PP     +P T   P  A SP+ SP  
Sbjct: 128 PVAASPPPSS--PADLPPPNPPARSDTPPVVQSPPPPHRRSPRTPWAPPMAPSPSGSPTK 185

Query: 184 PTPASTPSTA-----PTPSTAGSPPAPTPDSLGPG-----PSGADTPPP 300
           P+PAS    A     PTP+   SP A TP + G G     PS   + PP
Sbjct: 186 PSPASPSPIAGDPIIPTPNNPSSPLA-TPSAPGSGTPVVTPSAPVSGPP 233

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 42/107 (39%), Positives = 51/107 (47%), Gaps = 12/107 (11%)
 Frame = +1

Query: 13  PPTATPA--PKAQPPAAA-TPPTATPP----TATPPAAATPPTATPPTATP--PAPAS-S 162
           PP ++PA  P   PPA + TPP    P      +P     PP A  P+ +P  P+PAS S
Sbjct: 133 PPPSSPADLPPPNPPARSDTPPVVQSPPPPHRRSPRTPWAPPMAPSPSGSPTKPSPASPS 192

Query: 163 P-ATSPPAPTPASTPSTAPTPSTAGS-PPAPTPDSLGPGPSGADTPP 297
           P A  P  PTP +  S   TPS  GS  P  TP +   GP    T P
Sbjct: 193 PIAGDPIIPTPNNPSSPLATPSAPGSGTPVVTPSAPVSGPPSPGTAP 239

[50][TOP]
>UniRef100_Q1EPA3 Protein kinase family protein n=1 Tax=Musa acuminata
           RepID=Q1EPA3_MUSAC
          Length = 648

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 46/110 (41%), Positives = 60/110 (54%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPP----TATPPTATPPAAATPP---TATPPTATPPAPASS 162
           P  PP A+P P   PP A  PP    T+ PP A PP + +PP    + PP +TPP P S+
Sbjct: 43  PPSPPPASPPPPTPPPPADVPPPPVVTSPPPPAPPPPSVSPPPPALSPPPASTPPRPPSA 102

Query: 163 ---PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              PA +PP P P++TP   PT S    P A  P ++ P P G+ +PP P
Sbjct: 103 SPPPAAAPPPPPPSATP--PPTNSPPPPPSATPPPTISPPPPGSQSPPAP 150

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 48/107 (44%), Positives = 56/107 (52%), Gaps = 10/107 (9%)
 Frame = +1

Query: 13  PPTATPAPKAQ---PPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSP----AT 171
           PP+ +P P      PPA+ +PP A  P A PP   +PP A+PP  TPP PA  P     T
Sbjct: 12  PPSTSPPPPTSLSPPPASNSPPPA--PNAPPPTPPSPPPASPPPPTPPPPADVPPPPVVT 69

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPA---PTPDSLGPGPSGADTPPPP 303
           SPP P P   PS +P P     PPA   P P S  P P+ A  PPPP
Sbjct: 70  SPPPPAPPP-PSVSPPPPALSPPPASTPPRPPSASPPPAAAPPPPPP 115

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 48/109 (44%), Positives = 58/109 (53%), Gaps = 10/109 (9%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPP-----TATPPTATPPAPASS- 162
           AP  P  + P P   PP A+TPP   PP+A+PP AA PP        PPT +PP P S+ 
Sbjct: 75  APPPPSVSPPPPALSPPPASTPPR--PPSASPPPAAAPPPPPPSATPPPTNSPPPPPSAT 132

Query: 163 --PATSPPAPTPASTPSTAPTPSTAGSPPAP--TPDSLGPGPSGADTPP 297
             P  SPP P   S P+ AP+ ST G+PPAP   P    P PS +   P
Sbjct: 133 PPPTISPPPPGSQSPPAPAPSNSTGGTPPAPPKPPSPPSPSPSASHRAP 181

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 46/107 (42%), Positives = 56/107 (52%), Gaps = 7/107 (6%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPP----AAATPPTATPPTATPPAPASSPA 168
           AP  PP   P+P   PPA+  PPT  PP   PP     +  PP   PP+ +PP PA SP 
Sbjct: 35  APNAPPPTPPSP---PPASPPPPTPPPPADVPPPPVVTSPPPPAPPPPSVSPPPPALSP- 90

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPT---PDSLGPGPSGADTPPP 300
             PPA TP   PS +P P+ A  PP P+   P +  P P  + TPPP
Sbjct: 91  --PPASTPPRPPSASPPPAAAPPPPPPSATPPPTNSPPPPPSATPPP 135

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 34/75 (45%), Positives = 44/75 (58%), Gaps = 3/75 (4%)
 Frame = +1

Query: 88  ATPPAAATPPTATPPTATPPAPAS---SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPD 258
           ++PP +   P+ATPP+ +PP P S    PA++ P P P + P T P+P  A SPP PTP 
Sbjct: 2   SSPPPS---PSATPPSTSPPPPTSLSPPPASNSPPPAPNAPPPTPPSPPPA-SPPPPTP- 56

Query: 259 SLGPGPSGADTPPPP 303
                P  AD PPPP
Sbjct: 57  -----PPPADVPPPP 66

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/97 (42%), Positives = 52/97 (53%), Gaps = 2/97 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPP-TATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P  PP+ATP P   PP    PP+ATPP T +PP    PP +  P A  PAP++S   +PP
Sbjct: 111 PPPPPSATPPPTNSPPP---PPSATPPPTISPP----PPGSQSPPA--PAPSNSTGGTPP 161

Query: 181 A-PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
           A P P S PS +P+ S        +P S G G   +D
Sbjct: 162 APPKPPSPPSPSPSASHRAPAYPISPSSNGSGIPTSD 198

[51][TOP]
>UniRef100_B8ACV5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8ACV5_ORYSI
          Length = 698

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 51/108 (47%), Positives = 61/108 (56%), Gaps = 7/108 (6%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATP--PAAATPPTA--TPPTATPPAP---AS 159
           A   P TATP P  QP A    P+ TPP A+P  P+AATPP    +PP + PPAP     
Sbjct: 17  AAAAPSTATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPDSPPPSPPPAPPVAVP 76

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PAT PP P P ++P   PTPS    PP+P P S+   P+ A TPP P
Sbjct: 77  PPATVPPPPVPVASP--PPTPSATLPPPSP-PASVPVPPTPATTPPKP 121

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 41/106 (38%), Positives = 53/106 (50%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-PTATPPTATPPAPAS---SPAT 171
           P +P +  P+P   PP A  PP   PP   P A+  P P+AT P  +PPA      +PAT
Sbjct: 57  PPQPDSPPPSPPPAPPVAVPPPATVPPPPVPVASPPPTPSATLPPPSPPASVPVPPTPAT 116

Query: 172 SPPAPTPASTPSTA--PTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +PP P+P   P  A  P PS+    P P P +    P    +PPPP
Sbjct: 117 TPPKPSPVQQPPVAASPPPSSPADLPPPNPPARSDTPPVVQSPPPP 162

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/110 (42%), Positives = 56/110 (50%), Gaps = 11/110 (10%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP-ASSPATSP 177
           +P  P  ATP P+   P  + PP   PP A PP A  PP   P  + PP P A+ P  SP
Sbjct: 47  SPPLPSAATPPPQPDSPPPSPPPA--PPVAVPPPATVPPPPVPVASPPPTPSATLPPPSP 104

Query: 178 PA-----PTPAST---PSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPP 297
           PA     PTPA+T   PS    P  A SPP  +P  L P   P+ +DTPP
Sbjct: 105 PASVPVPPTPATTPPKPSPVQQPPVAASPPPSSPADLPPPNPPARSDTPP 154

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 46/121 (38%), Positives = 55/121 (45%), Gaps = 21/121 (17%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPP----AAATPPT--ATPPTATPPAA-------ATPPTATPPTATP 144
           P  PP A P P   PP     A+ PPT  AT P  +PPA+       AT P    P   P
Sbjct: 68  PPAPPVAVPPPATVPPPPVPVASPPPTPSATLPPPSPPASVPVPPTPATTPPKPSPVQQP 127

Query: 145 PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAP------TP--DSLGPGPSGADTPPP 300
           P  AS P +SP    P + P+ + TP    SPP P      TP    + P PSG+ T P 
Sbjct: 128 PVAASPPPSSPADLPPPNPPARSDTPPVVQSPPPPHRRSPRTPWAPPMAPSPSGSPTKPS 187

Query: 301 P 303
           P
Sbjct: 188 P 188

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 36/84 (42%), Positives = 45/84 (53%), Gaps = 2/84 (2%)
 Frame = +1

Query: 58  ATPPTATPPTATPP-AAATPPTATPPTATPP-APASSPATSPPAPTPASTPSTAPTPSTA 231
           A+ P+ +P TATP  AAA P TATP  AT P A  + P+ +PPA +P    +  P P   
Sbjct: 2   ASSPSPSPGTATPATAAAAPSTATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPD 61

Query: 232 GSPPAPTPDSLGPGPSGADTPPPP 303
             PP+P P      P  A  PPPP
Sbjct: 62  SPPPSPPPAPPVAVPPPATVPPPP 85

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 38/86 (44%), Positives = 49/86 (56%), Gaps = 6/86 (6%)
 Frame = +1

Query: 61  TPPTATPPTATP-PAAATPPTATPPTATPPAPA-SSPATSPPAPTPASTP--STAPTPST 228
           +P TATP TA   P+ ATP  AT P ATP  P+ + PA SPP P+ A+ P    +P PS 
Sbjct: 8   SPGTATPATAAAAPSTATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPDSPPPSP 67

Query: 229 AGSPP--APTPDSLGPGPSGADTPPP 300
             +PP   P P ++ P P    +PPP
Sbjct: 68  PPAPPVAVPPPATVPPPPVPVASPPP 93

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 48/122 (39%), Positives = 59/122 (48%), Gaps = 22/122 (18%)
 Frame = +1

Query: 4   PTKPPTAT----PAPKAQPPAAATPPTATP---PTATPPAAA-TPPTA---------TPP 132
           P  P  AT    P+P  QPP AA+PP ++P   P   PPA + TPP           +P 
Sbjct: 109 PVPPTPATTPPKPSPVQQPPVAASPPPSSPADLPPPNPPARSDTPPVVQSPPPPHRRSPR 168

Query: 133 TATPPAPASSPATSPPAPTPASTPSTA-----PTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           T   P  A SP+ SP  P+PAS    A     PTP+   SP A TP + G G +   TPP
Sbjct: 169 TPWAPPMAPSPSGSPTKPSPASPSPIAGDPIIPTPNNPSSPLA-TPSAPGSG-TPVVTPP 226

Query: 298 PP 303
            P
Sbjct: 227 AP 228

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 34/94 (36%), Positives = 43/94 (45%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +PTKP  A+P+P A  P   TP   + P ATP A    P +  P  TPPAP S P     
Sbjct: 182 SPTKPSPASPSPIAGDPIIPTPNNPSSPLATPSA----PGSGTPVVTPPAPVSGP----- 232

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG 282
            P+P + P+TA   S     P     S+     G
Sbjct: 233 -PSPGTAPATAADRSNKSLSPNTQDGSVSSSDGG 265

[52][TOP]
>UniRef100_B4FBV0 Putative uncharacterized protein n=2 Tax=Zea mays
           RepID=B4FBV0_MAIZE
          Length = 260

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 59/122 (48%), Positives = 67/122 (54%), Gaps = 22/122 (18%)
 Frame = +1

Query: 1   APTKPPT--------ATPAPKAQPP--AAATPPTATPPTATPPAAAT-PPTATPPTATPP 147
           A   PPT        AT AP + PP  AAA P +ATPPT  P A  T PP A+PPTA PP
Sbjct: 80  ASAAPPTTAASPQLAATLAPVSSPPLAAAAPPASATPPTTPPSATQTQPPVASPPTAMPP 139

Query: 148 APASSPATSPPA--PTP---------ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
           A A  PAT PPA  PTP         A+ P+TAP P+     PAPTP S+ P PS  + P
Sbjct: 140 AAALPPATLPPAMAPTPLLAAPVMPPAAPPATAPAPAPVS--PAPTP-SVAPTPSPTEAP 196

Query: 295 PP 300
            P
Sbjct: 197 AP 198

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 55/121 (45%), Positives = 66/121 (54%), Gaps = 23/121 (19%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPT------------ATPPTATPPAAATPPTATPPTATP 144
           A   P ++ P   A PPA+ATPPT            A+PPTA PPAAA PP   PP   P
Sbjct: 95  ATLAPVSSPPLAAAAPPASATPPTTPPSATQTQPPVASPPTAMPPAAALPPATLPPAMAP 154

Query: 145 P--------APASSPATSP-PAP-TPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADT 291
                     PA+ PAT+P PAP +PA TPS APTPS   +P P+PT ++  P PS A  
Sbjct: 155 TPLLAAPVMPPAAPPATAPAPAPVSPAPTPSVAPTPSPTEAPAPSPTTEAPVPTPSPALA 214

Query: 292 P 294
           P
Sbjct: 215 P 215

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 48/106 (45%), Positives = 56/106 (52%), Gaps = 15/106 (14%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATP-PAAATP--PTATPP-TATPPAPASSPATS 174
           T+PP A+P P A PPAAA PP   PP   P P  A P  P A PP TA  PAP S   T 
Sbjct: 126 TQPPVASP-PTAMPPAAALPPATLPPAMAPTPLLAAPVMPPAAPPATAPAPAPVSPAPTP 184

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTP-----------DSLGPGPS 279
             APTP+ T + AP+P+T    P P+P            SL PGP+
Sbjct: 185 SVAPTPSPTEAPAPSPTTEAPVPTPSPALAPLSSVSVSPSLSPGPA 230

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 54/144 (37%), Positives = 62/144 (43%), Gaps = 44/144 (30%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPT---------ATPPT--ATP----------------- 96
           A  +PPT   A  + P A+A  PT         A PPT  A+P                 
Sbjct: 51  ASAQPPTTVAA--SGPQASAAAPTKAALAPQASAAPPTTAASPQLAATLAPVSSPPLAAA 108

Query: 97  --PAAATPPT------------ATPPTATPPAPASSPATSPP--APTPASTPSTAPTPST 228
             PA+ATPPT            A+PPTA PPA A  PAT PP  APTP       P  + 
Sbjct: 109 APPASATPPTTPPSATQTQPPVASPPTAMPPAAALPPATLPPAMAPTPLLAAPVMPPAAP 168

Query: 229 AGSPPAPTPDSLGPGPSGADTPPP 300
             + PAP P S  P PS A TP P
Sbjct: 169 PATAPAPAPVSPAPTPSVAPTPSP 192

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 44/110 (40%), Positives = 52/110 (47%), Gaps = 9/110 (8%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATP-------PTATPP--TATPPAAATPPTATPPTATPPAP 153
           APTK   A  A  A P  AA+P       P ++PP   A PPA+ATPPT TPP+AT   P
Sbjct: 70  APTKAALAPQASAAPPTTAASPQLAATLAPVSSPPLAAAAPPASATPPT-TPPSATQTQP 128

Query: 154 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P  SPP   P +          A  PPA  P ++ P P  A    PP
Sbjct: 129 ---PVASPPTAMPPA----------AALPPATLPPAMAPTPLLAAPVMPP 165

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 42/105 (40%), Positives = 54/105 (51%), Gaps = 11/105 (10%)
 Frame = +1

Query: 13  PPTATPAPKA--QPPA--AATPPTATPPTAT-----PPAAATPPT--ATPPTATPPAPAS 159
           P TA  AP+A  QPP   AA+ P A+    T     P A+A PPT  A+P  A   AP S
Sbjct: 42  PTTAVSAPQASAQPPTTVAASGPQASAAAPTKAALAPQASAAPPTTAASPQLAATLAPVS 101

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
           SP  +  AP  ++TP T P  +T   PP  +P +  P P+ A  P
Sbjct: 102 SPPLAAAAPPASATPPTTPPSATQTQPPVASPPTAMP-PAAALPP 145

[53][TOP]
>UniRef100_A7PLL6 Chromosome chr7 scaffold_20, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PLL6_VITVI
          Length = 235

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 54/111 (48%), Positives = 62/111 (55%), Gaps = 10/111 (9%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQP--PAAATPPTATPPTATP-----PAAATPPTATPPTATPPAPAS 159
           +P   PTATP     P  PA ATPP ++P  A P     PA  T PT++PPTA    PAS
Sbjct: 23  SPAASPTATPVTAHSPATPAVATPPASSPAAAAPTKSKTPAPVTAPTSSPPTAVSSPPAS 82

Query: 160 SPATSPP---APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           SP +SPP    PTPAS+P  A TP    SPPAP P S  P    A +PP P
Sbjct: 83  SPVSSPPTPAVPTPASSP-VAVTP--VSSPPAPVPVSSPPLLPPAKSPPVP 130

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 44/107 (41%), Positives = 57/107 (53%), Gaps = 14/107 (13%)
 Frame = +1

Query: 1   APTKPPTATP--APKAQPPAAATPPTATPPTATPPAAATP-----PTATPPTATPPAPAS 159
           APTK  T  P  AP + PP A + P A+ P ++PP  A P     P A  P ++PPAP  
Sbjct: 55  APTKSKTPAPVTAPTSSPPTAVSSPPASSPVSSPPTPAVPTPASSPVAVTPVSSPPAPVP 114

Query: 160 -------SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 279
                   PA SPP P PA+ P+ +P P+   SPPA TP +  P P+
Sbjct: 115 VSSPPLLPPAKSPPVPAPANPPAASP-PAPVSSPPAETPAAEVPSPA 160

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 43/104 (41%), Positives = 52/104 (50%), Gaps = 5/104 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS-----PA 168
           P   P A    K++ PA  T PT++PPTA     A+ P ++PPT   P PASS     P 
Sbjct: 47  PASSPAAAAPTKSKTPAPVTAPTSSPPTAVSSPPASSPVSSPPTPAVPTPASSPVAVTPV 106

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           +SPPAP P S+P   P    A SPP P P      P  A  P P
Sbjct: 107 SSPPAPVPVSSPPLLP---PAKSPPVPAP----ANPPAASPPAP 143

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 45/108 (41%), Positives = 59/108 (54%), Gaps = 7/108 (6%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAA-----TPPTATPPTATPPAAATPPTATPPTATPPAPA-SS 162
           +P  P  ATP P + P AAA     TP   T PT++PP A + P A+ P ++PP PA  +
Sbjct: 37  SPATPAVATP-PASSPAAAAPTKSKTPAPVTAPTSSPPTAVSSPPASSPVSSPPTPAVPT 95

Query: 163 PATSPPAPTPAST-PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PA+SP A TP S+ P+  P  S    PPA +P    P    A +PP P
Sbjct: 96  PASSPVAVTPVSSPPAPVPVSSPPLLPPAKSPPVPAPANPPAASPPAP 143

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 40/108 (37%), Positives = 51/108 (47%), Gaps = 9/108 (8%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPP--AAATPPTATPPTATPPAPASSPATSPP 180
           + P   TP      P   + P   PP  +PP  A A PP A+PP      PA +PA   P
Sbjct: 98  SSPVAVTPVSSPPAPVPVSSPPLLPPAKSPPVPAPANPPAASPPAPVSSPPAETPAAEVP 157

Query: 181 APTPA-------STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P+        +P+ AP P  A SPPAP  ++  PGPS   T P P
Sbjct: 158 SPAPSKKKTKKLKSPAPAPAPE-ALSPPAPPTEA--PGPSYDATSPSP 202

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 49/105 (46%), Positives = 55/105 (52%), Gaps = 18/105 (17%)
 Frame = +1

Query: 43  QPPAAATPPTATPPTA---TPPAAATPPTATPPTATPP----------APASSPAT---S 174
           Q PAA+  PTATP TA     PA ATPP A+ P A  P          AP SSP T   S
Sbjct: 22  QSPAAS--PTATPVTAHSPATPAVATPP-ASSPAAAAPTKSKTPAPVTAPTSSPPTAVSS 78

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP--PP 303
           PPA +P S+P T   P+ A SP A TP S  P P    +PP  PP
Sbjct: 79  PPASSPVSSPPTPAVPTPASSPVAVTPVSSPPAPVPVSSPPLLPP 123

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 42/107 (39%), Positives = 50/107 (46%), Gaps = 12/107 (11%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPT---ATPPAAATP-PTATPPTATPPAPASSPAT 171
           P   P A P P + PP    PP  +PP    A PPAA+ P P ++PP  TP A   SPA 
Sbjct: 105 PVSSPPA-PVPVSSPPLL--PPAKSPPVPAPANPPAASPPAPVSSPPAETPAAEVPSPAP 161

Query: 172 SP--------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
           S         PAP PA    + P P T    P P+ D+  P PS  D
Sbjct: 162 SKKKTKKLKSPAPAPAPEALSPPAPPT--EAPGPSYDATSPSPSLPD 206

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 35/89 (39%), Positives = 46/89 (51%), Gaps = 1/89 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P K P   PAP A PPAA+ P   + P A  PAA  P  A     T    + +PA +P A
Sbjct: 123 PAKSPPV-PAP-ANPPAASPPAPVSSPPAETPAAEVPSPAPSKKKTKKLKSPAPAPAPEA 180

Query: 184 PTPASTPSTAPTPSTAGSPPAPT-PDSLG 267
            +P + P+ AP PS   + P+P+ PD  G
Sbjct: 181 LSPPAPPTEAPGPSYDATSPSPSLPDESG 209

[54][TOP]
>UniRef100_B6KLS9 Voltage gated chloride channel domain-containing protein n=1
           Tax=Toxoplasma gondii ME49 RepID=B6KLS9_TOXGO
          Length = 1779

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 41/127 (32%), Positives = 77/127 (60%), Gaps = 26/127 (20%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPP------------TATP 144
           +P+ PP ++P   + P +++ PP+++PP+++PP++++P +++PP            ++T 
Sbjct: 250 SPSSPPPSSPPSSSSPSSSSPPPSSSPPSSSPPSSSSPSSSSPPPSSSPPPPSPPSSSTS 309

Query: 145 PAPASSPATSPPAPT--PASTPSTAPTPSTAGSPPAP------------TPDSLGPGPSG 282
           P+P+S P++SPP+P+  P+S PS++P  S+  SPP+P            +P S  P PS 
Sbjct: 310 PSPSSPPSSSPPSPSPPPSSPPSSSPPSSSPPSPPSPSSPPPSSPPSSSSPSSSSPPPSS 369

Query: 283 ADTPPPP 303
           +  PP P
Sbjct: 370 SPPPPSP 376

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 43/107 (40%), Positives = 77/107 (71%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPP-TATPPTATPPA---PASS--- 162
           P+ PP+++P P + PP+ ++PP ++PP+++ P++++PP +++PP+++PP+   P+SS   
Sbjct: 235 PSSPPSSSP-PSSSPPSPSSPPPSSPPSSSSPSSSSPPPSSSPPSSSPPSSSSPSSSSPP 293

Query: 163 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P++SPP P+P S+ ST+P+PS   SPP+ +P S  P PS   +  PP
Sbjct: 294 PSSSPPPPSPPSS-STSPSPS---SPPSSSPPSPSPPPSSPPSSSPP 336

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 42/126 (33%), Positives = 78/126 (61%), Gaps = 25/126 (19%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPT-ATPPTATPPA----AATPPTATPPTATPPAPASSP 165
           +P+ PP+++P P + PP+++T P+ ++PP+++PP+     ++PP+++PP+++PP+P+S P
Sbjct: 197 SPSSPPSSSP-PSSSPPSSSTSPSPSSPPSSSPPSPSPPPSSPPSSSPPSSSPPSPSSPP 255

Query: 166 ATSPP--------APTPASTP------------STAPTPSTAGSPPAPTPDSLGPGPSGA 285
            +SPP        +P P+S+P            S++P PS++  PP+P   S  P PS  
Sbjct: 256 PSSPPSSSSPSSSSPPPSSSPPSSSPPSSSSPSSSSPPPSSSPPPPSPPSSSTSPSPSSP 315

Query: 286 DTPPPP 303
            +  PP
Sbjct: 316 PSSSPP 321

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 39/118 (33%), Positives = 76/118 (64%), Gaps = 17/118 (14%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTA-TPPAAATPPTATPPTATPPAPASSPATSP 177
           +P+  P+++ +P    P +++PP+++PP++ T P+ ++PP+++PP+ +PP P+S P++SP
Sbjct: 185 SPSSSPSSSTSPSPSSPPSSSPPSSSPPSSSTSPSPSSPPSSSPPSPSPP-PSSPPSSSP 243

Query: 178 PA---PTPASTPSTAP----TPSTAGSPPAPTPDSLGP---------GPSGADTPPPP 303
           P+   P+P+S P ++P    +PS++  PP+ +P S  P          P  + +PPPP
Sbjct: 244 PSSSPPSPSSPPPSSPPSSSSPSSSSPPPSSSPPSSSPPSSSSPSSSSPPPSSSPPPP 301

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 35/101 (34%), Positives = 68/101 (67%), Gaps = 5/101 (4%)
 Frame = +1

Query: 13  PPTATPAPKAQP-----PAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           PP+++P P + P     P+ ++PP+++PP+ +PP ++ PP+++PP+++PP+P  SP++ P
Sbjct: 293 PPSSSPPPPSPPSSSTSPSPSSPPSSSPPSPSPPPSS-PPSSSPPSSSPPSP-PSPSSPP 350

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P+  P+S+  ++ +P  + SPP P+P S  P  S + +  P
Sbjct: 351 PSSPPSSSSPSSSSPPPSSSPPPPSPPSSSPPSSSSPSSSP 391

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 35/99 (35%), Positives = 65/99 (65%), Gaps = 1/99 (1%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA- 183
           + P +++P P + PP  + P ++T P+ + P +++PP+ +PP ++PP+ +S P++SPP+ 
Sbjct: 285 SSPSSSSPPPSSSPPPPSPPSSSTSPSPSSPPSSSPPSPSPPPSSPPS-SSPPSSSPPSP 343

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P+P+S P ++P  S++ S  +P P S  P PS   + PP
Sbjct: 344 PSPSSPPPSSPPSSSSPSSSSPPPSSSPPPPSPPSSSPP 382

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 35/100 (35%), Positives = 64/100 (64%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP+++ +P    P +++PP+ +PP ++PP +++PP+++PP  +PP+P+S P +SPP+
Sbjct: 300 PPSPPSSSTSPSPSSPPSSSPPSPSPPPSSPP-SSSPPSSSPP--SPPSPSSPPPSSPPS 356

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              +S+PS++  P ++  PP   P S  P  S   + P P
Sbjct: 357 ---SSSPSSSSPPPSSSPPPPSPPSSSPPSSSSPSSSPSP 393

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 38/111 (34%), Positives = 69/111 (62%), Gaps = 11/111 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQP---PAAATPPTATPPTATPPAAATPPTATPPTATP------PAPA 156
           PT  P      K +P   P +++ P+++P ++T P+ ++PP+++PP+++P      P+P+
Sbjct: 162 PTSEPFVHADLKMRPSLSPPSSSSPSSSPSSSTSPSPSSPPSSSPPSSSPPSSSTSPSPS 221

Query: 157 SSPATSPPAPT--PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           S P++SPP+P+  P+S PS++P  S+  SP +P P S     S + + PPP
Sbjct: 222 SPPSSSPPSPSPPPSSPPSSSPPSSSPPSPSSPPPSSPPSSSSPSSSSPPP 272

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 35/103 (33%), Positives = 67/103 (65%), Gaps = 4/103 (3%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTA---TPPAAATPPTATPPTATPPAPAS-SPA 168
           +P+ PP+++P   + PP++  PP+++PP++   +PP+ ++PP ++PP+++ P+ +S  P+
Sbjct: 311 SPSSPPSSSPPSPSPPPSS--PPSSSPPSSSPPSPPSPSSPPPSSPPSSSSPSSSSPPPS 368

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           +SPP P+P S  S+ P+ S+  S P+P+ D        AD  P
Sbjct: 369 SSPPPPSPPS--SSPPSSSSPSSSPSPSADLSERAQGPADEAP 409

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 5/103 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPT-ATPPTATPPAAATPPTATPPTATPPAPASSPA--TS 174
           P+ P +++P+    P + + P   ++PP+   P ++ PP+++     PP+P+SS +  +S
Sbjct: 614 PSSPYSSSPSVPVPPSSPSMPLLPSSPPSVPVPPSSPPPSSSLSAPVPPSPSSSSSHSSS 673

Query: 175 PPA--PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           PP+  P P   PS +P+PS+A SP  P P S    PS   + P
Sbjct: 674 PPSVLPLPPHVPS-SPSPSSASSPSMPLPTSSSSPPSSPPSSP 715

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 31/96 (32%), Positives = 56/96 (58%), Gaps = 4/96 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAA-TPPTATPPTATPPAAATPPTATP-PTATPPAPASSPATSP 177
           P+ PP+    P + PP+++ + P    P+++   +++PP+  P P   P +P+ S A+SP
Sbjct: 637 PSSPPSVPVPPSSPPPSSSLSAPVPPSPSSSSSHSSSPPSVLPLPPHVPSSPSPSSASSP 696

Query: 178 --PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 279
             P PT +S+P ++P PS+   P + +  S+ P PS
Sbjct: 697 SMPLPTSSSSPPSSP-PSSPSVPLSSSSPSVPPSPS 731

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 32/105 (30%), Positives = 58/105 (55%), Gaps = 8/105 (7%)
 Frame = +1

Query: 13  PPTATPAP--KAQPPAAATPPTATPPTAT--PPAAATPPTATPPTATPPA--PASSPATS 174
           PP++   P   + PP+   PP++ PP+++   P   +P +++  +++PP+  P      S
Sbjct: 627 PPSSPSMPLLPSSPPSVPVPPSSPPPSSSLSAPVPPSPSSSSSHSSSPPSVLPLPPHVPS 686

Query: 175 PPAPTPASTPSTAPTPSTAGSPPA--PTPDSLGPGPSGADTPPPP 303
            P+P+ AS+PS  P P+++ SPP+  P+  S+    S    PP P
Sbjct: 687 SPSPSSASSPS-MPLPTSSSSPPSSPPSSPSVPLSSSSPSVPPSP 730

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 31/104 (29%), Positives = 55/104 (52%), Gaps = 18/104 (17%)
 Frame = +1

Query: 4   PTKPPTAT-------PAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS 162
           P+ PP ++       P+P +    +++PP+  P     P++ +P +A+ P+   P  +SS
Sbjct: 647 PSSPPPSSSLSAPVPPSPSSSSSHSSSPPSVLPLPPHVPSSPSPSSASSPSMPLPTSSSS 706

Query: 163 PATSPPA----PTPASTPSTAPTPS-------TAGSPPAPTPDS 261
           P +SPP+    P  +S+PS  P+PS       +  S P+ +PDS
Sbjct: 707 PPSSPPSSPSVPLSSSSPSVPPSPSSPVSVLLSRSSSPSFSPDS 750

[55][TOP]
>UniRef100_UPI00019829A2 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019829A2
          Length = 726

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 45/109 (41%), Positives = 61/109 (55%), Gaps = 8/109 (7%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP--PAPASSPATS 174
           +P  PP   P   + PP ++ PP ++PP + PP  + PP + PP  +P  P+P+S P  S
Sbjct: 148 SPPPPPPTEPPVTSPPPPSSNPPKSSPPPSEPPKTSPPPPSKPPPVSPPSPSPSSPPEDS 207

Query: 175 PPAPTPA-STPSTAPTPSTAGSPPA--PTPDSL---GPGPSGADTPPPP 303
           PP P P   + ST P PS +GS PA  P+P+S     P P    TPPPP
Sbjct: 208 PPPPVPVPPSNSTPPAPSPSGSQPATPPSPNSPPKGSPPPPRTPTPPPP 256

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 42/107 (39%), Positives = 54/107 (50%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP + P     PP+  +PP  TPP  +PP    PPT  P +  PP P   P TSPP 
Sbjct: 106 PPTPPPSPPIAPVPPPSNPSPPPLTPPPTSPPPPP-PPTNPPRSPPPPPPTEPPVTSPPP 164

Query: 184 PT---PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA----DTPPPP 303
           P+   P S+P  +  P T+  PP+  P    P PS +    D+PPPP
Sbjct: 165 PSSNPPKSSPPPSEPPKTSPPPPSKPPPVSPPSPSPSSPPEDSPPPP 211

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/112 (41%), Positives = 59/112 (52%), Gaps = 12/112 (10%)
 Frame = +1

Query: 4   PTKPPTATPA---PKAQPPAAATPPTATPPTATPPAA-ATPPTATPPTATPP-----APA 156
           P  P ++TP    P A PP  A   T++PP  +PPA  A PP A+PP   P      +P+
Sbjct: 31  PPPPESSTPPSSQPNADPPDGAAGSTSSPPPQSPPAVPAAPPPASPPPPPPTPSLANSPS 90

Query: 157 SSPATSPPAPTP-ASTPSTAPTPSTAGSPPA--PTPDSLGPGPSGADTPPPP 303
           S P  SPP P+P A  P+  P+P  A  PP   P+P  L P P+    PPPP
Sbjct: 91  SPPPPSPPPPSPNAPPPTPPPSPPIAPVPPPSNPSPPPLTPPPTSPPPPPPP 142

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 45/109 (41%), Positives = 52/109 (47%), Gaps = 10/109 (9%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPP-AAATPPTATPPTATPPAAATPPTATPPTATPP---------APA 156
           T  P    +P A PP +AATPP        PP ++TPP++ P  A PP          P 
Sbjct: 3   TASPPPNSSPSAVPPTSAATPPPPLSSPPPPPESSTPPSSQP-NADPPDGAAGSTSSPPP 61

Query: 157 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            SP   P AP PAS P   PTPS A SP +P P S  P    A  P PP
Sbjct: 62  QSPPAVPAAPPPASPPPPPPTPSLANSPSSPPPPSPPPPSPNAPPPTPP 110

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/120 (34%), Positives = 54/120 (45%), Gaps = 20/120 (16%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-----------PA 150
           P  PP A+P P    P+ A  P++ PP + PP +   P  TPP + P           P 
Sbjct: 68  PAAPPPASPPPPPPTPSLANSPSSPPPPSPPPPSPNAPPPTPPPSPPIAPVPPPSNPSPP 127

Query: 151 PASSPATSPPAPTPASTPSTAPTPS-------TAGSPPAPTPDSLGPGPS--GADTPPPP 303
           P + P TSPP P P + P  +P P        T+  PP+  P    P PS     +PPPP
Sbjct: 128 PLTPPPTSPPPPPPPTNPPRSPPPPPPTEPPVTSPPPPSSNPPKSSPPPSEPPKTSPPPP 187

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 42/106 (39%), Positives = 53/106 (50%), Gaps = 9/106 (8%)
 Frame = +1

Query: 13  PPTATPA-PKAQPPAAATPPTATPPTATPPAAATPPTATPPT--ATPPAPASSPATSP-P 180
           PP + PA P A PPA+  PP  TP  A  P++  PP+  PP+  A PP P  SP  +P P
Sbjct: 60  PPQSPPAVPAAPPPASPPPPPPTPSLANSPSSPPPPSPPPPSPNAPPPTPPPSPPIAPVP 119

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGP-----SGADTPPPP 303
            P+  S P   P P++   PP PT     P P         +PPPP
Sbjct: 120 PPSNPSPPPLTPPPTSPPPPPPPTNPPRSPPPPPPTEPPVTSPPPP 165

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 42/123 (34%), Positives = 59/123 (47%), Gaps = 23/123 (18%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP---------- 153
           PT+PP  +P P +  P  ++PP + PP  +PP  + PP  +PP+ +P +P          
Sbjct: 154 PTEPPVTSPPPPSSNPPKSSPPPSEPPKTSPPPPSKPPPVSPPSPSPSSPPEDSPPPPVP 213

Query: 154 ---------ASSPATSPPA--PTPASTPSTAPTPSTAGSPPAP--TPDSLGPGPSGADTP 294
                    A SP+ S PA  P+P S P  +P P    +PP P  +P  L P PS   TP
Sbjct: 214 VPPSNSTPPAPSPSGSQPATPPSPNSPPKGSPPPPRTPTPPPPARSPPPLSP-PSSPQTP 272

Query: 295 PPP 303
             P
Sbjct: 273 NSP 275

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 39/102 (38%), Positives = 52/102 (50%), Gaps = 7/102 (6%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATP--PTATPPAAATPPTATPPTATPPAPASSPATSPPAP-- 186
           T++P P++ P   A PP A+P  P  TP  A +P +  PP+  PP+P + P T PP+P  
Sbjct: 56  TSSPPPQSPPAVPAAPPPASPPPPPPTPSLANSPSSPPPPSPPPPSPNAPPPTPPPSPPI 115

Query: 187 ---TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
               P S PS  P      SPP P P +    P  +  PPPP
Sbjct: 116 APVPPPSNPSPPPLTPPPTSPPPPPPPT---NPPRSPPPPPP 154

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 38/111 (34%), Positives = 55/111 (49%), Gaps = 13/111 (11%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTAT---------PPTATPPAAATPPTATPP---TATPP 147
           P++PP  +P P ++PP  + P  +          PP   PP+ +TPP  +P     ATPP
Sbjct: 176 PSEPPKTSPPPPSKPPPVSPPSPSPSSPPEDSPPPPVPVPPSNSTPPAPSPSGSQPATPP 235

Query: 148 APASSPATSPPAPTPASTPSTAPTPSTAGSPPAP-TPDSLGPGPSGADTPP 297
           +P S P  SPP P   + P  A +P     P +P TP+S    PS  ++ P
Sbjct: 236 SPNSPPKGSPPPPRTPTPPPPARSPPPLSPPSSPQTPNSPSDSPSVNNSTP 286

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/101 (37%), Positives = 53/101 (52%), Gaps = 7/101 (6%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQ-PPAAATPPTATP---PTATPPAAATPPTATPP---TATPPAPAS 159
           +P+ PP  +P P    PP+ +TPP  +P     ATPP+  +PP  +PP   T TPP PA 
Sbjct: 199 SPSSPPEDSPPPPVPVPPSNSTPPAPSPSGSQPATPPSPNSPPKGSPPPPRTPTPPPPAR 258

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG 282
           SP    P  +P +  S + +PS   S P  +P+S   G  G
Sbjct: 259 SPPPLSPPSSPQTPNSPSDSPSVNNSTPNGSPNSTSKGGIG 299

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 30/79 (37%), Positives = 41/79 (51%), Gaps = 11/79 (13%)
 Frame = +1

Query: 100 AAATPPTATPPTATPPAPASS---PATSPPAP-----TPASTPSTAPTPSTAG---SPPA 246
           A A+PP  + P+A PP  A++   P +SPP P      P+S P+  P    AG   SPP 
Sbjct: 2   ATASPPPNSSPSAVPPTSAATPPPPLSSPPPPPESSTPPSSQPNADPPDGAAGSTSSPPP 61

Query: 247 PTPDSLGPGPSGADTPPPP 303
            +P ++   P  A  PPPP
Sbjct: 62  QSPPAVPAAPPPASPPPPP 80

[56][TOP]
>UniRef100_UPI00015538CB PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI00015538CB
          Length = 241

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 48/103 (46%), Positives = 54/103 (52%), Gaps = 3/103 (2%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATP-PAAATPPTATPPTATP-PAPASSPATS 174
           AP   P   PAP A  PA A  P   PP   P PA   P  A  P   P PAPA +PA +
Sbjct: 64  APAPAPAPAPAPPAPAPAPAPAPAPAPPAPAPAPAPPAPAPAPAPAPAPAPAPAPAPAPA 123

Query: 175 PPAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPP 300
           PPAP PA  P+ AP P+ A +P PAP P    P P+ A  PPP
Sbjct: 124 PPAPAPAPAPAPAPAPAPAPAPAPAPAP---APAPAPAPAPPP 163

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 45/108 (41%), Positives = 52/108 (48%), Gaps = 8/108 (7%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP- 177
           AP   P   PAP    PA A  P A  P   P  A  P  A  P   PPAPA +PA +P 
Sbjct: 77  APAPAPAPAPAPAPPAPAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAPA 136

Query: 178 PAPTPASTPSTAPTPSTAGSP-------PAPTPDSLGPGPSGADTPPP 300
           PAP PA  P+ AP P+ A +P       PAP P +  P P+ A  P P
Sbjct: 137 PAPAPAPAPAPAPAPAPAPAPAPAPPPAPAPAPPAPAPAPAPAPAPAP 184

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/103 (46%), Positives = 54/103 (52%), Gaps = 3/103 (2%)
 Frame = +1

Query: 1   APTKP-PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASSPATS 174
           AP  P P   PAP A  PA A  P   P  A  PA A P  A  P   P PAPA +PA +
Sbjct: 87  APAPPAPAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAPAPAPAPAPAPA 146

Query: 175 P-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P PAP PA  P+ AP P+ A +PPAP P    P P+ A  P P
Sbjct: 147 PAPAPAPAPAPAPAPPPAPAPAPPAPAP---APAPAPAPAPAP 186

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 43/100 (43%), Positives = 48/100 (48%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           AP   P   PAP A  PA A  P   P  A P  A  P  A  P    PAPA +P    P
Sbjct: 46  APAPAPAPAPAP-APAPAPAPAPAPAPAPAPPAPAPAPAPAPAPAPPAPAPAPAPPAPAP 104

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           AP PA  P+ AP P+ A +PPAP P    P P+ A  P P
Sbjct: 105 APAPAPAPAPAPAPAPAPAPPAPAP---APAPAPAPAPAP 141

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 43/99 (43%), Positives = 48/99 (48%), Gaps = 1/99 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           AP   P   PAP   PPA A  P   P  A  PA A  P   P  A  PAPA  PA +P 
Sbjct: 109 APAPAPAPAPAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPPPAPAPA 168

Query: 181 APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP 294
            P PA  P+ AP P+ A +P PAP P    P P+ A  P
Sbjct: 169 PPAPAPAPAPAPAPAPAPAPAPAPAP---APAPAPAPAP 204

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 43/100 (43%), Positives = 48/100 (48%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           AP   P   PAP    PA A  P   P  A  PA A  P   P  A  PAP  +PA +PP
Sbjct: 111 APAPAPAPAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPPPAPAPAPP 170

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           AP PA  P+ AP P+ A   PAP P    P P+ A  P P
Sbjct: 171 APAPAPAPAPAPAPAPA---PAPAP---APAPAPAPAPAP 204

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 45/102 (44%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS-P 177
           AP   P   PAP   P  A  PP   P  A  PA A  P   P  A  PAPA +PA + P
Sbjct: 103 APAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPP 162

Query: 178 PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPP 300
           PAP PA  P+ AP P+ A +P PAP P    P P+ A  P P
Sbjct: 163 PAPAPA-PPAPAPAPAPAPAPAPAPAP---APAPAPAPAPAP 200

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 41/97 (42%), Positives = 45/97 (46%), Gaps = 1/97 (1%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP-PAPT 189
           PP   PAP   P  A  P  A  P    PA A  P   P  A  PAPA +PA +P PAP 
Sbjct: 99  PPAPAPAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPA 158

Query: 190 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           PA  P+ AP P      PAP P    P P+ A  P P
Sbjct: 159 PAPPPAPAPAPPAPAPAPAPAP---APAPAPAPAPAP 192

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 44/98 (44%), Positives = 49/98 (50%), Gaps = 3/98 (3%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATP-PTATP-PAAATPPTATPPTATPPAPASSPATS 174
           AP   P   PAP A  PA A  P   P P   P PA A  P   P  A PPAPA +P   
Sbjct: 113 APAPAPAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPPPAPAPAPPAP 172

Query: 175 PPAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGA 285
            PAP PA  P+ AP P+ A +P PAP P    P P+ A
Sbjct: 173 APAPAPAPAPAPAPAPAPAPAPAPAPAP---APAPASA 207

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 40/96 (41%), Positives = 48/96 (50%), Gaps = 3/96 (3%)
 Frame = +1

Query: 22  ATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA---PASSPATSPPAPTP 192
           + PAP   P  A  P  A  P   P  A  PP   P  A  PA   PA +PA +PPAP P
Sbjct: 45  SAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAPAPAPPAPAPAPAPPAPAP 104

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           A  P+ AP P+ A + PAP P +  P P+ A  P P
Sbjct: 105 APAPAPAPAPAPAPA-PAPAPPAPAPAPAPAPAPAP 139

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 39/100 (39%), Positives = 48/100 (48%), Gaps = 1/100 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP- 177
           AP   P   PAP   P  A  P  A  P   PP A  P    P  A  PAPA +PA +P 
Sbjct: 130 APAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPPPAPAPAPPAPAPAPAPAPAPAPAPAPA 189

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           PAP PA  P+ AP P++A +  + +   L PG    D+ P
Sbjct: 190 PAPAPAPAPAPAPAPASASASASVSAFHLAPGICAIDSVP 229

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 42/98 (42%), Positives = 52/98 (53%), Gaps = 4/98 (4%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPA- 195
           +A+ +  A  PA A  P   P  A  PA A  P   PP A  PAPA +PA +PPAP PA 
Sbjct: 39  SASASASAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPP-APAPAPAPAPAPAPPAPAPAP 97

Query: 196 STPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPP 300
           + P+ AP P+ A +P   PAP P    P P+ A  P P
Sbjct: 98  APPAPAPAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAP 135

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 33/86 (38%), Positives = 41/86 (47%)
 Frame = +1

Query: 43  QPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTP 222
           +P   A    +   +A  PA A  P   P  A  PAPA +PA +PPAP PA  P+ AP P
Sbjct: 31  RPRRWAVRSASASASAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAPAPAP 90

Query: 223 STAGSPPAPTPDSLGPGPSGADTPPP 300
                 PAP   +  P P+ A  P P
Sbjct: 91  PAPAPAPAPPAPAPAPAPAPAPAPAP 116

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 35/95 (36%), Positives = 45/95 (47%), Gaps = 5/95 (5%)
 Frame = +1

Query: 34  PKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTA 213
           P+     +A+   + P  A  PA A  P   P  A  PAPA +P    PAP PA  P+  
Sbjct: 32  PRRWAVRSASASASAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAPAPA-P 90

Query: 214 PTPSTAGSPPAPTP-----DSLGPGPSGADTPPPP 303
           P P+ A +PPAP P      +  P P+ A  P PP
Sbjct: 91  PAPAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPP 125

[57][TOP]
>UniRef100_B9RKQ3 ATP binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RKQ3_RICCO
          Length = 670

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 50/113 (44%), Positives = 63/113 (55%), Gaps = 13/113 (11%)
 Frame = +1

Query: 4   PTKPPTATPA------PKAQPPA--AATPPTATPPTATPPAAATPPTATPPTATPPAPAS 159
           P  PP ATPA      P A PPA  AA PP    P+A PPA ATP +  P +++ P P S
Sbjct: 30  PAAPPPATPAAPPPATPAAPPPATPAAPPPAPVTPSAPPPAPATPSSPPPTSSSSPPPPS 89

Query: 160 SPATSPP--APTPASTPSTAPTPST--AGSPPAPTPDSLG-PGPSGADTPPPP 303
           +P+ SPP   P+P S PST P+P T    +P  PTP +   P P  + +P PP
Sbjct: 90  TPSPSPPTSTPSPPSPPSTTPSPPTNSGTTPSTPTPTTRSPPAPPTSSSPSPP 142

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/102 (46%), Positives = 54/102 (52%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPP-TATPAPKAQPPAAATPPT-ATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           PT PP T T AP    PAA  P T A PP ATP A      A PP ATP AP  +P T P
Sbjct: 6   PTSPPSTNTTAPPPATPAAPPPSTPAAPPPATPAAPPPATPAAPPPATPAAPPPAPVT-P 64

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            AP PA    ++P P+++ SPP P+  S  P  S    P PP
Sbjct: 65  SAPPPAPATPSSPPPTSSSSPPPPSTPSPSPPTSTPSPPSPP 106

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/110 (44%), Positives = 57/110 (51%), Gaps = 11/110 (10%)
 Frame = +1

Query: 7   TKPPTATPA------PKAQPPAAATPPTATPPTATPPA--AATPPTATPPTATPPAPA-- 156
           T PP ATPA      P A PPA    P    P A PPA  AA PP    P+A PPAPA  
Sbjct: 15  TAPPPATPAAPPPSTPAAPPPATPAAPPPATPAAPPPATPAAPPPAPVTPSAPPPAPATP 74

Query: 157 -SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            S P TS  +P P STPS +P P++  SPP+P   +  P  +   TP  P
Sbjct: 75  SSPPPTSSSSPPPPSTPSPSP-PTSTPSPPSPPSTTPSPPTNSGTTPSTP 123

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 44/100 (44%), Positives = 58/100 (58%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP A   P A PPA ATP +  P +++ P   + P+ +PPT+T P+P S P+T+P  
Sbjct: 54  PAAPPPAPVTPSAPPPAPATPSSPPPTSSSSPPPPSTPSPSPPTST-PSPPSPPSTTPSP 112

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PT + T  + PTP+T  SPPAP P S  P P     P PP
Sbjct: 113 PTNSGTTPSTPTPTTR-SPPAP-PTSSSPSP-----PSPP 145

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 31/88 (35%), Positives = 51/88 (57%), Gaps = 2/88 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAAT--PPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           P+ PP A   P + PP +++  PP +TP  + P +  +PP+   P +T P+P ++  T+P
Sbjct: 64  PSAPPPAPATPSSPPPTSSSSPPPPSTPSPSPPTSTPSPPS---PPSTTPSPPTNSGTTP 120

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDS 261
             PTP +    AP  S++ SPP+P  +S
Sbjct: 121 STPTPTTRSPPAPPTSSSPSPPSPPSNS 148

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 38/80 (47%), Positives = 46/80 (57%), Gaps = 2/80 (2%)
 Frame = +1

Query: 67  PTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPST-AGSPP 243
           PT T P +T   A  PP ATP    P  PA+ P  +P AP PA TP+ AP P+T A  PP
Sbjct: 4   PTPTSPPSTNTTA--PPPATPAAPPPSTPAAPPPATPAAPPPA-TPA-APPPATPAAPPP 59

Query: 244 AP-TPDSLGPGPSGADTPPP 300
           AP TP +  P P+   +PPP
Sbjct: 60  APVTPSAPPPAPATPSSPPP 79

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 30/78 (38%), Positives = 44/78 (56%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  P T +P+P    P+  +PP+ TP   T  +  TP T TP T +PPAP +S + SPP
Sbjct: 84  SPPPPSTPSPSPPTSTPSPPSPPSTTPSPPTN-SGTTPSTPTPTTRSPPAPPTSSSPSPP 142

Query: 181 APTPASTPSTAPTPSTAG 234
           +P P+++ S   T    G
Sbjct: 143 SP-PSNSSSGISTGVVVG 159

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 28/69 (40%), Positives = 37/69 (53%), Gaps = 3/69 (4%)
 Frame = +1

Query: 103 AATPPTATPPTATPPAPASSPATSPPAPTPASTP---STAPTPSTAGSPPAPTPDSLGPG 273
           +A  PT+ P T T   P ++PA  PP+ TPA+ P     AP P+T  +PP  TP +  P 
Sbjct: 2   SAPTPTSPPSTNTTAPPPATPAAPPPS-TPAAPPPATPAAPPPATPAAPPPATPAAPPPA 60

Query: 274 PSGADTPPP 300
           P     PPP
Sbjct: 61  PVTPSAPPP 69

[58][TOP]
>UniRef100_Q9ZT16 Classical arabinogalactan protein 4 n=1 Tax=Arabidopsis thaliana
           RepID=AGP4_ARATH
          Length = 135

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 48/87 (55%), Positives = 53/87 (60%), Gaps = 5/87 (5%)
 Frame = +1

Query: 1   APTK---PPTATPAPKAQPPAAAT-PPTATPPTATPPAAATPPTATPPTATPPAPASSPA 168
           APT    PP ATP P A PP  AT PP ATP  ATPP AATP  AT P +  P+PA  P 
Sbjct: 25  APTPTATPPPATPPPVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVAPSPADVPT 84

Query: 169 TSPPAPT-PASTPSTAPTPSTAGSPPA 246
            SPPAP  P  +PS+AP PS A   P+
Sbjct: 85  ASPPAPEGPTVSPSSAPGPSDASPAPS 111

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 48/96 (50%), Positives = 53/96 (55%), Gaps = 7/96 (7%)
 Frame = +1

Query: 31  APKAQPPAAATPPTATPPTATPPAAAT-PPTATPPTATPPAPASSPATSPPAPTPASTPS 207
           A  A   A A  PTATPP ATPP  AT PP ATPP A  PAPA+ P  + PAP   + PS
Sbjct: 16  ATSALAQAPAPTPTATPPPATPPPVATPPPVATPPPAATPAPATPPPAATPAPA-TTPPS 74

Query: 208 TAPTPS--TAGSPPAP----TPDSLGPGPSGADTPP 297
            AP+P+     SPPAP       S  PGPS A   P
Sbjct: 75  VAPSPADVPTASPPAPEGPTVSPSSAPGPSDASPAP 110

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/97 (48%), Positives = 53/97 (54%), Gaps = 8/97 (8%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTAT-PPTATPPAAAT-PPTATPPTATPPAPAS-SPATSPP--A 183
           T+  A    P   ATPP AT PP ATPP  AT PP ATP  ATPP  A+ +PAT+PP  A
Sbjct: 17  TSALAQAPAPTPTATPPPATPPPVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVA 76

Query: 184 PTPASTPST---APTPSTAGSPPAPTPDSLGPGPSGA 285
           P+PA  P+    AP   T     AP P    P PS A
Sbjct: 77  PSPADVPTASPPAPEGPTVSPSSAPGPSDASPAPSAA 113

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 38/76 (50%), Positives = 44/76 (57%), Gaps = 3/76 (3%)
 Frame = +1

Query: 85  TATPPAAATPPTATPPTATPPAPASSP--ATSPPAPTPA-STPSTAPTPSTAGSPPAPTP 255
           +A   A A  PTATPP ATPP  A+ P  AT PPA TPA +TP  A TP+     PA TP
Sbjct: 18  SALAQAPAPTPTATPPPATPPPVATPPPVATPPPAATPAPATPPPAATPA-----PATTP 72

Query: 256 DSLGPGPSGADTPPPP 303
            S+ P P+   T  PP
Sbjct: 73  PSVAPSPADVPTASPP 88

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 40/80 (50%), Positives = 45/80 (56%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAP 186
           T PP ATPAP A PP AATP  AT P +  P+ A  PTA+PP   P  P  SP +S P P
Sbjct: 48  TPPPAATPAP-ATPPPAATPAPATTPPSVAPSPADVPTASPP--APEGPTVSP-SSAPGP 103

Query: 187 TPASTPSTAPTPSTAGSPPA 246
           + AS     P PS A S  A
Sbjct: 104 SDAS-----PAPSAAFSNKA 118

[59][TOP]
>UniRef100_B8A9G0 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8A9G0_ORYSI
          Length = 682

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 49/120 (40%), Positives = 54/120 (45%), Gaps = 20/120 (16%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT--SP 177
           P  PP  TP P   PP +  PP  +PP  TPP   +PP  TPP  TPP P + P    SP
Sbjct: 32  PVSPPPVTPPPVTPPPVS--PPPVSPPPVTPP-PVSPPPVTPPPVTPPTPVAPPPVPPSP 88

Query: 178 PAPTPASTPST-APTPSTAGSPPAP-----------------TPDSLGPGPSGADTPPPP 303
           P PTP  TP T +P P    SPP P                  P SL P PS     PPP
Sbjct: 89  PPPTPTPTPVTPSPPPPVTPSPPPPVASPPPPDVPTAPPPSNNPPSLPPSPSNVPASPPP 148

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/102 (40%), Positives = 49/102 (48%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P + P  TP P   PP  + PP   PP   PP   +PP  +PP  TPP  +  P T PP 
Sbjct: 16  PPQTPPVTPPPVTAPPPVSPPPVTPPPVTPPP--VSPPPVSPPPVTPPPVSPPPVTPPPV 73

Query: 184 --PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PTP + P   P+P     PP PTP  + P P    TP PP
Sbjct: 74  TPPTPVAPPPVPPSP----PPPTPTPTPVTPSPPPPVTPSPP 111

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 40/101 (39%), Positives = 48/101 (47%), Gaps = 2/101 (1%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATP-PAAATPPTATPPTATPPAPASSPATSPPA 183
           T PP   P P A PP   +PP   PPT TP P   +PP    P+  PP  +  P   P A
Sbjct: 69  TPPPVTPPTPVAPPPVPPSPP---PPTPTPTPVTPSPPPPVTPSPPPPVASPPPPDVPTA 125

Query: 184 PTPAST-PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P++  PS  P+PS   + P P   SL P       PPPP
Sbjct: 126 PPPSNNPPSLPPSPSNVPASPPPPRISLSP-------PPPP 159

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 39/99 (39%), Positives = 52/99 (52%), Gaps = 11/99 (11%)
 Frame = +1

Query: 4   PTKPPTAT---PAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP----ASS 162
           P  PPT     P P + PP     PT TP T +PP   T P+  PP A+PP P    A  
Sbjct: 72  PVTPPTPVAPPPVPPSPPPPT---PTPTPVTPSPPPPVT-PSPPPPVASPPPPDVPTAPP 127

Query: 163 PATSPPA--PTPASTPSTAPTPSTAGSPPAP--TPDSLG 267
           P+ +PP+  P+P++ P++ P P  + SPP P  TP   G
Sbjct: 128 PSNNPPSLPPSPSNVPASPPPPRISLSPPPPPSTPTQSG 166

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 28/78 (35%), Positives = 39/78 (50%), Gaps = 3/78 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPP---AAATPPTATPPTATPPAPASSPATSPPA 183
           PPT TP P    P     P+  PP A+PP       PP +  P + PP+P++ PA+ PP 
Sbjct: 90  PPTPTPTPVTPSPPPPVTPSPPPPVASPPPPDVPTAPPPSNNPPSLPPSPSNVPASPPPP 149

Query: 184 PTPASTPSTAPTPSTAGS 237
               S P    TP+ +G+
Sbjct: 150 RISLSPPPPPSTPTQSGA 167

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 29/72 (40%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +1

Query: 88  ATPPAAATPPTATPPTATPPAPASSPATSPP-APTPASTPSTAPTPSTAGSPPAPTPDSL 264
           + P   A PP  TPP   PP  A  P + PP  P P + P  +P P    SPP  TP  +
Sbjct: 7   SAPVTPAAPPPQTPPVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPV---SPPPVTPPPV 63

Query: 265 GPGPSGADTPPP 300
            P P    TPPP
Sbjct: 64  SPPPV---TPPP 72

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 33/81 (40%), Positives = 37/81 (45%), Gaps = 7/81 (8%)
 Frame = +1

Query: 82  PTATPPAAATPPT---ATPPTATPPAPASSPATSPP--APTPASTPSTAPTPSTAG--SP 240
           P+A    AA PP     TPP  T P P S P  +PP   P P S P  +P P T    SP
Sbjct: 6   PSAPVTPAAPPPQTPPVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPVSPPPVTPPPVSP 65

Query: 241 PAPTPDSLGPGPSGADTPPPP 303
           P  TP  + P    A  P PP
Sbjct: 66  PPVTPPPVTPPTPVAPPPVPP 86

[60][TOP]
>UniRef100_B6U1N0 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6U1N0_MAIZE
          Length = 299

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 44/90 (48%), Positives = 52/90 (57%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   APTKPP----TATPAPKAQPPAAATPPTA-TPPTATPPAAATPPTATPPTATPPAPASSP 165
           APT PP    T  PAP   PPA  TPP A T P  +PPA+  P   TPP + P +P  +P
Sbjct: 65  APTTPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAP 124

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTP 255
           AT PP+P  A  P+T P P+T   P APTP
Sbjct: 125 ATPPPSPPMAPPPATPPPPATPPPPAAPTP 154

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 49/105 (46%), Positives = 55/105 (52%), Gaps = 6/105 (5%)
 Frame = +1

Query: 4   PTKPPTATP--APKAQPPAAATPPTA--TPPTA--TPPAAATPPTATPPTATPPAPASSP 165
           P   PTATP  AP   PPA  TPP A  TPP A  TPP A T P  +PP + PPAP + P
Sbjct: 54  PPPAPTATPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPP 113

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            + P +P PA  P+T P       PPA  P    P P  A TP P
Sbjct: 114 PSPPASPPPA--PATPPPSPPMAPPPATPPPPATPPPPAAPTPAP 156

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 52/110 (47%), Positives = 58/110 (52%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPP---TATPPAAATPPTATPPTATPPAPASSP-AT 171
           P  PP   P P   PP A   PTATPP   T  PPA  TPP A  PT  PPAP + P A 
Sbjct: 40  PQAPPAGNPPPAGNPPPA---PTATPPPAPTTPPPAPTTPPPA--PTTPPPAPTTPPPAP 94

Query: 172 SPPAPTPASTPSTAPT---PSTAGSPPAPTPDSLGPGPSGAD---TPPPP 303
           + P P+P ++P  APT   PS   SPP P P +  P P  A    TPPPP
Sbjct: 95  TTPPPSPPASPPPAPTTPPPSPPASPP-PAPATPPPSPPMAPPPATPPPP 143

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 42/97 (43%), Positives = 45/97 (46%), Gaps = 2/97 (2%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPAS 198
           TA  +P AQPP     P A  P   PPA   PP   PP A    P  +P T PPAPT   
Sbjct: 18  TAQQSPPAQPPPTPNAPPANSPPQAPPAGNPPPAGNPPPAPTATPPPAPTTPPPAPTTPP 77

Query: 199 TPSTAPTPSTAGSPPAPT--PDSLGPGPSGADTPPPP 303
              T P P+    PPAPT  P S    P  A T PPP
Sbjct: 78  PAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPP 114

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 50/108 (46%), Positives = 54/108 (50%), Gaps = 12/108 (11%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTATPPTATPPAAATPP---TATPP---TATPPAPAS---SPA 168
           P A P P    P A +PP A PP   PP A  PP   TATPP   T  PPAP +   +P 
Sbjct: 23  PPAQPPPTPNAPPANSPPQA-PPAGNPPPAGNPPPAPTATPPPAPTTPPPAPTTPPPAPT 81

Query: 169 TSPPAP-TPASTPSTAPTPSTAGSPPAPT--PDSLGPGPSGADTPPPP 303
           T PPAP TP   P+T P    A  PPAPT  P S    P  A   PPP
Sbjct: 82  TPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPP 129

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 41/89 (46%), Positives = 48/89 (53%), Gaps = 7/89 (7%)
 Frame = +1

Query: 1   APTKPP----TATPAPKAQPPAAATPPTATPPTATPPAAATPPTA---TPPTATPPAPAS 159
           APT PP    T  P+P A PP A T P  +PP + PPA ATPP +    PP ATPP PA+
Sbjct: 86  APTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPPSPPMAPPPATPPPPAT 145

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPA 246
            P   P APTPA +  T      A +  A
Sbjct: 146 PP--PPAAPTPAPSVGTVVAVEAAATAVA 172

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 34/80 (42%), Positives = 41/80 (51%), Gaps = 3/80 (3%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTA---TPPTATPPAAATPPTATPPTATPPAPASSPAT 171
           APT PP + PA  + PPA ATPP +    PP ATPP  ATPP   PP A  PAP+     
Sbjct: 108 APTTPPPSPPA--SPPPAPATPPPSPPMAPPPATPPPPATPP---PPAAPTPAPSVGTVV 162

Query: 172 SPPAPTPASTPSTAPTPSTA 231
           +  A   A   +     +TA
Sbjct: 163 AVEAAATAVAGAVMAAAATA 182

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 30/74 (40%), Positives = 37/74 (50%), Gaps = 2/74 (2%)
 Frame = +1

Query: 88  ATPPAAATPPTATPPTATPPAPASSPATSPPA--PTPASTPSTAPTPSTAGSPPAPTPDS 261
           A+  A  +PP   PPT   P PA+SP  +PPA  P PA  P  APT +   +P  P P  
Sbjct: 15  ASCTAQQSPPAQPPPTPNAP-PANSPPQAPPAGNPPPAGNPPPAPTATPPPAPTTPPPAP 73

Query: 262 LGPGPSGADTPPPP 303
             P P+    PP P
Sbjct: 74  TTPPPAPTTPPPAP 87

[61][TOP]
>UniRef100_B9Q1D7 Chloride channel, putative n=1 Tax=Toxoplasma gondii GT1
           RepID=B9Q1D7_TOXGO
          Length = 1756

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 44/118 (37%), Positives = 77/118 (65%), Gaps = 21/118 (17%)
 Frame = +1

Query: 13  PPTATPAPKAQP-----PAAATPPTATPPT-------ATPPAAATPPTATPP--TATPPA 150
           PP++ P+P + P     P+ ++PP+++PP+       +T P+ ++PP ++PP  ++T P+
Sbjct: 225 PPSSPPSPSSAPSSSTSPSPSSPPSSSPPSPSSAPSSSTSPSPSSPPPSSPPSSSSTSPS 284

Query: 151 PASSPATSPPAP-----TPASTPSTAPTPSTA--GSPPAPTPDSLGPGPSGADTPPPP 303
           P+S+P++SPP+P     +P S+ ST+P+PS+A   SPP+ +P S  P PS +  PP P
Sbjct: 285 PSSAPSSSPPSPSPPPSSPPSSSSTSPSPSSAPSSSPPSSSPSSSSPPPSSSPPPPSP 342

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 37/101 (36%), Positives = 68/101 (67%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P+ PP+++P P + P +++ PP+++PP ++PP+    P++ P ++T P+P+S P++SPP
Sbjct: 199 SPSSPPSSSP-PSSSPSSSSPPPSSSPPPSSPPS----PSSAPSSSTSPSPSSPPSSSPP 253

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P+ A + ST+P+PS+      P+  S  P PS A +  PP
Sbjct: 254 SPSSAPSSSTSPSPSSPPPSSPPSSSSTSPSPSSAPSSSPP 294

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 40/110 (36%), Positives = 75/110 (68%), Gaps = 11/110 (10%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATP-PTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           + PP+++P+  + PP+++ PP++ P P++ P ++ +P  ++PP+++PP+P+S+P++S  +
Sbjct: 206 SSPPSSSPSSSSPPPSSSPPPSSPPSPSSAPSSSTSPSPSSPPSSSPPSPSSAPSSST-S 264

Query: 184 PTPASTP--------STAPTPSTA--GSPPAPTPDSLGPGPSGADTPPPP 303
           P+P+S P        ST+P+PS+A   SPP+P+P    P PS + T P P
Sbjct: 265 PSPSSPPPSSPPSSSSTSPSPSSAPSSSPPSPSPPPSSP-PSSSSTSPSP 313

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 37/108 (34%), Positives = 72/108 (66%), Gaps = 8/108 (7%)
 Frame = +1

Query: 1   APTKPPTATP-APKAQPPAAATPPTATPPTATPPAAATP-------PTATPPTATPPAPA 156
           +P+ PP+++P +P + P ++ +P  ++PP ++PP++++        P+++PP+ +PP P+
Sbjct: 243 SPSSPPSSSPPSPSSAPSSSTSPSPSSPPPSSPPSSSSTSPSPSSAPSSSPPSPSPP-PS 301

Query: 157 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           S P++S  +P+P+S PS++P PS++ S  +P P S  P PS   + PP
Sbjct: 302 SPPSSSSTSPSPSSAPSSSP-PSSSPSSSSPPPSSSPPPPSPPSSSPP 348

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 33/95 (34%), Positives = 61/95 (64%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPA 195
           P  +P   +    +++P T+T P+ + P +++PP+++P +++PP  +S P +SPP+P+ A
Sbjct: 176 PFLSPPSSSSSSPSSSPSTSTSPSPSSPPSSSPPSSSPSSSSPPPSSSPPPSSPPSPSSA 235

Query: 196 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            + ST+P+PS   SPP+ +P S    PS + +P P
Sbjct: 236 PSSSTSPSPS---SPPSSSPPSPSSAPSSSTSPSP 267

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 35/101 (34%), Positives = 67/101 (66%), Gaps = 2/101 (1%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPT-ATPPTATPPAAATPPTATPPTA-TPPAPASSPATSPP 180
           T P  ++P P + P +++T P+ ++ P+++PP+ + PP++ P ++ T P+P+S+P++SPP
Sbjct: 263 TSPSPSSPPPSSPPSSSSTSPSPSSAPSSSPPSPSPPPSSPPSSSSTSPSPSSAPSSSPP 322

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           + +P+   S++P PS++  PP+P P S  P  S   + P P
Sbjct: 323 SSSPS---SSSPPPSSSPPPPSP-PSSSPPSSSSPSSSPSP 359

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 62/93 (66%), Gaps = 8/93 (8%)
 Frame = +1

Query: 4   PTKPPTAT---PAPKAQP---PAAATPPTATPP--TATPPAAATPPTATPPTATPPAPAS 159
           P+ PP+++   P+P + P   P + +PP ++PP  ++T P+ ++ P+++PP+++P + + 
Sbjct: 272 PSSPPSSSSTSPSPSSAPSSSPPSPSPPPSSPPSSSSTSPSPSSAPSSSPPSSSPSSSSP 331

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPD 258
            P++SPP P+P S  S+ P+ S+  S P+P+ D
Sbjct: 332 PPSSSPPPPSPPS--SSPPSSSSPSSSPSPSAD 362

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 30/90 (33%), Positives = 61/90 (67%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P+ PP++ P+  +  P+ ++ P+++PP+++P +++ PP+++PP   PP+P   P++SPP
Sbjct: 295 SPSPPPSSPPSSSSTSPSPSSAPSSSPPSSSPSSSSPPPSSSPP---PPSP---PSSSPP 348

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGP 270
           +   +S+PS++P+PS   S  A  P +  P
Sbjct: 349 S---SSSPSSSPSPSADLSERAQGPANEAP 375

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 28/78 (35%), Positives = 50/78 (64%), Gaps = 3/78 (3%)
 Frame = +1

Query: 79  PPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPAST---PSTAPTPSTAGSPPAP 249
           P  + P ++++ P+++P T+T P+P+S P++SPP+ +P+S+   PS++P PS+  SP + 
Sbjct: 176 PFLSPPSSSSSSPSSSPSTSTSPSPSSPPSSSPPSSSPSSSSPPPSSSPPPSSPPSPSSA 235

Query: 250 TPDSLGPGPSGADTPPPP 303
              S  P PS   +  PP
Sbjct: 236 PSSSTSPSPSSPPSSSPP 253

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP--PTATPPTATPPAAATPPTA-TPPTATPPAPASSPATS 174
           P+ P +++P+    P + + P  P++ P    PP++ +P ++ + P    P+ +SS ++S
Sbjct: 580 PSSPYSSSPSVPVPPSSPSMPLLPSSPPSVPVPPSSPSPSSSLSAPVPPSPSSSSSHSSS 639

Query: 175 PPA--PTPASTPSTAPTPSTAGSPPAPTPD-SLGPGPSGADTPPPP 303
            P+  P P   PS +P+PS+A SP  P P  S  P PS + + P P
Sbjct: 640 SPSVLPLPPHVPS-SPSPSSASSPSMPLPTLSSSPPPSPSPSSPSP 684

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 30/102 (29%), Positives = 53/102 (51%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAA--TPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           P+ PP+    P +  P+++   P   +P +++  ++++P     P   P +P+ S A+SP
Sbjct: 603 PSSPPSVPVPPSSPSPSSSLSAPVPPSPSSSSSHSSSSPSVLPLPPHVPSSPSPSSASSP 662

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P P  T S++P PS + S P+P+  S+    S    PP P
Sbjct: 663 SMPLP--TLSSSPPPSPSPSSPSPSSPSVPLSSSSPSVPPSP 702

[62][TOP]
>UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J4Y2_HUMAN
          Length = 253

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 40/97 (41%), Positives = 47/97 (48%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           PP  +P P   PP+   PP  +PP   PP+   PP  +PP   PP+P   P  SPPAP+P
Sbjct: 160 PPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSP 219

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            S P   P P     PP P P    P P     PPPP
Sbjct: 220 PSPPLPPPPPPPPSPPPPPPPSPPPPSP-----PPPP 251

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 40/103 (38%), Positives = 49/103 (47%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPK--AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           +P  PP + P P   + PP   +PP   PP+  PP  + PP   PP+  PP P S P   
Sbjct: 127 SPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPL 186

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP+P P   PS  P P  +  PP P P    P P     PPPP
Sbjct: 187 PPSPPPPPPPSPPPPPPPS-PPPPPLPSPPAPSPPSPPLPPPP 228

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 39/100 (39%), Positives = 49/100 (49%), Gaps = 3/100 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPT---ATPPAPASSPATSPPA 183
           PP   P+P   PP+   PP  +PP+  PP+   PP  +PP    + PP P SSP   PP 
Sbjct: 18  PPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPP 77

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   P  +P P     PP P   S  P P    +PPPP
Sbjct: 78  PSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPP 117

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 39/103 (37%), Positives = 51/103 (49%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPP---TATPPTATPPAPASSPATS 174
           P+ PP   P+P   PP+   PP ++PP   PP +  PP   +  PP  +PP P   P+  
Sbjct: 46  PSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPP 105

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP P P+S P   P+P      P P P S  P P  +  PPPP
Sbjct: 106 PPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPP 148

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 43/103 (41%), Positives = 52/103 (50%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP + P P   PP+   PP + PP   PP+   PP  +PP   PP+P   P  SPP
Sbjct: 142 SPPPPPPSPPPPP--PPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPP 199

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDS--LGPGPSGADTPPPP 303
            P P S     P P    SPPAP+P S  L P P    +PPPP
Sbjct: 200 PPPPPS-----PPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPP 237

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/100 (40%), Positives = 50/100 (50%), Gaps = 3/100 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           PP  +P P   PP++  PP    P   PP+   PP  +PP+  PP+P   P  SPP P P
Sbjct: 2   PPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPP 61

Query: 193 AS---TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +     PS+ P P    SPP P P S  P P  +  PPPP
Sbjct: 62  SQPPPPPSSPPPPPPPPSPPPPPPPS-PPPPLPSPPPPPP 100

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 41/106 (38%), Positives = 48/106 (45%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP-- 177
           P  PP   P P + PP     P   PP+  PP   +PP+  PP+  PP P S P   P  
Sbjct: 4   PPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQ 63

Query: 178 PAPTPASTPSTAPTPS----TAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P P+S P   P PS       SPP P P    P P  +  PPPP
Sbjct: 64  PPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPP 109

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 39/100 (39%), Positives = 47/100 (47%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  P +  P P + PP   +PP   P    PP  + PP   PP + PP P  SP   PP+
Sbjct: 108 PPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPP---PPPSPPPPPPPSPPPPPPS 164

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P  +P P    SPP P P S  P P  +  PPPP
Sbjct: 165 P-PPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPP 203

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 37/100 (37%), Positives = 45/100 (45%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP + P P   PP     P   P  + PP   +PP   PP+  PP P+  P   PP
Sbjct: 113 SPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPP 172

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           +P P   PS  P      SPP P P S  P P  +  PPP
Sbjct: 173 SPLPPPPPS--PPHPLPPSPPPPPPPSPPPPPPPSPPPPP 210

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 39/110 (35%), Positives = 47/110 (42%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTAT-----PPTATPPAPASSPA 168
           P  PP   P+P   PP  + PP    P++ PP   +PP        PP + PP P  SP 
Sbjct: 85  PPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPP 144

Query: 169 TSPPAPTPASTPSTAPTPSTAGSP-----PAPTPDSLGPGPSGADTPPPP 303
             PP+P P   PS  P P +   P     P P P    P P     PPPP
Sbjct: 145 PPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPP 194

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 39/112 (34%), Positives = 47/112 (41%), Gaps = 12/112 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPP-------TATPPTATPPAPASS 162
           P+ PP   P P   PP   +PP   P    PP   +PP       +  PP  +PP P  S
Sbjct: 68  PSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLS 127

Query: 163 PATSPPAPTP-----ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P   PP+P P        P  +P P    SPP P P    P P  +  PPPP
Sbjct: 128 PPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPP 179

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 37/100 (37%), Positives = 48/100 (48%), Gaps = 3/100 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           PP ++P P   PP+   PP  +PP   P     PP  +PP   PP P+S P   PP P+P
Sbjct: 66  PPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPP-PPPPLPSSPP---PPPPSP 121

Query: 193 ASTPSTAPTPSTAGSPP---APTPDSLGPGPSGADTPPPP 303
              P + P P  +  PP   +P P    P P    +PPPP
Sbjct: 122 PPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPP 161

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 34/86 (39%), Positives = 42/86 (48%), Gaps = 1/86 (1%)
 Frame = +1

Query: 46  PPAAATPPTATPPTATPPAAATP-PTATPPTATPPAPASSPATSPPAPTPASTPSTAPTP 222
           PP   +PP   PP ++PP    P P   PP+  PP P S P+  PP+P P   PS  P P
Sbjct: 1   PPPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPP 60

Query: 223 STAGSPPAPTPDSLGPGPSGADTPPP 300
            +   PP  +P    P PS    PPP
Sbjct: 61  PSQPPPPPSSPPPPPPPPSPPPPPPP 86

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 39/111 (35%), Positives = 49/111 (44%), Gaps = 10/111 (9%)
 Frame = +1

Query: 1   APTKPPTAT-----PAPKAQPPAAATPPTATPPTATPPAAATPP-----TATPPTATPPA 150
           +P  PP  +     P+P   PP  + PP    P++ PP   +PP        PP + PP 
Sbjct: 79  SPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPP 138

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P  SP   PP+P P   PS  P P +   PP P P  L P P     P PP
Sbjct: 139 PLLSPPPPPPSPPPPPPPSPPPPPPSP-PPPLPPPSPLPPPPPSPPHPLPP 188

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 31/83 (37%), Positives = 41/83 (49%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP  +P P   PP+   PP  +PP   PP+   PP  +PP  +PP+P   P   PP
Sbjct: 173 SPLPPPPPSP-PHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPSP---PLPPPP 228

Query: 181 APTPASTPSTAPTPSTAGSPPAP 249
            P P+  P   P+P     PP P
Sbjct: 229 PPPPSPPPPPPPSPPPPSPPPPP 251

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 29/76 (38%), Positives = 36/76 (47%), Gaps = 4/76 (5%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTAT----PPAPASSPAT 171
           P  PP   P P   PP   +PP   PP+  PP   +PP  +PP+      PP P S P  
Sbjct: 179 PPSPPHPLP-PSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPP 237

Query: 172 SPPAPTPASTPSTAPT 219
            PP+P P S P   P+
Sbjct: 238 PPPSPPPPSPPPPPPS 253

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 27/64 (42%), Positives = 32/64 (50%)
 Frame = +1

Query: 112 PPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 291
           PP    P   PP P+S P   PP+P P   P  +P P    SPP+P P S  P P  +  
Sbjct: 1   PPPPPSPPPPPPPPSSPPPPPPPSPPP---PPPSPPPPPPPSPPSPLPPSPPPPPPPSPP 57

Query: 292 PPPP 303
           PPPP
Sbjct: 58  PPPP 61

[63][TOP]
>UniRef100_Q9FPQ6 Vegetative cell wall protein gp1 n=1 Tax=Chlamydomonas reinhardtii
           RepID=GP1_CHLRE
          Length = 555

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 41/101 (40%), Positives = 58/101 (57%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  P  A P+P    PA  +PP+  PP+  PP+ A PP+  PP+  PP+PA  P+ +PP
Sbjct: 57  SPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPA-PPSPAPPSPAPPSPAP-PSPAPP 114

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P S PS AP   +  +PP+P+P S  P    +  PP P
Sbjct: 115 SPAPPSPPSPAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSP 155

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 42/102 (41%), Positives = 58/102 (56%), Gaps = 3/102 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  P   +P P   PP   TPP+ +PP+  PP+    P   PP+  PP+PA SP  SP  
Sbjct: 285 PMPPSPPSPPPSPAPPTPPTPPSPSPPSPVPPS----PAPVPPSPAPPSPAPSPPPSPAP 340

Query: 184 PTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPP 300
           PTP+ +PS +P+PS + SP   P+P+P  + P PS   +P P
Sbjct: 341 PTPSPSPSPSPSPSPSPSPSPSPSPSPSPI-PSPSPKPSPSP 381

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 39/100 (39%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  P  A P+P    P+   PP+  PP+  PP    PP+  PP+  PP P S    SPP+
Sbjct: 166 PVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPV---PPSPAPPSPAPPVPPSPAPPSPPS 222

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S PS AP   +  +PP+P P S  P      +P PP
Sbjct: 223 PAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPP 262

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 38/100 (38%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+  P   P+P    PA   PP+  PP+  PP    PP+  PP+   PAP S P+ +PP+
Sbjct: 179 PSPSPPVPPSPAPPSPAPPVPPSPAPPSPAPPV---PPSPAPPSPPSPAPPSPPSPAPPS 235

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P + PS  P      SP  P+P    P P  +  PPPP
Sbjct: 236 PSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPP 275

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/113 (36%), Positives = 60/113 (53%), Gaps = 12/113 (10%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA--TPPTATPPTATPPAPAS----- 159
           AP  P   +PAP +  P +  PP+  PP+  PP+ A  +PP+  PP+ +PPAP S     
Sbjct: 82  APPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSPSPPS 141

Query: 160 -----SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                 P+ +PP+P+P   PS +P    + +PP+PTP S  P    +  PP P
Sbjct: 142 PAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSP 194

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/114 (38%), Positives = 57/114 (50%), Gaps = 13/114 (11%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTAT-PPAPASSPAT-S 174
           +P  P  + PAP +  P +  PP+  PP+  PPA   PP+  PP    PP PA++P   S
Sbjct: 230 SPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPS 289

Query: 175 PPAPTPASTPSTAPTP-----------STAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP+P P+  P T PTP           S A  PP+P P S  P P  +  PP P
Sbjct: 290 PPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTP 343

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 39/103 (37%), Positives = 58/103 (56%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA--SSPATS 174
           +P  P  A P+P +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  S P+ +
Sbjct: 67  SPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPSPA-PPSPAPPSPAPPSPAPPSPPSPA 125

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP+P+P + PS +P       PP+P P S  P    + +PP P
Sbjct: 126 PPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVP 168

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 48/114 (42%), Positives = 62/114 (54%), Gaps = 14/114 (12%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAA-TP----PTATPPTATPPAAATPPTATPPTATPPAPAS-- 159
           AP  PP+  P P  +PP  A TP    P + PP+  PP   TPP+ +PP+  PP+PA   
Sbjct: 263 APPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVP 322

Query: 160 ------SPATSPPAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPP 300
                 SPA SPP      TPS +P+PS + SP P+P+P S  P PS   +P P
Sbjct: 323 PSPAPPSPAPSPPPSPAPPTPSPSPSPSPSPSPSPSPSP-SPSPSPSPIPSPSP 375

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 42/103 (40%), Positives = 55/103 (53%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA--TPPTATPPTATPPAPAS-SPATS 174
           P  P   +PAP +  P +  PP+  PP+  PP+ A  +PP+  PP+  PP+PA  SPA  
Sbjct: 40  PPSPAPPSPAPPSPAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPP 99

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PAP   + PS AP      SPP+P P S  P P    +P PP
Sbjct: 100 SPAPPSPAPPSPAPPSPAPPSPPSPAPPS--PSPPAPPSPSPP 140

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+  P   P+P    PA   PP+  PP+   PA  +PP+  PP+ +PPAP   P+  PP+
Sbjct: 192 PSPAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAP---PSPVPPS 248

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S    +P P     PP+P P      P  A+TP PP
Sbjct: 249 PAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPP 288

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 39/105 (37%), Positives = 55/105 (52%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQP-PAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS--SPAT 171
           +P  PP+ +P   A P P +  PP+ +PP    P+   PP+  PP+ TPP+P+    P+ 
Sbjct: 130 SPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSP 189

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDS-LGPGPSGADTPPPP 303
           +PP+P P   PS AP       PP+P P S   P P    +P PP
Sbjct: 190 APPSPAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAPP 234

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 42/105 (40%), Positives = 57/105 (54%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQP-PAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           +P  P   +PAP + P PA  +PP+  PP+ +PPA   PP+  PP+  PP+PA  P+  P
Sbjct: 206 SPAPPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPA---PPSPVPPSPAPPSPAP-PSPKP 261

Query: 178 PAPTPASTPSTAPTPS---TAGSPPAPTPDSLGPGPSGADTPPPP 303
           PAP P  +P   P P     A +P  P+P S  P P+    P PP
Sbjct: 262 PAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPP 306

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 47/114 (41%), Positives = 61/114 (53%), Gaps = 14/114 (12%)
 Frame = +1

Query: 1   APTKPPT-ATPAPKAQPPAAATPPTATPPTATPPAA---ATPPTATPPTATPPA---PAS 159
           AP  PP+ A P+P    P +  PP+  PP+  PP+    A PP  +PP   PP    PA+
Sbjct: 224 APPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPAN 283

Query: 160 SP-ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP------GPSGADTPPP 300
           +P   SPP+P P+  P T PTP +  SPP+P P S  P       PS A +PPP
Sbjct: 284 TPMPPSPPSPPPSPAPPTPPTPPSP-SPPSPVPPSPAPVPPSPAPPSPAPSPPP 336

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 39/104 (37%), Positives = 53/104 (50%), Gaps = 3/104 (2%)
 Frame = +1

Query: 1   APTKPPT-ATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS--PAT 171
           AP  PP+ A P+P    P + +PP+  PP    PA  +P    PP+ +PP P S   P+ 
Sbjct: 117 APPSPPSPAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSP 176

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +PP+P+P   PS AP       PP+P P S  P    +  PP P
Sbjct: 177 TPPSPSPPVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPSP 220

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 42/108 (38%), Positives = 53/108 (49%), Gaps = 8/108 (7%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP----PTATPPTATPPAPASSPA 168
           AP  P   +P P A PP  + PP   PP   P  A TP    P + PP+  PP P + P+
Sbjct: 250 APPSPAPPSPKPPAPPPPPSPPPP--PPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPS 307

Query: 169 TSPPAPTPAS----TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            SPP+P P S     PS AP       PP+P P +  P PS + +P P
Sbjct: 308 PSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSPSPSPSPSP 355

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 47/125 (37%), Positives = 65/125 (52%), Gaps = 25/125 (20%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPT----------------------ATPPTATPPAAATP 114
           +P  P  A P+PK  PPA   PP+                      + PP+  PP   TP
Sbjct: 248 SPAPPSPAPPSPK--PPAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTP 305

Query: 115 PTATPPTATPPAPAS-SPATSPPAPTPASTPSTA-PTPSTAGSP-PAPTPDSLGPGPSGA 285
           P+ +PP+  PP+PA   P+ +PP+P P+  PS A PTPS + SP P+P+P S  P PS +
Sbjct: 306 PSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSPSPSPSPSP-SPSPSPSPS 364

Query: 286 DTPPP 300
            +P P
Sbjct: 365 PSPSP 369

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 43/99 (43%), Positives = 53/99 (53%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  P  A P+P    P +  PP+  PP    PA  +PP+  PP+  PP+PA  P+ SPPA
Sbjct: 184 PVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAPPS--PPSPA-PPSPSPPA 240

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P     PS AP PS A  PP+P P +  P PS    PPP
Sbjct: 241 PPSPVPPSPAP-PSPA--PPSPKPPAPPPPPSPPPPPPP 276

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 43/106 (40%), Positives = 57/106 (53%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQP-PAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS--SPATS 174
           P  P   +P+P   P P+   PP+  PP+ TPP+ + P    PP+  PP+PA    P+ +
Sbjct: 147 PPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPP---VPPSPAPPSPAPPVPPSPA 203

Query: 175 PPAPTPASTPSTAP--TPSTA-GSPPAPTPDSLGPGPSGADTPPPP 303
           PP+P P   PS AP   PS A  SPP+P P S  P P    +P PP
Sbjct: 204 PPSPAPPVPPSPAPPSPPSPAPPSPPSPAPPS--PSPPAPPSPVPP 247

[64][TOP]
>UniRef100_UPI0001925155 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra
           magnipapillata RepID=UPI0001925155
          Length = 781

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 47/107 (43%), Positives = 54/107 (50%), Gaps = 8/107 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPP------TATPPAPASSP 165
           P  PP   P+P   PPAA   P A+PP A PPAA   P A PP       A PPA  +SP
Sbjct: 147 PVLPPETPPSPAVLPPAAPISPAASPPAAPPPAAPASPAAPPPAAPASSAAPPPAAPASP 206

Query: 166 ATSPPAP--TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           A  PPA   +PA+ P  AP P+   SP AP P      P+    PPP
Sbjct: 207 AAPPPAAPGSPAAPPPAAPPPAAPASPAAPPP----AAPASPAAPPP 249

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/106 (46%), Positives = 56/106 (52%), Gaps = 9/106 (8%)
 Frame = +1

Query: 4   PTKPPTATPA-PKAQPPAA----ATPPTATP--PTATPPAAATPPTATPPTATPPAPASS 162
           P  PP A PA P A PPAA    A PP A P  P A PPAA   P A PP A PPA  +S
Sbjct: 173 PAAPPPAAPASPAAPPPAAPASSAAPPPAAPASPAAPPPAAPGSPAAPPPAAPPPAAPAS 232

Query: 163 PATSPPA--PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
           PA  PPA   +PA+ P  AP    A  P AP   ++ P P+   +P
Sbjct: 233 PAAPPPAAPASPAAPPPAAPASPAAPPPAAPASPAVLPPPAAPPSP 278

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 44/109 (40%), Positives = 52/109 (47%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATP-PTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P  P +    P  +PP    PP   P P   PPAA   P A+PP A PPA  +SPA  PP
Sbjct: 130 PVAPSSPVAPPPTEPPLPVLPPETPPSPAVLPPAAPISPAASPPAAPPPAAPASPAAPPP 189

Query: 181 -------APTPASTPS-TAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                  AP PA+  S  AP P+  GSP AP P +  P    +   PPP
Sbjct: 190 AAPASSAAPPPAAPASPAAPPPAAPGSPAAPPPAAPPPAAPASPAAPPP 238

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 44/105 (41%), Positives = 52/105 (49%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSP---AT 171
           +P  PP A PA  A PP AA    A PP A P + A PP A PP A P +PA+ P     
Sbjct: 183 SPAAPPPAAPASSAAPPPAAPASPAAPPPAAPGSPAAPPPAAPPPAAPASPAAPPPAAPA 242

Query: 172 SPPAPTPASTPS-TAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           SP AP PA+  S  AP P+   SP    P +  P P    +P  P
Sbjct: 243 SPAAPPPAAPASPAAPPPAAPASPAVLPPPAAPPSPVALISPAAP 287

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/104 (44%), Positives = 52/104 (50%), Gaps = 8/104 (7%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAA----ATPPTATP--PTATPPAPASSPATS 174
           PP A  +P A PPAA  P     P A PPAA    A PP A P  P A PPA   SPA  
Sbjct: 161 PPAAPISPAASPPAAPPPAAPASPAAPPPAAPASSAAPPPAAPASPAAPPPAAPGSPAAP 220

Query: 175 PPAPTPASTPST--APTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           PPA  P + P++  AP P+   SP AP P      P+    PPP
Sbjct: 221 PPAAPPPAAPASPAAPPPAAPASPAAPPP----AAPASPAAPPP 260

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 40/104 (38%), Positives = 51/104 (49%), Gaps = 3/104 (2%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP A P   A PP AA PP A    A PP AA    A PP A P +PA+ P  +P 
Sbjct: 205 SPAAPPPAAPGSPAAPPPAAPPPAAPASPAAPPPAAPASPAAPPPAAPASPAAPPPAAPA 264

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           +P     P+  P+P    SP AP+P +     P P+   +P  P
Sbjct: 265 SPAVLPPPAAPPSPVALISPAAPSPAAPLPASPPPAALASPVAP 308

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/100 (44%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP A   P + PPAA   P A  P A P     PP ATPP+   P PA+    SPP 
Sbjct: 545 PAVPPPAALRPASLPPAAPASPVAPIPPAAPSLLVVPPPATPPSLVAPPPAAPMLASPPP 604

Query: 184 PTP-ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            +P A TP TAP PS A  PPA  P +  P P+   +P P
Sbjct: 605 ASPVALTPPTAP-PSPAAPPPA-APPTASPPPAATPSPVP 642

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 47/98 (47%), Positives = 52/98 (53%), Gaps = 12/98 (12%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPA-----------AATPPTATPPTATPPAPAS 159
           PPTA P+P A PPAA  PPTA+PP A  P+            ATPP A P +A P APAS
Sbjct: 612 PPTAPPSPAAPPPAA--PPTASPPPAATPSPVPLIPLATLPPATPPPAEPASAPPAAPAS 669

Query: 160 SPATSPPA-PTPASTPSTAPTPSTAGSPPAPTPDSLGP 270
             A  PPA P PAS P  AP    A +PPA       P
Sbjct: 670 PVALIPPATPPPASPPLAAPASPVALAPPAAPASPAAP 707

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/106 (43%), Positives = 54/106 (50%), Gaps = 7/106 (6%)
 Frame = +1

Query: 4   PTKPPTATPA-PKAQPPAA----ATPPTATP--PTATPPAAATPPTATPPTATPPAPASS 162
           P  PP A PA P A PPAA    A PP A P  P A PPAA   P   PP A PP+P + 
Sbjct: 222 PAAPPPAAPASPAAPPPAAPASPAAPPPAAPASPAAPPPAAPASPAVLPPPAAPPSPVA- 280

Query: 163 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
              SP AP+PA+    +P P+   SP AP P +  P    +   PP
Sbjct: 281 -LISPAAPSPAAPLPASPPPAALASPVAPIPPAAPPLAVPSPASPP 325

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 47/109 (43%), Positives = 55/109 (50%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATP--PAAATPPTATPPTATPPA---PASSPA 168
           P  PP A P+P + P AA   P A  P A P  PAA   P A PP A PPA   PAS P 
Sbjct: 311 PAAPPLAVPSPASPPAAAPASPVALIPPAAPSLPAAPPSPVAPPPVAPPPAASIPASPPP 370

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTP--PPP 303
            +P +P    +P+    P+T  SP AP P +  P   P  A TP  PPP
Sbjct: 371 AAPASPVALISPAAPSLPATPFSPVAPPPVAPPPTATPPAASTPASPPP 419

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 43/104 (41%), Positives = 53/104 (50%), Gaps = 4/104 (3%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATP--PAAATPPTATPPTATPPAPASSPATS 174
           +P  PP   P P A PPAA+TP  A+PP A P  P A  PP A    A PP+P + P  +
Sbjct: 393 SPVAPPPVAPPPTATPPAASTP--ASPPPAVPASPVALIPPAAPSLPAAPPSPVAPPPAA 450

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPPP 300
           PP+P     P+    P  A   PA +P +  P   PS  D PPP
Sbjct: 451 PPSPVALIPPAALSLP--AAPLPAASPSAAPPIAAPSPVDPPPP 492

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 47/108 (43%), Positives = 54/108 (50%), Gaps = 11/108 (10%)
 Frame = +1

Query: 13  PPTATPAPKAQPPA---AATPPTATPPTATPPAAATPPTATPPTATPPAP------ASSP 165
           PP A P   + PPA   A TPPTA P  A PP AA PPTA+PP A  P+P      A+ P
Sbjct: 592 PPPAAPMLASPPPASPVALTPPTAPPSPAAPPPAA-PPTASPPPAATPSPVPLIPLATLP 650

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPPPP 303
             +PP   PAS P  AP    A  PPA  P +  P   P+      PP
Sbjct: 651 PATPPPAEPASAPPAAPASPVALIPPATPPPASPPLAAPASPVALAPP 698

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 45/112 (40%), Positives = 52/112 (46%), Gaps = 15/112 (13%)
 Frame = +1

Query: 13  PPTATPAPKA-------QPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT 171
           PP ATP+P A        PP A + P A PPT  P     P T   P   PPA   SPA 
Sbjct: 111 PPAATPSPVALIPLVVPPPPVAPSSPVAPPPTEPPLPVLPPETPPSPAVLPPAAPISPAA 170

Query: 172 SPPA-------PTPASTPSTAPTPSTAGSPPAP-TPDSLGPGPSGADTPPPP 303
           SPPA        +PA+ P  AP  S A  P AP +P +  P   G+   PPP
Sbjct: 171 SPPAAPPPAAPASPAAPPPAAPASSAAPPPAAPASPAAPPPAAPGSPAAPPP 222

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 44/105 (41%), Positives = 51/105 (48%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPT--ATPPAA---ATPPTATPPTATPPAPASSP 165
           AP  P    P P A P     PP ATPP+  A PPAA   A+PP A+P   TPP    SP
Sbjct: 562 APASP--VAPIPPAAPSLLVVPPPATPPSLVAPPPAAPMLASPPPASPVALTPPTAPPSP 619

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           A  PPA  P ++P  A TPS     P  T     P P+   + PP
Sbjct: 620 AAPPPAAPPTASPPPAATPSPVPLIPLATLPPATPPPAEPASAPP 664

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 46/104 (44%), Positives = 56/104 (53%), Gaps = 8/104 (7%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAA---ATPPTA-----TPPTATPPAAATPPTATPPTATPPAPASSPA 168
           PP   P+  A PPAA   A+PP A     TPPTA PP+ A PP A PPTA+PP PA++P+
Sbjct: 582 PPATPPSLVAPPPAAPMLASPPPASPVALTPPTA-PPSPAAPPPAAPPTASPP-PAATPS 639

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             P  P     P+T P    A +PPA     +   P    TPPP
Sbjct: 640 PVPLIPLATLPPATPPPAEPASAPPAAPASPVALIPPA--TPPP 681

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 53/128 (41%), Positives = 62/128 (48%), Gaps = 29/128 (22%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQP------PAA----ATPPTATPPTATPPAAATP----PTATPPTAT 141
           P  PPTA+P P A P      P A    ATPP A P +A P A A+P    P ATPP A+
Sbjct: 624 PAAPPTASPPPAATPSPVPLIPLATLPPATPPPAEPASAPPAAPASPVALIPPATPPPAS 683

Query: 142 PP--APASSPATSPPA-------------PTPASTPSTAPTPSTAGSPPAPTPDSLGPGP 276
           PP  APAS  A +PPA             P PA+ P  AP    A  PPA  P ++ P  
Sbjct: 684 PPLAAPASPVALAPPAAPASPAAPISPLTPLPAAPPLAAPPSPVAFIPPAALPPAILPPA 743

Query: 277 SGADTPPP 300
           +    PPP
Sbjct: 744 A----PPP 747

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 43/101 (42%), Positives = 51/101 (50%), Gaps = 3/101 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP- 180
           P  P      P A PP+   PP A P  A+PP A+ P   TPPTA PP+PA+ P  +PP 
Sbjct: 572 PAAPSLLVVPPPATPPSLVAPPPAAPMLASPPPAS-PVALTPPTA-PPSPAAPPPAAPPT 629

Query: 181 -APTPASTPSTAPTPSTAGSPPA-PTPDSLGPGPSGADTPP 297
            +P PA+TPS  P    A  PPA P P      P  A   P
Sbjct: 630 ASPPPAATPSPVPLIPLATLPPATPPPAEPASAPPAAPASP 670

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 49/127 (38%), Positives = 60/127 (47%), Gaps = 26/127 (20%)
 Frame = +1

Query: 1   APTKPPTATPA-PKAQPPAAATPPTATPPTATPPA-------AATPPTATPPTATPPAPA 156
           +P  PP A PA P A PPAA   P   PP A PP+       AA  P A  P + PPA  
Sbjct: 243 SPAAPPPAAPASPAAPPPAAPASPAVLPPPAAPPSPVALISPAAPSPAAPLPASPPPAAL 302

Query: 157 SSP-ATSPPA------PTPASTPSTAPT----------PSTAGSPPAP-TPDSLGPGPSG 282
           +SP A  PPA      P+PAS P+ AP           PS   +PP+P  P  + P P+ 
Sbjct: 303 ASPVAPIPPAAPPLAVPSPASPPAAAPASPVALIPPAAPSLPAAPPSPVAPPPVAPPPAA 362

Query: 283 ADTPPPP 303
           +    PP
Sbjct: 363 SIPASPP 369

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 40/100 (40%), Positives = 49/100 (49%), Gaps = 4/100 (4%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPP----APASSPATSPP 180
           PP A P+P A    AA  P A  P + PPAA   P A  P A PP    +PAS PA +P 
Sbjct: 271 PPAAPPSPVALISPAAPSPAAPLPASPPPAALASPVAPIPPAAPPLAVPSPASPPAAAPA 330

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           +P     P+    P+   SP AP P +  P  S   +PPP
Sbjct: 331 SPVALIPPAAPSLPAAPPSPVAPPPVAPPPAASIPASPPP 370

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 56/126 (44%), Positives = 60/126 (47%), Gaps = 25/126 (19%)
 Frame = +1

Query: 1   APTKPPTATPA------PKAQP--PAAATPPTATPPTATPPAAATPPTATPPTATP---- 144
           +P  PP A PA      P A P  PAA   P A PP A PPAA+ P  A+PP A P    
Sbjct: 320 SPASPPAAAPASPVALIPPAAPSLPAAPPSPVAPPPVAPPPAASIP--ASPPPAAPASPV 377

Query: 145 ----PAPASSPAT--SPPAPTPASTPSTA--PTPSTAGSPPAPTPDS---LGP--GPSGA 285
               PA  S PAT  SP AP P + P TA  P  ST  SPP   P S   L P   PS  
Sbjct: 378 ALISPAAPSLPATPFSPVAPPPVAPPPTATPPAASTPASPPPAVPASPVALIPPAAPSLP 437

Query: 286 DTPPPP 303
             PP P
Sbjct: 438 AAPPSP 443

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 46/104 (44%), Positives = 52/104 (50%), Gaps = 7/104 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-------PTATPPTATPPAPASS 162
           P  PP A   P + PPAA   P A    A P   ATP       P A PPTATPPA AS+
Sbjct: 355 PVAPPPAASIPASPPPAAPASPVALISPAAPSLPATPFSPVAPPPVAPPPTATPPA-AST 413

Query: 163 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
           PA+ PPA  PAS    A  P  A S PA  P  + P P+   +P
Sbjct: 414 PASPPPA-VPAS--PVALIPPAAPSLPAAPPSPVAPPPAAPPSP 454

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 48/115 (41%), Positives = 52/115 (45%), Gaps = 16/115 (13%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPT--ATPPTATPPAPASSPATSP 177
           P  PP A P P   PP AA  P +TPP   P  A+ PP   A+P    PPA  S PA  P
Sbjct: 491 PPSPPLAAP-PLTSPPPAAPIPLSTPPPVVPTPASPPPAVPASPVALNPPAAPSLPAVPP 549

Query: 178 PAP-TPASTPSTAP----------TPSTAGSPPAPTPDSLGPGPSGAD---TPPP 300
           PA   PAS P  AP           PS    PP  TP SL   P  A    +PPP
Sbjct: 550 PAALRPASLPPAAPASPVAPIPPAAPSLLVVPPPATPPSLVAPPPAAPMLASPPP 604

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 45/132 (34%), Positives = 55/132 (41%), Gaps = 31/132 (23%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTA------TPPTATPPAPASS 162
           +P  P T        PP+AA    ATPP A PPAA   P A       PP   P +P + 
Sbjct: 80  SPAAPFTLATLAVPSPPSAAPSLAATPPAAPPPAATPSPVALIPLVVPPPPVAPSSPVAP 139

Query: 163 PATSPPAP-------------------TPASTPSTAPTPSTAGSPPAPTP----DSLGPG 273
           P T PP P                   +PA++P  AP P+   SP AP P     S  P 
Sbjct: 140 PPTEPPLPVLPPETPPSPAVLPPAAPISPAASPPAAPPPAAPASPAAPPPAAPASSAAPP 199

Query: 274 PSGADTP--PPP 303
           P+   +P  PPP
Sbjct: 200 PAAPASPAAPPP 211

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 47/120 (39%), Positives = 56/120 (46%), Gaps = 21/120 (17%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAA---ATPPTATPPTATP--PAAATPPTATPPTATP-----PAP 153
            P +P +A PA  A P A    ATPP A+PP A P  P A  PP A    A P     P P
Sbjct: 656  PAEPASAPPAAPASPVALIPPATPPPASPPLAAPASPVALAPPAAPASPAAPISPLTPLP 715

Query: 154  ASSPATSPPAPT---------PASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPPP 300
            A+ P  +PP+P          PA  P  AP P+T  S  AP+  +  P   P  A  PPP
Sbjct: 716  AAPPLAAPPSPVAFIPPAALPPAILPPAAPPPATLPSSVAPSLAAASPLAAPPPAAPPPP 775

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 45/120 (37%), Positives = 51/120 (42%), Gaps = 24/120 (20%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTAT-------------PPAP 153
           PP + P   A P   AT    +PP+A P  AATPP A PP AT             PP  
Sbjct: 73  PPASLPDSPAAPFTLATLAVPSPPSAAPSLAATPPAAPPPAATPSPVALIPLVVPPPPVA 132

Query: 154 ASSPATSPPA--PTPASTPSTAPTP---------STAGSPPAPTPDSLGPGPSGADTPPP 300
            SSP   PP   P P   P T P+P         S A SPPA  P +    P+    PPP
Sbjct: 133 PSSPVAPPPTEPPLPVLPPETPPSPAVLPPAAPISPAASPPAAPPPA---APASPAAPPP 189

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 46/117 (39%), Positives = 54/117 (46%), Gaps = 17/117 (14%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAA----------ATPPTATPPTATPPAAA-TPPTATPPTATPP 147
           +P  P  A P P + PPAA          A PP A P  A+PPAAA   P A  P A P 
Sbjct: 283 SPAAPSPAAPLPASPPPAALASPVAPIPPAAPPLAVPSPASPPAAAPASPVALIPPAAPS 342

Query: 148 APASSP---ATSPPAPTPASTPSTAPTPSTAGSPPA---PTPDSLGPGPSGADTPPP 300
            PA+ P   A  P AP PA++   +P P+   SP A   P   SL   P     PPP
Sbjct: 343 LPAAPPSPVAPPPVAPPPAASIPASPPPAAPASPVALISPAAPSLPATPFSPVAPPP 399

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 48/126 (38%), Positives = 57/126 (45%), Gaps = 29/126 (23%)
 Frame = +1

Query: 13  PPTATPAPKAQ-PPAA---------ATPPTATPPTATP----PAAATPPTATPPTATPPA 150
           PP A P+P A  PPAA         A  P+A PP A P    P   +PP A PP  +PP 
Sbjct: 447 PPAAPPSPVALIPPAALSLPAAPLPAASPSAAPPIAAPSPVDPPPPSPPLAAPPLTSPPP 506

Query: 151 PASSPATSPP--APTPASTPSTAPTPSTAGSPPA-------PTPDSLGP------GPSGA 285
            A  P ++PP   PTPAS P   P    A +PPA       P P +L P       P+  
Sbjct: 507 AAPIPLSTPPPVVPTPASPPPAVPASPVALNPPAAPSLPAVPPPAALRPASLPPAAPASP 566

Query: 286 DTPPPP 303
             P PP
Sbjct: 567 VAPIPP 572

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 47/117 (40%), Positives = 54/117 (46%), Gaps = 17/117 (14%)
 Frame = +1

Query: 4   PTKPPTATPAPK------AQPPAAATP--PTATPPTATPPAAATPPTATPPTATPPA-PA 156
           P  PP A PA        A P   ATP  P A PP A PP  ATPP A+ P + PPA PA
Sbjct: 365 PASPPPAAPASPVALISPAAPSLPATPFSPVAPPPVA-PPPTATPPAASTPASPPPAVPA 423

Query: 157 SSPATSPPA--------PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           S  A  PPA        P+P + P  AP    A  PPA       P P+ + +  PP
Sbjct: 424 SPVALIPPAAPSLPAAPPSPVAPPPAAPPSPVALIPPAALSLPAAPLPAASPSAAPP 480

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 46/114 (40%), Positives = 53/114 (46%), Gaps = 14/114 (12%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQ--PPAAATPPTATP-PTATPPAAATPPTATPPTA-----TPPAPAS 159
           P  PP A PA      PPAA + P A P P A PPAA   P A  P A       P PA+
Sbjct: 414 PASPPPAVPASPVALIPPAAPSLPAAPPSPVAPPPAAPPSPVALIPPAALSLPAAPLPAA 473

Query: 160 SPATSPP--APTPASTPSTAP----TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           SP+ +PP  AP+P   P  +P     P T+  P AP P S  P        PPP
Sbjct: 474 SPSAAPPIAAPSPVDPPPPSPPLAAPPLTSPPPAAPIPLSTPPPVVPTPASPPP 527

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 48/124 (38%), Positives = 54/124 (43%), Gaps = 24/124 (19%)
 Frame = +1

Query: 1   APTKPPTATPA-PKAQPPAAATPPTATPPTA-------TPPA-----------AATPPTA 123
           +P  PP A PA P A PPAA   P A PP A        PPA           AA  P A
Sbjct: 232 SPAAPPPAAPASPAAPPPAAPASPAAPPPAAPASPAVLPPPAAPPSPVALISPAAPSPAA 291

Query: 124 TPPTATPPAPASSP-ATSPPAPTPASTPSTAPTPSTAGSPPA----PTPDSLGPGPSGAD 288
             P + PPA  +SP A  PPA  P + PS A  P+ A + P     P   SL   P    
Sbjct: 292 PLPASPPPAALASPVAPIPPAAPPLAVPSPASPPAAAPASPVALIPPAAPSLPAAPPSPV 351

Query: 289 TPPP 300
            PPP
Sbjct: 352 APPP 355

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 42/108 (38%), Positives = 52/108 (48%), Gaps = 12/108 (11%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAA---ATPPTATPPTATPPAAATPPTATPPTATPP--APASSPATSP 177
           PP A P+P   PP +   A PP  +PP A P   +TPP   P  A+PP   PAS  A +P
Sbjct: 479 PPIAAPSPVDPPPPSPPLAAPPLTSPPPAAPIPLSTPPPVVPTPASPPPAVPASPVALNP 538

Query: 178 PA-------PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           PA       P PA+    +  P+   SP AP P +    PS    PPP
Sbjct: 539 PAAPSLPAVPPPAALRPASLPPAAPASPVAPIPPA---APSLLVVPPP 583

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 9/108 (8%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQP--PAAATPPTATPPTATPPAAATPPTATPPTATPPAP-------A 156
           P  PP A+P P A P  P A  PP A    A P +  TP  A PP A PP+P       A
Sbjct: 676 PATPPPASP-PLAAPASPVALAPPAAPASPAAPISPLTPLPAAPPLAAPPSPVAFIPPAA 734

Query: 157 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             PA  PPA  P +T  ++  PS A + P   P    P P  A  PPP
Sbjct: 735 LPPAILPPAAPPPATLPSSVAPSLAAASPLAAPPPAAPPPPAA--PPP 780

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 43/110 (39%), Positives = 48/110 (43%), Gaps = 14/110 (12%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTAT--PPTATPPAPASSPATSPPA- 183
           PP   P P + PPA    P A  P A P   A PP A   P +  P APAS  A  PPA 
Sbjct: 515 PPPVVPTPASPPPAVPASPVALNPPAAPSLPAVPPPAALRPASLPPAAPASPVAPIPPAA 574

Query: 184 ------PTPASTPSTAPTPSTA---GSPPAPTPDSLGP--GPSGADTPPP 300
                 P PA+ PS    P  A    SPP  +P +L P   P     PPP
Sbjct: 575 PSLLVVPPPATPPSLVAPPPAAPMLASPPPASPVALTPPTAPPSPAAPPP 624

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 41/105 (39%), Positives = 50/105 (47%), Gaps = 6/105 (5%)
 Frame = +1

Query: 7   TKP-PTATPAPKAQPPAAATPPTATPPT-ATPPAAATPPTATPPTATPPAPASSPATSPP 180
           T+P P   P P  +PP   TPP + P + A P   AT    +PP+A P   A+ PA  PP
Sbjct: 53  TEPSPPFKPPPPVEPPPTVTPPASLPDSPAAPFTLATLAVPSPPSAAPSLAATPPAAPPP 112

Query: 181 APTP---ASTPSTAPTPSTAGSPPAPTPDSLGPGP-SGADTPPPP 303
           A TP   A  P   P P  A S P   P +  P P    +TPP P
Sbjct: 113 AATPSPVALIPLVVPPPPVAPSSPVAPPPTEPPLPVLPPETPPSP 157

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 38/109 (34%), Positives = 49/109 (44%), Gaps = 10/109 (9%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS------PA 168
           T P +    P   P    +    +PP   PP    PPT TPP + P +PA+         
Sbjct: 33  TLPVSVAEHPLDVPFEEHSLTEPSPPFKPPPPVEPPPTVTPPASLPDSPAAPFTLATLAV 92

Query: 169 TSPP--APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP--PPP 303
            SPP  AP+ A+TP  AP P+   SP A  P  + P P    +P  PPP
Sbjct: 93  PSPPSAAPSLAATPPAAPPPAATPSPVALIPLVVPPPPVAPSSPVAPPP 141

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 34/78 (43%), Positives = 38/78 (48%), Gaps = 4/78 (5%)
 Frame = +1

Query: 1   APTKPPTATPA--PKAQPPA--AATPPTATPPTATPPAAATPPTATPPTATPPAPASSPA 168
           AP  P T  PA  P A PP+  A  PP A PP   PPAA  PP   P +  P   A+SP 
Sbjct: 706 APISPLTPLPAAPPLAAPPSPVAFIPPAALPPAILPPAAP-PPATLPSSVAPSLAAASPL 764

Query: 169 TSPPAPTPASTPSTAPTP 222
            +PP   P   P  AP P
Sbjct: 765 AAPPPAAP--PPPAAPPP 780

[65][TOP]
>UniRef100_Q7TLR4 Putative uncharacterized protein n=1 Tax=Choristoneura fumiferana
           MNPV RepID=Q7TLR4_NPVCF
          Length = 251

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 48/107 (44%), Positives = 60/107 (56%), Gaps = 7/107 (6%)
 Frame = +1

Query: 1   APTKPPTA--TPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASSPAT 171
           +PT PPT   TP P   P    TP    PPT +P    TP    PPT +P P P  SP  
Sbjct: 52  SPTPPPTPSPTPPPTPSPTPPPTPSPTPPPTPSPTLPPTPSPTLPPTPSPTPPPTPSPTP 111

Query: 172 SP-PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPP 300
           SP P+PTP+ TPS  P+P+ + +P   P+PTP S  P P+ + TPPP
Sbjct: 112 SPTPSPTPSPTPSPTPSPTPSPTPSATPSPTP-SATPLPTSSPTPPP 157

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/103 (42%), Positives = 53/103 (51%), Gaps = 4/103 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           PT PPT  P P   PP   TP    PPT +P    TP    PPT +P  P +   T PP 
Sbjct: 41  PTPPPTPPPTPSPTPPP--TPSPTPPPTPSPTPPPTPSPTPPPTPSPTLPPTPSPTLPPT 98

Query: 184 PTPASTPSTAPTPSTAGSP-PAPTPD---SLGPGPSGADTPPP 300
           P+P   P+ +PTPS   SP P+PTP    S  P P+ + TP P
Sbjct: 99  PSPTPPPTPSPTPSPTPSPTPSPTPSPTPSPTPSPTPSATPSP 141

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 41/99 (41%), Positives = 50/99 (50%), Gaps = 3/99 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAA--ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAP 186
           PPT  P P   PP     TP    PPT +P    TP    PPT +P  P +   T PP P
Sbjct: 32  PPTPWPTPPPTPPPTPPPTPSPTPPPTPSPTPPPTPSPTPPPTPSPTPPPTPSPTLPPTP 91

Query: 187 TPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPP 300
           +P   P+ +PTP    SP P+PTP S  P P+ + TP P
Sbjct: 92  SPTLPPTPSPTPPPTPSPTPSPTP-SPTPSPTPSPTPSP 129

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 38/90 (42%), Positives = 52/90 (57%), Gaps = 10/90 (11%)
 Frame = +1

Query: 1   APTKPPTA------TPAPKAQPPAAATPPTATPPTATPPAAATP-PTATP-PTATP-PAP 153
           +PT PPT       TP+P   P  + TPP    PT +P  + TP PT +P P+ TP P P
Sbjct: 76  SPTPPPTPSPTLPPTPSPTLPPTPSPTPPPTPSPTPSPTPSPTPSPTPSPTPSPTPSPTP 135

Query: 154 ASSPATSPPA-PTPASTPSTAPTPSTAGSP 240
           +++P+ +P A P P S+P+  PTPS  G P
Sbjct: 136 SATPSPTPSATPLPTSSPTPPPTPSPLGEP 165

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 35/90 (38%), Positives = 44/90 (48%), Gaps = 2/90 (2%)
 Frame = +1

Query: 37  KAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP-PAPTPASTPSTA 213
           K  PP     P  TPP   PP  +  P  TP    PP P+ +P  +P P P P  +P+  
Sbjct: 29  KELPPTPWPTPPPTPPPTPPPTPSPTPPPTPSPTPPPTPSPTPPPTPSPTPPPTPSPTLP 88

Query: 214 PTPSTAGSP-PAPTPDSLGPGPSGADTPPP 300
           PTPS    P P+PTP    P P+ + TP P
Sbjct: 89  PTPSPTLPPTPSPTPPPT-PSPTPSPTPSP 117

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 25/60 (41%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = +1

Query: 127 PPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPPP 303
           PPT  P  P + P T PP P+P   P+ +PTP    SP P PTP    P       PP P
Sbjct: 32  PPTPWPTPPPTPPPTPPPTPSPTPPPTPSPTPPPTPSPTPPPTPSPTPPPTPSPTLPPTP 91

[66][TOP]
>UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2U1_EHV86
          Length = 2873

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 40/102 (39%), Positives = 56/102 (54%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P+ PP+  P+P    P   +PP  +PP  +PP +  PP+  PP+  PP+P   P+  PP+
Sbjct: 2683 PSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSP-PPPSPPPPS 2741

Query: 184  PTPASTPSTAPTPSTAGS--PPAPTPDSLGPGPSGADTPPPP 303
            P P S P  +P P +     PPAP+P    P PS   +PPPP
Sbjct: 2742 PPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPP 2783

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 39/102 (38%), Positives = 50/102 (49%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA--SSPATSP 177
            P  PP + P P   P    +PP  +PP  +PP  + PP + PP+  PP+P   S P  SP
Sbjct: 2673 PPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSP 2732

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P+P       P+P     PP   P  L P PS   +PPPP
Sbjct: 2733 PPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPP 2774

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 39/95 (41%), Positives = 50/95 (52%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP  +P P + PP+   PP + PP + PP +  PP+  PP+  PP+P   P  SPP 
Sbjct: 2700 PPSPPPPSPPPPSPPPSP--PPPSPPPPSPPPPSPPPPSPPPPSPPPPSP---PPPSPPP 2754

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
            P+P   P   P PS   SPP P+P    P PS  D
Sbjct: 2755 PSP--PPPLPPAPSPPPSPPPPSPPPSPPPPSPPD 2787

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 38/98 (38%), Positives = 50/98 (51%)
 Frame = +1

Query: 10   KPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPT 189
            KPP+  P P   P    +PP  +PP + PP+   PP  +PP  +PP P+  P + PP+P 
Sbjct: 2666 KPPSPPPPPSPPP----SPPPPSPPPSPPPS---PPPPSPPPPSPPPPSPPPPSPPPSPP 2718

Query: 190  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P S P  +P P    SPP P+P    P P     P PP
Sbjct: 2719 PPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPP 2753

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 33/85 (38%), Positives = 45/85 (52%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  P    P+P   PP  + PP + PP + PP +  PP+  PP+  PP+P   P+  PP
Sbjct: 2702 SPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPP 2760

Query: 181  APTPASTPSTAPTPSTAGSPPAPTP 255
             P   S P + P PS   SPP P+P
Sbjct: 2761 LPPAPSPPPSPPPPSPPPSPPPPSP 2785

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 38/96 (39%), Positives = 50/96 (52%), Gaps = 3/96 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPP--APASSPATSP 177
            P+ PP + P P   PP+   PP  +PP  +PP  + PP + PP + PP   PA SP  SP
Sbjct: 2715 PSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSP 2771

Query: 178  PAPT-PASTPSTAPTPSTAGSPPAPTPDSLGPGPSG 282
            P P+ P S P  +P   T+ S    T  S+  G SG
Sbjct: 2772 PPPSPPPSPPPPSPPDRTSTSGTKATIGSIAGGMSG 2807

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 31/87 (35%), Positives = 42/87 (48%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP   P P   PP    PP+  PP+  PP   +PP  +PP   PP+P   P    P 
Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPT 262

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSL 264
           PT  S  S A  P T G+   P+ +++
Sbjct: 263 PTGRSCFSYAIGPYTRGNSGTPSGENI 289

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 31/78 (39%), Positives = 38/78 (48%)
 Frame = +1

Query: 70   TATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAP 249
            T   P + PP  + PP+  PP+  P  P S P  SPP P+P   P + P PS   SPP P
Sbjct: 2663 TCIKPPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSP--PPPSPPPPSPPPSPPPP 2720

Query: 250  TPDSLGPGPSGADTPPPP 303
            +P    P P     P PP
Sbjct: 2721 SPPPPSPPPPSPPPPSPP 2738

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 28/70 (40%), Positives = 37/70 (52%)
 Frame = +1

Query: 46   PPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPS 225
            PP +  PP+  PP+  PP+   PP + PP   PP+P   P T PP+P P S P  +P P 
Sbjct: 2253 PPPSPPPPSPHPPSPPPPSP--PPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPP 2310

Query: 226  TAGSPPAPTP 255
            +   P  P P
Sbjct: 2311 SPPPPSQPPP 2320

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 28/67 (41%), Positives = 36/67 (53%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP  +P P + PP +  PP+  PP  TPP +  PP  TPP + PP     P+  PP+
Sbjct: 2254 PPSPPPPSPHPPSPPPPSPPPPS--PPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPS 2311

Query: 184  PTPASTP 204
            P P S P
Sbjct: 2312 PPPPSQP 2318

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 32/80 (40%), Positives = 41/80 (51%)
 Frame = +1

Query: 61   TPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSP 240
            +PP + PP +  P +  PP+  PP+  PP P  SP   PP P P+  P + P P    SP
Sbjct: 2252 SPPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPP----SP 2307

Query: 241  PAPTPDSLGPGPSGADTPPP 300
            P P+P    P PS    PPP
Sbjct: 2308 PPPSP----PPPS---QPPP 2320

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 27/70 (38%), Positives = 35/70 (50%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
            PP + P P   PP+   PP  +PP  +PP    PP+  PP  TPP     P+  PP+P P
Sbjct: 2253 PPPSPPPPSPHPPS---PPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPP 2309

Query: 193  ASTPSTAPTP 222
             S P  +  P
Sbjct: 2310 PSPPPPSQPP 2319

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 26/70 (37%), Positives = 36/70 (51%)
 Frame = +1

Query: 31   APKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPST 210
            +P   PP  +  P + PP + PP +  PPT  PP+  PP P   P+  PP+P P S P  
Sbjct: 2252 SPPPSPPPPSPHPPSPPPPSPPPPSPPPPT-PPPSPPPPPPTPPPSPPPPSPPPPSPPPP 2310

Query: 211  APTPSTAGSP 240
            +P P +   P
Sbjct: 2311 SPPPPSQPPP 2320

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 33/72 (45%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = +1

Query: 91   TPPAAATPPTATPPTATPPAPASSPATSPPAPTPA-STPSTAPTPSTAGSPPAPTPDSLG 267
            +PP +  PP+  PP+  PP+P   P  SPP PTP  S P   PTP  +  PP+P P S  
Sbjct: 2252 SPPPSPPPPSPHPPSPPPPSP---PPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPS-P 2307

Query: 268  PGPSGADTPPPP 303
            P PS    PPPP
Sbjct: 2308 PPPS----PPPP 2315

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 26/68 (38%), Positives = 37/68 (54%)
 Frame = +1

Query: 40   AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPT 219
            + P +  +PP  +PP + PP+   PP   PP  +PP P+  P + PP+P P S P + P 
Sbjct: 2524 SDPCSPPSPPPPSPPPSPPPS---PPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPP 2580

Query: 220  PSTAGSPP 243
            PS    PP
Sbjct: 2581 PSPPPYPP 2588

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 27/67 (40%), Positives = 35/67 (52%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP+  P P + PP+   PP + PP   PP +  PP+  PP+  P  P  SP  SPP 
Sbjct: 2526 PCSPPS--PPPPSPPPS---PPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPP 2580

Query: 184  PTPASTP 204
            P+P   P
Sbjct: 2581 PSPPPYP 2587

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 26/67 (38%), Positives = 31/67 (46%)
 Frame = +1

Query: 67  PTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPA 246
           P+  PP   PP    PP   PP+  PP+P   P  SPP P+P   P  +P P     PP 
Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPP----PPP 258

Query: 247 PTPDSLG 267
           P P   G
Sbjct: 259 PLPTPTG 265

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 27/65 (41%), Positives = 36/65 (55%)
 Frame = +1

Query: 76   TPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTP 255
            +PP+  PP+   PP + PP+  PP P   P+  PP+P P S P + P PS   SPP P+P
Sbjct: 2528 SPPSPPPPS---PPPSPPPSPPPPLPPP-PSPPPPSPPPPSPPPSPPPPSPPPSPPPPSP 2583

Query: 256  DSLGP 270
                P
Sbjct: 2584 PPYPP 2588

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 30/79 (37%), Positives = 40/79 (50%)
 Frame = +1

Query: 61   TPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSP 240
            TP   T  ++ P +  +PP  +PP + PP+P   P   PP+P P S P  +P P    SP
Sbjct: 2515 TPYEHTMISSDPCSPPSPPPPSPPPSPPPSPPP-PLPPPPSPPPPSPPPPSPPP----SP 2569

Query: 241  PAPTPDSLGPGPSGADTPP 297
            P P+P    P PS    PP
Sbjct: 2570 PPPSPPPSPPPPSPPPYPP 2588

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 25/64 (39%), Positives = 34/64 (53%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  PP  +P P   P    +PP   PP  +PP  + PP + PP+  PP+P  SP   PP
Sbjct: 2528 SPPSPPPPSPPPSPPP----SPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSP--PPP 2581

Query: 181  APTP 192
            +P P
Sbjct: 2582 SPPP 2585

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 27/60 (45%), Positives = 33/60 (55%)
 Frame = +1

Query: 124  TPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +PP+  PP+P  SP  SPP P P   P + P P    SPP P+P    P PS   +PPPP
Sbjct: 2528 SPPSPPPPSPPPSPPPSPPPPLP--PPPSPPPP----SPPPPSPPPSPPPPSPPPSPPPP 2581

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 26/65 (40%), Positives = 31/65 (47%)
 Frame = +1

Query: 109 TPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
           +PP   PP   PP P   P  SPP P+P   P  +P P +   PP P+P    P P    
Sbjct: 204 SPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSP----PPP---- 255

Query: 289 TPPPP 303
            PPPP
Sbjct: 256 -PPPP 259

[67][TOP]
>UniRef100_Q58NA5 Plus agglutinin (Fragment) n=1 Tax=Chlamydomonas incerta
            RepID=Q58NA5_CHLIN
          Length = 2371

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 41/100 (41%), Positives = 53/100 (53%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +PAP +  P +  PPT  PP+  PP +  PP+ TPP   PP+PA  PA  PP+
Sbjct: 1176 PPSPAPPSPAPPSPVPPSPIPPTPAPPSPEPP-SPVPPSPTPPAPQPPSPA-PPAPQPPS 1233

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S    +P P+T  SP  P+P    P P    +P PP
Sbjct: 1234 PAPPSPNPPSPAPTTPASPEPPSPQPPSPSPPVPPSPAPP 1273

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 45/112 (40%), Positives = 60/112 (53%), Gaps = 11/112 (9%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPA-------AATPPTATPPTATPPAPA- 156
            AP  P   +PAP +  P +  PP+  PP+  PP+       +  PP+  PP+  PP+PA 
Sbjct: 1419 APPSPQPPSPAPPSPRPPSPAPPSPAPPSPVPPSPQPPAPPSPAPPSPAPPSPAPPSPAP 1478

Query: 157  ---SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
               +SP+  PP PTP   PS AP P+T+  PP+PTP    P  S A  P PP
Sbjct: 1479 PSPASPSPVPPLPTP---PSPAPAPTTSPLPPSPTPALPAPPASPAPPPNPP 1527

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 41/101 (40%), Positives = 57/101 (56%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           AP  PP  +PAP +  P +  PP+  PP+  PP + TPP+  PP+  PP+P   P+  PP
Sbjct: 686 APPSPPPPSPAPPSPRPPSPEPPSPKPPSPEPP-SPTPPSPQPPSPAPPSP-PPPSPEPP 743

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P S P  +P P +  +PP+P P S  P      +PPPP
Sbjct: 744 SPAPPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPPP 783

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 45/109 (41%), Positives = 59/109 (54%), Gaps = 8/109 (7%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS-- 174
            +P  P    PAP +  P +  PP+  PP+  PP+ A+ P+  PP  TPP+PA +P TS  
Sbjct: 1447 SPVPPSPQPPAPPSPAPPSPAPPSPAPPSPAPPSPAS-PSPVPPLPTPPSPAPAPTTSPL 1505

Query: 175  PPAPTPA-----STPSTAPTPSTAGSPP-APTPDSLGPGPSGADTPPPP 303
            PP+PTPA     ++P+  P P     PP AP P    P PS A   PPP
Sbjct: 1506 PPSPTPALPAPPASPAPPPNPPRPPQPPAAPPPSPAAPPPSPAPLAPPP 1554

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 41/102 (40%), Positives = 55/102 (53%), Gaps = 1/102 (0%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  P   +PAP +  P +  PP+  PP+  PP+ A PP+  PP+  PPAP S    SP 
Sbjct: 1409 APPSPAPPSPAPPSPQPPSPAPPSPRPPSPAPPSPA-PPSPVPPSPQPPAPPSPAPPSPA 1467

Query: 181  APTPASTPSTAPTPSTAGS-PPAPTPDSLGPGPSGADTPPPP 303
             P+PA      P+P++    PP PTP S  P P+ +  PP P
Sbjct: 1468 PPSPAPPSPAPPSPASPSPVPPLPTPPSPAPAPTTSPLPPSP 1509

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 41/108 (37%), Positives = 58/108 (53%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPASS--- 162
            P  P   +PAP + PP +  PP+  PP+  PP+    +  PP+  PP+  PP+PA     
Sbjct: 797  PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 856

Query: 163  -PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S PS +P P +  +PP+P P S  P      +PPPP
Sbjct: 857  PPSPEPPSPAPPSPPSPSPEPPSP-APPSPPPPSPAPPSPAPPSPPPP 903

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 41/108 (37%), Positives = 58/108 (53%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPAS---- 159
            P  P   +PAP + PP +  PP+  PP+  PP+    +  PP+  PP+  PP+PA     
Sbjct: 812  PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 871

Query: 160  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            SP+  PP+P P S P  +P P +  +PP+P P S  P      +PPPP
Sbjct: 872  SPSPEPPSPAPPSPPPPSPAPPSP-APPSPPPPSPEPPSPAPPSPPPP 918

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 41/108 (37%), Positives = 58/108 (53%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPA----S 159
            P  P   +PAP + PP +  PP+  PP+  PP+    +  PP+ TPP+  PP+PA     
Sbjct: 962  PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPTPPSPEPPSPAPPSPP 1021

Query: 160  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S P  +P P +  +PP+P P S  P      +PPPP
Sbjct: 1022 PPSPEPPSPAPPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPPP 1068

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 41/108 (37%), Positives = 58/108 (53%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPA----S 159
            P  P   +PAP + PP +  PP+  PP+ TPP+    +  PP+  PP+  PP+PA     
Sbjct: 977  PPSPEPPSPAPPSPPPPSPEPPSPAPPSPTPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 1036

Query: 160  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S P  +P P +  +PP+P P S  P      +PPPP
Sbjct: 1037 PPSPEPPSPAPPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPPP 1083

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 46/107 (42%), Positives = 60/107 (56%), Gaps = 6/107 (5%)
 Frame = +1

Query: 1   APTKPPTATPAP---KAQPPAAATPPTATPPTATPPAA-ATPPTATPPTATPPAPASSPA 168
           AP  PPTA P+P     +PP+  +PP+  PP+  PP+  A PP+  PP+  PP PA  P+
Sbjct: 594 APPDPPTAPPSPDPPSPEPPSQPSPPSPDPPSPDPPSPPALPPSPKPPSPKPPTPAP-PS 652

Query: 169 TSPPAPTPAST--PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PP+P P S   PS AP P    +PP+PTP S  P      +P PP
Sbjct: 653 PLPPSPLPPSPAPPSPAP-PQPPPAPPSPTPPSPAPPSPPPPSPAPP 698

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 41/110 (37%), Positives = 59/110 (53%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPASS--- 162
            P  P   +PAP + PP +  PP+  PP+  PP+    +  PP+  PP+  PP+PA     
Sbjct: 782  PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 841

Query: 163  -PATSPPAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S P  +P P +    SPP+P+P+   P P    +PPPP
Sbjct: 842  PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPSPSPEPPSPAP---PSPPPP 888

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 41/114 (35%), Positives = 59/114 (51%), Gaps = 13/114 (11%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPA---------AATPPTATPPTATPPAP 153
            AP  PP+ +P P +  P +  PP+  PP+  PP+         +  PP+  PP+  PP+P
Sbjct: 866  APPSPPSPSPEPPSPAPPSPPPPSPAPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSP 925

Query: 154  AS----SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            AS     P+  PP+P P S P  +P P +  +PP+P P S  P      +PPPP
Sbjct: 926  ASPSPPPPSPEPPSPAPPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPPP 978

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 40/108 (37%), Positives = 58/108 (53%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPA----S 159
            P  P   +PAP + PP +  PP+  PP+  PP+    +  PP+  PP+  PP+PA    +
Sbjct: 947  PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPT 1006

Query: 160  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S P  +P P +  +PP+P P S  P      +PPPP
Sbjct: 1007 PPSPEPPSPAPPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPPP 1053

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS----PA 168
            AP  P   +P P +  P +  PP+ TPP+  PP+ A PP+  PP+  PP+PA      P+
Sbjct: 696  APPSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPSPA-PPSPPPPSPEPPSPAPPSPPPPS 754

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              PP+P P S P  +P P +  +PP+P P S  P      +PPPP
Sbjct: 755  PEPPSPAPPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPPP 798

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 40/104 (38%), Positives = 57/104 (54%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS----PAT 171
            P  P + +P P +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA      P+ 
Sbjct: 922  PPSPASPSPPPPSPEPPSPAPPSPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPPPPSP 980

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PP+P P S P  +P P +  +PP+PTP S  P      +PPPP
Sbjct: 981  EPPSPAPPSPPPPSPEPPSP-APPSPTPPSPEPPSPAPPSPPPP 1023

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 43/115 (37%), Positives = 55/115 (47%), Gaps = 16/115 (13%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP----PTATPPTATPPAPASS--- 162
            P  P   TPAP +  P +  PP+ TPP   PP+ A P    P+  PP+  PP+PA +   
Sbjct: 1191 PPSPIPPTPAPPSPEPPSPVPPSPTPPAPQPPSPAPPAPQPPSPAPPSPNPPSPAPTTPA 1250

Query: 163  ---------PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
                     P+ SPP P   + PS AP P  +  PP+P P S  P PS    P P
Sbjct: 1251 SPEPPSPQPPSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPPSPPAPPSP 1305

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 40/108 (37%), Positives = 57/108 (52%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPASS--- 162
            P  P   +PAP + PP +  PP+  PP+  PP+    +  PP+  PP+  PP+PA     
Sbjct: 722  PPSPQPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 781

Query: 163  -PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S P  +P P +  +PP+P P S  P      +PPPP
Sbjct: 782  PPSPEPPSPAPPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPPP 828

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 40/108 (37%), Positives = 57/108 (52%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPASS--- 162
            P  P   +PAP + PP +  PP+  PP+  PP+    +  PP+  PP+  PP+PA     
Sbjct: 737  PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 796

Query: 163  -PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S P  +P P +  +PP+P P S  P      +PPPP
Sbjct: 797  PPSPEPPSPAPPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPPP 843

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 40/108 (37%), Positives = 57/108 (52%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPASS--- 162
            P  P   +PAP + PP +  PP+  PP+  PP+    +  PP+  PP+  PP+PA     
Sbjct: 752  PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 811

Query: 163  -PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S P  +P P +  +PP+P P S  P      +PPPP
Sbjct: 812  PPSPEPPSPAPPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPPP 858

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 43/102 (42%), Positives = 57/102 (55%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPA--AATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           P  P   +PAP   PPA  + TPP+  PP+  PP+ A PP+  PP+  PP+P   P+  P
Sbjct: 660 PPSPAPPSPAPPQPPPAPPSPTPPSPAPPSPPPPSPA-PPSPRPPSPEPPSP-KPPSPEP 717

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+PTP S    +P P    SPP P+P+   P P    +PPPP
Sbjct: 718 PSPTPPSPQPPSPAPP---SPPPPSPEPPSPAP---PSPPPP 753

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 39/113 (34%), Positives = 54/113 (47%), Gaps = 13/113 (11%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPA---------AATPPTATPPTATPPAP 153
            AP  PP  +P P +  P +  PP+  PP+  PP+         +  PP+  PP+  PP+P
Sbjct: 836  APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPSPSPEPPSPAPPSPPPPSPAPPSP 895

Query: 154  A----SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            A      P+  PP+P P S P  +P P +  SP  P P    P P+    PPP
Sbjct: 896  APPSPPPPSPEPPSPAPPSPPPPSPEPPSPASPSPPPPSPEPPSPAPPSPPPP 948

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 8/107 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPASS--- 162
            P  P   +PAP + PP +  PP+  PP+  PP+    +  PP+  PP+  PP+PA     
Sbjct: 1007 PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 1066

Query: 163  -PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             P+  PP+P P S P  +P PS+   P  P P    P P    + PP
Sbjct: 1067 PPSPEPPSPAPPSPPPPSPEPSSPAPPSPPPPSPAPPSPEPQSSAPP 1113

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPASSPA 168
            AP  PP  +PAP +  P ++ PP+  P ++ PP+    +  PP+  PP+  PP+P+ SPA
Sbjct: 1091 APPSPPPPSPAPPSPEPQSSAPPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPA 1150

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              PP P P S    +P P T   PP+P P S  P      +P PP
Sbjct: 1151 --PPIPAPPSPQPPSPAPQTP-QPPSPDPPSPAPPSPAPPSPVPP 1192

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 40/101 (39%), Positives = 54/101 (53%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA-TPPTATPPTATPPAPASSPATSPP 180
           P  P   TPAP +  P +  PP+  PP+  PP     PP+ TPP+  PP+P   P+ +PP
Sbjct: 640 PPSPKPPTPAPPSPLPPSPLPPSPAPPSPAPPQPPPAPPSPTPPSPAPPSP-PPPSPAPP 698

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P S    +P P +   PP+PTP S  P      +PPPP
Sbjct: 699 SPRPPSPEPPSPKPPSP-EPPSPTPPSPQPPSPAPPSPPPP 738

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 43/102 (42%), Positives = 59/102 (57%), Gaps = 4/102 (3%)
 Frame = +1

Query: 10   KPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS----PATSP 177
            +PP+ TP P  QPP+ A PP+  PP+  PP+ A PP+  PP+  PP+PA      P+  P
Sbjct: 716  EPPSPTP-PSPQPPSPA-PPSPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPPPPSPEP 772

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P P S P  +P P +  +PP+P P S  P      +PPPP
Sbjct: 773  PSPAPPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPPP 813

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 39/109 (35%), Positives = 56/109 (51%), Gaps = 10/109 (9%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPA----S 159
            P  P   +PAP + PP +  PP+  PP+  PP+    +  PP+  PP+  PP+PA     
Sbjct: 767  PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 826

Query: 160  SPATSPPAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPP 300
             P+  PP+P P S P  +P P +    SPP P+P+   P P    +P P
Sbjct: 827  PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPSPSP 875

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 40/108 (37%), Positives = 56/108 (51%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP----PTATPPTATPPAPASS--- 162
            P  P   +PAP + PP +  PP+  PP+  PP+   P    P+  PP+  PP+PA     
Sbjct: 887  PPSPAPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPASPSPPPPSPEPPSPAPPSPP 946

Query: 163  -PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S P  +P P +  +PP+P P S  P      +PPPP
Sbjct: 947  PPSPEPPSPAPPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPPP 993

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 40/105 (38%), Positives = 57/105 (54%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPASSPA 168
            AP  PP  +P P +  P +  PP+  PP+  PP+    +  PP+  PP+  PP+P   P+
Sbjct: 941  APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSP-EPPS 999

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             +PP+PTP S    +P P    SPP P+P+   P P    +PPPP
Sbjct: 1000 PAPPSPTPPSPEPPSPAPP---SPPPPSPEPPSPAP---PSPPPP 1038

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 42/103 (40%), Positives = 59/103 (57%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA--SSPATSP 177
            P+  P + P+P  +PP+ A PP+  PP+  PP+ A PP+  PP+  PP+PA  S P  SP
Sbjct: 863  PSPAPPSPPSPSPEPPSPA-PPSPPPPSPAPPSPA-PPSPPPPSPEPPSPAPPSPPPPSP 920

Query: 178  PAPTPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSGADTPPPP 303
              P+PAS     P+P   + +PP+P P S  P      +PPPP
Sbjct: 921  EPPSPASPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPP 963

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 39/109 (35%), Positives = 57/109 (52%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP---------PTATPPTATPPAPA 156
            P  P   +PAP + PP +  PP+  PP+  PP+   P         P+  PP+  PP+P 
Sbjct: 827  PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPSPSPEPPSPAPPSP- 885

Query: 157  SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P+ +PP+P P S P  +P P +  +PP+P P S  P    + +PPPP
Sbjct: 886  PPPSPAPPSPAPPSPPPPSPEPPSP-APPSPPPPSPEPPSPASPSPPPP 933

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 38/101 (37%), Positives = 54/101 (53%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  P   +P P +  P +  PP+  PP+  PP +  PP+  PP+  PP+P   P+  PP
Sbjct: 1001 APPSPTPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSPEPPSPAPPSP-PPPSPEPP 1058

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S P  +P P +  +PP+P P S  P      +PPPP
Sbjct: 1059 SPAPPSPPPPSPEPPSP-APPSPPPPSPEPSSPAPPSPPPP 1098

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 40/101 (39%), Positives = 52/101 (51%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  P   +P P +  P    PP+  PP+  PP + TPP   PP+  PPAP   P+ +PP
Sbjct: 1180 APPSPAPPSPVPPSPIPPTPAPPSPEPPSPVPP-SPTPPAPQPPSPAPPAP-QPPSPAPP 1237

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P   PS APT   +  PP+P P S  P    +  PP P
Sbjct: 1238 SPNP---PSPAPTTPASPEPPSPQPPSPSPPVPPSPAPPSP 1275

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 39/101 (38%), Positives = 55/101 (54%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  PP  +P P +  P +  PP+  PP+  P ++A PP+  P ++ PP+P   P+ +PP
Sbjct: 1076 APPSPPPPSPEPSSPAPPSPPPPSPAPPSPEPQSSA-PPSPEPQSSAPPSPVP-PSPAPP 1133

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P+PS A  PP P P S  P      TP PP
Sbjct: 1134 SPAPPSPEPPSPSPSPA--PPIPAPPSPQPPSPAPQTPQPP 1172

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 41/101 (40%), Positives = 57/101 (56%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  P   +P P +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  P+  PP
Sbjct: 1394 SPIPPAPPSPEPPSPAPPSPAPPSPAPPSPQPPSPA-PPSPRPPSPAPPSPAP-PSPVPP 1451

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P + PS AP PS A  PP+P P S  P    + +P PP
Sbjct: 1452 SPQPPAPPSPAP-PSPA--PPSPAPPSPAPPSPASPSPVPP 1489

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 42/102 (41%), Positives = 55/102 (53%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPT-ATPPAAATPPTATP-PTATPPAPASSPATSP 177
            P  P  A P+P   PP +  PP+  PP+ A PP+   PP+  P P A PP+P   P+ +P
Sbjct: 1265 PVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPPSPPAPPSPEPIPPAPPPSPPEPPSPAP 1324

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P P   PS +P PS A  PP+P P S  P      +P PP
Sbjct: 1325 PSPQPPQPPSPSP-PSPA--PPSPEPPSPIPPSPAPPSPAPP 1363

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 40/110 (36%), Positives = 57/110 (51%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPASS--- 162
            P  P   +PAP + PP +  PP+   P+  PP+    +  PP+  PP+  PP+PA     
Sbjct: 902  PPSPEPPSPAPPSPPPPSPEPPSPASPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 961

Query: 163  -PATSPPAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S P  +P P +    SPP P+P+   P P  + TPP P
Sbjct: 962  PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPTPPSP 1010

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 38/101 (37%), Positives = 53/101 (52%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  PP+  P P A PP+   PP+  PP+  PP    PP+ +PP+  PP+P   P+  PP
Sbjct: 1298 SPPAPPSPEPIPPAPPPSPPEPPSPAPPSPQPP---QPPSPSPPSPAPPSP-EPPSPIPP 1353

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P P +   PP+P P S  P      +P PP
Sbjct: 1354 SPAPPSPAPPSPQPPSP-EPPSPAPPSPAPLSPAPPSPAPP 1393

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 39/102 (38%), Positives = 55/102 (53%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA--AATPPTATPPTATPPAPASSPATSP 177
            P  P   +PAP +  P +  PP+  PP+  PPA  +  PP+  PP+  PP+PA  P+  P
Sbjct: 1367 PPSPEPPSPAPPSPAPLSPAPPSPAPPSPIPPAPPSPEPPSPAPPSPAPPSPA-PPSPQP 1425

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P P S    +P P +  +PP+P P S  P P    +P PP
Sbjct: 1426 PSPAPPSPRPPSPAPPSP-APPSPVPPS--PQPPAPPSPAPP 1464

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP-ASSPATSPP 180
           P +PP+  PAP A P     PP+  PP+  PP+  +PP+  PP+  PP+P A  P+  PP
Sbjct: 583 PPRPPSP-PAPPAPPDPPTAPPSPDPPSPEPPSQPSPPSPDPPSPDPPSPPALPPSPKPP 641

Query: 181 APTPASTPSTAPTPST----AGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P +    +P P +    + +PP+P P    P P  + TPP P
Sbjct: 642 SPKPPTPAPPSPLPPSPLPPSPAPPSPAPPQPPPAPP-SPTPPSP 685

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 37/99 (37%), Positives = 53/99 (53%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +PAP + PP +  PP+  PP+  PP+   PP+  PP+  PP+P   P+ +PP+
Sbjct: 1022 PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPE-PPSPAPPSPPPPSP-EPPSPAPPS 1079

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P P S   ++P P    SPP P+P    P P  +  P P
Sbjct: 1080 PPPPSPEPSSPAPP---SPPPPSPAPPSPEPQSSAPPSP 1115

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 41/106 (38%), Positives = 56/106 (52%), Gaps = 7/106 (6%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATP--PAAATPPTATPPTATPPAPASSPATSP 177
            P  P   +PAP A  P +  PP+  PP+  P  PA+  PP+  PP+ +PP P S PA   
Sbjct: 1216 PPAPQPPSPAPPAPQPPSPAPPSPNPPSPAPTTPASPEPPSPQPPSPSPPVPPS-PAPPS 1274

Query: 178  PAPTPASTPS----TAPTPSTAGSPPA-PTPDSLGPGPSGADTPPP 300
            PAP P  +P       P+P+   SPPA P+P+ + P P  +   PP
Sbjct: 1275 PAPLPPPSPDPPSPVPPSPAPPPSPPAPPSPEPIPPAPPPSPPEPP 1320

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 38/114 (33%), Positives = 58/114 (50%), Gaps = 13/114 (11%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPASS-- 162
            AP  PP  +P P +  P +  PP+  PP+  PP+    +  PP+  PP+  PP+P  S  
Sbjct: 1031 APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPSSP 1090

Query: 163  -------PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                   P+ +PP+P P S+   +P P ++ +PP+P P S  P      +P PP
Sbjct: 1091 APPSPPPPSPAPPSPEPQSSAPPSPEPQSS-APPSPVPPSPAPPSPAPPSPEPP 1143

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPASSPAT 171
            P  P   +PAP + PP +  PP+  PP+  PP+    +  PP+  PP+  PP+P    ++
Sbjct: 1052 PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPSSPAPPSPPPPSPAPPSPEPQ-SS 1110

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +PP+P P S+   +P P +  +PP+P P S  P PS + +P PP
Sbjct: 1111 APPSPEPQSSAPPSPVPPSP-APPSPAPPSPEP-PSPSPSPAPP 1152

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/102 (40%), Positives = 51/102 (50%), Gaps = 1/102 (0%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  P  A P+P    PA  TP +  PP+  PP+ + P    PP+  PP+PA  P  SP 
Sbjct: 1228 APQPPSPAPPSPNPPSPAPTTPASPEPPSPQPPSPSPP---VPPSPAPPSPAPLPPPSPD 1284

Query: 181  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPPP 303
             P+P   PS AP PS    P P P P +  P P    +P PP
Sbjct: 1285 PPSPV-PPSPAPPPSPPAPPSPEPIPPAPPPSPPEPPSPAPP 1325

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 38/102 (37%), Positives = 53/102 (51%), Gaps = 1/102 (0%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS-SPATSP 177
            +P  P   +P+P +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  SPA   
Sbjct: 1326 SPQPPQPPSPSPPSPAPPSPEPPSPIPPSPAPPSPA-PPSPQPPSPEPPSPAPPSPAPLS 1384

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PAP   + PS  P    +  PP+P P S  P      +P PP
Sbjct: 1385 PAPPSPAPPSPIPPAPPSPEPPSPAPPSPAPPSPAPPSPQPP 1426

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 6/107 (5%)
 Frame = +1

Query: 1    APTKPPT-ATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPAS-S 162
            +P +PP+ A P+P+   P + +PP+  PP+  PP+    +  PP+  PP+  PP+P   S
Sbjct: 1315 SPPEPPSPAPPSPQPPQPPSPSPPSPAPPSPEPPSPIPPSPAPPSPAPPSPQPPSPEPPS 1374

Query: 163  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PA   PAP   + PS AP      +PP+P P S  P      +P PP
Sbjct: 1375 PAPPSPAPLSPAPPSPAPPSPIPPAPPSPEPPSPAPPSPAPPSPAPP 1421

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 40/104 (38%), Positives = 56/104 (53%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA----SSPAT 171
            P  P   +PAP +  P +  PP+  PP+  PP+   PP+  PP+  PP+PA    + P+ 
Sbjct: 1332 PPSPSPPSPAPPSPEPPSPIPPSPAPPSPAPPSPQ-PPSPEPPSPAPPSPAPLSPAPPSP 1390

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +PP+P P + PS  P PS A  PP+P P S  P      +P PP
Sbjct: 1391 APPSPIPPAPPSPEP-PSPA--PPSPAPPSPAPPSPQPPSPAPP 1431

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 42/110 (38%), Positives = 55/110 (50%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPT--ATP-----PTATPPAPASS 162
            P+  P   P+P    PA   PP+  PP+  PP+ A PP+  A P     P A PP+P   
Sbjct: 1260 PSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPPSPPAPPSPEPIPPAPPPSPPEP 1319

Query: 163  PATSPPAPTPASTPSTAPTPSTA---GSPPAPTPDSLGPGPSGADTPPPP 303
            P+ +PP+P P   PS +P PS A     PP+P P S  P      +P PP
Sbjct: 1320 PSPAPPSPQPPQPPSPSP-PSPAPPSPEPPSPIPPSPAPPSPAPPSPQPP 1368

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 46/110 (41%), Positives = 55/110 (50%), Gaps = 9/110 (8%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQ-PPAAATP----PTATPPTATPPAAATPPTATP----PTATPPAP 153
            AP  P   +PAP +  PP+ A P    P+  PP  TPP+ A  PT +P    PT   PAP
Sbjct: 1457 APPSPAPPSPAPPSPAPPSPAPPSPASPSPVPPLPTPPSPAPAPTTSPLPPSPTPALPAP 1516

Query: 154  ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             +SPA  P  P P   P+ AP PS A  PP+P P  L P P      P P
Sbjct: 1517 PASPAPPPNPPRPPQPPA-APPPSPAAPPPSPAP--LAPPPPQPQPQPTP 1563

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/116 (37%), Positives = 54/116 (46%), Gaps = 15/116 (12%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP----PTATPPAPASSPA 168
           +P +PP+  P     PP A  PP    P A PPA   PPTA P    P+  PP+  S P+
Sbjct: 562 SPPRPPSPQPPVPRPPPRAPRPPRPPSPPA-PPAPPDPPTAPPSPDPPSPEPPSQPSPPS 620

Query: 169 TSPPAPTPASTPSTAPTPSTAGS-----------PPAPTPDSLGPGPSGADTPPPP 303
             PP+P P S P+  P+P                PP+P P S  P PS A   PPP
Sbjct: 621 PDPPSPDPPSPPALPPSPKPPSPKPPTPAPPSPLPPSPLPPSPAP-PSPAPPQPPP 675

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/98 (38%), Positives = 51/98 (52%), Gaps = 1/98 (1%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATP-PTATPPAAATPPTATPPTATPPAPASSPATSPPAPT 189
            PP+  P   A PP+   PP+  P P A PP+   PP+  PP+  PP P   P+ SPP+P 
Sbjct: 1285 PPSPVPPSPAPPPSPPAPPSPEPIPPAPPPSPPEPPSPAPPSPQPPQP---PSPSPPSPA 1341

Query: 190  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1342 PPSPEPPSPIPPSP-APPSPAPPSPQPPSPEPPSPAPP 1378

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/102 (37%), Positives = 54/102 (52%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS--SPATSP 177
            P  P   +PAP +  P +  PP+  PP+  P + A PP+  PP+  PPAP S   P+ +P
Sbjct: 1352 PPSPAPPSPAPPSPQPPSPEPPSPAPPSPAPLSPA-PPSPAPPSPIPPAPPSPEPPSPAP 1410

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1411 PSPAPPSPAPPSPQPPSP-APPSPRPPSPAPPSPAPPSPVPP 1451

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 39/110 (35%), Positives = 54/110 (49%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA----TPPTATPPTATPPAPASS--P 165
            P  P   +PAP +  P +  PP+  PP+  PP+ A     PP+  PP+  PPAP S   P
Sbjct: 1347 PPSPIPPSPAPPSPAPPSPQPPSPEPPSPAPPSPAPLSPAPPSPAPPSPIPPAPPSPEPP 1406

Query: 166  ATSPPAPTPASTPSTAPTPSTAGSP----PAPTPDSLGPGPSGADTPPPP 303
            + +PP+P P S    +P P +   P    P+P P S  P      +P PP
Sbjct: 1407 SPAPPSPAPPSPAPPSPQPPSPAPPSPRPPSPAPPSPAPPSPVPPSPQPP 1456

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 40/106 (37%), Positives = 54/106 (50%), Gaps = 5/106 (4%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAA---ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT 171
            AP  P   +PAP +  P +     PP+  PP+  PP+ A PP+  PP+  PP+PA  P+ 
Sbjct: 1376 APPSPAPLSPAPPSPAPPSPIPPAPPSPEPPSPAPPSPA-PPSPAPPSPQPPSPA-PPSP 1433

Query: 172  SPPAPTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PP+P P S   PS  P      +PP+P P S  P      +P PP
Sbjct: 1434 RPPSPAPPSPAPPSPVPPSPQPPAPPSPAPPSPAPPSPAPPSPAPP 1479

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 39/105 (37%), Positives = 52/105 (49%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATP----PAAATPPTATPPTATPPAPASSPA 168
            AP  P   +P+P   PP  A PP+  PP+  P    P +  PP+  PP+  PP+P   P+
Sbjct: 1136 APPSPEPPSPSPSPAPPIPA-PPSPQPPSPAPQTPQPPSPDPPSPAPPSPAPPSPV-PPS 1193

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              PP P P S    +P P +  +PPAP P S  P      +P PP
Sbjct: 1194 PIPPTPAPPSPEPPSPVPPSP-TPPAPQPPSPAPPAPQPPSPAPP 1237

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 37/101 (36%), Positives = 47/101 (46%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  P    P+P    PA+  PP+  PP+ +PP    PP+  PP+  P  P S    SP 
Sbjct: 1233 SPAPPSPNPPSPAPTTPASPEPPSPQPPSPSPP---VPPSPAPPSPAPLPPPSPDPPSPV 1289

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+PA  PS    PS    PPAP P    P      +P PP
Sbjct: 1290 PPSPAPPPSPPAPPSPEPIPPAPPPSPPEPPSPAPPSPQPP 1330

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 41/101 (40%), Positives = 53/101 (52%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  P   +P P +  P +  PP+  PP+  PP+ A PP+  P +  PP+PA  P+  PP
Sbjct: 1341 APPSPEPPSPIPPSPAPPSPAPPSPQPPSPEPPSPA-PPSPAPLSPAPPSPAP-PSPIPP 1398

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            AP     PS AP PS A  PP+P P S  P      +P PP
Sbjct: 1399 APPSPEPPSPAP-PSPA--PPSPAPPSPQPPSPAPPSPRPP 1436

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 39/101 (38%), Positives = 51/101 (50%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            APT P  A+P P +  P + +PP    P    PA   PP+  PP+  PP+PA  P  SPP
Sbjct: 1245 APTTP--ASPEPPSPQPPSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPSPA--PPPSPP 1300

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            AP P+  P     P +   PP+P P S  P    + +PP P
Sbjct: 1301 AP-PSPEPIPPAPPPSPPEPPSPAPPSPQPPQPPSPSPPSP 1340

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 33/100 (33%), Positives = 44/100 (44%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +P+P   P  A   P   PP +  P +  PP+  PP + P  P+  P    P 
Sbjct: 1254 PPSPQPPSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPPSPPAPPSPEPIPPAPP 1313

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P   PS AP       PP+P+P S  P      +P PP
Sbjct: 1314 PSPPEPPSPAPPSPQPPQPPSPSPPSPAPPSPEPPSPIPP 1353

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 38/104 (36%), Positives = 52/104 (50%), Gaps = 3/104 (2%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATP---PAAATPPTATPPTATPPAPASSPAT 171
            AP  P   +PAP +  P +  PP+ +P  A P   P +  PP+  P T  PP+P   P+ 
Sbjct: 1121 APPSPVPPSPAPPSPAPPSPEPPSPSPSPAPPIPAPPSPQPPSPAPQTPQPPSP-DPPSP 1179

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +PP+P P S    +P P T  +PP+P P S  P       P PP
Sbjct: 1180 APPSPAPPSPVPPSPIPPTP-APPSPEPPSPVPPSPTPPAPQPP 1222

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 39/106 (36%), Positives = 53/106 (50%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATP---PTATPPTATPPAAATPPT---ATPPTATPPAPASSP 165
            P  P   +PAP   PPA  +P   P A PP+   P +  PP+     PP+ +PP+PA  P
Sbjct: 1285 PPSPVPPSPAPPPSPPAPPSPEPIPPAPPPSPPEPPSPAPPSPQPPQPPSPSPPSPA-PP 1343

Query: 166  ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +  PP+P P S    +P P +   PP+P P S  P      +P PP
Sbjct: 1344 SPEPPSPIPPSPAPPSPAPPSP-QPPSPEPPSPAPPSPAPLSPAPP 1388

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 37/108 (34%), Positives = 51/108 (47%), Gaps = 7/108 (6%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA---TPPTATPPTATPPAPA----S 159
            AP  P   + AP +  P +  PP+  PP+  PP+ +    PP   PP+  PP+PA     
Sbjct: 1111 APPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPAPPIPAPPSPQPPSPAPQTPQ 1170

Query: 160  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S    +P P +   PP P P S  P      +P PP
Sbjct: 1171 PPSPDPPSPAPPSPAPPSPVPPSP-IPPTPAPPSPEPPSPVPPSPTPP 1217

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 38/94 (40%), Positives = 45/94 (47%)
 Frame = +1

Query: 22  ATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPAST 201
           A P+P    P+   PP+  PP   PP  A  P   P    PPAP   P T+PP+P P S 
Sbjct: 552 AMPSPVPPLPSPPRPPSPQPPVPRPPPRAPRPPRPPSPPAPPAP-PDPPTAPPSPDPPS- 609

Query: 202 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
               P P +  SPP+P P S  P PS    PP P
Sbjct: 610 ----PEPPSQPSPPSPDPPSPDP-PSPPALPPSP 638

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 38/104 (36%), Positives = 49/104 (47%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP---PTATPPTATPPAP-ASSPAT 171
            P      +P P++  P +  PP+  PP+  PP+   P   P+  PP   PP+P   SPA 
Sbjct: 1107 PQSSAPPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPAPPIPAPPSPQPPSPAP 1166

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P P     PS AP PS A  PP+P P S  P      +P PP
Sbjct: 1167 QTPQPPSPDPPSPAP-PSPA--PPSPVPPSPIPPTPAPPSPEPP 1207

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 41/120 (34%), Positives = 47/120 (39%), Gaps = 20/120 (16%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA---------TPPTATPPTATPPAPA 156
           P  PP   PAP   PP    PP + P    PP  A           P+  PP  +PP P 
Sbjct: 508 PPSPPPTPPAPPPVPPLPPAPPPSPPLPPEPPFIALCIRAGVLCAMPSPVPPLPSPPRP- 566

Query: 157 SSPATSPPAPTPASTPSTAPTPSTAGSPPA-----------PTPDSLGPGPSGADTPPPP 303
             P+  PP P P   P  AP P    SPPA           P+PD   P P    +PP P
Sbjct: 567 --PSPQPPVPRP---PPRAPRPPRPPSPPAPPAPPDPPTAPPSPDPPSPEPPSQPSPPSP 621

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 32/91 (35%), Positives = 41/91 (45%), Gaps = 5/91 (5%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPT-----ATPPTATPPAPASSP 165
            +P  P    P+P   P  +  PP+ TP    PPA+  PP        PP A PP+PA+ P
Sbjct: 1485 SPVPPLPTPPSPAPAPTTSPLPPSPTPALPAPPASPAPPPNPPRPPQPPAAPPPSPAAPP 1544

Query: 166  ATSPPAPTPASTPSTAPTPSTAGSPPAPTPD 258
             +  P   P   P   PTP+ A   P   PD
Sbjct: 1545 PSPAPLAPPPPQPQPQPTPAAAAPSPPLPPD 1575

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 38/117 (32%), Positives = 47/117 (40%), Gaps = 20/117 (17%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           PP+ +PAP   PP   +PP    P + P   + PPT   P  TPPAP   P   PPAP P
Sbjct: 472 PPSPSPAPPRPPPFPPSPPPNPRPPSPPVPPSPPPTPPSPPPTPPAPPPVPPL-PPAPPP 530

Query: 193 A--------------------STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +                    + PS  P   +   PP+P P    P P     P PP
Sbjct: 531 SPPLPPEPPFIALCIRAGVLCAMPSPVPPLPSPPRPPSPQPPVPRPPPRAPRPPRPP 587

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 41/122 (33%), Positives = 48/122 (39%), Gaps = 22/122 (18%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPP------------------TATPPTATPPAAATP--PTA 123
           P  PP   P P A PP+   PP                  +  PP  +PP   +P  P  
Sbjct: 515 PPAPPPVPPLPPAPPPSPPLPPEPPFIALCIRAGVLCAMPSPVPPLPSPPRPPSPQPPVP 574

Query: 124 TPP--TATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
            PP     PP P S PA  PPAP    T   +P P +   P  P+P S  P P   D P 
Sbjct: 575 RPPPRAPRPPRPPSPPA--PPAPPDPPTAPPSPDPPSPEPPSQPSPPS--PDPPSPDPPS 630

Query: 298 PP 303
           PP
Sbjct: 631 PP 632

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 38/121 (31%), Positives = 42/121 (34%), Gaps = 21/121 (17%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP-PTATPPAPASSPATSPP 180
           P  P  A P P   PP+    P    P   P    TPP+  P P A PP P   PA  P 
Sbjct: 472 PPSPSPAPPRPPPFPPSPPPNPRPPSPPVPPSPPPTPPSPPPTPPAPPPVPPLPPAPPPS 531

Query: 181 APTPASTPSTA----------------PTPS----TAGSPPAPTPDSLGPGPSGADTPPP 300
            P P   P  A                P PS     +  PP P P    P P    +PP 
Sbjct: 532 PPLPPEPPFIALCIRAGVLCAMPSPVPPLPSPPRPPSPQPPVPRPPPRAPRPPRPPSPPA 591

Query: 301 P 303
           P
Sbjct: 592 P 592

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 28/72 (38%), Positives = 31/72 (43%), Gaps = 2/72 (2%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA--AATPPTATPPTATPPAPASSPATSP 177
            P  P  A PAP A P     PP    P A PP   AA PP+  P    PP P   P  + 
Sbjct: 1506 PPSPTPALPAPPASPAPPPNPPRPPQPPAAPPPSPAAPPPSPAPLAPPPPQPQPQPTPAA 1565

Query: 178  PAPTPASTPSTA 213
             AP+P   P  A
Sbjct: 1566 AAPSPPLPPDCA 1577

[68][TOP]
>UniRef100_C5Z861 Putative uncharacterized protein Sb10g027460 n=1 Tax=Sorghum
           bicolor RepID=C5Z861_SORBI
          Length = 278

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 47/111 (42%), Positives = 63/111 (56%), Gaps = 11/111 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTAT----PPAAATPPTATPPTATPPAPA--SSP 165
           PT PPT  P+P + PPA AT P+++PP+ +    P  AATP +   P A+ PAPA  ++ 
Sbjct: 143 PTSPPTPLPSPPSSPPAPATSPSSSPPSGSAAPVPAPAATPTSPPSPAASAPAPAPTTTA 202

Query: 166 ATSPPAPTPAS-TPSTAPTPSTAGSPPAPTPDSLGPGPSGAD----TPPPP 303
            +SPPAP   + +PST PTP    S   P+  +  PG  G      TPPPP
Sbjct: 203 PSSPPAPAAQTPSPSTTPTPGGGSSSSPPSGSASAPGGDGGSGSTTTPPPP 253

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 46/102 (45%), Positives = 61/102 (59%), Gaps = 7/102 (6%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPT---ATPPAPASSPATSPPAPT 189
           + T  P A PP +   P  +PP++ PPA AT P+++PP+   A  PAPA++P TSPP+P 
Sbjct: 133 SGTRTPPAAPPTSPPTPLPSPPSS-PPAPATSPSSSPPSGSAAPVPAPAATP-TSPPSPA 190

Query: 190 PASTPSTAPTPSTAGSPPAP---TPD-SLGPGPSGADTPPPP 303
            AS P+ APT +   SPPAP   TP  S  P P G  +  PP
Sbjct: 191 -ASAPAPAPTTTAPSSPPAPAAQTPSPSTTPTPGGGSSSSPP 231

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 36/93 (38%), Positives = 48/93 (51%), Gaps = 4/93 (4%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATP-PAAATPPTATPPT---ATPPAPASSPA 168
           AP   PT+ P+P A  PA A  PT T P++ P PAA TP  +T PT    +  +P S  A
Sbjct: 178 APAATPTSPPSPAASAPAPA--PTTTAPSSPPAPAAQTPSPSTTPTPGGGSSSSPPSGSA 235

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLG 267
           ++P     + + +T P PS A    A    SLG
Sbjct: 236 SAPGGDGGSGSTTTPPPPSAAAPVVAGFVGSLG 268

[69][TOP]
>UniRef100_B6SUZ1 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6SUZ1_MAIZE
          Length = 284

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 52/125 (41%), Positives = 58/125 (46%), Gaps = 32/125 (25%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAA---ATPPTATPPTATPPAAATPPTATPP---------TATP 144
           AP KPP  TP P   PPA    ATPP   PP   PPAAA PPTATPP           TP
Sbjct: 129 APAKPPPVTPPPVTPPPATPPPATPPAVLPPAVLPPAAAPPPTATPPAEAPASLPPATTP 188

Query: 145 PAPASSPATSPPAPTPA----------------STPSTAPTPSTAGSPPAPTP----DSL 264
           P  A +PA  PPA  P+                  P+ AP P +  +P AP+P    D  
Sbjct: 189 PPVAEAPAELPPAEAPSKGKNKHKRRRKQHGKKEAPAEAPQPLSPPAPAAPSPADLEDVS 248

Query: 265 GPGPS 279
           GP PS
Sbjct: 249 GPAPS 253

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 43/90 (47%), Positives = 45/90 (50%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           AP KPP   PA     P   TPP  TPP ATPP  ATPP   PP   PPA A  P  +PP
Sbjct: 117 APAKPPPVAPAVAPAKPPPVTPPPVTPPPATPP-PATPPAVLPPAVLPPAAAPPPTATPP 175

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGP 270
           A  PAS P  A TP      PA  P +  P
Sbjct: 176 AEAPASLP-PATTPPPVAEAPAELPPAEAP 204

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 51/103 (49%), Positives = 55/103 (53%), Gaps = 3/103 (2%)
 Frame = +1

Query: 1   APTKPPTA--TPAPKAQPPAAATPPTATPPTA-TPPAAATPPTATPPTATPPAPASSPAT 171
           AP  PP    TPAP A P A A PP   P  A   P   TPP  TPP ATPP PA+ PA 
Sbjct: 98  APANPPPVPTTPAPTATPVAPAKPPPVAPAVAPAKPPPVTPPPVTPPPATPP-PATPPAV 156

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            PPA  P   P+ AP P+   +PPA  P SL P    A TPPP
Sbjct: 157 LPPAVLP---PAAAPPPT--ATPPAEAPASLPP----ATTPPP 190

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 50/100 (50%), Positives = 54/100 (54%), Gaps = 2/100 (2%)
 Frame = +1

Query: 4   PTKP-PTATP-APKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           PT P PTATP AP   PP A     A PP  TPP   TPP ATPP ATPPA    PA  P
Sbjct: 106 PTTPAPTATPVAPAKPPPVAPAVAPAKPPPVTPPPV-TPPPATPPPATPPA-VLPPAVLP 163

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           PA  P  T +T P  + A  PPA TP  +   P  A+ PP
Sbjct: 164 PAAAPPPT-ATPPAEAPASLPPATTPPPVAEAP--AELPP 200

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 46/104 (44%), Positives = 47/104 (45%), Gaps = 3/104 (2%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATP-PTATP--PTATPPAAATPPTATPPTATPPAPASSPAT 171
           APT P     AP   PP   TP PTATP  P   PP A     A PP  TPP     PAT
Sbjct: 88  APTTPAATPVAPANPPPVPTTPAPTATPVAPAKPPPVAPAVAPAKPPPVTPPPVTPPPAT 147

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PPA  PA  P  A  P  A  PP  TP +  P      T PPP
Sbjct: 148 PPPATPPAVLP-PAVLPPAAAPPPTATPPAEAPASLPPATTPPP 190

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 49/114 (42%), Positives = 55/114 (48%), Gaps = 15/114 (13%)
 Frame = +1

Query: 1   APTKPPT-ATPAPKAQPPAAATPPTATPPTATPPAAATPP---TATPPTATPPAPAS--- 159
           APT P T  TPA    P A  TP   T P ATP A A PP   T   PTATP APA    
Sbjct: 64  APTTPATPTTPAAPTTPIAPTTPAAPTTPAATPVAPANPPPVPTTPAPTATPVAPAKPPP 123

Query: 160 -SPATSPPAPTPASTPSTAPTPST-------AGSPPAPTPDSLGPGPSGADTPP 297
            +PA +P  P P + P   P P+T       A  PPA  P +  P P+   TPP
Sbjct: 124 VAPAVAPAKPPPVTPPPVTPPPATPPPATPPAVLPPAVLPPAAAPPPTA--TPP 175

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 50/109 (45%), Positives = 55/109 (50%), Gaps = 9/109 (8%)
 Frame = +1

Query: 1   APTKPPT-ATPAPKAQPPAAATPPTATPPTA--TPPAAATPPTATPPTATPPAPAS-SPA 168
           APT P T  TPA    P A  TP T T P A  TP A  TP   T P ATP APA+  P 
Sbjct: 46  APTTPATPTTPAAPTTPAAPTTPATPTTPAAPTTPIAPTTPAAPTTPAATPVAPANPPPV 105

Query: 169 TSPPAPT-----PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            + PAPT     PA  P  AP  + A  PP  TP  + P P+   TPPP
Sbjct: 106 PTTPAPTATPVAPAKPPPVAPAVAPA-KPPPVTPPPVTPPPA---TPPP 150

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 46/115 (40%), Positives = 50/115 (43%), Gaps = 14/115 (12%)
 Frame = +1

Query: 1   APTKPPT-ATPAPKAQPPAAATPPTATPPTATPPAAATP---------PTATPPTATPPA 150
           APT P    TPA    P A  TP   T P A    AATP         PT   PTATP A
Sbjct: 58  APTTPAAPTTPATPTTPAAPTTPIAPTTPAAPTTPAATPVAPANPPPVPTTPAPTATPVA 117

Query: 151 PAS----SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PA     +PA +P  P P + P   P P+T   PPA  P  L P        PPP
Sbjct: 118 PAKPPPVAPAVAPAKPPPVTPPPVTPPPAT--PPPATPPAVLPPAVLPPAAAPPP 170

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 46/109 (42%), Positives = 53/109 (48%), Gaps = 12/109 (11%)
 Frame = +1

Query: 13  PPTA--TPAPKAQPPAAATPPTATPPTA--TPPAAATPPTATPPTA--TPPAPASSPATS 174
           PPTA  TPA    P A  TP T T P A  TP A  TP T T P A  TP AP +  A +
Sbjct: 31  PPTAPTTPAAPTTPAAPTTPATPTTPAAPTTPAAPTTPATPTTPAAPTTPIAPTTPAAPT 90

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP------GPSGADTPPPP 303
            PA TP +  +  P P+T    PAPT   + P       P+ A   PPP
Sbjct: 91  TPAATPVAPANPPPVPTT----PAPTATPVAPAKPPPVAPAVAPAKPPP 135

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 37/86 (43%), Positives = 45/86 (52%), Gaps = 4/86 (4%)
 Frame = +1

Query: 55  AATPPTA--TPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPST--APTP 222
           A +PPTA  TP   T PAA T P ATP T   P   ++P T+P  PT  + P+T  APT 
Sbjct: 28  AQSPPTAPTTPAAPTTPAAPTTP-ATPTTPAAPTTPAAP-TTPATPTTPAAPTTPIAPTT 85

Query: 223 STAGSPPAPTPDSLGPGPSGADTPPP 300
             A + PA TP +    P    TP P
Sbjct: 86  PAAPTTPAATPVAPANPPPVPTTPAP 111

[70][TOP]
>UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas
           reinhardtii RepID=A8J1N3_CHLRE
          Length = 527

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 39/100 (39%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +PAP +  P +  PP+  PP    PA  TPP   PP+  PP P   P+ +PP+
Sbjct: 217 PPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTPPGPPPPSPAPPNPPPPPSPAPPS 276

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S    +P P  +  PP+P P S  P       PPPP
Sbjct: 277 PKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPP 316

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 36/100 (36%), Positives = 48/100 (48%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+  P   P+P    P    PP+  PP   PP +  PP+  PP+  PP+P   P+  PP+
Sbjct: 238 PSPQPPVPPSPAPPTPPGPPPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPPPSPEPPS 297

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S    +P P     PP+P P S  P      +PPPP
Sbjct: 298 PKPPSPEPPSPQPPLPPPPPSPYPPSPSPPSPPPPSPPPP 337

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 41/103 (39%), Positives = 49/103 (47%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP--PTATPPAPASSPATS 174
           +P  P  A P+P  QPP    PP+  PP+  PP   +PP  +P  P+  PPAP S P   
Sbjct: 370 SPLPPSPAPPSP--QPPLPPPPPSPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPPP 427

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP P P   P   P      SPP P+P    P P     PPPP
Sbjct: 428 PPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPP 470

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 40/100 (40%), Positives = 51/100 (51%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP +  PP+  PP+  PP+   PP   PP+  PP+PA     SPP 
Sbjct: 431 PPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPPLPPSPPP 490

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   PS AP    + +PP+P P    P P+    PPPP
Sbjct: 491 PSP-YPPSPAPPVPPSPAPPSPEP----PSPAPPSPPPPP 525

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 37/101 (36%), Positives = 45/101 (44%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  P  A P P + PP +  PP+  PP    P    PP   PP   PP P   P  SPP
Sbjct: 391 SPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPFPPFPPPPSPP 450

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P       P+P     PP P+P    P P    +PPPP
Sbjct: 451 PPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPPLPPSPPPP 491

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 36/99 (36%), Positives = 49/99 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP   P P +  P + +PP+  PP+  PP   +P   TPP   PP+PA  P   PP 
Sbjct: 212 PSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTPPGPPPPSPA--PPNPPPP 269

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P+PA      P+P     PP P+P+   P P   + P P
Sbjct: 270 PSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSP 308

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 35/97 (36%), Positives = 47/97 (48%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           P   +P P +  P +  PP+  PP   PP +  PP+ +PP+  PP+P      SP  PTP
Sbjct: 194 PSPPSPLPPSPRPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTP 253

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P  +P P     PP+P P S  P      +PPPP
Sbjct: 254 PGPPPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPP 290

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 37/100 (37%), Positives = 52/100 (52%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +PAP +  P +  PP+  PP +  P +  PP+  PP+  PP P   P+  PP+
Sbjct: 264 PNPPPPPSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPPPSPYPPS 323

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P S P  +P P +  +PP+P P S          PPPP
Sbjct: 324 PSPPSPPPPSPPPPSP-APPSPAPPS----------PPPP 352

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 41/106 (38%), Positives = 49/106 (46%), Gaps = 5/106 (4%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           AP  PP   P P   PP     P   PP + PP +  PP+  PP+  PP P   P+  PP
Sbjct: 419 APPSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPP 478

Query: 181 APTPASTPSTAP----TPSTAGS-PPAPTPDSLGPGPSGADTPPPP 303
           +P P   PS  P     PS A   PP+P P S  P      +PPPP
Sbjct: 479 SPAPPLPPSPPPPSPYPPSPAPPVPPSPAPPSPEPPSPAPPSPPPP 524

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 38/101 (37%), Positives = 46/101 (45%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  P  A PAP + PP    PP   PP    P    PP+  PP+  PP+PA      PP
Sbjct: 409 SPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPP 468

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S    +P P    SPP P+P    P P    +P PP
Sbjct: 469 PPPPPSPYPPSPAPPLPPSPPPPSPYPPSPAPPVPPSPAPP 509

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 35/101 (34%), Positives = 48/101 (47%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  P   +P P +  P +  PP   PP +  P + +PP+  PP+  PP P S    +PP
Sbjct: 195 SPPSPLPPSPRPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTPP 254

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S     P P  + +PP+P P    P P     PPPP
Sbjct: 255 GPPPPSPAPPNPPPPPSPAPPSPKP----PSPEPPSPPPPP 291

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 38/116 (32%), Positives = 48/116 (41%), Gaps = 16/116 (13%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----------------AATPPTATPPT 135
           P  P   +P P + PP +  PP+  PP+  PP                 +  PP+  PP+
Sbjct: 321 PPSPSPPSPPPPSPPPPSPAPPSPAPPSPPPPCECLAGERELTCAFLPPSPLPPSPAPPS 380

Query: 136 ATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PP P   P+  PP+P P   PS  P      SP  P P S  P P     PPPP
Sbjct: 381 PQPPLPPPPPSPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPPPPP 436

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 38/99 (38%), Positives = 46/99 (46%), Gaps = 2/99 (2%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAA--TPPTATPPTATPPAPASSPATSPPAP 186
           PP+  P P   PP+   P    PP+  PP+ A   PP+  PP+  PP+PA     SPP P
Sbjct: 368 PPSPLP-PSPAPPSPQPPLPPPPPSPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPP 426

Query: 187 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P   P   P P     PP P+P    PGP     P PP
Sbjct: 427 PPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPP 465

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 38/108 (35%), Positives = 50/108 (46%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP  +P P +  P +  PP+  PP   PP +  PP+ +PP+  PP+P   P  SP  
Sbjct: 285 PSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPPPSPYPPSPSPPSPPPPSP---PPPSPAP 341

Query: 184 PTPASTPSTAPTPSTAGS--------PPAPTPDSLGPGPSGADTPPPP 303
           P+PA      P    AG         PP+P P S  P       PPPP
Sbjct: 342 PSPAPPSPPPPCECLAGERELTCAFLPPSPLPPSPAPPSPQPPLPPPP 389

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 39/117 (33%), Positives = 52/117 (44%), Gaps = 17/117 (14%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPP----------------TATPPT 135
           P  PP  +P P +  P +  PP+  PP+  PP+ A P                    PP+
Sbjct: 311 PLPPPPPSPYPPSPSPPSPPPPSPPPPSPAPPSPAPPSPPPPCECLAGERELTCAFLPPS 370

Query: 136 ATPPAPASSPATSPPAPTPASTP-STAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PP+PA  P+  PP P P  +P   +P P    SPP P+P    P P    +PPPP
Sbjct: 371 PLPPSPA-PPSPQPPLPPPPPSPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPP 426

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 39/117 (33%), Positives = 48/117 (41%), Gaps = 18/117 (15%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPA-----------------AATPPTATPPTATPPAAATPPTATPP 132
           P  P   +PAP + PP                  +  PP+  PP+  PP    PP+  PP
Sbjct: 336 PPSPAPPSPAPPSPPPPCECLAGERELTCAFLPPSPLPPSPAPPSPQPPLPPPPPSPYPP 395

Query: 133 TATPPAPASSPATSPPAPTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           +  PP P S P  SP  P+PA   P + P P     PP P P    P P     PPP
Sbjct: 396 SPAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPP 452

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 43/116 (37%), Positives = 54/116 (46%), Gaps = 18/116 (15%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP----PAPASSP---- 165
           KPP+  P P  QPP    PP+  PP+ +PP+   PP  +PP  +P    PAP S P    
Sbjct: 299 KPPSPEP-PSPQPPLPPPPPSPYPPSPSPPS---PPPPSPPPPSPAPPSPAPPSPPPPCE 354

Query: 166 ----------ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                     A  PP+P P S    +P P     PP+P P S  P P    +PPPP
Sbjct: 355 CLAGERELTCAFLPPSPLPPSPAPPSPQPPLPPPPPSPYPPS--PAPPVPPSPPPP 408

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 4/88 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP--PTATPPTATPPAPAS--SPAT 171
           P+ PP +   P   PP+   PP   PP+  PP+ A P  P+  PP+  PP+PA    P+ 
Sbjct: 447 PSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPPLPPSPPPPSPYPPSPAPPVPPSP 506

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTP 255
           +PP+P P       P+P+    PP P+P
Sbjct: 507 APPSPEP-------PSPAPPSPPPPPSP 527

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 32/82 (39%), Positives = 42/82 (51%), Gaps = 4/82 (4%)
 Frame = +1

Query: 70  TATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAP 249
           T +PP+  PP+   PP+  PP+  PP     P+ +PP+P+P S P  +P P    SP  P
Sbjct: 193 TPSPPSPLPPSPR-PPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPP 251

Query: 250 TPDSLGPGPSGAD----TPPPP 303
           TP    PGP         PPPP
Sbjct: 252 TP----PGPPPPSPAPPNPPPP 269

[71][TOP]
>UniRef100_C2BVJ8 Putative uncharacterized protein n=1 Tax=Mobiluncus curtisii ATCC
            43063 RepID=C2BVJ8_9ACTO
          Length = 1525

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 51/106 (48%), Positives = 56/106 (52%), Gaps = 6/106 (5%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPASSPA 168
            APT  PT  PAP    P   TPP  TP   TPPA      TPP  TP   TPPAPA  P 
Sbjct: 1331 APTPGPTTPPAPT---PGPTTPPAPTPGPTTPPAPTPGPTTPPAPTPGPTTPPAPAPGP- 1386

Query: 169  TSPPAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPP 300
            T+PPAPTP  T   APTP   G  +P +P P++    PS   TP P
Sbjct: 1387 TTPPAPTPGPTTPPAPTPGGGGPSTPVSPAPNT----PSTPTTPKP 1428

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 51/100 (51%), Positives = 54/100 (54%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            APT PP  TP P   P  A TP   TPP  T P   TPP  TP   TPPAP   P T+PP
Sbjct: 1326 APT-PPAPTPGPTTPP--APTPGPTTPPAPT-PGPTTPPAPTPGPTTPPAPTPGP-TTPP 1380

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            AP P  T   APTP    +PPAPTP   G GPS   +P P
Sbjct: 1381 APAPGPTTPPAPTPGPT-TPPAPTPG--GGGPSTPVSPAP 1417

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 51/115 (44%), Positives = 56/115 (48%), Gaps = 15/115 (13%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQP---PAAATPPTATPPTATPPAAA----TPPTATPPTATPPAPASS 162
            PT PP  TP P   P   P   TPP  TP   TPPA      TPP   P   TPPAP   
Sbjct: 1336 PTTPPAPTPGPTTPPAPTPGPTTPPAPTPGPTTPPAPTPGPTTPPAPAPGPTTPPAPTPG 1395

Query: 163  PATSPPAPTPAST-PST--APTPSTAGSPPAPTPD-----SLGPGPSGADTPPPP 303
            P T+PPAPTP    PST  +P P+T  +P  P P      S    PS  +TP PP
Sbjct: 1396 P-TTPPAPTPGGGGPSTPVSPAPNTPSTPTTPKPSQPSEPSQPSEPSQPETPAPP 1449

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 46/100 (46%), Positives = 50/100 (50%), Gaps = 5/100 (5%)
 Frame = +1

Query: 19   TATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPAS 198
            TA  +  A  P A TP   TPP  TP    TPP  TP   TPPAP   P T+PPAPTP  
Sbjct: 1319 TAQFSAPAPTPPAPTPGPTTPPAPTP-GPTTPPAPTPGPTTPPAPTPGP-TTPPAPTPGP 1376

Query: 199  TPSTAPTPSTAGSPPAP-----TPDSLGPGPSGADTPPPP 303
            T   AP P    +PPAP     TP +  PG  G  TP  P
Sbjct: 1377 TTPPAPAPGPT-TPPAPTPGPTTPPAPTPGGGGPSTPVSP 1415

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 38/92 (41%), Positives = 44/92 (47%), Gaps = 4/92 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQP---PAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
            PT PP  TP P   P   P   TPP  TP   TPP A TP    P T   PAP +    +
Sbjct: 1366 PTTPPAPTPGPTTPPAPAPGPTTPPAPTPGPTTPP-APTPGGGGPSTPVSPAPNTPSTPT 1424

Query: 175  PPAPTPASTPSTAPTPSTAGSPPAP-TPDSLG 267
             P P+  S PS    PS   +P  P +PD+LG
Sbjct: 1425 TPKPSQPSEPSQPSEPSQPETPAPPRSPDNLG 1456

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 38/108 (35%), Positives = 46/108 (42%), Gaps = 9/108 (8%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQP--PAAATPPTATPPTATP-------PAAATPPTATPPTATPPAP 153
            APT  PT  PAP   P  P A TP   TPP  TP       P +  P T + PT   P+ 
Sbjct: 1371 APTPGPTTPPAPAPGPTTPPAPTPGPTTPPAPTPGGGGPSTPVSPAPNTPSTPTTPKPSQ 1430

Query: 154  ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
             S P + P  P+   TP+   +P   G P  P        PS A + P
Sbjct: 1431 PSEP-SQPSEPSQPETPAPPRSPDNLGKPATPALPGRSLTPSQAPSAP 1477

[72][TOP]
>UniRef100_Q5JN60 Os01g0750600 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5JN60_ORYSJ
          Length = 682

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 46/103 (44%), Positives = 51/103 (49%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT--SP 177
           P  PP  TP P   PP +  PP  +PP  TPP   +PP  TPP  TPP P + P    SP
Sbjct: 32  PVSPPPVTPPPVTPPPVS--PPPVSPPPVTPP-PVSPPPVTPPPVTPPTPVAPPPVPPSP 88

Query: 178 PAPTPASTPST-APTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P PTP  TP T +P P    SPP P      P P    T PPP
Sbjct: 89  PPPTPTPTPVTPSPPPPVTPSPPPPV---ASPPPPDVPTAPPP 128

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/102 (40%), Positives = 49/102 (48%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P + P  TP P   PP  + PP   PP   PP   +PP  +PP  TPP  +  P T PP 
Sbjct: 16  PPQTPPVTPPPVTAPPPVSPPPVTPPPVTPPP--VSPPPVSPPPVTPPPVSPPPVTPPPV 73

Query: 184 --PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PTP + P   P+P     PP PTP  + P P    TP PP
Sbjct: 74  TPPTPVAPPPVPPSP----PPPTPTPTPVTPSPPPPVTPSPP 111

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 42/102 (41%), Positives = 50/102 (49%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPT--ATPPAAATPPTATPPTATPPAPASSPATSP 177
           P  PP  TP P + PP   TPP  TPPT  A PP   +PP  TP T TP  P+  P  +P
Sbjct: 52  PVSPPPVTPPPVSPPPV--TPPPVTPPTPVAPPPVPPSPPPPTP-TPTPVTPSPPPPVTP 108

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P P ++P     P+    PP+  P S  P PS     PPP
Sbjct: 109 SPPPPVASPPPPDVPT--APPPSNNPPSPPPSPSNVPASPPP 148

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 40/101 (39%), Positives = 48/101 (47%), Gaps = 2/101 (1%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATP-PAAATPPTATPPTATPPAPASSPATSPPA 183
           T PP   P P A PP   +PP   PPT TP P   +PP    P+  PP  +  P   P A
Sbjct: 69  TPPPVTPPTPVAPPPVPPSPP---PPTPTPTPVTPSPPPPVTPSPPPPVASPPPPDVPTA 125

Query: 184 PTPAST-PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P++  PS  P+PS   + P P   SL P       PPPP
Sbjct: 126 PPPSNNPPSPPPSPSNVPASPPPPRISLSP-------PPPP 159

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 38/96 (39%), Positives = 51/96 (53%), Gaps = 8/96 (8%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP----ASSPAT 171
           P  PP   P+P   PP     PT TP T +PP   T P+  PP A+PP P    A  P+ 
Sbjct: 78  PVAPPPVPPSP--PPPT----PTPTPVTPSPPPPVT-PSPPPPVASPPPPDVPTAPPPSN 130

Query: 172 SPPA--PTPASTPSTAPTPSTAGSPPAP--TPDSLG 267
           +PP+  P+P++ P++ P P  + SPP P  TP   G
Sbjct: 131 NPPSPPPSPSNVPASPPPPRISLSPPPPPSTPTQSG 166

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 28/78 (35%), Positives = 39/78 (50%), Gaps = 3/78 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPP---AAATPPTATPPTATPPAPASSPATSPPA 183
           PPT TP P    P     P+  PP A+PP       PP +  P + PP+P++ PA+ PP 
Sbjct: 90  PPTPTPTPVTPSPPPPVTPSPPPPVASPPPPDVPTAPPPSNNPPSPPPSPSNVPASPPPP 149

Query: 184 PTPASTPSTAPTPSTAGS 237
               S P    TP+ +G+
Sbjct: 150 RISLSPPPPPSTPTQSGA 167

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 29/72 (40%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +1

Query: 88  ATPPAAATPPTATPPTATPPAPASSPATSPP-APTPASTPSTAPTPSTAGSPPAPTPDSL 264
           + P   A PP  TPP   PP  A  P + PP  P P + P  +P P    SPP  TP  +
Sbjct: 7   SAPVTPAAPPPQTPPVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPV---SPPPVTPPPV 63

Query: 265 GPGPSGADTPPP 300
            P P    TPPP
Sbjct: 64  SPPPV---TPPP 72

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 33/81 (40%), Positives = 37/81 (45%), Gaps = 7/81 (8%)
 Frame = +1

Query: 82  PTATPPAAATPPT---ATPPTATPPAPASSPATSPP--APTPASTPSTAPTPSTAG--SP 240
           P+A    AA PP     TPP  T P P S P  +PP   P P S P  +P P T    SP
Sbjct: 6   PSAPVTPAAPPPQTPPVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPVSPPPVTPPPVSP 65

Query: 241 PAPTPDSLGPGPSGADTPPPP 303
           P  TP  + P    A  P PP
Sbjct: 66  PPVTPPPVTPPTPVAPPPVPP 86

[73][TOP]
>UniRef100_C5XK46 Putative uncharacterized protein Sb03g034710 n=1 Tax=Sorghum
           bicolor RepID=C5XK46_SORBI
          Length = 731

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 47/109 (43%), Positives = 59/109 (54%), Gaps = 8/109 (7%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P+ PP  TP+P   PPA+   P+ T P + PP A+ P  + P  A+PP PAS P  SPP
Sbjct: 87  SPSPPPPVTPSPP--PPASVPTPSPTLPASPPPPASVPTPSPPLPASPPPPASVPTPSPP 144

Query: 181 APT-----PASTPSTAPTP-STAGSPPAP--TPDSLGPGPSGADTPPPP 303
            P      P+S P++ P P S   SPP P   P S  P PS    PPPP
Sbjct: 145 PPVRRPPPPSSVPASPPPPDSVPSSPPPPNGVPASPAPPPSHLSVPPPP 193

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 42/103 (40%), Positives = 53/103 (51%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPP---TATPPAAATPPTATPPTATPPAPASSPATS 174
           P   PT +P   A PP  A+ PT +PP   +  PPA+   P+  PP   PP P+S PA+ 
Sbjct: 101 PASVPTPSPTLPASPPPPASVPTPSPPLPASPPPPASVPTPSPPPPVRRPPPPSSVPASP 160

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP   P S PS+ P P+   + PAP P  L   P     PPPP
Sbjct: 161 PP---PDSVPSSPPPPNGVPASPAPPPSHLSVPP-----PPPP 195

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 43/114 (37%), Positives = 54/114 (47%), Gaps = 13/114 (11%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQ-------PPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS 159
           APT P T +P+P A        P  A  PPT +P   TP      P+  PPT  P  P  
Sbjct: 5   APTPPATPSPSPPAPVTPTPSPPSPAPVPPTPSPQPPTPAPVPPTPSTIPPTPAPVPPTP 64

Query: 160 SP-----ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL-GPGPSGADTPPPP 303
           SP     A  PP PTP+  P  +P+P    +P  P P S+  P P+   +PPPP
Sbjct: 65  SPIPPTPAPVPPTPTPSPPPPPSPSPPPPVTPSPPPPASVPTPSPTLPASPPPP 118

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/106 (38%), Positives = 50/106 (47%), Gaps = 9/106 (8%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATP------PTATPPTATP---PAAATPPTATPPTATPPAPASSP 165
           PPT +P P    P   TP      P   PPT +P     A  PPT TP    PP+P+  P
Sbjct: 33  PPTPSPQPPTPAPVPPTPSTIPPTPAPVPPTPSPIPPTPAPVPPTPTPSPPPPPSPSPPP 92

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             +P  P PAS P+ +PT   +  PPA  P    P P    +PPPP
Sbjct: 93  PVTPSPPPPASVPTPSPTLPASPPPPASVPT---PSPPLPASPPPP 135

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 46/116 (39%), Positives = 54/116 (46%), Gaps = 19/116 (16%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP--------PT------ATPPA 150
           PPT +P P   P  A  PPT TP    PP+ + PP  TP        PT      A+PP 
Sbjct: 61  PPTPSPIP---PTPAPVPPTPTPSPPPPPSPSPPPPVTPSPPPPASVPTPSPTLPASPPP 117

Query: 151 PASSPATSPPAPTPASTPSTAPTPS-----TAGSPPAPTPDSLGPGPSGADTPPPP 303
           PAS P  SPP P     P++ PTPS         PP+  P S  P  S   +PPPP
Sbjct: 118 PASVPTPSPPLPASPPPPASVPTPSPPPPVRRPPPPSSVPASPPPPDSVPSSPPPP 173

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 44/102 (43%), Positives = 54/102 (52%), Gaps = 1/102 (0%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P   P ATP+P   PPA  T PT +PP+  P     PPT +P   TP     +P+T PP
Sbjct: 3   SPAPTPPATPSPS--PPAPVT-PTPSPPSPAP----VPPTPSPQPPTPAPVPPTPSTIPP 55

Query: 181 APTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   TPS  P P+ A  PP PTP    P P  + +PPPP
Sbjct: 56  TPAPVPPTPSPIP-PTPAPVPPTPTP---SPPPPPSPSPPPP 93

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 42/105 (40%), Positives = 50/105 (47%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAAT-PPTATP----PTATPPAAATPPTATPPTATPPAPASSPA 168
           P  P T  P P   PP  +  PPT  P    PT +PP   +P    P T +PP PAS P 
Sbjct: 47  PPTPSTIPPTPAPVPPTPSPIPPTPAPVPPTPTPSPPPPPSPSPPPPVTPSPPPPASVPT 106

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            SP  P     P++ PTPS    P +P P +  P PS    PPPP
Sbjct: 107 PSPTLPASPPPPASVPTPSPP-LPASPPPPASVPTPS----PPPP 146

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 42/107 (39%), Positives = 54/107 (50%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAA-TPPTATPPTATP---PAAATPPTATPPTATPPAPASSPAT 171
           P  P    P P   PP  A  PPT +P   TP   P   TP    PP+ +PP P  +P+ 
Sbjct: 40  PPTPAPVPPTPSTIPPTPAPVPPTPSPIPPTPAPVPPTPTPSPPPPPSPSPPPPV-TPSP 98

Query: 172 SPPA--PTPAST-PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PPA  PTP+ T P++ P P++  +P  P P S  P P+   TP PP
Sbjct: 99  PPPASVPTPSPTLPASPPPPASVPTPSPPLPAS-PPPPASVPTPSPP 144

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 30/96 (31%), Positives = 46/96 (47%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           A   PP + P P    PA+  PP + P  + PP    PP  +   A+PP P S P++ PP
Sbjct: 113 ASPPPPASVPTPSPPLPASPPPPASVPTPSPPPPVRRPPPPSSVPASPPPPDSVPSSPPP 172

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
                ++P+  P+  +   PP P P +  P  S ++
Sbjct: 173 PNGVPASPAPPPSHLSVPPPPPPAPSTSSPSKSSSN 208

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 36/84 (42%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +1

Query: 58  ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT-SPPAPTPASTPSTAPTPSTAG 234
           ++P    P T +P    +PP    PT +PP+PA  P T SP  PTPA  P   PTPST  
Sbjct: 2   SSPAPTPPATPSP----SPPAPVTPTPSPPSPAPVPPTPSPQPPTPAPVP---PTPSTIP 54

Query: 235 SPPAPTPDSLGP-GPSGADTPPPP 303
             PAP P +  P  P+ A  PP P
Sbjct: 55  PTPAPVPPTPSPIPPTPAPVPPTP 78

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 28/81 (34%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP--PAPASSPATS 174
           A   PP + P P   PP    PP ++ P + PP  + P +  PP   P  PAP  S  + 
Sbjct: 130 ASPPPPASVPTPSPPPPVRRPPPPSSVPASPPPPDSVPSSPPPPNGVPASPAPPPSHLSV 189

Query: 175 PPAPTPASTPSTAPTPSTAGS 237
           PP P PA + S+    S+ G+
Sbjct: 190 PPPPPPAPSTSSPSKSSSNGT 210

[74][TOP]
>UniRef100_B9SG43 Copper ion binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9SG43_RICCO
          Length = 238

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 53/110 (48%), Positives = 60/110 (54%), Gaps = 11/110 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATP-PTATPPAAATPPTATPPTA------TPPA--PA 156
           P KP T   AP + PPA A    A P P ATPPAAA  P ++PP A      TPPA  PA
Sbjct: 58  PAKPTTPVAAPVSSPPATAPSKQAVPAPVATPPAAAVTPVSSPPAAAVTPVSTPPAATPA 117

Query: 157 SSPATSPPAPTP--ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            SPA SPP+P P  A+ P     P TA  PPAP P +    P+ AD P P
Sbjct: 118 KSPAKSPPSPAPVAATPPPATSAPETA--PPAPVPVA---APTAADVPAP 162

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 51/106 (48%), Positives = 59/106 (55%), Gaps = 6/106 (5%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP-PTATPPAPASSPATSP 177
           AP KP     AP + PPA  T P A P  ++PPA A    A P P ATPPA A +P +SP
Sbjct: 42  APAKPEAPVAAPVSSPPAKPTTPVAAP-VSSPPATAPSKQAVPAPVATPPAAAVTPVSSP 100

Query: 178 PAP--TPASTPSTA-PTPSTAGSPPAPTPDSLGPGP--SGADTPPP 300
           PA   TP STP  A P  S A SPP+P P +  P P  S  +T PP
Sbjct: 101 PAAAVTPVSTPPAATPAKSPAKSPPSPAPVAATPPPATSAPETAPP 146

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 50/118 (42%), Positives = 60/118 (50%), Gaps = 17/118 (14%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTA------TPPAAA-------TPPTATPPTAT 141
           AP+K   A PAP A PPAAA  P ++PP A      TPPAA        +PP+  P  AT
Sbjct: 76  APSKQ--AVPAPVATPPAAAVTPVSSPPAAAVTPVSTPPAATPAKSPAKSPPSPAPVAAT 133

Query: 142 PPAPASSPATSPPAPTPASTPST----APTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP   S+P T+PPAP P + P+     APTPS           S  PGP  +  P PP
Sbjct: 134 PPPATSAPETAPPAPVPVAAPTAADVPAPTPSKKKPKKHSHATSPAPGPDVSSPPAPP 191

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 50/122 (40%), Positives = 60/122 (49%), Gaps = 30/122 (24%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPA--AATPPTATPPTATPPAPASSPATSPPAP 186
           PP A   P + PPAAA  P +TPP ATP    A +PP+  P  ATPP   S+P T+PPAP
Sbjct: 89  PPAAAVTPVSSPPAAAVTPVSTPPAATPAKSPAKSPPSPAPVAATPPPATSAPETAPPAP 148

Query: 187 TPASTPSTA----PTPST-----------------AGSPPAPTPDSLGP-------GPSG 282
            P + P+ A    PTPS                    SPPAP  ++ GP       GPS 
Sbjct: 149 VPVAAPTAADVPAPTPSKKKPKKHSHATSPAPGPDVSSPPAPPMEAPGPSLDASSPGPSV 208

Query: 283 AD 288
           AD
Sbjct: 209 AD 210

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 36/106 (33%), Positives = 46/106 (43%), Gaps = 19/106 (17%)
 Frame = +1

Query: 43  QPPAAATPPTATPPTATPPAAATPPTA--TPPTATPPA----PASSPATSPPA------- 183
           Q P+AA   T   P   P  A   P A    P ++PPA    P ++P +SPPA       
Sbjct: 22  QSPSAAPTTTPAKPVTAPAKAPAKPEAPVAAPVSSPPAKPTTPVAAPVSSPPATAPSKQA 81

Query: 184 -PTPASTPSTA-----PTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P +TP  A      +P  A   P  TP +  P  S A +PP P
Sbjct: 82  VPAPVATPPAAAVTPVSSPPAAAVTPVSTPPAATPAKSPAKSPPSP 127

[75][TOP]
>UniRef100_B9H3S0 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9H3S0_POPTR
          Length = 686

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 48/105 (45%), Positives = 60/105 (57%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ P  ATP P++ PPA   PP A+PP   PP+   P T  PP   PP+P +SP  +PPA
Sbjct: 21  PSNP--ATPPPQSPPPA---PPAASPPAPPPPSPIIPSTP-PPFPPPPSPPASPPPAPPA 74

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT-----PPPP 303
            TP S P TAP P++  +PP P P S  P P  + T     PPPP
Sbjct: 75  LTPPS-PPTAPPPASTTAPPPPPPISTSPPPRASPTTPVTSPPPP 118

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 45/107 (42%), Positives = 52/107 (48%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS---PATS 174
           P  PP + PA     P A TPP+  PPTA PPA+ T P   PP +T P P +S   P TS
Sbjct: 57  PFPPPPSPPASPPPAPPALTPPS--PPTAPPPASTTAPPPPPPISTSPPPRASPTTPVTS 114

Query: 175 PPAPTPAS----TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP P   S     P+  P P    SPP PT       P+    PPPP
Sbjct: 115 PPPPQAVSPSPPPPANDPIPPATNSPPPPTEKPPESPPALPTVPPPP 161

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 49/118 (41%), Positives = 62/118 (52%), Gaps = 18/118 (15%)
 Frame = +1

Query: 4   PTKPPTATPA--PKAQPPAAAT--------PPTATPPTATPPA--AATPPTATPPTATPP 147
           P  PP A PA  P A PP +          PP  +PP + PPA  A TPP+  PPTA PP
Sbjct: 29  PQSPPPAPPAASPPAPPPPSPIIPSTPPPFPPPPSPPASPPPAPPALTPPS--PPTAPPP 86

Query: 148 APASSP------ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           A  ++P      +TSPP     +TP T+P P  A S P+P P +  P P   ++PPPP
Sbjct: 87  ASTTAPPPPPPISTSPPPRASPTTPVTSPPPPQAVS-PSPPPPANDPIPPATNSPPPP 143

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4   PTKPPTATPA------PKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSP 165
           P  PP A PA      P A PPA+ T P   PP +T P     PT TP T+ PP  A SP
Sbjct: 65  PASPPPAPPALTPPSPPTAPPPASTTAPPPPPPISTSPPPRASPT-TPVTSPPPPQAVSP 123

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAP--TPDSLGPGPSGADTPPPP 303
           +  PPA  P    + +P P T   P +P   P    P PS     PPP
Sbjct: 124 SPPPPANDPIPPATNSPPPPTEKPPESPPALPTVPPPPPSSQSDSPPP 171

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 47/119 (39%), Positives = 56/119 (47%), Gaps = 21/119 (17%)
 Frame = +1

Query: 4   PTKPPTA-TPAPKAQPPAAATPPT----ATPPTATPPAAATPPTATPP--------TATP 144
           PT PP A T AP   PP + +PP      TP T+ PP  A  P+  PP        T +P
Sbjct: 81  PTAPPPASTTAPPPPPPISTSPPPRASPTTPVTSPPPPQAVSPSPPPPANDPIPPATNSP 140

Query: 145 PAPASSPATSPPA-----PTPASTPSTAPTPSTAGSPPAPTPDSLGPG---PSGADTPP 297
           P P   P  SPPA     P P S+ S +P P+T  SPP P      P    PS + TPP
Sbjct: 141 PPPTEKPPESPPALPTVPPPPPSSQSDSPPPTT-NSPPPPISTLQSPPPSIPSTSSTPP 198

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/93 (39%), Positives = 46/93 (49%), Gaps = 13/93 (13%)
 Frame = +1

Query: 64  PPTATPPTAT--PPAAATP--PTATPPTATPPAP--ASSPATSPPAPTPASTPSTAPTPS 225
           PP+ + P  T  PP  +TP  P   PP + PPAP  AS PA  PP+P   STP   P P 
Sbjct: 3   PPSTSQPDQTIDPPLPSTPSNPATPPPQSPPPAPPAASPPAPPPPSPIIPSTPPPFPPPP 62

Query: 226 TAGSPPAPTPDSL-------GPGPSGADTPPPP 303
           +  + P P P +L        P P+    PPPP
Sbjct: 63  SPPASPPPAPPALTPPSPPTAPPPASTTAPPPP 95

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 46/118 (38%), Positives = 56/118 (47%), Gaps = 17/118 (14%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTAT---PPAAATPPTATPPTAT-PPAPASSPA 168
           +PT P T+ P P+A  P+   P     P AT   PP    PP + P   T PP P SS +
Sbjct: 107 SPTTPVTSPPPPQAVSPSPPPPANDPIPPATNSPPPPTEKPPESPPALPTVPPPPPSSQS 166

Query: 169 TSPPAPT-------------PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            SPP  T             P S PST+ TP  A SPPAP  +S     +G+ TPP P
Sbjct: 167 DSPPPTTNSPPPPISTLQSPPPSIPSTSSTP-PAISPPAPPVNS---SVTGSPTPPFP 220

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 42/114 (36%), Positives = 52/114 (45%), Gaps = 15/114 (13%)
 Frame = +1

Query: 4   PTKPPTAT-PAPKAQPPAAAT---PPTATPPTATPPAAATPPTAT----PPTATPP-APA 156
           P  PP +T P P+A P    T   PP A  P+  PPA    P AT    PPT  PP +P 
Sbjct: 93  PPPPPISTSPPPRASPTTPVTSPPPPQAVSPSPPPPANDPIPPATNSPPPPTEKPPESPP 152

Query: 157 SSPATSPPAPT------PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           + P   PP P+      P +T S  P  ST  SPP   P +    P+ +   PP
Sbjct: 153 ALPTVPPPPPSSQSDSPPPTTNSPPPPISTLQSPPPSIPSTSSTPPAISPPAPP 206

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 34/104 (32%), Positives = 46/104 (44%), Gaps = 8/104 (7%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAAT---PPTATPPTATPPAAATPPTA-----TPPTATPPAPA 156
           A   PP  T  P   PPA  T   PP ++   + PP   +PP       +PP + P   +
Sbjct: 136 ATNSPPPPTEKPPESPPALPTVPPPPPSSQSDSPPPTTNSPPPPISTLQSPPPSIPSTSS 195

Query: 157 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
           + PA SPPAP   S+ + +PTP     P  PT        +G D
Sbjct: 196 TPPAISPPAPPVNSSVTGSPTPP---FPAIPTEKPTARATNGTD 236

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 33/96 (34%), Positives = 46/96 (47%), Gaps = 6/96 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQ----PPAAATPPTATPPTATPPAAATPPTATPPTATPPA-PASSPA 168
           PT PP   P P +Q    PP   +PP       +PP +    ++TPP  +PPA P +S  
Sbjct: 155 PTVPP---PPPSSQSDSPPPTTNSPPPPISTLQSPPPSIPSTSSTPPAISPPAPPVNSSV 211

Query: 169 TSPPAPTPASTPSTAPTP-STAGSPPAPTPDSLGPG 273
           T  P P   + P+  PT  +T G+  +    S GPG
Sbjct: 212 TGSPTPPFPAIPTEKPTARATNGTDVSTNTSSTGPG 247

[76][TOP]
>UniRef100_A4S1Y9 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901
           RepID=A4S1Y9_OSTLU
          Length = 1065

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 42/101 (41%), Positives = 54/101 (53%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP-PTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           PT  PT TP+P   PP +  P P  +PP + PP+    P  +PP + PP+P S P + PP
Sbjct: 471 PTPTPTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPP 530

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P+  PS  P PS   SPP   P S  P P  +  P PP
Sbjct: 531 SPPPSPPPS--PPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 569

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 42/101 (41%), Positives = 54/101 (53%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           APT  PT TP P + PP+    P  +PP + PP+    P  +PP + PP+P  SP + PP
Sbjct: 468 APTPTPTPTPTP-SPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPP 526

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P+  PS  P PS   SPP   P S  P P  +  P PP
Sbjct: 527 SPPPSPPPS--PPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 565

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 39/101 (38%), Positives = 55/101 (54%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP-PTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P+ PP+  P+P   PP +  P P  +PP + PP+    P  +PP+  P  P S P + PP
Sbjct: 479 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPP 538

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +P P+  PS  P+P  +  PP+P P    P PS   +PPPP
Sbjct: 539 SPPPSPPPSPPPSPPPS-PPPSPPP---SPPPSPPPSPPPP 575

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 41/102 (40%), Positives = 55/102 (53%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPT--ATPPAAATPPTATPPTATPPAPASSPATSP 177
           P+ PP+  P+P   PP +  PP + PP+   +PP +  P   +PP + PP+P  SP  SP
Sbjct: 483 PSPPPSPPPSPPPSPPPS--PPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSP 540

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P+P  +P  +P PS   SPP   P S  P P     PPPP
Sbjct: 541 P-PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP-----PPPP 576

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/97 (42%), Positives = 48/97 (49%), Gaps = 1/97 (1%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATP-PTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           P A  A  A P    TP PT +PP + PP+    P  +PP + PP+P  SP  SPP   P
Sbjct: 459 PNAAAALAAAPTPTPTPTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 518

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            S PS  P PS   SPP   P S  P P  +  P PP
Sbjct: 519 PSPPS--PPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 553

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 38/95 (40%), Positives = 46/95 (48%), Gaps = 1/95 (1%)
 Frame = +1

Query: 22  ATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPAST 201
           A  AP A    AA P     PT TP    +PP + PP+  P  P S P + PP+P P+  
Sbjct: 455 AVLAPNAAAALAAAPTPTPTPTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 514

Query: 202 PSTAPT-PSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PS  P+ PS   SPP   P S  P P  +  P PP
Sbjct: 515 PSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 549

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 30/82 (36%), Positives = 44/82 (53%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP+  P+P   PP +   P  +PP + PP+    P  +PP + PP+P  SP  SPP 
Sbjct: 503 PSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP- 561

Query: 184 PTPASTPSTAPTPSTAGSPPAP 249
           P+P  +P  +P P    +P  P
Sbjct: 562 PSPPPSPPPSPPPPPHFAPFVP 583

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 30/79 (37%), Positives = 42/79 (53%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP+  P+P + PP+    P  +PP + PP+    P  +PP + PP+P  SP  SPP 
Sbjct: 511 PSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP- 569

Query: 184 PTPASTPSTAPTPSTAGSP 240
           P+P   P  AP    A  P
Sbjct: 570 PSPPPPPHFAPFVPLASVP 588

[77][TOP]
>UniRef100_Q5ASL5 Putative uncharacterized protein n=1 Tax=Emericella nidulans
           RepID=Q5ASL5_EMENI
          Length = 1186

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 45/101 (44%), Positives = 48/101 (47%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PPTA+  P   PPA  TP    PP   PP  A+     PP   PPAP SS    PP 
Sbjct: 456 PVPPPTASVPPPPPPPARPTPTVTGPPPPPPPPPASSGPPMPPPPPPPAPGSSAPPPPPP 515

Query: 184 PTP-ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P A  P   P P  AG+PP P P      P GA  PPPP
Sbjct: 516 PPPGAGAPPPPPPPPGAGAPPPPPP------PPGAGAPPPP 550

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 46/105 (43%), Positives = 52/105 (49%), Gaps = 6/105 (5%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTAT-PPTATPPAAATPPTATPPTATPPAPASS-----PA 168
           ++PP   P P A  P    PPTA+ PP   PPA  TP    PP   PP PASS     P 
Sbjct: 442 SQPPPPPPVPGASRPVP--PPTASVPPPPPPPARPTPTVTGPPPPPPPPPASSGPPMPPP 499

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PPAP  ++ P   P P  AG+PP P P      P GA  PPPP
Sbjct: 500 PPPPAPGSSAPPPPPPPPPGAGAPPPPPP------PPGAGAPPPP 538

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/105 (39%), Positives = 46/105 (43%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQ-PPAAATPPTAT--PPTATPPAAATPPTATPPTATPPAPASSPATS 174
           P  PP A P P    PP    PP A+  PP   PP    P ++ PP   PP P +     
Sbjct: 466 PPPPPPARPTPTVTGPPPPPPPPPASSGPPMPPPPPPPAPGSSAPPPPPPPPPGAGAPPP 525

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLG--PGPSGADTPPPP 303
           PP P  A  P   P P  AG+PP P P   G  P P G   PP P
Sbjct: 526 PPPPPGAGAPPPPPPPPGAGAPPPPPPPGAGAPPPPPGGAAPPLP 570

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 43/113 (38%), Positives = 50/113 (44%), Gaps = 12/113 (10%)
 Frame = +1

Query: 1   APTKPPTATPA-PKAQPPAAATPPTATPPTATPPAAA-----TPPTATPPTATPPAPASS 162
           AP  PP+ +PA P   PP  A+P  ATPP   P   A      PP    P + PP P   
Sbjct: 393 APPAPPSRSPAGPPPPPPRTASP--ATPPQLPPKVPAFSSGPPPPPPRSPASQPPPPPPV 450

Query: 163 PATSPPAPTPAST------PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P  S P P P ++      P   PTP+  G PP P P     GP     PPPP
Sbjct: 451 PGASRPVPPPTASVPPPPPPPARPTPTVTGPPPPPPPPPASSGPPMPPPPPPP 503

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 40/105 (38%), Positives = 48/105 (45%), Gaps = 10/105 (9%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPP----------TATPPAPASSPA 168
           +A PAP ++ PA   PP        PP  A+P  ATPP          +  PP P  SPA
Sbjct: 392 SAPPAPPSRSPAGPPPP--------PPRTASP--ATPPQLPPKVPAFSSGPPPPPPRSPA 441

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           + PP P P    S    P TA  PP P P +  P P+    PPPP
Sbjct: 442 SQPPPPPPVPGASRPVPPPTASVPPPPPPPA-RPTPTVTGPPPPP 485

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 42/112 (37%), Positives = 51/112 (45%), Gaps = 17/112 (15%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATPPTATPPAA----ATPPTATPP-------TATPPAPAS-S 162
           TA  AP A+P AA+      PP   PP A    A P    PP        + PPAP S S
Sbjct: 342 TAGQAPPARPRAASGATPGPPPPPRPPKAPVDDAPPRFGVPPPFQGERKVSAPPAPPSRS 401

Query: 163 PATSPPAPTPASTPSTAP-----TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PA  PP P   ++P+T P      P+ +  PP P P S    P+    PPPP
Sbjct: 402 PAGPPPPPPRTASPATPPQLPPKVPAFSSGPPPPPPRS----PASQPPPPPP 449

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 32/86 (37%), Positives = 36/86 (41%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTA-TPPAPASSPATSP 177
           A + PP   P P   P ++A PP   PP   P A A PP   PP A  PP P   P    
Sbjct: 490 ASSGPPMPPPPPPPAPGSSAPPP---PPPPPPGAGAPPPPPPPPGAGAPPPPPPPPGAGA 546

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTP 255
           P P P       P P    +PP P P
Sbjct: 547 PPPPPPPGAGAPPPPPGGAAPPLPQP 572

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 29/77 (37%), Positives = 29/77 (37%), Gaps = 3/77 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPP---AAATPPTATPPTATPPAPASSPATS 174
           P  PP   P   A PP    PP A  P   PP   A A PP   PP A  P P   P   
Sbjct: 497 PPPPPPPAPGSSAPPPPPPPPPGAGAPPPPPPPPGAGAPPPPPPPPGAGAPPPPPPPGAG 556

Query: 175 PPAPTPASTPSTAPTPS 225
            P P P       P PS
Sbjct: 557 APPPPPGGAAPPLPQPS 573

[78][TOP]
>UniRef100_C8VA31 Putative uncharacterized protein n=1 Tax=Aspergillus nidulans FGSC
           A4 RepID=C8VA31_EMENI
          Length = 657

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 45/101 (44%), Positives = 48/101 (47%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PPTA+  P   PPA  TP    PP   PP  A+     PP   PPAP SS    PP 
Sbjct: 456 PVPPPTASVPPPPPPPARPTPTVTGPPPPPPPPPASSGPPMPPPPPPPAPGSSAPPPPPP 515

Query: 184 PTP-ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P A  P   P P  AG+PP P P      P GA  PPPP
Sbjct: 516 PPPGAGAPPPPPPPPGAGAPPPPPP------PPGAGAPPPP 550

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 46/105 (43%), Positives = 52/105 (49%), Gaps = 6/105 (5%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTAT-PPTATPPAAATPPTATPPTATPPAPASS-----PA 168
           ++PP   P P A  P    PPTA+ PP   PPA  TP    PP   PP PASS     P 
Sbjct: 442 SQPPPPPPVPGASRPVP--PPTASVPPPPPPPARPTPTVTGPPPPPPPPPASSGPPMPPP 499

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PPAP  ++ P   P P  AG+PP P P      P GA  PPPP
Sbjct: 500 PPPPAPGSSAPPPPPPPPPGAGAPPPPPP------PPGAGAPPPP 538

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/105 (39%), Positives = 46/105 (43%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQ-PPAAATPPTAT--PPTATPPAAATPPTATPPTATPPAPASSPATS 174
           P  PP A P P    PP    PP A+  PP   PP    P ++ PP   PP P +     
Sbjct: 466 PPPPPPARPTPTVTGPPPPPPPPPASSGPPMPPPPPPPAPGSSAPPPPPPPPPGAGAPPP 525

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLG--PGPSGADTPPPP 303
           PP P  A  P   P P  AG+PP P P   G  P P G   PP P
Sbjct: 526 PPPPPGAGAPPPPPPPPGAGAPPPPPPPGAGAPPPPPGGAAPPLP 570

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 43/113 (38%), Positives = 50/113 (44%), Gaps = 12/113 (10%)
 Frame = +1

Query: 1   APTKPPTATPA-PKAQPPAAATPPTATPPTATPPAAA-----TPPTATPPTATPPAPASS 162
           AP  PP+ +PA P   PP  A+P  ATPP   P   A      PP    P + PP P   
Sbjct: 393 APPAPPSRSPAGPPPPPPRTASP--ATPPQLPPKVPAFSSGPPPPPPRSPASQPPPPPPV 450

Query: 163 PATSPPAPTPAST------PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P  S P P P ++      P   PTP+  G PP P P     GP     PPPP
Sbjct: 451 PGASRPVPPPTASVPPPPPPPARPTPTVTGPPPPPPPPPASSGPPMPPPPPPP 503

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 40/105 (38%), Positives = 48/105 (45%), Gaps = 10/105 (9%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPP----------TATPPAPASSPA 168
           +A PAP ++ PA   PP        PP  A+P  ATPP          +  PP P  SPA
Sbjct: 392 SAPPAPPSRSPAGPPPP--------PPRTASP--ATPPQLPPKVPAFSSGPPPPPPRSPA 441

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           + PP P P    S    P TA  PP P P +  P P+    PPPP
Sbjct: 442 SQPPPPPPVPGASRPVPPPTASVPPPPPPPA-RPTPTVTGPPPPP 485

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 42/112 (37%), Positives = 51/112 (45%), Gaps = 17/112 (15%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATPPTATPPAA----ATPPTATPP-------TATPPAPAS-S 162
           TA  AP A+P AA+      PP   PP A    A P    PP        + PPAP S S
Sbjct: 342 TAGQAPPARPRAASGATPGPPPPPRPPKAPVDDAPPRFGVPPPFQGERKVSAPPAPPSRS 401

Query: 163 PATSPPAPTPASTPSTAP-----TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PA  PP P   ++P+T P      P+ +  PP P P S    P+    PPPP
Sbjct: 402 PAGPPPPPPRTASPATPPQLPPKVPAFSSGPPPPPPRS----PASQPPPPPP 449

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 32/86 (37%), Positives = 36/86 (41%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTA-TPPAPASSPATSP 177
           A + PP   P P   P ++A PP   PP   P A A PP   PP A  PP P   P    
Sbjct: 490 ASSGPPMPPPPPPPAPGSSAPPP---PPPPPPGAGAPPPPPPPPGAGAPPPPPPPPGAGA 546

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTP 255
           P P P       P P    +PP P P
Sbjct: 547 PPPPPPPGAGAPPPPPGGAAPPLPQP 572

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 29/77 (37%), Positives = 29/77 (37%), Gaps = 3/77 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPP---AAATPPTATPPTATPPAPASSPATS 174
           P  PP   P   A PP    PP A  P   PP   A A PP   PP A  P P   P   
Sbjct: 497 PPPPPPPAPGSSAPPPPPPPPPGAGAPPPPPPPPGAGAPPPPPPPPGAGAPPPPPPPGAG 556

Query: 175 PPAPTPASTPSTAPTPS 225
            P P P       P PS
Sbjct: 557 APPPPPGGAAPPLPQPS 573

[79][TOP]
>UniRef100_B8PFG8 Predicted protein n=1 Tax=Postia placenta Mad-698-R
           RepID=B8PFG8_POSPM
          Length = 476

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 47/110 (42%), Positives = 51/110 (46%), Gaps = 9/110 (8%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA-PASSPATSP 177
           AP  PP A P P     AA TPP +  PT    AA TPP +  PT  PPA P   P  +P
Sbjct: 243 APPPPPAAAPRPSPPRSAAPTPPRSAAPTPPRSAAPTPPRSAAPTPAPPAPPPPRPTAAP 302

Query: 178 PAPTPAST--------PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PAP P           P T P P + G PP P      P PSG   PPPP
Sbjct: 303 PAPPPPPARPAVAPPPPPTRPAPPSGGPPPPPP-----PAPSGGPPPPPP 347

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 47/107 (43%), Positives = 54/107 (50%), Gaps = 6/107 (5%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-PTATPPTATPPAPASSPATSP 177
           APT P +A P P     AA TPP +  PT  PPA   P PTA PP   PP P + PA +P
Sbjct: 261 APTPPRSAAPTPPRS--AAPTPPRSAAPTPAPPAPPPPRPTAAPP--APPPPPARPAVAP 316

Query: 178 PAP-----TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P      P+  P   P P+ +G PP P P    P   GA  PPPP
Sbjct: 317 PPPPTRPAPPSGGPPPPPPPAPSGGPPPPPPPPPPPPAGGAPPPPPP 363

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 51/106 (48%), Positives = 54/106 (50%), Gaps = 5/106 (4%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATP-PTATPPTATPPAAATPPTATPPTATPPAPASS--PAT 171
           APT P +A P P   PPA   P PTA PP A PP  A P  A PP  T PAP S   P  
Sbjct: 277 APTPPRSAAPTPA--PPAPPPPRPTAAPP-APPPPPARPAVAPPPPPTRPAPPSGGPPPP 333

Query: 172 SPPAPT--PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PPAP+  P   P   P P   G+PP P P    P PSG   PPPP
Sbjct: 334 PPPAPSGGPPPPPPPPPPPPAGGAPPPPPPPP--PPPSGGMPPPPP 377

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 44/112 (39%), Positives = 49/112 (43%), Gaps = 15/112 (13%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP---A 183
           PP   P     PP A  PP A  P  +PP +A P   TPP +  P P  S A +PP   A
Sbjct: 229 PPPPAPLRHRPPPQAPPPPPAAAPRPSPPRSAAP---TPPRSAAPTPPRSAAPTPPRSAA 285

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPG------------PSGADTPPPP 303
           PTPA  P   P P    +PPAP P    P             PSG   PPPP
Sbjct: 286 PTPA--PPAPPPPRPTAAPPAPPPPPARPAVAPPPPPTRPAPPSGGPPPPPP 335

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 35/100 (35%), Positives = 40/100 (40%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P +P  A P P  +P     PP+  PP   PPA +  P   PP   PP    +P   PP 
Sbjct: 309 PARPAVAPPPPPTRP----APPSGGPPPPPPPAPSGGPPPPPPPPPPPPAGGAPPPPPPP 364

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S     P       PP P P    PGPS     P P
Sbjct: 365 PPPPSGGMPPP-------PPPPPPAGGSPGPSAGLPAPAP 397

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/94 (37%), Positives = 39/94 (41%), Gaps = 6/94 (6%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPP------AAATPPTATPPTATPPAAATPPTATPPTATPPAPASS 162
           AP  PPT    P   PP       +  PP   PP   PPA   PP   PP   PP P+  
Sbjct: 315 APPPPPTRPAPPSGGPPPPPPPAPSGGPPPPPPPPPPPPAGGAPP---PPPPPPPPPSGG 371

Query: 163 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL 264
               PP P PA     +P PS     PAP  D+L
Sbjct: 372 MPPPPPPPPPA---GGSPGPSAGLPAPAPGRDAL 402

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 39/98 (39%), Positives = 45/98 (45%), Gaps = 10/98 (10%)
 Frame = +1

Query: 40  AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP---APTPASTPST 210
           AQ  A A P     P   PP  A      PP A PP PA++P  SPP   APTP  + + 
Sbjct: 214 AQKSAPAPPAAKKKP---PPPPAPLRHRPPPQAPPPPPAAAPRPSPPRSAAPTPPRSAAP 270

Query: 211 APTPSTAGSPP---APTPDSLGPGP----SGADTPPPP 303
            P  S A +PP   APTP    P P    +    PPPP
Sbjct: 271 TPPRSAAPTPPRSAAPTPAPPAPPPPRPTAAPPAPPPP 308

[80][TOP]
>UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E1896
          Length = 695

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 45/101 (44%), Positives = 45/101 (44%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP- 180
           P  PP   P P   PPA A PP   PP   PP  A PP   PP   PPAP   PA  PP 
Sbjct: 601 PPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPP 660

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           AP P   P   P P     PPAP P    P P     PPPP
Sbjct: 661 APAPPPAPPPPPPP-----PPAPPPP---PAPPPPPAPPPP 693

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 40/96 (41%), Positives = 44/96 (45%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           P +  P P   PPA A PP   PP   PP A  PP   PP   PP P + P   PPAP P
Sbjct: 596 PQSPGPPP---PPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPP 652

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
              P   P P+   +PP P P    P P  A  PPP
Sbjct: 653 PPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPP 688

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 45/101 (44%), Positives = 49/101 (48%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP   PAP   PPA A P  A PP   PP    PP A PP   PPAP   P  +PP
Sbjct: 598 SPGPPPPPAPAP---PPAPAPPAPAPPPAPPPPPPPPPPPAPPP---PPAPPPPPPPAPP 651

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P PA  P  AP P  A  PP P P +  P P+    P PP
Sbjct: 652 PP-PAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPP 691

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 43/86 (50%), Positives = 43/86 (50%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPA-TSP 177
           AP  PP   P P   PP A  PP A PP   PP A  PP A PP   PPAPA  PA   P
Sbjct: 617 APAPPPAPPPPPPPPPPPAPPPPPAPPPP--PPPAPPPPPAPPP---PPAPAPPPAPPPP 671

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTP 255
           P P PA  P  AP P     PPAP P
Sbjct: 672 PPPPPAPPPPPAPPP-----PPAPPP 692

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 35/91 (38%), Positives = 39/91 (42%)
 Frame = +1

Query: 31  APKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPST 210
           A    P +   PP   PP   PP A  PP   PP A PP P   P   PPAP P   P  
Sbjct: 591 AESMMPQSPGPPP---PPAPAPPPAPAPPAPAPPPAPPPPP---PPPPPPAPPPPPAPPP 644

Query: 211 APTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P+    P  P P +  P P+    PPPP
Sbjct: 645 PPPPAPPPPPAPPPPPAPAPPPAPPPPPPPP 675

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 29/74 (39%), Positives = 31/74 (41%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP A  PP A  P   PP P   P   PP 
Sbjct: 622 PAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPP 681

Query: 184 PTPASTPSTAPTPS 225
           P P   P+  P P+
Sbjct: 682 PAPPPPPAPPPPPA 695

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 29/62 (46%), Positives = 30/62 (48%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           AP  PP   P P   PPA   PP   PP A  P  A PP   PP A PP PA  P  +PP
Sbjct: 635 APPPPPAPPPPP---PPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPP 691

Query: 181 AP 186
            P
Sbjct: 692 PP 693

[81][TOP]
>UniRef100_Q91GH4 Putative uncharacterized protein n=1 Tax=Epiphyas postvittana NPV
           RepID=Q91GH4_NPVEP
          Length = 234

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 46/107 (42%), Positives = 61/107 (57%), Gaps = 7/107 (6%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP- 177
           +PT  PT +P P   P  + TPP +  P+ TPP + T P+ TP    PP+P  SP  SP 
Sbjct: 41  SPTPLPTPSPTPSPSPTPSPTPPPSPTPSPTPPPSPT-PSPTPSPTPPPSPTPSPTPSPT 99

Query: 178 PAPTPASTPSTAPTPSTAGSP-----PAPTPD-SLGPGPSGADTPPP 300
           P+PTP+ +P  +PTPS   SP     P+PTP  +L P PS +  P P
Sbjct: 100 PSPTPSPSPLPSPTPSPTPSPTLWPTPSPTPSPTLWPTPSPSPPPSP 146

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 47/110 (42%), Positives = 61/110 (55%), Gaps = 13/110 (11%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASSPATSP-PAP 186
           PPT +P P   P  + TP  +  P+ TPP + TP    PP+ TP P P+ +P  SP P+P
Sbjct: 37  PPTPSPTPLPTP--SPTPSPSPTPSPTPPPSPTPSPTPPPSPTPSPTPSPTPPPSPTPSP 94

Query: 187 TPASTPSTAPTPSTAGSP-PAPTPD-SLGPGPSGADTP---------PPP 303
           TP+ TPS  P+PS   SP P+PTP  +L P PS   +P         PPP
Sbjct: 95  TPSPTPSPTPSPSPLPSPTPSPTPSPTLWPTPSPTPSPTLWPTPSPSPPP 144

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 44/102 (43%), Positives = 59/102 (57%), Gaps = 13/102 (12%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQP---PAAATPPTATP---PTATPPAAATP-PTATP-PTATP-PAP 153
           +PT  P+ TP+P   P   P+   PP+ TP   P+ TPP + TP PT +P P+ TP P+P
Sbjct: 49  SPTPSPSPTPSPTPPPSPTPSPTPPPSPTPSPTPSPTPPPSPTPSPTPSPTPSPTPSPSP 108

Query: 154 ASSPATSP-PAPTPASTPSTAPTPS---TAGSPPAPTPDSLG 267
             SP  SP P+PT   TPS  P+P+   T    P P+P+ LG
Sbjct: 109 LPSPTPSPTPSPTLWPTPSPTPSPTLWPTPSPSPPPSPNPLG 150

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 39/90 (43%), Positives = 50/90 (55%), Gaps = 2/90 (2%)
 Frame = +1

Query: 37  KAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASSPATSP-PAPTPASTPST 210
           K  PP  +  P  TP + TP  + TP    PP+ TP P P  SP  SP P+PTP  +P+ 
Sbjct: 34  KCLPPTPSPTPLPTP-SPTPSPSPTPSPTPPPSPTPSPTPPPSPTPSPTPSPTPPPSPTP 92

Query: 211 APTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           +PTPS   S P P+P  L P P+ + TP P
Sbjct: 93  SPTPSPTPS-PTPSPSPL-PSPTPSPTPSP 120

[82][TOP]
>UniRef100_Q43558 Proline rich protein n=1 Tax=Medicago sativa RepID=Q43558_MEDSA
          Length = 228

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/100 (52%), Positives = 58/100 (58%), Gaps = 6/100 (6%)
 Frame = +1

Query: 7   TKPPT-ATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           T PP  +TP P + PP  A+PP  +PP ATPP  ATPP ATPP A  P P SSP  + PA
Sbjct: 106 TPPPVQSTPPPASPPP--ASPPPFSPPPATPP-PATPPPATPPPALTPTPLSSPPATTPA 162

Query: 184 PTPASTPSTAPTPSTAGSP---PAPTPDSLGP--GPSGAD 288
           P PA   S APT +   SP   PAP   SL P   PSG D
Sbjct: 163 PAPAKLKSKAPTLAPVLSPSDAPAPGLSSLSPSISPSGTD 202

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 45/114 (39%), Positives = 55/114 (48%), Gaps = 15/114 (13%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATP----PAAATPPTATPPTATPPAPASSPAT 171
           P    T  P   + PP +A PP    P  TP    P  +TPP A+PP A+PP  +  PAT
Sbjct: 74  PPAQSTPPPVQSSPPPVSAPPPVQQSPPPTPLTPPPVQSTPPPASPPPASPPPFSPPPAT 133

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTP-----------DSLGPGPSGADTPPP 300
            PPA  P +TP  A TP+   SPPA TP            +L P  S +D P P
Sbjct: 134 PPPATPPPATPPPALTPTPLSSPPATTPAPAPAKLKSKAPTLAPVLSPSDAPAP 187

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 46/119 (38%), Positives = 57/119 (47%), Gaps = 19/119 (15%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPT---ATPP----------TATPPAAATPPTA--TPP- 132
           AP+  P ++PAP   P  A TPPT   A+PP          ++ PP  ++PP A  TPP 
Sbjct: 25  APSTSPNSSPAPPTPP--ANTPPTTPQASPPPVQSSPPPVQSSPPPVQSSPPPAQSTPPP 82

Query: 133 --TATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPA-PTPDSLGPGPSGADTPPP 300
             ++ PP  A  P    P PTP + P    TP  A  PPA P P S  P      TPPP
Sbjct: 83  VQSSPPPVSAPPPVQQSPPPTPLTPPPVQSTPPPASPPPASPPPFSPPPATPPPATPPP 141

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 41/99 (41%), Positives = 52/99 (52%), Gaps = 4/99 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA---ATPPTATPPTATPPAAATPPTATPPTATP-PAPASSPAT 171
           P  PP A+P P + PPA    ATPP ATP    PPA    P ++PP  TP PAPA   + 
Sbjct: 116 PASPPPASPPPFSPPPATPPPATPPPATP----PPALTPTPLSSPPATTPAPAPAKLKSK 171

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 288
           +P    P  +PS AP P  +   P+ +P   G   SGA+
Sbjct: 172 APTL-APVLSPSDAPAPGLSSLSPSISPS--GTDDSGAE 207

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 38/101 (37%), Positives = 48/101 (47%), Gaps = 8/101 (7%)
 Frame = +1

Query: 22  ATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPP--TATPPAPASS--PATSPPAPT 189
           A  AP   P ++  PPT  PP  TPP   T P A+PP   ++PP   SS  P  S P P 
Sbjct: 22  AQQAPSTSPNSSPAPPT--PPANTPP---TTPQASPPPVQSSPPPVQSSPPPVQSSPPPA 76

Query: 190 PASTPSTAPTPSTAGSPP----APTPDSLGPGPSGADTPPP 300
            ++ P    +P    +PP    +P P  L P P    TPPP
Sbjct: 77  QSTPPPVQSSPPPVSAPPPVQQSPPPTPLTP-PPVQSTPPP 116

[83][TOP]
>UniRef100_O49870 Extensin (Fragment) n=1 Tax=Hordeum vulgare RepID=O49870_HORVU
          Length = 330

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 53/116 (45%), Positives = 56/116 (48%), Gaps = 16/116 (13%)
 Frame = +1

Query: 4   PTKPPTATP--------APKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPP 147
           P KPPT TP         P A  P   TPP   PPT TPPA      TPP   PPT TPP
Sbjct: 216 PYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKPPTPTPPAHKPATPTPPAHKPPTPTPP 275

Query: 148 A---PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL-GPGPSGADTPPPP 303
           A      +PA  PP PTP +     PTP  A  PP PTP +   P PS    PPPP
Sbjct: 276 AHKPTTPTPAYKPPTPTPPADKPPTPTP-LAHKPPTPTPPAYKAPTPS----PPPP 326

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/99 (49%), Positives = 53/99 (53%), Gaps = 2/99 (2%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAA-TPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPT 189
           PP   P PK  PPA   TPP   PPT TPPA   PPT TPP   PP P + PA  PP PT
Sbjct: 196 PPAYKPVPKPSPPAPKPTPPPYKPPTPTPPAQK-PPTPTPPAYKPPTP-TPPAHKPPTPT 253

Query: 190 PASTPSTAPTPSTAGSPPAPTPDSLGP-GPSGADTPPPP 303
           P +     PTP  A  PP PTP +  P  P+ A  PP P
Sbjct: 254 PPAHKPATPTP-PAHKPPTPTPPAHKPTTPTPAYKPPTP 291

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/105 (46%), Positives = 51/105 (48%), Gaps = 8/105 (7%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPA--PA--SSPA 168
           PP   P P    P   TPP   PPT TPPA      TPP   PPT TPPA  PA  + PA
Sbjct: 207 PPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKPPTPTPPAHKPATPTPPA 266

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PP PTP +   T PTP  A  PP PTP         AD PP P
Sbjct: 267 HKPPTPTPPAHKPTTPTP--AYKPPTPTPP--------ADKPPTP 301

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 43/101 (42%), Positives = 48/101 (47%), Gaps = 4/101 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP-PTATPPAPASSPATSPPAPT 189
           PP   PAPK  PPA    P  +PP   P    +PP   P P  +PPA   +P  SPPA  
Sbjct: 130 PPAYKPAPKVSPPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYK 189

Query: 190 PA---STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PA   S P+  P P    SPPAP P    P P    TP PP
Sbjct: 190 PAPKVSPPAYKPVPKP--SPPAPKPT---PPPYKPPTPTPP 225

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 41/104 (39%), Positives = 47/104 (45%), Gaps = 7/104 (6%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP-PTATPPAPASSPATSPPAPT 189
           PP   P+PK  PPA    P  +PP   P    +PP   P P  +PPA    P  SPPAP 
Sbjct: 152 PPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPVPKPSPPAPK 211

Query: 190 PASTPSTAPTPST-AGSPPAPTP-----DSLGPGPSGADTPPPP 303
           P   P   PTP+  A  PP PTP      +  P      TP PP
Sbjct: 212 PTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKPPTPTPP 255

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 43/110 (39%), Positives = 49/110 (44%), Gaps = 13/110 (11%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP-PTATPPAPASSPATSPPA-- 183
           PP   PAPK  PPA    P  +PP   P    +PP   P P  +PPA   +P  SPPA  
Sbjct: 141 PPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYK 200

Query: 184 -------PTPASTPS--TAPTPS-TAGSPPAPTPDSLGPGPSGADTPPPP 303
                  P P  TP     PTP+  A  PP PTP +  P      TP PP
Sbjct: 201 PVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYKP-----PTPTPP 245

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 40/100 (40%), Positives = 47/100 (47%), Gaps = 4/100 (4%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP-PTATPPAPASSPATSPPAPT 189
           PP   PAPK  PPA    P  +PP   P    +PP   P P  +PPA   +P  SPPA  
Sbjct: 119 PPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYK 178

Query: 190 PASTPSTAP---TPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           PA  P  +P    P+   SPPA  P      P+   TPPP
Sbjct: 179 PA--PKVSPPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPP 216

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 41/109 (37%), Positives = 47/109 (43%), Gaps = 12/109 (11%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPT------ATPPAAATPPTATPPTATP------PAPA 156
           PP   PAPK  PPA    P  +PP        +PPA    P  +PP   P      P   
Sbjct: 163 PPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPPYKPPTP 222

Query: 157 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           + PA  PP PTP +     PTP  A  PP PTP +  P      TP PP
Sbjct: 223 TPPAQKPPTPTPPAYKPPTPTP-PAHKPPTPTPPAHKPA-----TPTPP 265

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 40/102 (39%), Positives = 49/102 (48%), Gaps = 11/102 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQ-PPAAATPPTATPPTATPPAAATPPTATPPTA--TPPAPASSPAT- 171
           P  P   +PAPK + PP    PP        P  +  PPT +PPTA  TPPAP  +P T 
Sbjct: 14  PPSPTPISPAPKHEKPPKGHKPPHHHHHAKPPVGSQAPPTYSPPTAKPTPPAPKPAPPTY 73

Query: 172 ----SPPAPT-PASTPSTAPTPSTAGSP--PAPTPDSLGPGP 276
                PP P+ PA  P+  P P T   P  P P+P +  P P
Sbjct: 74  APIPKPPKPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAP 115

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 47/111 (42%), Positives = 52/111 (46%), Gaps = 13/111 (11%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAA---TPPTATPPTATPPAAATPPTATPPT---ATPPAPASSP 165
           PT  PT  PAPK  PP  A    PP  +PP   P     PPT  PPT    +PPA   +P
Sbjct: 57  PTAKPTP-PAPKPAPPTYAPIPKPPKPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAP 115

Query: 166 ATSPPAPTPA---STPSTAPTPSTAGSPPA--PTPDSLGPG--PSGADTPP 297
             SPPA  PA   S P+  P P    SPPA  P P    P   PS   +PP
Sbjct: 116 KVSPPAYKPAPKVSPPAYKPAPKV--SPPAYKPAPKVSPPAYKPSPKVSPP 164

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 43/103 (41%), Positives = 46/103 (44%), Gaps = 6/103 (5%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAAT-PPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPT 189
           PPTA P P A  PA  T  P   PP  +PPA    P   PPT  PP   + P  SPPA  
Sbjct: 56  PPTAKPTPPAPKPAPPTYAPIPKPPKPSPPAYHPTPKPAPPTYKPP---TQPKPSPPAYK 112

Query: 190 PA---STPSTAPTPSTAGSPPA--PTPDSLGPGPSGADTPPPP 303
           PA   S P+  P P    SPPA  P P    P    A    PP
Sbjct: 113 PAPKVSPPAYKPAPKV--SPPAYKPAPKVSPPAYKPAPKVSPP 153

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 43/108 (39%), Positives = 48/108 (44%), Gaps = 11/108 (10%)
 Frame = +1

Query: 13  PPTATP---APKAQPPAAATPPTATPPTATPPA--AATPPTATP-PTATPPAPASSPATS 174
           PPT  P    PK  PPA    P   PPT  PP     +PP   P P  +PPA   +P  S
Sbjct: 70  PPTYAPIPKPPKPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVS 129

Query: 175 PPAPTPA---STPSTAPTPSTAGSPPA--PTPDSLGPGPSGADTPPPP 303
           PPA  PA   S P+  P P    SPPA  P+P    P    A    PP
Sbjct: 130 PPAYKPAPKVSPPAYKPAPKV--SPPAYKPSPKVSPPAYKPAPKVSPP 175

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 38/109 (34%), Positives = 46/109 (42%), Gaps = 11/109 (10%)
 Frame = +1

Query: 10  KPPT----ATPAPKAQPPAAATPPTA--TPPTATPPAAATPPTATPPTATPPAPASSPAT 171
           KPP     A P   +Q P   +PPTA  TPP   P      P   PP  +PPA   +P  
Sbjct: 34  KPPHHHHHAKPPVGSQAPPTYSPPTAKPTPPAPKPAPPTYAPIPKPPKPSPPAYHPTPKP 93

Query: 172 SPPAPTPASTPSTAP---TPSTAGSPPA--PTPDSLGPGPSGADTPPPP 303
           +PP   P + P  +P    P+   SPPA  P P    P    A    PP
Sbjct: 94  APPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPP 142

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 39/107 (36%), Positives = 43/107 (40%), Gaps = 10/107 (9%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATP--------PTATPPAAATPPTATPPTATPPAPASSPA 168
           PP   P PK  PP    P    P        P  +PPA    P  +PP A  PAP  SP 
Sbjct: 84  PPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPP-AYKPAPKVSPP 142

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPA--PTPDSLGPGPSGADTPPPP 303
              PAP   S P+  P+P    SPPA  P P    P    A    PP
Sbjct: 143 AYKPAP-KVSPPAYKPSPKV--SPPAYKPAPKVSPPAYKPAPKVSPP 186

[84][TOP]
>UniRef100_B6SXS9 Receptor protein kinase PERK1 n=1 Tax=Zea mays RepID=B6SXS9_MAIZE
          Length = 689

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 53/118 (44%), Positives = 67/118 (56%), Gaps = 17/118 (14%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAA---ATPPTATPPTATPP--AAATPPTATP-------PTATP 144
           APT PP A PA    PP A   A+PPT TPP  TPP  A + PP ++P       P  +P
Sbjct: 9   APTAPP-APPANATIPPPATPSASPPTPTPPKPTPPPPAPSAPPPSSPSVPPPATPAVSP 67

Query: 145 PAPASSPAT----SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS-GADTPPPP 303
           P+P+S+PAT    SP +P+  +TP+T   PS   SPP+ TP      PS  +DTP PP
Sbjct: 68  PSPSSTPATPSAPSPSSPSSPATPATPSPPSDTPSPPSDTPSPPSDTPSPPSDTPSPP 125

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 59/114 (51%), Positives = 69/114 (60%), Gaps = 18/114 (15%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTAT-PPTATPPAAATPPTATPPTATPPAPA------SSPATS 174
           PTA PAP A P   A P  AT PP ATP  +A+PPT TPP  TPP PA      SSP+  
Sbjct: 4   PTAAPAPTAPP---APPANATIPPPATP--SASPPTPTPPKPTPPPPAPSAPPPSSPSVP 58

Query: 175 PPA------PTPASTPST--APTPSTAGSP--PA-PTPDSLGPGPSGADTPPPP 303
           PPA      P+P+STP+T  AP+PS+  SP  PA P+P S  P P  +DTP PP
Sbjct: 59  PPATPAVSPPSPSSTPATPSAPSPSSPSSPATPATPSPPSDTPSPP-SDTPSPP 111

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 46/103 (44%), Positives = 57/103 (55%), Gaps = 6/103 (5%)
 Frame = +1

Query: 13  PPTATPA-PKAQPPAAATPPTAT---PPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           PPT TP  P   PPA + PP ++   PP ATP  +   P++TP  ATP AP+ S  +SP 
Sbjct: 32  PPTPTPPKPTPPPPAPSAPPPSSPSVPPPATPAVSPPSPSSTP--ATPSAPSPSSPSSPA 89

Query: 181 APTPASTPSTAPT-PSTAGSPPAPTPDSLGPGPS-GADTPPPP 303
            P   S PS  P+ PS   SPP+ TP      PS  +DTP PP
Sbjct: 90  TPATPSPPSDTPSPPSDTPSPPSDTPSPPSDTPSPPSDTPSPP 132

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 42/107 (39%), Positives = 57/107 (53%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA-ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT-SP 177
           P KP    PAP A PP++ + PP ATP  + P  ++TP T + P+ + P+  ++PAT SP
Sbjct: 37  PPKPTPPPPAPSAPPPSSPSVPPPATPAVSPPSPSSTPATPSAPSPSSPSSPATPATPSP 96

Query: 178 PAPTPASTPSTAP-----TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+ TP S PS  P     TPS     P+P  D+  P  S      PP
Sbjct: 97  PSDTP-SPPSDTPSPPSDTPSPPSDTPSPPSDTPSPPSSSGGGRSPP 142

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 35/100 (35%), Positives = 52/100 (52%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P+ PP ATPA     P++     + P  ++P + ATP T +PP+ TP  P+ +P  SPP
Sbjct: 54  SPSVPPPATPAVSPPSPSSTPATPSAPSPSSPSSPATPATPSPPSDTPSPPSDTP--SPP 111

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           + TP+    T   PS   SPP+ +     P  SG +   P
Sbjct: 112 SDTPSPPSDTPSPPSDTPSPPSSSGGGRSPPSSGGERSTP 151

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 9/106 (8%)
 Frame = +1

Query: 1   APTKPPTATPAPK-AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           +P+  P    AP  + P + ATP T +PP+ TP   +  P+    T +PP+   SP +  
Sbjct: 69  SPSSTPATPSAPSPSSPSSPATPATPSPPSDTPSPPSDTPSPPSDTPSPPSDTPSPPSDT 128

Query: 178 PAP--------TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 291
           P+P        +P S+     TPS+   P + +P   G G SG  T
Sbjct: 129 PSPPSSSGGGRSPPSSGGERSTPSSHSPPKSHSPGGEGGGSSGPST 174

[85][TOP]
>UniRef100_O10341 Uncharacterized 29.3 kDa protein n=1 Tax=Orgyia pseudotsugata MNPV
           RepID=Y091_NPVOP
          Length = 279

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 47/104 (45%), Positives = 57/104 (54%), Gaps = 4/104 (3%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-PTATPPTATPPAPASSPATSP 177
           +PT  PT TP+P   P  + TP  +  P+ TP  + TP PT TP     P+P  SP T  
Sbjct: 88  SPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPSP-TPS 146

Query: 178 PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPP 300
           P PTP+ TPS  PTPS   SP   P+PTP    P P  + TPPP
Sbjct: 147 PTPTPSPTPSPTPTPSPTPSPTPTPSPTP---SPTPPPSPTPPP 187

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 53/107 (49%), Positives = 61/107 (57%), Gaps = 8/107 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP-PTATP-PTATPPAAATPPTATPPTATPPAPASSPATSP 177
           P+  PT TP+P   P  + TP PT TP PT TP  + TP  A  PT TP +P  SP  SP
Sbjct: 35  PSPTPTPTPSPTPTPTPSPTPTPTPTPTPTPTPTPSPTPTPALSPTPTP-SPTLSPTPSP 93

Query: 178 ---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPP 300
              P+PTP+ TPS  PTPS   SP   P+PTP S  P PS   TP P
Sbjct: 94  TPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTP-SPTPTPSPTPTPSP 139

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 46/107 (42%), Positives = 58/107 (54%), Gaps = 8/107 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASSPATSP- 177
           P   PT TP+P   P  + TP  +  P+ TP    TP     PT TP P P+ +P  SP 
Sbjct: 75  PALSPTPTPSPTLSPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPT 134

Query: 178 --PAPTPASTPSTAPTPSTAGSP---PAPTPD-SLGPGPSGADTPPP 300
             P+PTP+ TPS  PTPS   SP   P+PTP  +  P P+ + TPPP
Sbjct: 135 PTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPPP 181

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 52/111 (46%), Positives = 58/111 (52%), Gaps = 12/111 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP-PTATPPTATPPAAATPPTATP-PTATP---PAPASSPA 168
           PT  PT TP P   P    TP PT TP  +  P  A  PT TP PT +P   P P  SP 
Sbjct: 41  PTPSPTPTPTPSPTPTPTPTPTPTPTPTPSPTPTPALSPTPTPSPTLSPTPSPTPTPSPT 100

Query: 169 TSP---PAPTPASTPSTAPTPSTAGSP---PAPTP-DSLGPGPSGADTPPP 300
            SP   P PTP+ TPS  PTPS   SP   P+PTP  S  P P+ + TP P
Sbjct: 101 PSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPSPTPTP 151

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 50/108 (46%), Positives = 57/108 (52%), Gaps = 9/108 (8%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQP-PAAATPPTATP-PTATPPAAATPPTATPPTATP-PAPASSPATS 174
           PT  PT TP P   P P  A  PT TP PT +P  + TP  +  P+ TP P P  SP  S
Sbjct: 57  PTPTPTPTPTPTPSPTPTPALSPTPTPSPTLSPTPSPTPTPSPTPSPTPSPTPTPSPTPS 116

Query: 175 P-----PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPP 300
           P     P P+P  TPS  PTPS   SP P+PTP +  P PS   TP P
Sbjct: 117 PTPTPSPTPSPTPTPSPTPTPSPTPSPTPSPTP-TPSPTPSPTPTPSP 163

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 48/110 (43%), Positives = 61/110 (55%), Gaps = 11/110 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP---PTATP-PTATPPAAATPPTATPPTATP-PAPASSPA 168
           PT  PT TP+P   P  + TP   PT +P P+ TP  + TP     PT TP P P+ +P 
Sbjct: 61  PTPTPTPTPSPTPTPALSPTPTPSPTLSPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPT 120

Query: 169 TSP---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPP 300
            SP   P PTP+ TP+ +PTPS   SP   P+PTP    P P+ + TP P
Sbjct: 121 PSPTPSPTPTPSPTPTPSPTPSPTPSPTPTPSPTP---SPTPTPSPTPSP 167

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 46/105 (43%), Positives = 60/105 (57%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATP-PTATP-PTATPPAAATPPTATPPTATP-PAPASSPAT 171
           +PT  P  +P P   P  + TP PT TP PT +P  + TP  +  P+ TP P+P  SP  
Sbjct: 70  SPTPTPALSPTPTPSPTLSPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTP 129

Query: 172 SP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPP 300
           +P P PTP+ TPS  P+P+   SP P+PTP +  P PS   TP P
Sbjct: 130 TPSPTPTPSPTPSPTPSPTPTPSPTPSPTP-TPSPTPSPTPTPSP 173

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 41/101 (40%), Positives = 48/101 (47%), Gaps = 4/101 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-PTATPPTATPPAPASSPATSP- 177
           PT  PT +P P   P  + TP     P+ TP    TP PT TP     P P+ +P  SP 
Sbjct: 95  PTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPSPTPTPSPT 154

Query: 178 --PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
             P PTP+ TPS  PTPS   SP  P   +  P PS    P
Sbjct: 155 PSPTPTPSPTPSPTPTPSPTPSPTPPPSPTPPPSPSPLGDP 195

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 42/97 (43%), Positives = 51/97 (52%), Gaps = 9/97 (9%)
 Frame = +1

Query: 37  KAQPPAAATPPTATP-PTATPPAAATPPTATPPTATPPAPASSPATSP-------PAPTP 192
           + +PP  +  PT TP PT TP  + TP     PT TP  P  SP  +P       P+PT 
Sbjct: 29  ETKPPLPSPTPTPTPSPTPTPTPSPTPTPTPTPTPTP-TPTPSPTPTPALSPTPTPSPTL 87

Query: 193 ASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPP 300
           + TPS  PTPS   SP P+PTP +  P PS   TP P
Sbjct: 88  SPTPSPTPTPSPTPSPTPSPTP-TPSPTPSPTPTPSP 123

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 30/75 (40%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASSPATSP 177
           +PT  PT TP+P   P    +P  +  PT +P  + TP  +  P+ TP P+P  SP T P
Sbjct: 122 SPTPSPTPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPSP-TPP 180

Query: 178 PAPTPASTPSTAPTP 222
           P+PTP  +PS    P
Sbjct: 181 PSPTPPPSPSPLGDP 195

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 30/73 (41%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-PTATPPTATPPAPASSPATSPP 180
           PT  PT TP+P   P  + TP  +  P+ TP  + TP PT TP     P P  SP T PP
Sbjct: 129 PTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPPPSP-TPPP 187

Query: 181 APTPASTPSTAPT 219
           +P+P   P   P+
Sbjct: 188 SPSPLGDPMYFPS 200

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 32/82 (39%), Positives = 41/82 (50%), Gaps = 2/82 (2%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATP-PTATPPAAATP-PTATPPTATPPAPASSPATS 174
           +PT  P+ TP P          PT +P P+ TP  + TP PT TP     P P  SP   
Sbjct: 126 SPTPTPSPTPTPS---------PTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPT-- 174

Query: 175 PPAPTPASTPSTAPTPSTAGSP 240
            P+PTP  +P+  P+PS  G P
Sbjct: 175 -PSPTPPPSPTPPPSPSPLGDP 195

[86][TOP]
>UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae
            RepID=UPI000186983E
          Length = 1411

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 40/100 (40%), Positives = 40/100 (40%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 871  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P GA  PPPP
Sbjct: 931  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPP 970

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 39/100 (39%), Positives = 39/100 (39%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            PT PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 851  PTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 911  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 869  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 929  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPP 968

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 854  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 914  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 855  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 915  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 856  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 916  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 857  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 917  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 858  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 918  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 859  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 919  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 860  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 920  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 861  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 921  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 862  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 922  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 863  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 923  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 38/99 (38%), Positives = 38/99 (38%)
 Frame = +1

Query: 7    TKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAP 186
            T PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP P
Sbjct: 853  TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912

Query: 187  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P   P   P P     PP P P    P P     PPPP
Sbjct: 913  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 39/99 (39%), Positives = 40/99 (40%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 887  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P P   P   P P   G+PP P P      P GA  PPP
Sbjct: 947  PPPPPPPPPPPPPPPPGAPPPPPPAL----PPGAPPPPP 981

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 39/102 (38%), Positives = 40/102 (39%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 884  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943

Query: 184  PTPASTPSTAPTPSTAGSP--PAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     P  P P P +L PG      PPPP
Sbjct: 944  PPPPPPPPPPPPPPPPPPPGAPPPPPPALPPG-----APPPP 980

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 35/96 (36%), Positives = 35/96 (36%)
 Frame = +1

Query: 16   PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPA 195
            P     P   PP    PP   PP   PP    PP   PP   PP P   P   PP P P 
Sbjct: 845  PMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904

Query: 196  STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P   P P     PP P P    P P     PPPP
Sbjct: 905  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 34/92 (36%), Positives = 34/92 (36%)
 Frame = +1

Query: 28   PAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPS 207
            PAP         PP   PP   PP    PP   PP   PP P   P   PP P P   P 
Sbjct: 843  PAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902

Query: 208  TAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P P     PP P P    P P     PPPP
Sbjct: 903  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/100 (36%), Positives = 38/100 (38%), Gaps = 2/100 (2%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP   P P   PP    PP   PP   PP    PP   PP   PP P       PP 
Sbjct: 902  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP-------PPP 954

Query: 184  PTPASTPSTAPTPSTAGSPPA--PTPDSLGPGPSGADTPP 297
            P P   P  AP P     PP   P P +L     G + PP
Sbjct: 955  PPPPPPPPGAPPPPPPALPPGAPPPPPALPCFHEGQEYPP 994

[87][TOP]
>UniRef100_Q89X06 Blr0521 protein n=1 Tax=Bradyrhizobium japonicum RepID=Q89X06_BRAJA
          Length = 745

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 47/107 (43%), Positives = 53/107 (49%), Gaps = 10/107 (9%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAAT--PPTATPPTATPPAAATPPTATPPTATPPAPASSP----ATS 174
           PP A   P A PPAAA   PP A PP A PP  A PP   PP A  PAP   P    A  
Sbjct: 60  PPAAPARPAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPPPPPPAARPAPPPPPPPPAAPK 119

Query: 175 PPAPTPASTPS----TAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P PA+ P     T P P+   + PAPTP +  P  +    PPPP
Sbjct: 120 QPSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAPPPAAAPQHAPPPP 166

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/104 (49%), Positives = 55/104 (52%), Gaps = 6/104 (5%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATP-PTATPPAAATP-PTATPPTATPPAPASSPATSP 177
           PT  PTATP P A PPAA T    +P P ATP    TP PTATP     PAP S+P   P
Sbjct: 189 PTPAPTATPTPVAPPPAAPTARPGSPAPAATPAPTPTPAPTATPAPTATPAPGSTPGAPP 248

Query: 178 PAPTPASTPSTAP-TPSTAGSPPAP--TP-DSLGPGPSGADTPP 297
                A  P   P +P  AGSPPAP  TP  +  P P G  TPP
Sbjct: 249 AGRPGAPPPGVRPGSPPAAGSPPAPGATPAPTTTPAPGGTATPP 292

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 47/100 (47%), Positives = 52/100 (52%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P   P A PA  A PP AA PP   PP A PPAAA P  A PP   PP PA+ PA  PP 
Sbjct: 56  PGAAPPAAPARPAAPPPAAAPPH--PPAAPPPAAAPPRPAAPPPPPPP-PAARPAPPPPP 112

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P PA+    +P P+ A    APTP    P P+    P PP
Sbjct: 113 PPPAAPKQPSPPPAAAPQQHAPTPPPPAP-PAARPAPTPP 151

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 63/141 (44%), Positives = 70/141 (49%), Gaps = 40/141 (28%)
 Frame = +1

Query: 1   APTKPPTATPA------PKAQPPAAAT-------PPTATPPTATPP--------AAATP- 114
           APT PP A PA      P A PPAAA        PP A  PT TPP        A  TP 
Sbjct: 133 APTPPPPAPPAARPAPTPPAPPPAAAPQHAPPPPPPPAARPTPTPPPPPPAGPAARPTPA 192

Query: 115 PTATP---------PTATP--PAPASSPATSP-PAPTPASTPSTAPTP-STAGSPPAPTP 255
           PTATP         PTA P  PAPA++PA +P PAPT    P+  P P ST G+PPA  P
Sbjct: 193 PTATPTPVAPPPAAPTARPGSPAPAATPAPTPTPAPTATPAPTATPAPGSTPGAPPAGRP 252

Query: 256 DSLGPG-----PSGADTPPPP 303
            +  PG     P  A +PP P
Sbjct: 253 GAPPPGVRPGSPPAAGSPPAP 273

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 43/101 (42%), Positives = 48/101 (47%), Gaps = 2/101 (1%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAAAT--PPTATPPTATPPAPASSPATSPP 180
           T P      P   PP AA P     P A PPAAA   PP A PP A PP PA+ P   PP
Sbjct: 42  TGPDGKPKQPPKGPPGAAPPAAPARPAAPPPAAAPPHPPAAPPPAAAPPRPAAPP---PP 98

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P PA+ P+  P P    +P  P+P         A TPPPP
Sbjct: 99  PPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPP 139

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 46/110 (41%), Positives = 51/110 (46%), Gaps = 13/110 (11%)
 Frame = +1

Query: 13  PPTATPA--PKAQPPAAATPPTATPPTATPPAAA--TPPTATPPTATPPAPASSPATSP- 177
           PP A P   P A PPAAA P  A PP   PP AA   PP   PP A P  P+  PA +P 
Sbjct: 71  PPAAAPPHPPAAPPPAAAPPRPAAPPPPPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQ 130

Query: 178 ---PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGP-----SGADTPPPP 303
              P P P + P+  P P+    PPA  P    P P         TPPPP
Sbjct: 131 QHAPTPPPPAPPAARPAPTPPAPPPAAAPQHAPPPPPPPAARPTPTPPPP 180

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 49/108 (45%), Positives = 56/108 (51%), Gaps = 8/108 (7%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAA-TPPTATPPTATPPAAATPPTATP----PTATPPA-PASS 162
           AP +P  A P P   PPAA   PP   PP A P   + PP A P    PT  PPA PA+ 
Sbjct: 88  APPRP--AAPPPPPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAAR 145

Query: 163 PATSPPAPTPASTPSTA-PTPSTAGSPPAPTPDSLGP-GPSGADTPPP 300
           PA +PPAP PA+ P  A P P    + P PTP    P GP+   TP P
Sbjct: 146 PAPTPPAPPPAAAPQHAPPPPPPPAARPTPTPPPPPPAGPAARPTPAP 193

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 48/107 (44%), Positives = 57/107 (53%), Gaps = 8/107 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP--PTATPPTATPPAAATPPTATPPTATPPAPASSPA-TS 174
           PT  PTATPAP A P   +TP  P A  P A PP     P + P   +PPAP ++PA T+
Sbjct: 224 PTPAPTATPAPTATPAPGSTPGAPPAGRPGAPPPGVR--PGSPPAAGSPPAPGATPAPTT 281

Query: 175 PPAP-----TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            PAP      P+  P  A TP+   + PAPT     P P GA TPPP
Sbjct: 282 TPAPGGTATPPSGRPGPASTPAPGAATPAPTAT---PAPGGALTPPP 325

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 50/120 (41%), Positives = 56/120 (46%), Gaps = 21/120 (17%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAA------TPPTATPPTA-------TPPAAATPPTATPPTATP 144
           P  PP A P   + PPAAA      TPP   PP A        PP AA P  A PP   P
Sbjct: 110 PPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAPPPAAAPQHAPPP---P 166

Query: 145 PAPASSPATSPPAPTPAS-----TPSTAPTPSTAGSPP-APT--PDSLGPGPSGADTPPP 300
           P PA+ P  +PP P PA      TP+   TP+    PP APT  P S  P  + A TP P
Sbjct: 167 PPPAARPTPTPPPPPPAGPAARPTPAPTATPTPVAPPPAAPTARPGSPAPAATPAPTPTP 226

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 45/112 (40%), Positives = 47/112 (41%), Gaps = 12/112 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPA--AATPPTATPPTATP--------PAP 153
           P  PP A PAP   PP  A P   +PP A  P   A TPP   PP A P        PA 
Sbjct: 98  PPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAPPPAA 157

Query: 154 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP--PPP 303
           A   A  PP P  A    T P P  AG    PT     P P+   TP  PPP
Sbjct: 158 APQHAPPPPPPPAARPTPTPPPPPPAGPAARPT-----PAPTATPTPVAPPP 204

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 50/127 (39%), Positives = 56/127 (44%), Gaps = 28/127 (22%)
 Frame = +1

Query: 4   PTKPPTA--TPAPKAQPPAAATPP---TATPPTATP-------PAAATP-PTATP----- 129
           P  PP A   PAP A P    TP    TATPP+  P       P AATP PTATP     
Sbjct: 261 PGSPPAAGSPPAPGATPAPTTTPAPGGTATPPSGRPGPASTPAPGAATPAPTATPAPGGA 320

Query: 130 -------PTATP---PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 279
                  P A P   P   + PA +P A TPA+ P     P+   +P      S  PG S
Sbjct: 321 LTPPPGRPGAGPTPGPQGGTPPAGAPAAGTPAAPPQAGGLPARPAAPAGAAAPSTVPG-S 379

Query: 280 GADTPPP 300
            A TPPP
Sbjct: 380 AAATPPP 386

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 42/111 (37%), Positives = 48/111 (43%), Gaps = 10/111 (9%)
 Frame = +1

Query: 1   APTKPPTATPAP-------KAQPPAAATP-PTATPPTATPPAAATPPTATPPTA--TPPA 150
           A T  PTATPAP         +P A  TP P    P A  PAA TP  A PP A   P  
Sbjct: 306 AATPAPTATPAPGGALTPPPGRPGAGPTPGPQGGTPPAGAPAAGTP--AAPPQAGGLPAR 363

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PA+    + P+  P S  +T P      +PP  TP         A  PPPP
Sbjct: 364 PAAPAGAAAPSTVPGSAAATPPPNRAQFAPPTVTPAFQAAPTVVAPLPPPP 414

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 34/101 (33%), Positives = 38/101 (37%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           A T    A  A  AQ  +      A P    P      P   PP A PPA  + PA  PP
Sbjct: 13  ALTAMQLANTASHAQGASPLVVAQAQPQETGPDGKPKQPPKGPPGAAPPAAPARPAAPPP 72

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           A  P   P+  P  +    P AP P    P    A  PPPP
Sbjct: 73  AAAPPHPPAAPPPAAAPPRPAAPPPPPPPPAARPAPPPPPP 113

[88][TOP]
>UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f.
           nagariensis RepID=Q9SBM1_VOLCA
          Length = 409

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 40/101 (39%), Positives = 49/101 (48%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP   P P   PP    PP   PP   PP    PP+ +PP + PP+P  SP  SPP
Sbjct: 110 SPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPP 169

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P  +P  +P PS    PP   P S  P P  +  P PP
Sbjct: 170 -PSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPP 209

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 38/97 (39%), Positives = 45/97 (46%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           PP   P P   PP    PP  +PP   PP    PP+  PP   PP P  +P   PP P P
Sbjct: 89  PPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPP 148

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           + +P  +P PS   SPP   P S  P P  +  P PP
Sbjct: 149 SPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 185

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 38/100 (38%), Positives = 44/100 (44%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP     P   PP   PP  + PP   PP   PP P   P   PP+
Sbjct: 90  PPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPS 149

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P  +P  +P PS   SPP   P S  P P  +  P PP
Sbjct: 150 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPP 189

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 39/100 (39%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP+ +PP + PP+    P  +PP + PP+P  SP  SPP 
Sbjct: 127 PPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP- 185

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P  +P  +P PS   SPP   P S  P      +P PP
Sbjct: 186 PRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPP 225

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 40/103 (38%), Positives = 48/103 (46%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP-- 177
           P  PP   P+P   PP    PP   PP   PP  +  P  +PP + PP+P  SP  SP  
Sbjct: 115 PPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPP 174

Query: 178 -PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P+P  +P   P PS   SPP   P S  P P  +  PP P
Sbjct: 175 SPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSP 217

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 41/102 (40%), Positives = 49/102 (48%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTAT--PPAPASSPATSP 177
           P  PP+  P P   PP   +PP   PP   PP    PP   PP +   PP+P  SP  SP
Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSP 164

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P+P  +P  +P PS   SPP   P S  P P  +  P PP
Sbjct: 165 P-PSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPP 205

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 41/100 (41%), Positives = 48/100 (48%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P+P   PP    PP + PP   PP    PP   PP   PP P+ SP  SPP 
Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPP--PPPNPPPPPPPPPPSPSPPPSPP- 157

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P  +P  +P PS   SPP   P S  P P  +  P PP
Sbjct: 158 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPP 197

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 39/101 (38%), Positives = 50/101 (49%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP + +PP + PP+  P    +PP + PP+  P  P S P   PP+
Sbjct: 132 PPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPS 191

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS-LGPGPSGADTPPPP 303
           P P+  PS  P+P     PP+P P S   P PS     PPP
Sbjct: 192 PPPSPPPSPPPSPPPR-PPPSPNPPSPRPPSPSPPSPRPPP 231

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 38/100 (38%), Positives = 42/100 (42%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  P    P P   PP    PP   PP + PP    PP   P    PP P   P  +PP 
Sbjct: 82  PPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPP 141

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   PS +P PS   SPP   P S  P P  +  P PP
Sbjct: 142 PPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 181

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 40/102 (39%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTAT--PPTATPPAPASSPATSP 177
           P+ PP+  P+P  +PP +  PP+  PP+ +PP+   PP     PP + PP     PA  P
Sbjct: 194 PSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPP 253

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P P S P   P P    SPP P P    P P    +PPPP
Sbjct: 254 PRPPPPSPPPPLPPPP---SPPPPLPPPPSPPP---PSPPPP 289

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 39/104 (37%), Positives = 43/104 (41%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPP----TATPPTATPPAPASSPAT 171
           P  PP  TP P   PP  + P    PP   PP    PP     + PP   PP P   P  
Sbjct: 43  PGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPP 102

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP P P+  P   P P    SPP P P    P P+    PPPP
Sbjct: 103 PPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPP 146

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 40/100 (40%), Positives = 46/100 (46%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P + PP    PP   PP  +PP    PP   PP   PP P   P+ SPP 
Sbjct: 98  PPPPPPPPPPPPSPPPPPPPPP---PPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPP- 153

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P  +P  +P PS   SPP   P S  P P     P PP
Sbjct: 154 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPP 193

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 37/100 (37%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P+P   PP   +PP + PP+  P    +PP + PP+  P  P S P + PP+
Sbjct: 142 PPPPPPPSPSPPPSPP--PSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPS 199

Query: 184 PTPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSGADTPPP 300
           P P+  P   P+P+  +  PP+P+P S  P P     PPP
Sbjct: 200 PPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPP 239

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 39/100 (39%), Positives = 49/100 (49%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP A P P+  PP+   PP   PP + PP    PP+  PP+  PP+P   P+  PP 
Sbjct: 244 PRPPPPAPPPPRPPPPSP--PPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLP-PSPRPPK 300

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P + P   P P     PP P P S  P      +PPPP
Sbjct: 301 PSPPNNPFPRPPPPNP-PPPRPPPPSPNPPRPPPPSPPPP 339

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 39/98 (39%), Positives = 43/98 (43%), Gaps = 2/98 (2%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAP-- 186
           PP   P P  QPP    PP+ +PP   PP    PP   PP   PP+P   P   PP P  
Sbjct: 68  PPPPPPPPPPQPPL---PPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPS 124

Query: 187 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P   P   P P     PP P P S  P PS   +PPP
Sbjct: 125 PPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPP 162

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 38/102 (37%), Positives = 43/102 (42%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP-- 177
           P  PP   P P +  P    PP   PP   PP    PP+  PP   PP P  SP   P  
Sbjct: 72  PPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPP 131

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P P + P   P P  + SPP   P S  P P  +  P PP
Sbjct: 132 PPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPP 173

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 40/110 (36%), Positives = 45/110 (40%), Gaps = 14/110 (12%)
 Frame = +1

Query: 16  PTATPAPKAQPPAA-----ATPPTATPPTATPPAAATPPTAT---------PPTATPPAP 153
           P   P P+  P  A     A PP  +PP  TPP    PPT +         PP   PP P
Sbjct: 20  PARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQP 79

Query: 154 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P+ SPP P P   P   P P     PP+P P    P P     PPPP
Sbjct: 80  PLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPP 129

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 38/101 (37%), Positives = 52/101 (51%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P+ PP+  P+P   PP +  PP + PP+  P    +PP   PP+  P  P S P + PP
Sbjct: 149 SPSPPPSPPPSPPPSPPPS--PPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPP 206

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P+  P +   PS   SPP+P P    P P    +PPPP
Sbjct: 207 RPPPSPNPPSPRPPSP--SPPSPRPPPRRP-PFPPPSPPPP 244

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 40/103 (38%), Positives = 49/103 (47%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP--PTATPPTATPPAP-ASSPATS 174
           P  PP   P P + PP +  PP+  PP+  PP  + P  P   PP   PP P    P+ +
Sbjct: 268 PPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPN 327

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP P P S P   P P +  +PP P P    P PS    PPPP
Sbjct: 328 PPRPPPPSPPPPRPPPPSP-NPPRPPP----PSPSPPKPPPPP 365

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 37/101 (36%), Positives = 48/101 (47%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  P  + P+P+  P     PP + PP   PP A  PP   PP+  PP P   P+  PP
Sbjct: 216 SPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLP-PPPSPPPP 274

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S P  +P P +   PP+P P    P  +    PPPP
Sbjct: 275 LPPPPSPPPPSPPPPSP-LPPSPRPPKPSPPNNPFPRPPPP 314

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/100 (36%), Positives = 45/100 (45%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP   P P   PP    PP A PP   PP +  PP   PP+  PP P       PP
Sbjct: 226 SPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPP------PP 279

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           +P P S P  +P P +   P    P++  P P   + PPP
Sbjct: 280 SPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPP 319

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 36/96 (37%), Positives = 40/96 (41%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPA 195
           P A  AP  +PP   +P  A   T   P   +PP  TPP   PP   S P   PP P P 
Sbjct: 14  PHALGAPARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPP 73

Query: 196 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P   P P +   PP P P    P P     PPPP
Sbjct: 74  PPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPP 109

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 37/100 (37%), Positives = 47/100 (47%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP+  P P   PP +  P     P   PP +  PP+  PP+ +PP+P   P   PP 
Sbjct: 178 PSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSP-RPPPRRPPF 236

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P+  P   P P  A  PP P P S  P      +PPPP
Sbjct: 237 PPPSPPPPRPPPP--APPPPRPPPPSPPPPLPPPPSPPPP 274

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 39/105 (37%), Positives = 48/105 (45%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPA-PKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P +PP   P+ P  +PP  A PP   PP + PP    PP+  PP   PP+P   P  SPP
Sbjct: 231 PRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSP---PPPSPP 287

Query: 181 APTPASTPSTAPTPSTAGS----PPAPTPDSLGPGPSGADTPPPP 303
            P+P       P PS   +    PP P P    P P   + P PP
Sbjct: 288 PPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPP 332

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 36/100 (36%), Positives = 41/100 (41%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P   P  TP+    PP    PP   P    PP+ + PP   PP   PP P   P   PP 
Sbjct: 52  PPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPP---PPPPPPP 108

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P   P   P P  +  PP P P    P P     PPPP
Sbjct: 109 PSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPP 148

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 37/100 (37%), Positives = 50/100 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP+  P+P   PP    PP + PP+  P    +PP   PP+  PP+P   P+ SPP+
Sbjct: 170 PSPPPSPPPSPPPSPPPR--PPPSPPPSPPPSPPPSPPPRPPPSPNPPSP-RPPSPSPPS 226

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P  +  PP P P +  P      +PPPP
Sbjct: 227 PRP--PPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPP 264

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 36/103 (34%), Positives = 46/103 (44%), Gaps = 4/103 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS----PAT 171
           P +PP  +P P   PP +  PP   PP+  PP+   PP+  PP+  PP P+      P  
Sbjct: 253 PPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPP-PPSPLPPSPRPPKPSPPNNPFPRP 311

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            PP P P   P  +P P     P  P P    P P+    PPP
Sbjct: 312 PPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPPP 354

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 37/105 (35%), Positives = 48/105 (45%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP-PTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P+ PP+  P+P   PP +  P P  +PP + PP     P  +PP + PP+P   P  SP 
Sbjct: 154 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPN 213

Query: 181 APTP----ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P     S PS  P P     PP   P    P P+     PPP
Sbjct: 214 PPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPP 258

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 39/103 (37%), Positives = 50/103 (48%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA---ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           P  PP+  P+P   PP +     PP+  PP+  PP + +PP+  PP   PP P  SP   
Sbjct: 186 PRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPP-SPSPPSPRPPPRRPPFPPPSP--P 242

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PP P P + P   P P +   PP P P S  P      +PPPP
Sbjct: 243 PPRPPPPAPPPPRPPPPSP-PPPLPPPPSPPPPLPPPPSPPPP 284

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 37/107 (34%), Positives = 46/107 (42%), Gaps = 8/107 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQP-PAAATPPTATPPTATP-------PAAATPPTATPPTATPPAPAS 159
           P+ PP+  P P   P P +  PP+ +PP+  P       P  + PP   PP A PP    
Sbjct: 198 PSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPP 257

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P+  PP P P S P   P P +   P  P P  L P P      PP
Sbjct: 258 PPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPP 304

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 36/112 (32%), Positives = 45/112 (40%), Gaps = 13/112 (11%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP-------------PTATPPTATPPAAATPPTATPPTATP 144
           P+ PP + P P   PP+   P             P   PP   PP +  PP   PP+  P
Sbjct: 279 PSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPP 338

Query: 145 PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P P   P+ +PP P P       P+PS    PP P+P    P P      PP
Sbjct: 339 PRPPP-PSPNPPRPPP-------PSPSPPKPPPPPSPP---PRPPRRPPRPP 379

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 30/88 (34%), Positives = 34/88 (38%)
 Frame = +1

Query: 40  AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPT 219
           + P A   P    PP  +P  A     A PP  +PP     P   PP P+    P   P 
Sbjct: 12  SSPHALGAPARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPP 71

Query: 220 PSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P     PP P    L P PS    PPPP
Sbjct: 72  P-----PPPPPQPPLPPSPSPPPPPPPP 94

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 32/89 (35%), Positives = 39/89 (43%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P   P   P P   PP    PP+  PP   PP +  PP   PP+  PP P   P+ SPP
Sbjct: 302 SPPNNPFPRPPPPNPPPPRPPPPSPNPP-RPPPPSPPPPRPPPPSPNPPRP-PPPSPSPP 359

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLG 267
            P P  +P   P P     PP   P + G
Sbjct: 360 KPPPPPSPPPRP-PRRPPRPPRRPPTAPG 387

[89][TOP]
>UniRef100_Q1EP18 Protein kinase family protein n=1 Tax=Musa balbisiana
           RepID=Q1EP18_MUSBA
          Length = 637

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 47/107 (43%), Positives = 57/107 (53%), Gaps = 9/107 (8%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPP----TATPPTATPPAPASS--- 162
           P  P  + P P   PP A+TPP   PP+A+PP AA PP       PPT +PP P S+   
Sbjct: 77  PPPPSVSPPPPALSPPPASTPPP--PPSASPPPAAAPPPPPFATPPPTNSPPPPPSATPP 134

Query: 163 PATSPPAPTPASTPSTAPTPSTAGSPPAP--TPDSLGPGPSGADTPP 297
           P  SPP P   S P+ AP+ ST G+PPAP   P    P PS +   P
Sbjct: 135 PTISPPPPGSQSPPARAPSNSTGGTPPAPPKPPSPPSPSPSASHRAP 181

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 46/106 (43%), Positives = 56/106 (52%), Gaps = 6/106 (5%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPP----AAATPPTATPPTATPPAPASSPA 168
           AP  PP   P P + PPA++ PPT  PP   PP     +  PP   PP+ +PP PA SP 
Sbjct: 35  APNAPP--PPTPPSPPPASSPPPTPPPPADVPPPPVVTSPPPPDPPPPSVSPPPPALSP- 91

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPP--APTPDSLGPGPSGADTPPP 300
             PPA TP   PS +P P+ A  PP  A  P +  P P  + TPPP
Sbjct: 92  --PPASTPPPPPSASPPPAAAPPPPPFATPPPTNSPPPPPSATPPP 135

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 45/105 (42%), Positives = 54/105 (51%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQ--PPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           +P  P + +P P +   PPA   PP  TPP+  PPA++ PPT  PP   PP P     TS
Sbjct: 16  SPPPPSSLSPPPASNSPPPAPNAPPPPTPPSP-PPASSPPPTPPPPADVPPPPV---VTS 71

Query: 175 PPAPTPASTPSTAPTPSTAGSPPA---PTPDSLGPGPSGADTPPP 300
           PP P P   PS +P P     PPA   P P S  P P+ A  PPP
Sbjct: 72  PPPPDPPP-PSVSPPPPALSPPPASTPPPPPSASPPPAAAPPPPP 115

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 41/106 (38%), Positives = 56/106 (52%), Gaps = 8/106 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPP---TATPPTATPPAAATPPT---ATPPTATPPAPASSP 165
           P+ PP ++P P   PPA   PP   T+ PP   PP + +PP    + PP +TPP P S  
Sbjct: 45  PSPPPASSPPPTPPPPADVPPPPVVTSPPPPDPPPPSVSPPPPALSPPPASTPPPPPS-- 102

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPP--APTPDSLGPGPSGADTPP 297
           A+ PPA  P   P   P P+ +  PP  A  P ++ P P G+ +PP
Sbjct: 103 ASPPPAAAPPPPPFATPPPTNSPPPPPSATPPPTISPPPPGSQSPP 148

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 48/108 (44%), Positives = 59/108 (54%), Gaps = 11/108 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPP-TATPPAAATPPTAT-PPTATPPAPASSPATSP 177
           P  PP+A+P P A PP    PP ATPP T +PP    PP+AT PPT +PP P S    SP
Sbjct: 97  PPPPPSASPPPAAAPPP---PPFATPPPTNSPP---PPPSATPPPTISPPPPGSQ---SP 147

Query: 178 PAPTPA-STPSTAPTPSTAGSPPAPTP--------DSLGPGPSGADTP 294
           PA  P+ ST  T P P    SPP+P+P        D + P  +G+  P
Sbjct: 148 PARAPSNSTGGTPPAPPKPPSPPSPSPSASHRAPADPISPSSNGSGIP 195

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 43/109 (39%), Positives = 58/109 (53%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPP---TATPPTATPPAP---ASSP 165
           P  P   +P P   PP + +PP   PP  +PP A+TPP   +A+PP A  P P   A+ P
Sbjct: 64  PPPPVVTSPPPPDPPPPSVSPP---PPALSPPPASTPPPPPSASPPPAAAPPPPPFATPP 120

Query: 166 ATSPPAPTPAST--PSTAPTPSTAGSPPAPTP-DSLGPGPSGADTPPPP 303
            T+ P P P++T  P+ +P P  + SPPA  P +S G  P     PP P
Sbjct: 121 PTNSPPPPPSATPPPTISPPPPGSQSPPARAPSNSTGGTPPAPPKPPSP 169

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/108 (40%), Positives = 52/108 (48%), Gaps = 12/108 (11%)
 Frame = +1

Query: 13  PPTAT----PAPKAQPPAA--ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           PP A+    PAP A PP    + PP ++PP   PP A  PP   PP  T P P   P  S
Sbjct: 25  PPPASNSPPPAPNAPPPPTPPSPPPASSPPPTPPPPADVPP---PPVVTSPPPPDPPPPS 81

Query: 175 PPAPTPASTP---STAPTPSTAGSPPA---PTPDSLGPGPSGADTPPP 300
              P PA +P   ST P P +A  PPA   P P    P P+ +  PPP
Sbjct: 82  VSPPPPALSPPPASTPPPPPSASPPPAAAPPPPPFATPPPTNSPPPPP 129

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 43/115 (37%), Positives = 56/115 (48%), Gaps = 15/115 (13%)
 Frame = +1

Query: 4   PTKPP----------TATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP 153
           PT PP          T+ P P   PP+ + PP A  P   PPA+  PP   PP+A+PP  
Sbjct: 55  PTPPPPADVPPPPVVTSPPPPDPPPPSVSPPPPALSP---PPASTPPP---PPSASPPPA 108

Query: 154 ASSP----ATSPPAPTPASTPSTAPTPSTAGSPP-APTPDSLGPGPSGADTPPPP 303
           A+ P    AT PP  +P   PS  P P+ +  PP + +P +  P  S   TPP P
Sbjct: 109 AAPPPPPFATPPPTNSPPPPPSATPPPTISPPPPGSQSPPARAPSNSTGGTPPAP 163

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 41/105 (39%), Positives = 55/105 (52%), Gaps = 17/105 (16%)
 Frame = +1

Query: 40  AQPPAAATPPTATPPTATPPAAATPPTATPPTAT---PPAPASSPATSPPAPTPASTPST 210
           + PP +   P+ATPP+ +PP    P + +PP A+   PPAP + P  +PP+P PAS+P  
Sbjct: 2   SSPPPS---PSATPPSTSPP---PPSSLSPPPASNSPPPAPNAPPPPTPPSPPPASSPPP 55

Query: 211 APTPS---------TAGSPPAPTPDSLGP-----GPSGADTPPPP 303
            P P          T+  PP P P S+ P      P  A TPPPP
Sbjct: 56  TPPPPADVPPPPVVTSPPPPDPPPPSVSPPPPALSPPPASTPPPP 100

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 40/95 (42%), Positives = 53/95 (55%), Gaps = 9/95 (9%)
 Frame = +1

Query: 1   APTKPPTATPAP---KAQPPAAATPPTATPPTATPPAAATPPTATPPTA---TPPAPASS 162
           AP  PP ATP P      PP+A  PPT +PP   PP + +PP   P  +   TPPAP   
Sbjct: 110 APPPPPFATPPPTNSPPPPPSATPPPTISPP---PPGSQSPPARAPSNSTGGTPPAPPKP 166

Query: 163 PATSPPAPTPAST---PSTAPTPSTAGSPPAPTPD 258
           P  SPP+P+P+++   P+   +PS+ GS   PT D
Sbjct: 167 P--SPPSPSPSASHRAPADPISPSSNGS-GIPTSD 198

[90][TOP]
>UniRef100_B9RLA3 ATP binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RLA3_RICCO
          Length = 811

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 48/108 (44%), Positives = 59/108 (54%), Gaps = 11/108 (10%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPP----TATPPAAATPPTATPPTATPPAPASS--PAT- 171
           PP    AP  QPP A+ PPT +PP     A PP + +PP    P   PP P SS  PAT 
Sbjct: 102 PPANASAPTPQPPVASPPPTTSPPPPSPNADPPTSNSPPPPQSPVQLPPPPVSSTPPATP 161

Query: 172 -SPPA--PTPASTPSTAPTPSTAGSPP-APTPDSLGPGPSGADTPPPP 303
             PP   P P++TP+T+P PS+A  P  +P P SL P      +PPPP
Sbjct: 162 SDPPTSPPPPSNTPTTSPPPSSARPPANSPPPASLSPPQESPPSPPPP 209

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/112 (41%), Positives = 61/112 (54%), Gaps = 13/112 (11%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAA--ATPPTAT--------PPTATPPAPA 156
           +KPP   P+P   P   + PPT +PP+  PP A  + PPT +        PP  +PP PA
Sbjct: 211 SKPPENPPSPPPPPATPSEPPTNSPPSPPPPPATPSEPPTNSSPPPVSVPPPRRSPPGPA 270

Query: 157 SSPATSPPAPTPASTPSTAPTPSTAGSPP---APTPDSLGPGPSGADTPPPP 303
           ++P T+ P P PASTP  +  P  A +PP    P P S+ P PS A  PPPP
Sbjct: 271 ATPPTTSP-PPPASTPPASSPPPPASAPPENSPPPPASIAPTPSNA--PPPP 319

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/105 (44%), Positives = 61/105 (58%), Gaps = 7/105 (6%)
 Frame = +1

Query: 4   PTKPPT-ATPAPKAQPPAAATP--PTATPPTATPPAAATPPTATPPTATPPAPASS-PAT 171
           P++PPT ++P P + PP   +P  P ATPPT +PP    PP +TPP ++PP PAS+ P  
Sbjct: 245 PSEPPTNSSPPPVSVPPPRRSPPGPAATPPTTSPP----PPASTPPASSPPPPASAPPEN 300

Query: 172 SPPAPTP-ASTPSTAPTP--STAGSPPAPTPDSLGPGPSGADTPP 297
           SPP P   A TPS AP P   T   P  PTP      P+ + +PP
Sbjct: 301 SPPPPASIAPTPSNAPPPPGRTPFPPSQPTPSPSNSTPNASTSPP 345

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 45/107 (42%), Positives = 61/107 (57%), Gaps = 11/107 (10%)
 Frame = +1

Query: 13  PPTATPAPKAQPPA-AATPPTATPP--TATPPAAATPPTAT-PPTATPPAPAS---SPAT 171
           PP + P P+  PP  AATPPT +PP   +TPPA++ PP A+ PP  +PP PAS   +P+ 
Sbjct: 255 PPVSVPPPRRSPPGPAATPPTTSPPPPASTPPASSPPPPASAPPENSPPPPASIAPTPSN 314

Query: 172 SPPAPTPASTPSTAPTPSTAGSPP----APTPDSLGPGPSGADTPPP 300
           +PP P     P + PTPS + S P    +P   +L P P    + PP
Sbjct: 315 APPPPGRTPFPPSQPTPSPSNSTPNASTSPPLITLSPPPPSLSSAPP 361

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/102 (40%), Positives = 57/102 (55%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPP-TATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P+ PPT+ P P   P  +  P +A PP  + PPA+ +PP  +PP  +PP P+S P  +PP
Sbjct: 161 PSDPPTSPPPPSNTPTTSPPPSSARPPANSPPPASLSPPQESPP--SPPPPSSKPPENPP 218

Query: 181 A-PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           + P P +TPS  PT     SPP+P P    P     ++ PPP
Sbjct: 219 SPPPPPATPSEPPT----NSPPSPPPPPATPSEPPTNSSPPP 256

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 43/107 (40%), Positives = 61/107 (57%), Gaps = 10/107 (9%)
 Frame = +1

Query: 13  PPTATP---APKAQPPAAATPPTATPPT--ATPPAAATPP-TATPPTATPPAPASSPATS 174
           PPT +P   +P A PP + +PP    P     PP ++TPP T + P  +PP P+++P TS
Sbjct: 119 PPTTSPPPPSPNADPPTSNSPPPPQSPVQLPPPPVSSTPPATPSDPPTSPPPPSNTPTTS 178

Query: 175 PPAPTPASTPSTAPTPSTAG----SPPAPTPDSLGPGPSGADTPPPP 303
           PP P+ A  P+ +P P++      SPP+P P S  P P    +PPPP
Sbjct: 179 PP-PSSARPPANSPPPASLSPPQESPPSPPPPSSKP-PENPPSPPPP 223

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 42/110 (38%), Positives = 56/110 (50%), Gaps = 15/110 (13%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPT--ATPPTATPPAAATPPTATPPTAT-------PPAPASSP 165
           PP  +P     PP ++TPP   + PPT+ PP + TP T+ PP++        PPA  S P
Sbjct: 140 PPPQSPVQLPPPPVSSTPPATPSDPPTSPPPPSNTPTTSPPPSSARPPANSPPPASLSPP 199

Query: 166 ATSPPAPTPAST------PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
             SPP+P P S+      PS  P P+T   PP  +P S  P P+    PP
Sbjct: 200 QESPPSPPPPSSKPPENPPSPPPPPATPSEPPTNSPPSPPPPPATPSEPP 249

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 37/101 (36%), Positives = 51/101 (50%), Gaps = 4/101 (3%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA-PT 189
           P +A P   + PPA+ +PP  +PP+  PP++  P     P   P  P+  P  SPP+ P 
Sbjct: 181 PSSARPPANSPPPASLSPPQESPPSPPPPSSKPPENPPSPPPPPATPSEPPTNSPPSPPP 240

Query: 190 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSG---ADTPPPP 303
           P +TPS  PT S+      P P    PGP+      +PPPP
Sbjct: 241 PPATPSEPPTNSSPPPVSVPPPRRSPPGPAATPPTTSPPPP 281

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 42/107 (39%), Positives = 52/107 (48%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPP---TATPPTATPPAPASSPATS 174
           P  P T +P P+   P   TP T +PP+ TP A    P    A+ PT  PP  +  P TS
Sbjct: 67  PPDPLTTSPIPQ---PNVTTPSTPSPPSQTPSAVVVSPPPANASAPTPQPPVASPPPTTS 123

Query: 175 PPAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPG-PSGADTPPPP 303
           PP P+P + P T+ +P    SP   P P   S  P  PS   T PPP
Sbjct: 124 PPPPSPNADPPTSNSPPPPQSPVQLPPPPVSSTPPATPSDPPTSPPP 170

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 9/106 (8%)
 Frame = +1

Query: 13  PPTA-TPAPKAQPPAAATPPTATPPTAT---PPAAATPPTATPPTATPPAPASSPATSPP 180
           PPT+ +P P   P     PP ++ P AT   PP +  PP+ TP T+ PP+ A  PA SPP
Sbjct: 133 PPTSNSPPPPQSPVQLPPPPVSSTPPATPSDPPTSPPPPSNTPTTSPPPSSARPPANSPP 192

Query: 181 APT---PASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPPP 303
             +   P  +P + P PS+    +PP+P P    P     ++PP P
Sbjct: 193 PASLSPPQESPPSPPPPSSKPPENPPSPPPPPATPSEPPTNSPPSP 238

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 40/105 (38%), Positives = 55/105 (52%), Gaps = 8/105 (7%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPT---ATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           PP A+ +P  + P +  PP++ PP    + PP  ATP  + PPT +PP+P   PAT    
Sbjct: 191 PPPASLSPPQESPPSPPPPSSKPPENPPSPPPPPATP--SEPPTNSPPSPPPPPATPSEP 248

Query: 184 PTPASTPS-TAPTPSTAGSPPAPTPDSLGPGPSG----ADTPPPP 303
           PT +S P  + P P  +   PA TP +  P P      A +PPPP
Sbjct: 249 PTNSSPPPVSVPPPRRSPPGPAATPPTTSPPPPASTPPASSPPPP 293

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 41/103 (39%), Positives = 50/103 (48%), Gaps = 5/103 (4%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTAT-PPTATPP----AAATPPTATPPTATPPAPASSP 165
           A T P T+ P P + PPA++ PP A+ PP  +PP     A TP  A PP    P P S P
Sbjct: 270 AATPPTTSPPPPASTPPASSPPPPASAPPENSPPPPASIAPTPSNAPPPPGRTPFPPSQP 329

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
             SP   TP    ST+P P    SPP P+  S  P  +    P
Sbjct: 330 TPSPSNSTP--NASTSP-PLITLSPPPPSLSSAPPSDNNTSAP 369

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/92 (39%), Positives = 48/92 (52%), Gaps = 6/92 (6%)
 Frame = +1

Query: 46  PPAAATPPTATPPTATP---PAAATPPTATPPTATPPAPASSPATSPPAPTPASTPS--- 207
           PP  ++PP   P T +P   P   TP T +PP+ TP A   SP   PPA   A TP    
Sbjct: 59  PPLQSSPPPPDPLTTSPIPQPNVTTPSTPSPPSQTPSAVVVSP---PPANASAPTPQPPV 115

Query: 208 TAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P+T+  PP+P  D     P  +++PPPP
Sbjct: 116 ASPPPTTSPPPPSPNAD-----PPTSNSPPPP 142

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 35/105 (33%), Positives = 48/105 (45%), Gaps = 8/105 (7%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTA----TPPTATPPAAATPPTATPPTATPPAPASSPA 168
           A T P ++ P P + PP  + PP A    TP  A PP   TP   + PT +P     + +
Sbjct: 282 ASTPPASSPPPPASAPPENSPPPPASIAPTPSNAPPPPGRTPFPPSQPTPSPSNSTPNAS 341

Query: 169 TSPP----APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 291
           TSPP    +P P S  S  P+ +   +P     +S  PG  G  T
Sbjct: 342 TSPPLITLSPPPPSLSSAPPSDNNTSAP----ENSKSPGDGGIGT 382

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 32/95 (33%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPA--AATPPTATPPTATPPAAATPPTATPPTATPPAPASSP--A 168
           +P  P +A P     PPA  A TP  A PP    P   + PT +P  +TP A  S P   
Sbjct: 289 SPPPPASAPPENSPPPPASIAPTPSNAPPPPGRTPFPPSQPTPSPSNSTPNASTSPPLIT 348

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG 273
            SPP P+ +S P +    S   +  +P    +G G
Sbjct: 349 LSPPPPSLSSAPPSDNNTSAPENSKSPGDGGIGTG 383

[91][TOP]
>UniRef100_A9PG83 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
           RepID=A9PG83_POPTR
          Length = 241

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 45/100 (45%), Positives = 52/100 (52%), Gaps = 1/100 (1%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAA-TPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           T PPT TP    Q PA+A TPPTAT P ++P     P T TP    P  P SSPA +P  
Sbjct: 36  TPPPTTTPTTPTQSPASAVTPPTATTPISSPSPKVAPAT-TPVVPPPQPPQSSPAATPIP 94

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P     P  +P P+ A  PPAP P    P P+ A  PP P
Sbjct: 95  PPATPPPQVSPAPAPATPPPAPAPAKEVPAPAPATPPPAP 134

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 49/114 (42%), Positives = 56/114 (49%), Gaps = 24/114 (21%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATP----------------PTATPPTATPPAAATPPTATPPTATPP 147
           PT +PA    PP A TP                P   PP ++P A   PP ATPP    P
Sbjct: 46  PTQSPASAVTPPTATTPISSPSPKVAPATTPVVPPPQPPQSSPAATPIPPPATPPPQVSP 105

Query: 148 APASSPATSPPAPTPA--------STPSTAPTPSTAGSPPAPTPDSLGPGPSGA 285
           APA  PAT PPAP PA        +TP  AP P+ A  PPAP+P SL P P+ A
Sbjct: 106 APA--PATPPPAPAPAKEVPAPAPATPPPAPVPAPAIPPPAPSP-SLVPSPAPA 156

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 47/115 (40%), Positives = 55/115 (47%), Gaps = 15/115 (13%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P +PP ++PA    PP A  PP  +P     PA ATPP A  P    PAPA  PAT PPA
Sbjct: 80  PPQPPQSSPAATPIPPPATPPPQVSPA----PAPATPPPAPAPAKEVPAPA--PATPPPA 133

Query: 184 PTPA-STPSTAPTPSTAGSP-PAPTPDSL-------------GPGPSGADTPPPP 303
           P PA + P  AP+PS   SP PAP    +              P P+    P PP
Sbjct: 134 PVPAPAIPPPAPSPSLVPSPAPAPGKHKMKRKHKHKHHHHAPAPAPNPPSPPAPP 188

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 45/123 (36%), Positives = 54/123 (43%), Gaps = 30/123 (24%)
 Frame = +1

Query: 13  PPTATPAPKAQP-PAAATPPTATPPT--------ATPPAAATPPTATPPTATPPAPASSP 165
           PP ATP P+  P PA ATPP A  P         ATPP A  P  A PP A  P+P+  P
Sbjct: 94  PPPATPPPQVSPAPAPATPPPAPAPAKEVPAPAPATPPPAPVPAPAIPPPA--PSPSLVP 151

Query: 166 ATSP---------------------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG 282
           + +P                     PAP P S P+  PT +TA    AP      P P+G
Sbjct: 152 SPAPAPGKHKMKRKHKHKHHHHAPAPAPNPPSPPA-PPTVTTASEDTAP-----APSPNG 205

Query: 283 ADT 291
            +T
Sbjct: 206 GNT 208

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 37/84 (44%), Positives = 41/84 (48%), Gaps = 5/84 (5%)
 Frame = +1

Query: 67  PTATPPTATPPAA-ATPPTAT-PPTATPPAPASSPA---TSPPAPTPASTPSTAPTPSTA 231
           P A     TP  + +TP T T PPT TP  P  SPA   T P A TP S+PS    P+T 
Sbjct: 16  PLAITDAQTPAVSPSTPTTTTPPPTTTPTTPTQSPASAVTPPTATTPISSPSPKVAPATT 75

Query: 232 GSPPAPTPDSLGPGPSGADTPPPP 303
              P P P    P  S A TP PP
Sbjct: 76  PVVPPPQP----PQSSPAATPIPP 95

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 38/96 (39%), Positives = 42/96 (43%), Gaps = 20/96 (20%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTA-TPPTATPPAAATPPTATPPTATP------------- 144
           T PP   PA +   PA ATPP A  P  A PP A +P     P   P             
Sbjct: 111 TPPPAPAPAKEVPAPAPATPPPAPVPAPAIPPPAPSPSLVPSPAPAPGKHKMKRKHKHKH 170

Query: 145 ----PAPASSPATSPPAPTPASTPS--TAPTPSTAG 234
               PAPA +P  SPPAP   +T S  TAP PS  G
Sbjct: 171 HHHAPAPAPNP-PSPPAPPTVTTASEDTAPAPSPNG 205

[92][TOP]
>UniRef100_Q95JC9-2 Isoform 2 of Basic proline-rich protein n=1 Tax=Sus scrofa
           RepID=Q95JC9-2
          Length = 511

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 265 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 324

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 325 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 367

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 286 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 345

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 346 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 388

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 307 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 366

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 367 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 409

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 328 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 387

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 388 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 430

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 349 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 408

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 409 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 451

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/107 (41%), Positives = 46/107 (42%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 370 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 429

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS----LGPGPSG---ADTPPPP 303
           P P   P   P P  A  PP P P +     GP PSG      PPPP
Sbjct: 430 PPPPGPPPPGPAPPGARPPPGPPPPADEPQQGPAPSGDKPKKKPPPP 476

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 42/101 (41%), Positives = 42/101 (41%), Gaps = 3/101 (2%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPT 189
           KP    P P   PP    PP   PP   PP A  PP   PP   PP PA   A  PP P 
Sbjct: 225 KPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP 284

Query: 190 PASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 285 PPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 325

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 44/114 (38%), Positives = 44/114 (38%), Gaps = 14/114 (12%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTA-----------TPPAAATPPTATPPTATPPA 150
           P  PP   P P   PP    PP A PP              PP A  PP   PP   PP 
Sbjct: 233 PAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 292

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           PA   A  PP P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 293 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 346

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 43/111 (38%), Positives = 44/111 (39%), Gaps = 12/111 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 244 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 303

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSL---GPGPSGA---------DTPPP 300
           P P   P   P P  A  PP P P      GP P GA           PPP
Sbjct: 304 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 354

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/107 (41%), Positives = 46/107 (42%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPK-AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P   P   PAP  A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP
Sbjct: 64  PGDGPEQGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 123

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDS----LGPGPS--GADTPPPP 303
            P P   P   P P  A  PP P P +     GP PS  G    PPP
Sbjct: 124 GPPPPGPPPPGPAPPGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPP 170

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 42/101 (41%), Positives = 44/101 (43%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 391 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 450

Query: 184 -PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P PA  P   P PS  G  P   P    P P+G   PPPP
Sbjct: 451 PPPPADEPQQGPAPS--GDKPKKKP----PPPAGPPPPPPP 485

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 41/114 (35%), Positives = 45/114 (39%), Gaps = 16/114 (14%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTA-------------TPPAAATPPTATPPTATPPA 150
           +PP   P+P A      +PP+A  P                PPA   PP   PP   PP 
Sbjct: 191 RPPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPG 250

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL---GPGPSGADTPPPP 303
           PA   A  PP P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 251 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 304

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 39/105 (37%), Positives = 41/105 (39%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P    P  A PP   PP   PP    PP A PP   PP     P   PP 
Sbjct: 80  PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP-----PGPPPPG 134

Query: 184 PT-PASTPSTAPTPSTAGSPPAPTPDSLG----PGPSGADTPPPP 303
           P  P + P   P P   G    P P  +G    P P GA  PP P
Sbjct: 135 PAPPGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPPPGAGHPPRP 179

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 43/119 (36%), Positives = 46/119 (38%), Gaps = 19/119 (15%)
 Frame = +1

Query: 4   PTKPPTATP-----APKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPA 168
           P  PP   P      P A+PP    PP   PP   PP A  PP   PP   PP PA   A
Sbjct: 81  PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 140

Query: 169 TSPPAPTPAS------------TPSTAPTPSTAGSPPAPTP--DSLGPGPSGADTPPPP 303
             PP P P +             P   P P  AG PP P P  +   PGP     PP P
Sbjct: 141 RPPPGPPPPAGGLQQGPAPSHVGPKKKPPPPGAGHPPRPPPPANESQPGPRPPPGPPSP 199

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 40/111 (36%), Positives = 43/111 (38%), Gaps = 13/111 (11%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAAT---------PPTATPPTA-TPPAAATPPTATPPTATPPAPAS 159
           +PP     P+  PP  +          PP   P     PP A  PP   PP   PP PA 
Sbjct: 36  RPPPGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAP 95

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
             A  PP P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 96  PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 146

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 36/97 (37%), Positives = 38/97 (39%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P    P  A PP   PP   PP    PP A PP   PP PA  P    PA
Sbjct: 406 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG-PPPPADEPQQG-PA 463

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
           P+    P   P P     PP P P  +      A TP
Sbjct: 464 PS-GDKPKKKPPPPAGPPPPPPPPPGIQGQKMSAKTP 499

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 42/136 (30%), Positives = 45/136 (33%), Gaps = 36/136 (26%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTA--------------- 138
           P  PP     P A+PP    PP   PP   PP A  PP   PP                 
Sbjct: 107 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPAGGLQQGPAPSHVGPKK 166

Query: 139 TPPAPASSPATSPPAPTPASTPSTAPTP---------STAGSPPAPTPDSLGPGPSG--- 282
            PP P +     PP P   S P   P P         S  GSPP+      GP PSG   
Sbjct: 167 KPPPPGAGHPPRPPPPANESQPGPRPPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKP 226

Query: 283 ---------ADTPPPP 303
                       PPPP
Sbjct: 227 KKKPPPPAGPPPPPPP 242

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 36/108 (33%), Positives = 43/108 (39%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4   PTKPPTAT---PAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           P  PP A    P P+  PP   +PP       +PP+A  P     P+   P     P   
Sbjct: 177 PRPPPPANESQPGPRP-PPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAG 235

Query: 175 PPAPTPASTPSTAPTPSTAGS-----PPAPTPDSLGPGPSGADTPPPP 303
           PP P P       P P+  G+     PP P P   GP P GA  PP P
Sbjct: 236 PPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 283

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 46/143 (32%), Positives = 48/143 (33%), Gaps = 43/143 (30%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTA-----------------TPPAAATPPTATPP 132
           P  PP   P P   PP A  PP   PP                    PP A  PP   PP
Sbjct: 123 PGPPPPGPPPPGPAPPGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPPPGAGHPPRPPPP 182

Query: 133 T-------ATPPAPASSPAT-----SPPA-------PTPASTPSTAPTPSTAGSPPAPTP 255
                     PP P S PA      SPP+       P P+        P  AG PP P P
Sbjct: 183 ANESQPGPRPPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAGPPPPPPP 242

Query: 256 DS----LGPGPSGA---DTPPPP 303
                  GP P GA     PPPP
Sbjct: 243 PPGPPPPGPAPPGARPPPGPPPP 265

[93][TOP]
>UniRef100_Q95JC9-3 Isoform 3 of Basic proline-rich protein n=1 Tax=Sus scrofa
           RepID=Q95JC9-3
          Length = 566

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 265 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 324

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 325 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 367

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 286 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 345

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 346 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 388

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 307 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 366

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 367 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 409

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 328 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 387

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 388 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 430

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/103 (41%), Positives = 44/103 (42%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 349 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 408

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 409 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 451

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/107 (41%), Positives = 46/107 (42%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 370 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 429

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDS----LGPGPSG---ADTPPPP 303
           P P   P   P P  A  PP P P +     GP PSG      PPPP
Sbjct: 430 PPPPGPPPPGPAPPGARPPPGPPPPADEPQQGPAPSGDKPKKKPPPP 476

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 40/98 (40%), Positives = 40/98 (40%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPT 189
           KP    P P   PP    PP   PP   PP A  PP   PP   PP PA   A  PP P 
Sbjct: 468 KPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP 527

Query: 190 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P   P   P P  A  PP P P   GP P      PPP
Sbjct: 528 PPGPPPPGPAPPGARPPPGPPPPPPGPSPPRPPPGPPP 565

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 42/101 (41%), Positives = 42/101 (41%), Gaps = 3/101 (2%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPT 189
           KP    P P   PP    PP   PP   PP A  PP   PP   PP PA   A  PP P 
Sbjct: 225 KPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP 284

Query: 190 PASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 285 PPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 325

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 44/114 (38%), Positives = 44/114 (38%), Gaps = 14/114 (12%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTA-----------TPPAAATPPTATPPTATPPA 150
           P  PP   P P   PP    PP A PP              PP A  PP   PP   PP 
Sbjct: 233 PAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 292

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
           PA   A  PP P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 293 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 346

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 46/115 (40%), Positives = 47/115 (40%), Gaps = 15/115 (13%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 391 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 450

Query: 184 -PTPASTPSTAPTPS----------TAGSPPAPT----PDSLGPGPSGADTPPPP 303
            P PA  P   P PS           AG PP P     P   GP P GA  PP P
Sbjct: 451 PPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPPPGP 505

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 43/111 (38%), Positives = 44/111 (39%), Gaps = 12/111 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 244 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 303

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSL---GPGPSGA---------DTPPP 300
           P P   P   P P  A  PP P P      GP P GA           PPP
Sbjct: 304 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 354

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/107 (41%), Positives = 46/107 (42%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPK-AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P   P   PAP  A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP
Sbjct: 64  PGDGPEQGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 123

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDS----LGPGPS--GADTPPPP 303
            P P   P   P P  A  PP P P +     GP PS  G    PPP
Sbjct: 124 GPPPPGPPPPGPAPPGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPP 170

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 44/120 (36%), Positives = 44/120 (36%), Gaps = 20/120 (16%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPT-----------------ATPPAAATPPTATPP 132
           P  PP   P P   PP A  PP   PP                    PPA   PP   PP
Sbjct: 428 PGPPPPGPPPPGPAPPGARPPPGPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPPPPPP 487

Query: 133 TATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL---GPGPSGADTPPPP 303
              PP PA   A  PP P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 488 GPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 547

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 36/91 (39%), Positives = 37/91 (40%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP A PP   PP    PP   PP A PP     P   PP 
Sbjct: 476 PAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 535

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGP 276
           P P   P   P P     PP P+P    PGP
Sbjct: 536 PAP---PGARPPPGPPPPPPGPSPPRPPPGP 563

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 40/103 (38%), Positives = 41/103 (39%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P    P  A PP   PP A  P     P+   P   PP PA  P   PP 
Sbjct: 427 PPGPPPPGPPPPGPAPPGARPPPGPPPPADEPQQGPAPSGDKPKKKPPPPAGPP---PPP 483

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSL---GPGPSGADTPPPP 303
           P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 484 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 526

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 41/114 (35%), Positives = 45/114 (39%), Gaps = 16/114 (14%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTA-------------TPPAAATPPTATPPTATPPA 150
           +PP   P+P A      +PP+A  P                PPA   PP   PP   PP 
Sbjct: 191 RPPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAGPPPPPPPPPGPPPPG 250

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL---GPGPSGADTPPPP 303
           PA   A  PP P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 251 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 304

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 39/105 (37%), Positives = 41/105 (39%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P    P  A PP   PP   PP    PP A PP   PP     P   PP 
Sbjct: 80  PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP-----PGPPPPG 134

Query: 184 PT-PASTPSTAPTPSTAGSPPAPTPDSLG----PGPSGADTPPPP 303
           P  P + P   P P   G    P P  +G    P P GA  PP P
Sbjct: 135 PAPPGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPPPGAGHPPRP 179

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 43/119 (36%), Positives = 46/119 (38%), Gaps = 19/119 (15%)
 Frame = +1

Query: 4   PTKPPTATP-----APKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPA 168
           P  PP   P      P A+PP    PP   PP   PP A  PP   PP   PP PA   A
Sbjct: 81  PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 140

Query: 169 TSPPAPTPAS------------TPSTAPTPSTAGSPPAPTP--DSLGPGPSGADTPPPP 303
             PP P P +             P   P P  AG PP P P  +   PGP     PP P
Sbjct: 141 RPPPGPPPPAGGLQQGPAPSHVGPKKKPPPPGAGHPPRPPPPANESQPGPRPPPGPPSP 199

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 38/108 (35%), Positives = 39/108 (36%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P    P  A PP   PP   PP    PP A PP   PP PA  P   P  
Sbjct: 406 PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP-PADEPQQGPAP 464

Query: 184 --------PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                   P P + P   P P     PP P P    P P      PPP
Sbjct: 465 SGDKPKKKPPPPAGPPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPP 512

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 40/111 (36%), Positives = 43/111 (38%), Gaps = 13/111 (11%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAAT---------PPTATPPTA-TPPAAATPPTATPPTATPPAPAS 159
           +PP     P+  PP  +          PP   P     PP A  PP   PP   PP PA 
Sbjct: 36  RPPPGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAP 95

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDS---LGPGPSGADTPPPP 303
             A  PP P P   P   P P  A  PP P P      GP P GA  PP P
Sbjct: 96  PGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 146

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 34/84 (40%), Positives = 35/84 (41%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP     P A+PP    PP   PP   PP A  PP   PP   PP PA   A  PP 
Sbjct: 487 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 546

Query: 184 PTPASTPSTAPTPSTAGSPPAPTP 255
           P     P   P PS    PP P P
Sbjct: 547 P-----PPPPPGPSPPRPPPGPPP 565

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 42/136 (30%), Positives = 45/136 (33%), Gaps = 36/136 (26%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTA--------------- 138
           P  PP     P A+PP    PP   PP   PP A  PP   PP                 
Sbjct: 107 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPAGGLQQGPAPSHVGPKK 166

Query: 139 TPPAPASSPATSPPAPTPASTPSTAPTP---------STAGSPPAPTPDSLGPGPSG--- 282
            PP P +     PP P   S P   P P         S  GSPP+      GP PSG   
Sbjct: 167 KPPPPGAGHPPRPPPPANESQPGPRPPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKP 226

Query: 283 ---------ADTPPPP 303
                       PPPP
Sbjct: 227 KKKPPPPAGPPPPPPP 242

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 36/108 (33%), Positives = 43/108 (39%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4   PTKPPTAT---PAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           P  PP A    P P+  PP   +PP       +PP+A  P     P+   P     P   
Sbjct: 177 PRPPPPANESQPGPRP-PPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAG 235

Query: 175 PPAPTPASTPSTAPTPSTAGS-----PPAPTPDSLGPGPSGADTPPPP 303
           PP P P       P P+  G+     PP P P   GP P GA  PP P
Sbjct: 236 PPPPPPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGP 283

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 46/143 (32%), Positives = 48/143 (33%), Gaps = 43/143 (30%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTA-----------------TPPAAATPPTATPP 132
           P  PP   P P   PP A  PP   PP                    PP A  PP   PP
Sbjct: 123 PGPPPPGPPPPGPAPPGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPPPGAGHPPRPPPP 182

Query: 133 T-------ATPPAPASSPAT-----SPPA-------PTPASTPSTAPTPSTAGSPPAPTP 255
                     PP P S PA      SPP+       P P+        P  AG PP P P
Sbjct: 183 ANESQPGPRPPPGPPSPPANDSQEGSPPSADGPQQGPAPSGDKPKKKPPPPAGPPPPPPP 242

Query: 256 DS----LGPGPSGA---DTPPPP 303
                  GP P GA     PPPP
Sbjct: 243 PPGPPPPGPAPPGARPPPGPPPP 265

[94][TOP]
>UniRef100_Q6VTQ5 Putative uncharacterized protein n=1 Tax=Choristoneura fumiferana
           DEF MNPV RepID=Q6VTQ5_NPVCD
          Length = 218

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 45/100 (45%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASSPATSPPAP 186
           +PPT +P P   PP+   PPT +P T +P  + TP    PPT  P P+P  SP T PP P
Sbjct: 29  EPPTPSPTPSPTPPSPTPPPTPSP-TPSPTPSPTPSPTPPPTPLPTPSPTPSP-TPPPTP 86

Query: 187 TPASTPSTAPTPSTAGSP-PAPT-PDSLGPGPSGADTPPP 300
            P  +P+ +PTPS   SP P+PT P +  P P+ + TPPP
Sbjct: 87  LPTPSPTPSPTPSPTPSPTPSPTPPPTPSPTPTPSPTPPP 126

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 4/93 (4%)
 Frame = +1

Query: 1   APTKPPTA--TPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASSPAT 171
           +PT PPT   TP+P   P  + TPP    PT +P  + TPP    PT +P P+P  SP  
Sbjct: 43  SPTPPPTPSPTPSPTPSPTPSPTPPPTPLPTPSPTPSPTPPPTPLPTPSPTPSPTPSPTP 102

Query: 172 SP-PAPTPASTPSTAPTPSTAGSPPAPTPDSLG 267
           SP P+PTP  TPS  PTP+ + +PP P+P+ LG
Sbjct: 103 SPTPSPTPPPTPS--PTPTPSPTPP-PSPEPLG 132

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 29/76 (38%), Positives = 35/76 (46%), Gaps = 1/76 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATP-PAAATPPTATPPTATPPAPASSPATSPP 180
           PT  PT +P P   PP    P  +  P+ TP P  +  P+ TPP    P P  SP T PP
Sbjct: 68  PTPLPTPSPTPSPTPPPTPLPTPSPTPSPTPSPTPSPTPSPTPPPTPSPTPTPSP-TPPP 126

Query: 181 APTPASTPSTAPTPST 228
           +P P   P   P   T
Sbjct: 127 SPEPLGEPMYFPAEIT 142

[95][TOP]
>UniRef100_A8C635 Putative uncharacterized protein n=1 Tax=Antheraea pernyi
           nucleopolyhedrovirus RepID=A8C635_NPVAP
          Length = 204

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 44/88 (50%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = +1

Query: 43  QPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTP--STAP 216
           QP    TPPT TPP + PP+    PT TPPT TPP    SP  +PP PTP+ TP   T P
Sbjct: 32  QPLPTPTPPTPTPPPSPPPS----PTPTPPTPTPPP---SPTPTPPTPTPSPTPPTPTPP 84

Query: 217 TPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            PS   +PP+PTP +  P PS   +PPP
Sbjct: 85  PPSPTPTPPSPTPPTPTPPPSPPPSPPP 112

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/86 (51%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATP-PTATPPTATPPAPASSPATSPPAPT 189
           PPT TP P   P    TPPT TPP +  P   TP P+ TPPT TPP P  SP  +PP+PT
Sbjct: 39  PPTPTPPPSPPPSPTPTPPTPTPPPSPTPTPPTPTPSPTPPTPTPPPP--SPTPTPPSPT 96

Query: 190 PASTPSTAPTPSTAGSPPAPTPDSLG 267
           P   P+  P PS   SPP P P+ LG
Sbjct: 97  P---PTPTPPPSPPPSPP-PNPEPLG 118

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +1

Query: 115 PTATPPTAT-PPAPASSPATSPPAPTPASTPS-TAPTPSTAGSPPAPTPDSLGPGPSGAD 288
           PT TPPT T PP+P  SP  +PP PTP  +P+ T PTP+ + +PP PTP    P PS   
Sbjct: 35  PTPTPPTPTPPPSPPPSPTPTPPTPTPPPSPTPTPPTPTPSPTPPTPTP----PPPSPTP 90

Query: 289 TPPPP 303
           TPP P
Sbjct: 91  TPPSP 95

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 35/75 (46%), Positives = 40/75 (53%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           PT PP+ TP P    P+  TPPT TPP  +P    TPP+ TPPT TP  P S P + PP 
Sbjct: 59  PTPPPSPTPTPPTPTPSP-TPPTPTPPPPSP--TPTPPSPTPPTPTP--PPSPPPSPPPN 113

Query: 184 PTPASTPSTAPTPST 228
           P P   P   P   T
Sbjct: 114 PEPLGEPMYFPADIT 128

[96][TOP]
>UniRef100_B8HBY3 Peptidase M23 n=1 Tax=Arthrobacter chlorophenolicus A6
           RepID=B8HBY3_ARTCA
          Length = 487

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 46/107 (42%), Positives = 53/107 (49%), Gaps = 8/107 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSP---ATS 174
           PT  PT TP P   P    TP     PT TP A +T P+ TP   T PAP+ SP   +T 
Sbjct: 362 PTPTPTPTPTPSPSPSPTQTPRPTPTPTPTPSAPSTTPSPTPTAPTSPAPSPSPTPTSTP 421

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPT---PDSL--GPGPSGADTPPP 300
            P PTP  TP+  PTP+   S P PT   P S    P P+   TP P
Sbjct: 422 VPTPTPVPTPTPTPTPTPTASSPTPTAPPPSSATPSPAPTSTVTPTP 468

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/115 (40%), Positives = 58/115 (50%), Gaps = 15/115 (13%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP-----PTATPPAPASSPA 168
           P+  PT TP P   P A A  PT TP     P+ +  PT TP     PT TP AP+++P+
Sbjct: 341 PSPSPTPTPTPTPSPTAPAATPTPTPTPTPTPSPSPSPTQTPRPTPTPTPTPSAPSTTPS 400

Query: 169 TSP---------PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPPP 303
            +P         P+PTP STP   PTP    +P P PTP +  P P    T PPP
Sbjct: 401 PTPTAPTSPAPSPSPTPTSTPVPTPTPVPTPTPTPTPTPTASSPTP----TAPPP 451

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 48/125 (38%), Positives = 57/125 (45%), Gaps = 25/125 (20%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATP-------------------PTATPPAAATPPTA 123
           +P+  PT TP P    PAA   PT TP                   PT TP A +T P+ 
Sbjct: 342 SPSPTPTPTPTPSPTAPAATPTPTPTPTPTPSPSPSPTQTPRPTPTPTPTPSAPSTTPSP 401

Query: 124 TPPTATPPAPASSP---ATSPPAPTPASTPSTAPTPSTAGSPPAPT---PDSLGPGPSGA 285
           TP   T PAP+ SP   +T  P PTP  TP+  PTP+   S P PT   P S  P P+  
Sbjct: 402 TPTAPTSPAPSPSPTPTSTPVPTPTPVPTPTPTPTPTPTASSPTPTAPPPSSATPSPAPT 461

Query: 286 DTPPP 300
            T  P
Sbjct: 462 STVTP 466

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 46/109 (42%), Positives = 61/109 (55%), Gaps = 9/109 (8%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQ---PPAAATPPTATP-PTATPPAAATPPTATP---PTATP-PAPA 156
           +P+  P+ TP P      PP A   P+ +P PT TP  + T P ATP   PT TP P+P+
Sbjct: 316 SPSPSPSVTPGPTGTVLPPPGAPQVPSPSPTPTPTPTPSPTAPAATPTPTPTPTPTPSPS 375

Query: 157 SSPATSP-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            SP  +P P PTP  TPS AP+ + + +P APT  +  P P+   TP P
Sbjct: 376 PSPTQTPRPTPTPTPTPS-APSTTPSPTPTAPTSPAPSPSPTPTSTPVP 423

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/101 (40%), Positives = 53/101 (52%), Gaps = 1/101 (0%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP- 177
           +PT+ P  TP P   P A +T P+ TP   T PA +  PT T      P P  +P  +P 
Sbjct: 377 SPTQTPRPTPTPTPTPSAPSTTPSPTPTAPTSPAPSPSPTPTSTPVPTPTPVPTPTPTPT 436

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P PT +S   TAP PS+A   PAPT  ++ P P+ A T  P
Sbjct: 437 PTPTASSPTPTAPPPSSATPSPAPT-STVTPTPTAAPTSTP 476

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 41/102 (40%), Positives = 51/102 (50%), Gaps = 7/102 (6%)
 Frame = +1

Query: 19  TATPAPKAQP---PAAATPPTAT--PPTATPPAAATPPTATP-PTATPPAPASSPATSPP 180
           T TP   A P   P+    PT T  PP   P   +  PT TP PT +P APA++P    P
Sbjct: 308 TTTPPATASPSPSPSVTPGPTGTVLPPPGAPQVPSPSPTPTPTPTPSPTAPAATPT---P 364

Query: 181 APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPPP 303
            PTP  TPS +P+P+    P P PTP    P  + + TP  P
Sbjct: 365 TPTPTPTPSPSPSPTQTPRPTPTPTPTPSAPSTTPSPTPTAP 406

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 41/107 (38%), Positives = 49/107 (45%), Gaps = 13/107 (12%)
 Frame = +1

Query: 22  ATPAPKAQPPAAATPPTATPPTATPPAAATPPTAT--PPTATPPAPASSPATSP------ 177
           A P+   +  AA T P AT   +  P+    PT T  PP   P  P+ SP  +P      
Sbjct: 296 ADPSAGQEETAATTTPPATASPSPSPSVTPGPTGTVLPPPGAPQVPSPSPTPTPTPTPSP 355

Query: 178 --PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPPP 303
             PA TP  TP+  PTPS + SP   P PTP    P PS   T P P
Sbjct: 356 TAPAATPTPTPTPTPTPSPSPSPTQTPRPTPTPT-PTPSAPSTTPSP 401

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 38/90 (42%), Positives = 48/90 (53%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   APTKPPTATP-APKAQPPAAATPPTATP-PTATPPAAATP---PTATPPTATPPAPASSP 165
           AP+  P+ TP AP +  P+ +  PT+TP PT TP    TP   PT T  + TP AP  S 
Sbjct: 394 APSTTPSPTPTAPTSPAPSPSPTPTSTPVPTPTPVPTPTPTPTPTPTASSPTPTAPPPSS 453

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTP 255
           AT  PAPT   TP+    P++   P A  P
Sbjct: 454 ATPSPAPTSTVTPTPTAAPTSTPLPSATLP 483

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 39/96 (40%), Positives = 47/96 (48%), Gaps = 5/96 (5%)
 Frame = +1

Query: 28  PAPKAQPPAAATPPTATPPTATPPAAATP---PTATP-PTATPPAPASSPATSPPAPTPA 195
           P      P+A    TA   T TPPA A+P   P+ TP PT T   P  +P    P+PTP 
Sbjct: 291 PVGVGADPSAGQEETAA--TTTPPATASPSPSPSVTPGPTGTVLPPPGAPQVPSPSPTPT 348

Query: 196 STPSTAPTPSTAGSPPAPTP-DSLGPGPSGADTPPP 300
            TP+ +PT   A   P PTP  +  P PS   TP P
Sbjct: 349 PTPTPSPTAPAATPTPTPTPTPTPSPSPSPTQTPRP 384

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 44/101 (43%), Positives = 52/101 (51%), Gaps = 12/101 (11%)
 Frame = +1

Query: 4   PTKPPTATP-APKAQP---PAAATPPTATP---PTATPPAAATP-PTATP-PTATPPAPA 156
           PT  PT TP AP   P   P A T P  +P   PT+TP    TP PT TP PT TP A +
Sbjct: 384 PTPTPTPTPSAPSTTPSPTPTAPTSPAPSPSPTPTSTPVPTPTPVPTPTPTPTPTPTASS 443

Query: 157 SSPATSPPA---PTPASTPSTAPTPSTAGSPPAPTPDSLGP 270
            +P   PP+   P+PA T +  PTP TA     P P +  P
Sbjct: 444 PTPTAPPPSSATPSPAPTSTVTPTP-TAAPTSTPLPSATLP 483

[97][TOP]
>UniRef100_Q9LM00 Putative arabinogalactan protein n=1 Tax=Pinus taeda
           RepID=Q9LM00_PINTA
          Length = 236

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 57/131 (43%), Positives = 61/131 (46%), Gaps = 32/131 (24%)
 Frame = +1

Query: 1   APTKP------PTATPAPKAQPPAAA-------TPPTATPPTATPPAAATPPTATPPTAT 141
           APTKP      PT  P P  +PPA A        PP ATPP A PP A TPP A PP A 
Sbjct: 80  APTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVA-TPPVAAPPVAV 138

Query: 142 PPAPASSPATSPPAPTPAST--------------PSTAPTPSTAGSPPAPTPDSLGPGPS 279
           PPA  S PA  PP   PA +               + APTPS   SPP+P   S GP  S
Sbjct: 139 PPA--SPPAIPPPVQAPAPSHHKRKKKKKKHHHGSAPAPTPSALKSPPSPPLGSPGPSTS 196

Query: 280 G-----ADTPP 297
                 A TPP
Sbjct: 197 ADLFSPAPTPP 207

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 49/128 (38%), Positives = 55/128 (42%), Gaps = 27/128 (21%)
 Frame = +1

Query: 1   APTKP--PTAT------PAPKAQPPAAATPPTATPPTATPPAA--ATPPTATPPTATPPA 150
           APTKP  P A       PAP    P  A PPT  PP   P  A  + PP ATPP A PP 
Sbjct: 67  APTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPV 126

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTA-----------------GSPPAPTPDSLGPGPS 279
            A+ P  +PP   P ++P   P P  A                 GS PAPTP +L   PS
Sbjct: 127 -ATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKRKKKKKKHHHGSAPAPTPSALKSPPS 185

Query: 280 GADTPPPP 303
                P P
Sbjct: 186 PPLGSPGP 193

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 39/101 (38%), Positives = 42/101 (41%), Gaps = 4/101 (3%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTA--TPPTATPPAAATPPTATPPTATPPA--PASSPATSP 177
           KPPT TP   A  P    PP A    PT   P    P  A PPT  PPA  PA +P ++P
Sbjct: 55  KPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAP 114

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P  TP        TP  A  P A  P S    P     P P
Sbjct: 115 PVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAP 155

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 48/116 (41%), Positives = 50/116 (43%), Gaps = 16/116 (13%)
 Frame = +1

Query: 1   APT-KPPTATPAPKAQPPAAATPPTATP------PT--ATPPAAATPPTATPPTATPPAP 153
           APT KPPT  PA     P    PPT TP      PT  A P A A  PT   P  T P  
Sbjct: 37  APTAKPPTTAPAAPVSTPK---PPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTK 93

Query: 154 ASSPATSPPAPTPASTPSTAP---TPSTA----GSPPAPTPDSLGPGPSGADTPPP 300
           A  P T PPA  PA  P +AP   TP  A     +PP   P    P  S    PPP
Sbjct: 94  APPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPP 149

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/89 (39%), Positives = 41/89 (46%), Gaps = 3/89 (3%)
 Frame = +1

Query: 40  AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPT 219
           A  PAA   PTA PPT  P A  + P   PPT TP APA +P    P   PA  P+    
Sbjct: 32  ATAPAA---PTAKPPTTAPAAPVSTPK--PPTTTPVAPAVAPTKPAPPVAPAVAPTKPAP 86

Query: 220 PSTA---GSPPAPTPDSLGPGPSGADTPP 297
           P TA     PP   P ++ P  +    PP
Sbjct: 87  PVTAPTKAPPPTTKPPAVAPAKAPVSAPP 115

[98][TOP]
>UniRef100_C3Z6S3 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae
           RepID=C3Z6S3_BRAFL
          Length = 192

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 50/121 (41%), Positives = 51/121 (42%), Gaps = 20/121 (16%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPP--------TATPPTATPPAAATP------PTATPPTA 138
           AP  PP A P P A PP  A PP           PP   PPAA  P      PT  PP+ 
Sbjct: 33  APPPPPIAPPPPIAPPPPIAPPPPMDPPPPMAPPPPPPPPPAAPAPPVPAPVPTPAPPSI 92

Query: 139 TPPAPASSPATSPPAPTPASTPSTAPTP---STAGSP---PAPTPDSLGPGPSGADTPPP 300
           TP  P   P   PP P P   P   P P   S  G P   PAP PD   P P   D PPP
Sbjct: 93  TPVPPPPPPVAPPPLPPPLMPPPLPPAPNQDSRKGKPSPVPAPPPDPPAPAPPDPDPPPP 152

Query: 301 P 303
           P
Sbjct: 153 P 153

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 45/103 (43%), Positives = 47/103 (45%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1   APTKPPT--ATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATS 174
           APT PP   A P P A PP    PP A PP   PP A  PP A PP   PP P   P   
Sbjct: 7   APTAPPPPIAPPPPIAPPPMDPPPPIAPPP---PPIAPPPPIAPPPPIAPPPPMDPPPPM 63

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P P   P+ AP P      P P P S+ P P     PPPP
Sbjct: 64  APPPPPPPPPA-APAPPVPAPVPTPAPPSITPVP-----PPPP 100

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 40/97 (41%), Positives = 44/97 (45%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           PP A P     PP A  PP   PP   PP A  PP A PP   PP P + P   PP P  
Sbjct: 19  PPIAPPPMDPPPPIAPPPPPIAPP---PPIAPPPPIAPPPPMDPPPPMAPPPPPPPPPAA 75

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            + P  AP P+ A  PP+ TP    P P      PPP
Sbjct: 76  PAPPVPAPVPTPA--PPSITPVPPPPPPVAPPPLPPP 110

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/89 (38%), Positives = 37/89 (41%), Gaps = 1/89 (1%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           A   PP   P P   PP+    P   PP A PP    PP   PP   PPAP        P
Sbjct: 74  AAPAPPVPAPVPTPAPPSITPVPPPPPPVAPPPL---PPPLMPP-PLPPAPNQDSRKGKP 129

Query: 181 APTPASTPS-TAPTPSTAGSPPAPTPDSL 264
           +P PA  P   AP P     PP P P S+
Sbjct: 130 SPVPAPPPDPPAPAPPDPDPPPPPAPISI 158

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 28/66 (42%), Positives = 30/66 (45%)
 Frame = +1

Query: 106 ATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA 285
           A  PTA PP   PP P + P   PP P     P  AP P  A  PP   P  + P P  A
Sbjct: 5   APAPTAPPPPIAPPPPIAPPPMDPPPPIAPPPPPIAPPPPIAPPPPIAPPPPMDPPPPMA 64

Query: 286 DTPPPP 303
             PPPP
Sbjct: 65  PPPPPP 70

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 32/77 (41%), Positives = 34/77 (44%)
 Frame = +1

Query: 73  ATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPT 252
           A  PTA PP  A PP   PP   PP     P  +PP P  A  P  AP P  A  PP   
Sbjct: 5   APAPTAPPPPIAPPPPIAPPPMDPP-----PPIAPPPPPIAPPPPIAPPPPIAPPPPMDP 59

Query: 253 PDSLGPGPSGADTPPPP 303
           P  + P P     PPPP
Sbjct: 60  PPPMAPPP-----PPPP 71

[99][TOP]
>UniRef100_UPI0001983015 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983015
          Length = 469

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 47/116 (40%), Positives = 51/116 (43%), Gaps = 16/116 (13%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTA---------TP----PAAATPPTATPPTATP 144
           P  PP  TP P    P  A PP  TPP A         TP    P  A PP  TPP A  
Sbjct: 87  PPPPPKVTPPPPPPVPVPAPPPKGTPPPAPVPAPPPKETPPPPAPVPAPPPKETPPPAPV 146

Query: 145 PAPASSPATSPPAPTPASTPSTAPTPSTAGSPP---APTPDSLGPGPSGADTPPPP 303
           PAP       PPAP PA  P   P P+   +PP    P P +  P P   +TPPPP
Sbjct: 147 PAPPPKQTPPPPAPVPAPPPKETPPPAPVPAPPPKQTPPPPAPVPAPPPKETPPPP 202

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 48/114 (42%), Positives = 50/114 (43%), Gaps = 14/114 (12%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQ---PPAAATPPTAT----PPTATP----PAAATPPTATPPTATPPA 150
           P  PP  TP P A    PP   TPP A     PP  TP    P  A PP  TPP A  PA
Sbjct: 118 PAPPPKETPPPPAPVPAPPPKETPPPAPVPAPPPKQTPPPPAPVPAPPPKETPPPAPVPA 177

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAP---TPDSLGPGPSGADTPPPP 303
           P       PPAP PA  P   P P T    P P    P +  P P   +TPPPP
Sbjct: 178 PPPKQTPPPPAPVPAPPPKETPPPPTPVPAPPPKETPPPAPVPAPPPKETPPPP 231

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 46/107 (42%), Positives = 46/107 (42%), Gaps = 8/107 (7%)
 Frame = +1

Query: 4   PTKPPTATP--APKAQPPAAATPPTATPPTATPPAAATPPT---ATPPTATPPAPASSPA 168
           P  PP  TP  AP   PP   TPP   P  A PP    PP    A PP  TPP PA  PA
Sbjct: 133 PAPPPKETPPPAPVPAPPPKQTPPPPAPVPAPPPKETPPPAPVPAPPPKQTPPPPAPVPA 192

Query: 169 TSPPAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPP 300
             P    P  TP  AP P     P   PAP P    P PS    PPP
Sbjct: 193 PPPKETPPPPTPVPAPPPKETPPPAPVPAPPPKETPPPPSPVPAPPP 239

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 45/104 (43%), Positives = 48/104 (46%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASSPATSPP 180
           P  PP  TP P A  P  A PP  TPP A  P  A PP  TPP   P PAP       PP
Sbjct: 147 PAPPPKQTPPPPA--PVPAPPPKETPPPA--PVPAPPPKQTPPPPAPVPAPPPKETPPPP 202

Query: 181 APTPASTPSTAPTPSTAGSPP---APTPDSLGPGPSGADTPPPP 303
            P PA  P   P P+   +PP    P P S  P P   +T PPP
Sbjct: 203 TPVPAPPPKETPPPAPVPAPPPKETPPPPSPVPAPPPKETRPPP 246

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 45/108 (41%), Positives = 46/108 (42%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPA----- 168
           P  PP   P     PP    P  A PP  TPP A  P  A PP  TPP PA  PA     
Sbjct: 82  PPPPPPPPPPKVTPPPPPPVPVPAPPPKGTPPPAPVP--APPPKETPPPPAPVPAPPPKE 139

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPPAP---TPDSLGPGPSGADTPPPP 303
           T PPAP PA  P   P P      P P    P +  P P    TPPPP
Sbjct: 140 TPPPAPVPAPPPKQTPPPPAPVPAPPPKETPPPAPVPAPPPKQTPPPP 187

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 40/99 (40%), Positives = 44/99 (44%), Gaps = 4/99 (4%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTATPPTATP-PAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           P     P   PP    PP  TPP   P P  A PP  TPP A  PAP       PPAP P
Sbjct: 74  PPCIGKPCPPPPPPPPPPKVTPPPPPPVPVPAPPPKGTPPPAPVPAPPPKETPPPPAPVP 133

Query: 193 ASTPSTAPTPSTAGSPP---APTPDSLGPGPSGADTPPP 300
           A  P   P P+   +PP    P P +  P P   +TPPP
Sbjct: 134 APPPKETPPPAPVPAPPPKQTPPPPAPVPAPPPKETPPP 172

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 40/99 (40%), Positives = 42/99 (42%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  TP P + PP    P  A PP  TPP  A  P   P    P  P   P    PA
Sbjct: 358 PAPPPKVTPPPPSPPPPPPAPIPAPPPKETPPPPAPVPAPPPKKTLPQTP--PPPAPVPA 415

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P P  TP  AP P+    PP  TP  L P P     PPP
Sbjct: 416 PPPKETPPLAPVPA---PPPKETPPPLAPQPKETSPPPP 451

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 43/99 (43%), Positives = 44/99 (44%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P   P   P PK  PP A  P  A PP  TPP  A P  A PP  TPP P   PA  PP 
Sbjct: 156 PPPAPVPAPPPKETPPPAPVP--APPPKQTPPPPA-PVPAPPPKETPPPPTPVPA-PPPK 211

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            TP   P  AP P     PP+P P    P P     PPP
Sbjct: 212 ETPPPAPVPAPPPKETPPPPSPVP---APPPKETRPPPP 247

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 42/107 (39%), Positives = 47/107 (43%), Gaps = 11/107 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKA---QPPAAATPPTATPPTATPPAAATPPT---ATPPTATPPAPASSP 165
           P  PP  TP P A    PP   TPP  TP  A PP    PP    A PP  TPP P+  P
Sbjct: 176 PAPPPKQTPPPPAPVPAPPPKETPPPPTPVPAPPPKETPPPAPVPAPPPKETPPPPSPVP 235

Query: 166 A-----TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 291
           A     T PP PTP   P     P  +   PAP P ++    + A T
Sbjct: 236 APPPKETRPPPPTPVPAPPPQEDPECSTPAPAPPPTNIATAATSATT 282

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 45/107 (42%), Positives = 49/107 (45%), Gaps = 9/107 (8%)
 Frame = +1

Query: 7   TKPPTATPAP---KAQPPAA---ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPA 168
           T PP   PAP   +  PP A   A PP  TPP  T P  A PP  TPP A  PAP     
Sbjct: 169 TPPPAPVPAPPPKQTPPPPAPVPAPPPKETPPPPT-PVPAPPPKETPPPAPVPAPPPKET 227

Query: 169 TSPPAPTPASTP-STAPTPST--AGSPPAPTPDSLGPGPSGADTPPP 300
             PP+P PA  P  T P P T     PP   P+   P P+    PPP
Sbjct: 228 PPPPSPVPAPPPKETRPPPPTPVPAPPPQEDPECSTPAPA----PPP 270

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 39/110 (35%), Positives = 43/110 (39%), Gaps = 13/110 (11%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTAT---PPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           PP+  P P+   P    PP      PP    P    PP   PP  TPP P   P  +PP 
Sbjct: 49  PPSTPPPPRNSCPTQVCPPCVKGICPPCIGKPCPPPPPPPPPPKVTPPPPPPVPVPAPPP 108

Query: 184 P-TPASTPSTAPTPSTAGSPPAPT---------PDSLGPGPSGADTPPPP 303
             TP   P  AP P     PPAP          P +  P P    TPPPP
Sbjct: 109 KGTPPPAPVPAPPPKETPPPPAPVPAPPPKETPPPAPVPAPPPKQTPPPP 158

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 36/107 (33%), Positives = 44/107 (41%), Gaps = 10/107 (9%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTATPPAAA---TPP----TATPPTATPPAPASSPA 168
           K P     P + PP+   PP  + PT   P       PP       PP   PP P  +P 
Sbjct: 37  KCPPCIKVPCSPPPSTPPPPRNSCPTQVCPPCVKGICPPCIGKPCPPPPPPPPPPKVTPP 96

Query: 169 TSPPAPTPASTPSTAPTPSTAGSPP---APTPDSLGPGPSGADTPPP 300
             PP P PA  P   P P+   +PP    P P +  P P   +TPPP
Sbjct: 97  PPPPVPVPAPPPKGTPPPAPVPAPPPKETPPPPAPVPAPPPKETPPP 143

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 32/95 (33%), Positives = 37/95 (38%), Gaps = 9/95 (9%)
 Frame = +1

Query: 43  QPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTP 222
           +P     PP   P  A PP    PP + PP    P PA  P  +PP P P   P    T 
Sbjct: 344 EPCRPPPPPPPVPGPAPPPKVTPPPPSPPPPPPAPIPAPPPKETPPPPAPVPAPPPKKTL 403

Query: 223 STAGSPPAPTPD---------SLGPGPSGADTPPP 300
                PPAP P          +  P P   +TPPP
Sbjct: 404 PQTPPPPAPVPAPPPKETPPLAPVPAPPPKETPPP 438

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 34/81 (41%), Positives = 41/81 (50%), Gaps = 5/81 (6%)
 Frame = +1

Query: 4   PTKPPTATP--APKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPP---APASSPA 168
           P  PP  TP  AP   PP   TPP  +P  A PP    PP  TP  A PP      S+PA
Sbjct: 206 PAPPPKETPPPAPVPAPPPKETPPPPSPVPAPPPKETRPPPPTPVPAPPPQEDPECSTPA 265

Query: 169 TSPPAPTPASTPSTAPTPSTA 231
            +PP PT  +T +T+ T  T+
Sbjct: 266 PAPP-PTNIATAATSATTRTS 285

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 39/86 (45%), Positives = 39/86 (45%), Gaps = 3/86 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAA---ATPPTATPPTATPPAPASSPATS 174
           P  PP  TP P A  P  A PP  T P   PP A   A PP  TPP A  PAP       
Sbjct: 380 PAPPPKETPPPPA--PVPAPPPKKTLPQTPPPPAPVPAPPPKETPPLAPVPAP------- 430

Query: 175 PPAPTPASTPSTAPTPSTAGSPPAPT 252
           PP  TP   P  AP P    SPP PT
Sbjct: 431 PPKETP---PPLAPQPKET-SPPPPT 452

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 33/94 (35%), Positives = 38/94 (40%), Gaps = 4/94 (4%)
 Frame = +1

Query: 34  PKAQPPAAATPPTATPPTATPPAAATPPTAT---PPTATPPAPASSPATSPPAPTPASTP 204
           P  + P +  P T  PP  + P    PP      PP    P P   P   PP  TP   P
Sbjct: 40  PCIKVPCSPPPSTPPPPRNSCPTQVCPPCVKGICPPCIGKPCPPPPPPPPPPKVTPPPPP 99

Query: 205 ST-APTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
               P P   G+PP P P    P P   +TPPPP
Sbjct: 100 PVPVPAPPPKGTPP-PAP---VPAPPPKETPPPP 129

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 32/75 (42%), Positives = 34/75 (45%)
 Frame = +1

Query: 79  PPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPD 258
           P    PP    P  A PP  TPP P      SPP P PA  P  AP P     PPAP P 
Sbjct: 345 PCRPPPPPPPVPGPAPPPKVTPPPP------SPPPPPPAPIP--APPPKETPPPPAPVP- 395

Query: 259 SLGPGPSGADTPPPP 303
           +  P  +   TPPPP
Sbjct: 396 APPPKKTLPQTPPPP 410

[100][TOP]
>UniRef100_Q9LT74 Similarity to late embryogenesis abundant protein n=2
           Tax=Arabidopsis thaliana RepID=Q9LT74_ARATH
          Length = 631

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 46/106 (43%), Positives = 55/106 (51%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4   PTKPPTATPA-PKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P  PP  TP+ P   PP +  PPT TP   +P    +PP   PPT TP  P+ +P  SPP
Sbjct: 152 PVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP---PPTPTPSVPSPTPPVSPP 208

Query: 181 APTPASTPST-APTPSTAGSPPAPTPDSLGPGP----SGADTPPPP 303
            PTP  TPS  +PTP  +  PP PTP    P P        +PPPP
Sbjct: 209 PPTP--TPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPP 252

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 47/104 (45%), Positives = 55/104 (52%), Gaps = 7/104 (6%)
 Frame = +1

Query: 13  PPTATPA-PKAQPPAAATPPTATP--PTATPPAAATPPTATP--PTATPPA--PASSPAT 171
           PPT TP+ P   PP +  PPT TP  P+ TPP +  PPT TP  P+ TPP   P  +P  
Sbjct: 173 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 232

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           S P+PTP       P+P    SPP PTP    P P    TP PP
Sbjct: 233 SVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDV-TPTPP 275

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 47/111 (42%), Positives = 54/111 (48%), Gaps = 14/111 (12%)
 Frame = +1

Query: 13  PPTATPA-PKAQPPAAATPPTATP--PTATPPAAATPPT-------ATPPTATPPAPASS 162
           PPT TP+ P   PP +  PPT TP  P+ TPP +  PPT        TPP  T P P+  
Sbjct: 191 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPP 250

Query: 163 PATSPPAPTPA----STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P  SPP PTP     S P   PTP T   P  P+P  + P P     P PP
Sbjct: 251 PPVSPPPPTPTPSVPSPPDVTPTPPT---PSVPSPPDVTPTPPTPSVPSPP 298

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 42/92 (45%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +1

Query: 34  PKAQPPAAATPPTATPPTATPPAAATPPTATP--PTATPPAPASSPATSPPAPTPASTPS 207
           P   PP +  PPT + P+ TPP +  PPT TP  P+ TPP        SPP PTP  TPS
Sbjct: 147 PAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPP-------VSPPPPTP--TPS 197

Query: 208 TAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+P+   SPP PTP    P P+   +PPPP
Sbjct: 198 -VPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 228

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/109 (40%), Positives = 52/109 (47%), Gaps = 10/109 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT-SPP 180
           P  PP  TP P    P   TPP  T P  +PP   +PP   PPT TP  P+    T +PP
Sbjct: 222 PVSPPPPTPTPSVPSP---TPPVPTDPMPSPPPPVSPP---PPTPTPSVPSPPDVTPTPP 275

Query: 181 APTPASTPSTAPTPSTAG-------SPPAPTPDSLGPGPSGAD--TPPP 300
            P+  S P   PTP T         +P  PTP S+ P PSG+    PPP
Sbjct: 276 TPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSV-PTPSGSPPYVPPP 323

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 43/100 (43%), Positives = 49/100 (49%), Gaps = 5/100 (5%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPP-AAATPPTAT---PPTATPPAPASSPA 168
           +PT P    P P   PP +  PPT TP   +PP    TPPT +   PP  TP  P  S  
Sbjct: 236 SPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPS-V 294

Query: 169 TSPPAPTPAS-TPSTAPTPSTAGSPPAPTPDSLGPGPSGA 285
            SPP  TP   TP + PTPS  GSPP   P S     +GA
Sbjct: 295 PSPPDVTPTPPTPPSVPTPS--GSPPYVPPPSDEEEAAGA 332

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 35/71 (49%), Positives = 42/71 (59%)
 Frame = +1

Query: 91  TPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP 270
           TPPA   PP  +PP  TP  P+ +P  SPP PTP  TPS  P+P+   SPP PTP    P
Sbjct: 145 TPPAPV-PP-VSPPPPTPSVPSPTPPVSPPPPTP--TPS-VPSPTPPVSPPPPTPTPSVP 199

Query: 271 GPSGADTPPPP 303
            P+   +PPPP
Sbjct: 200 SPTPPVSPPPP 210

[101][TOP]
>UniRef100_Q6Z232 Os08g0482300 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q6Z232_ORYSJ
          Length = 146

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/97 (52%), Positives = 58/97 (59%), Gaps = 4/97 (4%)
 Frame = +1

Query: 25  TPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTP 204
           TPAPKAQPP  ATPPT  PP   P    +PP A PP  TPP P S+PA   PAP+ A+TP
Sbjct: 29  TPAPKAQPP-VATPPT-RPPAVAP---VSPPAAQPPVTTPP-PVSAPA-PVPAPSAAATP 81

Query: 205 STAPTPSTAG----SPPAPTPDSLGPGPSGADTPPPP 303
           S   +  TA     SPPAP P S+   P+ A T PPP
Sbjct: 82  SPQASAPTAEPPVLSPPAPAPGSISQSPTEAPTSPPP 118

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 39/90 (43%), Positives = 47/90 (52%), Gaps = 9/90 (10%)
 Frame = +1

Query: 4   PTKPPTATPA--PKAQPPAAATPPTATP-PTATPPAAATP------PTATPPTATPPAPA 156
           PT+PP   P   P AQPP    PP + P P   P AAATP      PTA PP  +PPAPA
Sbjct: 42  PTRPPAVAPVSPPAAQPPVTTPPPVSAPAPVPAPSAAATPSPQASAPTAEPPVLSPPAPA 101

Query: 157 SSPATSPPAPTPASTPSTAPTPSTAGSPPA 246
             P +   +PT A T    P+ ++  SP A
Sbjct: 102 --PGSISQSPTEAPTSPPPPSAASGVSPSA 129

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 34/72 (47%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATP-PTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           T PP + PAP   P AAATP P A+ PTA PP  +  P A  P +   +P  +P TSPP 
Sbjct: 62  TPPPVSAPAPVPAPSAAATPSPQASAPTAEPPVLS--PPAPAPGSISQSPTEAP-TSPPP 118

Query: 184 PTPAS--TPSTA 213
           P+ AS  +PS A
Sbjct: 119 PSAASGVSPSAA 130

[102][TOP]
>UniRef100_Q6SSE8 Minus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE8_CHLRE
          Length = 3889

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 42/114 (36%), Positives = 58/114 (50%), Gaps = 13/114 (11%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA---------TPPTATPPTATPPAP 153
            AP  PP  +P P +  P +  PP+  PP+  PP+ A          PP+  PP+  PP+P
Sbjct: 1035 APPSPPPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSP 1094

Query: 154  A----SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            A      P+  PP+P P S P  +P P +  +PP+P P SL P      +PPPP
Sbjct: 1095 APPSPRPPSPEPPSPVPPSPPPPSPEPPSP-APPSPPPPSLEPPSPAPPSPPPP 1147

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 42/105 (40%), Positives = 60/105 (57%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA----TPPTATPPTATPPAPASSPA 168
            +P+ PP +   P  +PP+ A PP+A PP+  PP+ A     PP+  PP+  PP+P   P+
Sbjct: 778  SPSIPPPSPGPPSPEPPSPA-PPSAAPPSPMPPSPAPPSPDPPSPKPPSPVPPSPL-PPS 835

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              PP+P P S P  +P P T+ +PP+P P S  P      +PPPP
Sbjct: 836  PEPPSPVPPSPPPASPEP-TSPAPPSPPPPSPEPPSPAPPSPPPP 879

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 43/109 (39%), Positives = 57/109 (52%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP----PTATPPAPA----S 159
            P  P   +PAP + PP +  PP+  PP+  PP+   P  A P    P+  PP+PA     
Sbjct: 848  PASPEPTSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPLPSPEPPSPAPPLPP 907

Query: 160  SPATSPPAPTPASTPSTAP-TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S P  +P  PS A SPP P+P+   P P    +PPPP
Sbjct: 908  PPSPEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPAP---PSPPPP 953

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 41/100 (41%), Positives = 57/100 (57%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP A+P P +  P +  PP+  PP+  PP +  PP+  PP+  PP+P   P+  PP+
Sbjct: 843  PPSPPPASPEPTSPAPPSPPPPSPEPPSPAPP-SPPPPSPEPPSPAPPSP-PLPSPEPPS 900

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P  +P P +  +PP+P P S  P PS A +PPPP
Sbjct: 901  PAPPLPPPPSPEPPSP-APPSPPPPSPEP-PSPAPSPPPP 938

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/101 (39%), Positives = 56/101 (55%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  PP  +P P +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  P+  PP
Sbjct: 1020 APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPA-PPSPEPPSPAPPSPA-PPSPEPP 1077

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P P +  +PP+P P S  P      +PPPP
Sbjct: 1078 SPAPPSPAPPSPEPPSP-APPSPRPPSPEPPSPVPPSPPPP 1117

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 42/105 (40%), Positives = 57/105 (54%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA----SSPAT 171
            P  P   +PAP +  P +  PP+  PP+  PP +  PP+  PP+  PP+PA      P+ 
Sbjct: 1076 PPSPAPPSPAPPSPEPPSPAPPSPRPPSPEPP-SPVPPSPPPPSPEPPSPAPPSPPPPSL 1134

Query: 172  SPPAPTPASTPSTAP-TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PP+P P S P  +P  PS A SPP P+P+   P P    +PPPP
Sbjct: 1135 EPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPVP---PSPPPP 1176

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 43/101 (42%), Positives = 56/101 (55%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +PT P    PAP+   P    PP+  PP+ TPP +  PP+  PP+ +PP+PA S   SPP
Sbjct: 1266 SPTPPSPEPPAPQPPSPTPHAPPSPEPPSPTPP-SPLPPSPEPPSPSPPSPAPS-VPSPP 1323

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P P  A  PP+PTP S  P P    +P PP
Sbjct: 1324 SPAPPSPMPPSPAP-LAPQPPSPTPPS--PAPPVPPSPEPP 1361

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 41/110 (37%), Positives = 57/110 (51%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA----AATPPTATPPTATPPAPA----S 159
            P  P   +PAP + PP +  PP+  PP+  PP+    +  PP+  PP+  PP+PA    +
Sbjct: 1026 PPSPEPPSPAPPSPPPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPSPA 1085

Query: 160  SPATSPPAPTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S   PS  P      SPP P+P+   P P    +PPPP
Sbjct: 1086 PPSPEPPSPAPPSPRPPSPEPPSPVPPSPPPPSPEPPSPAP---PSPPPP 1132

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 41/108 (37%), Positives = 57/108 (52%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPT---ATPPTATPPAAATPPTATPPTATPPAPA----SS 162
            P  P   +PAP + PP +  PP+   + PP +  P +  PP+  PP+  PP+PA      
Sbjct: 908  PPSPEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPLPPP 967

Query: 163  PATSPPAPTPASTPSTAP-TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+  PP+P P S P  +P  PS A  PP P+P+   P P    +PPPP
Sbjct: 968  PSPEPPSPAPPSPPPPSPEPPSPAPLPPPPSPEPPSPAP---PSPPPP 1012

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 43/104 (41%), Positives = 59/104 (56%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +PAP +  P +  PP+  PP+  PP+ A PP+  PP+  PP+P   P+  PP+
Sbjct: 1061 PPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSPA-PPSPRPPSPEPPSPV-PPSPPPPS 1118

Query: 184  PTPAS-TPSTAPTPS---TAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S  P + P PS    + +PP+P P S  P PS A +PPPP
Sbjct: 1119 PEPPSPAPPSPPPPSLEPPSPAPPSPPPPSPEP-PSPAPSPPPP 1161

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 45/116 (38%), Positives = 59/116 (50%), Gaps = 16/116 (13%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSP---ATS 174
            P+  P + P P  +PP+ A PP   PP+  PP+ A PP+  PP+  PP+PA SP   +  
Sbjct: 884  PSPAPPSPPLPSPEPPSPA-PPLPPPPSPEPPSPA-PPSPPPPSPEPPSPAPSPPPPSPE 941

Query: 175  PPAPTPASTPSTAPTPSTAGSP----PAPTPDSLGPG---------PSGADTPPPP 303
            PP+P P S P  +P P +   P    P+P P S  P          PS A  PPPP
Sbjct: 942  PPSPAPPSPPPPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPLPPPP 997

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 39/108 (36%), Positives = 54/108 (50%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP--------AS 159
            P  P   +PAP + PP +  PP+  PP   PP+   PP+  PP+  PP+P          
Sbjct: 937  PPSPEPPSPAPPSPPPPSPEPPSPAPPLPPPPSPE-PPSPAPPSPPPPSPEPPSPAPLPP 995

Query: 160  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S P  +P P +  +PP+P P S  P      +PPPP
Sbjct: 996  PPSPEPPSPAPPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPPP 1042

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 37/100 (37%), Positives = 54/100 (54%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +PAP + PP +  PP+  PP + PP +  PP+  PP+  PP+P   P+ +PP+
Sbjct: 996  PPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSPEPPSPAPPSPPPPSP-EPPSPAPPS 1053

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1054 PAPPSPEPPSPAPPSP-APPSPEPPSPAPPSPAPPSPEPP 1092

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 40/104 (38%), Positives = 51/104 (49%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAAT----PPTATPPTATPPAPASSPAT 171
            P  P   +P+P +  P+  +PP+  PP+  PP+ A     PP+ TPP+  PP P S    
Sbjct: 1302 PPSPEPPSPSPPSPAPSVPSPPSPAPPSPMPPSPAPLAPQPPSPTPPSPAPPVPPSPEPP 1361

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PP P P   PS  P       PP+PTP S  P PS A   P P
Sbjct: 1362 VPPGPDPPLPPSPTPPSPQPPVPPSPTPPSPQP-PSPAPPSPAP 1404

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 38/101 (37%), Positives = 54/101 (53%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP  PP  +P P +  P +  PP+  PP+  PP +  PP+  PP+  PP+PA  P+  PP
Sbjct: 1005 APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSPEPPSPAPPSPA-PPSPEPP 1062

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1063 SPAPPSPAPPSPEPPSP-APPSPAPPSPEPPSPAPPSPRPP 1102

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/108 (40%), Positives = 56/108 (51%), Gaps = 7/108 (6%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  P   +PAP+A P +   PP  T PTA PP    PP+  PP+ TPP+P   PA  PP
Sbjct: 1225 SPLAPSPPSPAPQA-PSSPFPPPQPTAPTAPPPPF--PPSPAPPSPTPPSP-EPPAPQPP 1280

Query: 181  APTPASTPSTAPTPSTAGSP-------PAPTPDSLGPGPSGADTPPPP 303
            +PTP + PS  P   T  SP       P+P+P S  P      +P PP
Sbjct: 1281 SPTPHAPPSPEPPSPTPPSPLPPSPEPPSPSPPSPAPSVPSPPSPAPP 1328

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 38/102 (37%), Positives = 54/102 (52%), Gaps = 1/102 (0%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATP-PTATPPAAATPPTATPPTATPPAPASSPATSP 177
            +P  P    P+P+   P   +PP A+P PT+  P +  PP+  PP+  PP+P   P+  P
Sbjct: 825  SPVPPSPLPPSPEPPSPVPPSPPPASPEPTSPAPPSPPPPSPEPPSPAPPSPPP-PSPEP 883

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P P S P  +P P +  +PP P P S  P      +PPPP
Sbjct: 884  PSPAPPSPPLPSPEPPSP-APPLPPPPSPEPPSPAPPSPPPP 924

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 42/105 (40%), Positives = 56/105 (53%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA----SSPAT 171
            P  P  + P P  +PP+ A PP+  PP+  PP+ A PP   PP+  PP+PA      P+ 
Sbjct: 928  PPSPAPSPPPPSPEPPSPA-PPSPPPPSPEPPSPA-PPLPPPPSPEPPSPAPPSPPPPSP 985

Query: 172  SPPAPTPASTPSTAPTPSTA-GSPPAPTPDSLGPGPSGADTPPPP 303
             PP+P P   P +   PS A  SPP P+P+   P P    +PPPP
Sbjct: 986  EPPSPAPLPPPPSPEPPSPAPPSPPPPSPEPPSPAP---PSPPPP 1027

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 39/108 (36%), Positives = 52/108 (48%), Gaps = 9/108 (8%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP---PTATPPTATPPAPA----SS 162
            P  P   +PAP   PP +  PP+  PP+  PP+   P   P   PP+  PP+PA      
Sbjct: 952  PPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPLPPPPSPEPPSPAPPSPPP 1011

Query: 163  PATSPPAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPP 300
            P+  PP+P P S P  +P P +    SPP P+P+   P P     P P
Sbjct: 1012 PSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPAPPSP 1059

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 39/99 (39%), Positives = 57/99 (57%), Gaps = 1/99 (1%)
 Frame = +1

Query: 10   KPPTATP-APKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAP 186
            +PP+ TP AP +  P + TPP+  PP+  PP+ + PP+  P   +PP+PA  P+  PP+P
Sbjct: 1278 QPPSPTPHAPPSPEPPSPTPPSPLPPSPEPPSPS-PPSPAPSVPSPPSPA-PPSPMPPSP 1335

Query: 187  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P +    +PTP +   P  P+P+   P P G D P PP
Sbjct: 1336 APLAPQPPSPTPPSPAPPVPPSPEP--PVPPGPDPPLPP 1372

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 40/103 (38%), Positives = 57/103 (55%), Gaps = 3/103 (2%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS---PATS 174
            P+  P + P P  +PP+ A PP+  PP+  PP+ A PP+  PP+  PP+PA S   P+  
Sbjct: 1107 PSPVPPSPPPPSPEPPSPA-PPSPPPPSLEPPSPA-PPSPPPPSPEPPSPAPSPPPPSPE 1164

Query: 175  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP+P P S P  +P P +  +PP+P P    P      +PP P
Sbjct: 1165 PPSPVPPSPPPPSPEPPSP-APPSPAPPLPLPPSPHTQSPPSP 1206

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 39/101 (38%), Positives = 51/101 (50%), Gaps = 4/101 (3%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTA--TPPTATPPAPASSPATS--PP 180
            PP + P PK  PP   +PP   PP   PP+   PP     PP+  PP+P   P+ S  PP
Sbjct: 725  PPKSPPPPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLPPNPPSPAPPSPPPPPSPSIPPP 784

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P P +A +PP+P P S  P      +P PP
Sbjct: 785  SPGPPSPEPPSPAPPSA-APPSPMPPSPAPPSPDPPSPKPP 824

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 39/100 (39%), Positives = 56/100 (56%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P+  P + P P  +PP+ A PP+  PP+  PP+ A PP+  PP+  PP+PA  P+ +PP+
Sbjct: 1002 PSPAPPSPPPPSPEPPSPA-PPSPPPPSPEPPSPA-PPSPPPPSPEPPSPA-PPSPAPPS 1058

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S    +P P +   PP+P P S  P      +P PP
Sbjct: 1059 PEPPSPAPPSPAPPSP-EPPSPAPPSPAPPSPEPPSPAPP 1097

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 44/109 (40%), Positives = 53/109 (48%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP---------PTATPPTATPPAPA 156
            P  PP+ TP P  QPP    PP+ TPP+  PP+ A P         P+  PP+  PP+PA
Sbjct: 1368 PPLPPSPTP-PSPQPPV---PPSPTPPSPQPPSPAPPSPAPSAPLQPSPDPPSPQPPSPA 1423

Query: 157  SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P  SPP+P     PST   PS A   PAP    + P P     P PP
Sbjct: 1424 PGPPPSPPSP-----PSTPSPPSPAPLAPAPPVPPMAPQPPSPPLPSPP 1467

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 42/120 (35%), Positives = 54/120 (45%), Gaps = 19/120 (15%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS------- 159
            +P  P   +P P +  P A  PP+ TPP+  PP   +P    PP   PP P S       
Sbjct: 1321 SPPSPAPPSPMPPSPAPLAPQPPSPTPPSPAPPVPPSPEPPVPPGPDPPLPPSPTPPSPQ 1380

Query: 160  ---SPATSPPAPTPASTPSTAPTPST----AGSPPAPTPDSLGPG-----PSGADTPPPP 303
                P+ +PP+P P S    +P PS     +  PP+P P S  PG     PS   TP PP
Sbjct: 1381 PPVPPSPTPPSPQPPSPAPPSPAPSAPLQPSPDPPSPQPPSPAPGPPPSPPSPPSTPSPP 1440

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 43/112 (38%), Positives = 56/112 (50%), Gaps = 11/112 (9%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-------PAPAS 159
            AP  P   +PAP +  P +  PP+  PP+  PP+   PP+  PP+  P       PAP S
Sbjct: 802  APPSPMPPSPAPPSPDPPSPKPPSPVPPSPLPPSPE-PPSPVPPSPPPASPEPTSPAPPS 860

Query: 160  SPATSP--PAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPPP 303
             P  SP  P+P P S P  +P P +    SPP P+P+   P P     PPPP
Sbjct: 861  PPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPLPSPEPPSPAP---PLPPPP 909

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 39/112 (34%), Positives = 53/112 (47%), Gaps = 11/112 (9%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPA---------AATPPTATPPTATPPAP 153
            AP  PP  +P P +  P +  PP+  PP+  PP+         +  PP   PP+  PP+P
Sbjct: 857  APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPLPSPEPPSPAPPLPPPPSPEPPSP 916

Query: 154  A--SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            A  S P  SP  P+PA +P        + +PP+P P S  P       PPPP
Sbjct: 917  APPSPPPPSPEPPSPAPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPLPPPP 968

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 40/108 (37%), Positives = 56/108 (51%), Gaps = 8/108 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATP----PTATPPAAATPPTATPPTATPPAPA----S 159
            P  P   +PAP + PP +  PP+  P    P+  PP+ A PP+  PP+  PP+PA     
Sbjct: 967  PPSPEPPSPAPPSPPPPSPEPPSPAPLPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPP 1025

Query: 160  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S P  +P P +  +PP+P P S  P      +P PP
Sbjct: 1026 PPSPEPPSPAPPSPPPPSPEPPSP-APPSPAPPSPEPPSPAPPSPAPP 1072

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 45/119 (37%), Positives = 60/119 (50%), Gaps = 18/119 (15%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQ----PPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS-SP 165
            AP  PP  +P P +     PP +  PP+  PP+  PP+   PP+  PP+  PP P   SP
Sbjct: 1140 APPSPPPPSPEPPSPAPSPPPPSPEPPSPVPPSPPPPSPE-PPSPAPPSPAPPLPLPPSP 1198

Query: 166  AT-SPPAPTPASTPSTAPTPST-------AGSPPAPTPDSLG-----PGPSGADTPPPP 303
             T SPP+P P S   +AP+P +       A SPP+P P +       P P+    PPPP
Sbjct: 1199 HTQSPPSPVPPSPAPSAPSPPSPQPPSPLAPSPPSPAPQAPSSPFPPPQPTAPTAPPPP 1257

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/97 (38%), Positives = 44/97 (45%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
            PP   P PK+ PP   +PP    P   PP    PP+  PP   PP P S    SPP P  
Sbjct: 719  PPPRPPPPKSPPPPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLPPNPPSPAPPSPPPPPS 778

Query: 193  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             S P  +P P +   PP+P P S  P      +P PP
Sbjct: 779  PSIPPPSPGPPSP-EPPSPAPPSAAPPSPMPPSPAPP 814

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPA--------AATPPTATPPTATPPAPAS 159
            P  P   +PAP + PP +  PP+  PP+  PP+        +  PP+  PP+  PP+P  
Sbjct: 1116 PPSPEPPSPAPPSPPPPSLEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPVPPSP-P 1174

Query: 160  SPATSPPAPTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPPP 303
             P+  PP+P P S     P P +    SPP+P P S  P      +P PP
Sbjct: 1175 PPSPEPPSPAPPSPAPPLPLPPSPHTQSPPSPVPPSPAPSAPSPPSPQPP 1224

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 40/106 (37%), Positives = 53/106 (50%), Gaps = 7/106 (6%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA--TPPTATPPTATPPAPASS----P 165
            P  P   +P P + PP +  PP+  PP+  PP     +P T +PP+  PP+PA S    P
Sbjct: 1160 PPSPEPPSPVPPSPPPPSPEPPSPAPPSPAPPLPLPPSPHTQSPPSPVPPSPAPSAPSPP 1219

Query: 166  ATSPPAPTPASTPSTAP-TPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            +  PP+P   S PS AP  PS+   PP PT  +  P P      PP
Sbjct: 1220 SPQPPSPLAPSPPSPAPQAPSSPFPPPQPTAPTAPPPPFPPSPAPP 1265

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 41/107 (38%), Positives = 55/107 (51%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS-SPATSPP 180
            P  P   +PAP + P  +  PP+  PP   PP+   PP+  PP+  PP+P   SPA SPP
Sbjct: 878  PPSPEPPSPAPPSPPLPSPEPPSPAPPLPPPPSPE-PPSPAPPSPPPPSPEPPSPAPSPP 936

Query: 181  APT---PASTPSTAPTPS---TAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+   P+  P + P PS    + +PP P P S  P      +PPPP
Sbjct: 937  PPSPEPPSPAPPSPPPPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPP 983

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/107 (37%), Positives = 55/107 (51%), Gaps = 7/107 (6%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA-------TPPTATPPTATPPAPASS 162
            P   PTA  AP    P +  PP+ TPP+  PPA          PP+  PP+ TPP+P   
Sbjct: 1244 PPPQPTAPTAPPPPFPPSPAPPSPTPPSPEPPAPQPPSPTPHAPPSPEPPSPTPPSPL-P 1302

Query: 163  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+  PP+P+P S   + P+P +  +PP+P P S  P      +P PP
Sbjct: 1303 PSPEPPSPSPPSPAPSVPSPPSP-APPSPMPPSPAPLAPQPPSPTPP 1348

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 44/118 (37%), Positives = 60/118 (50%), Gaps = 17/118 (14%)
 Frame = +1

Query: 1    APTKPPTATPAPKA-QPPAAATPPTATPPTATPPA-------AATPPTATPPTATPPAPA 156
            +PT P  A P P + +PP    P    PP+ TPP+       + TPP+  PP+  PP+PA
Sbjct: 1344 SPTPPSPAPPVPPSPEPPVPPGPDPPLPPSPTPPSPQPPVPPSPTPPSPQPPSPAPPSPA 1403

Query: 157  SS----PATSPPAPTPAST----PSTAPTPSTAGSPPAPTPDSLGPG-PSGADTPPPP 303
             S    P+  PP+P P S     P + P+P +  SPP+P P +  P  P  A  PP P
Sbjct: 1404 PSAPLQPSPDPPSPQPPSPAPGPPPSPPSPPSTPSPPSPAPLAPAPPVPPMAPQPPSP 1461

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/105 (36%), Positives = 55/105 (52%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQ----PPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPA 168
            AP  PP  +P P +     PP +  PP+  PP+  PP+   PP+  PP+  PP+P   P+
Sbjct: 976  APPSPPPPSPEPPSPAPLPPPPSPEPPSPAPPSPPPPSPE-PPSPAPPSPPPPSP-EPPS 1033

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             +PP+P P S    +P P +  +PP+P P S  P      +P PP
Sbjct: 1034 PAPPSPPPPSPEPPSPAPPSP-APPSPEPPSPAPPSPAPPSPEPP 1077

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 39/100 (39%), Positives = 53/100 (53%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P    P P  +PP+ A PP+  PP+  PP+ A PP+  PP+  PP+PA  P+  PP+
Sbjct: 987  PPSPAPLPPPPSPEPPSPA-PPSPPPPSPEPPSPA-PPSPPPPSPEPPSPAP-PSPPPPS 1043

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S    +P P +   PP+P P S  P      +P PP
Sbjct: 1044 PEPPSPAPPSPAPPSP-EPPSPAPPSPAPPSPEPPSPAPP 1082

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/101 (37%), Positives = 50/101 (49%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS-SPATSPP 180
            P  P   +P P + PP +  PP+  PP+  PP+   PP+  PP+  PP+P   SPA SPP
Sbjct: 1101 PPSPEPPSPVPPSPPPPSPEPPSPAPPSPPPPSLE-PPSPAPPSPPPPSPEPPSPAPSPP 1159

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+P       P+P     PP+P P S  P       P PP
Sbjct: 1160 PPSPEPPSPVPPSP----PPPSPEPPSPAPPSPAPPLPLPP 1196

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 38/102 (37%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPT--ATPPAPASSPATSP 177
            P  P T +P P+  PP +  PP  +PP    P    PP   PP+    PP P + P+ +P
Sbjct: 711  PLPPVTPSPPPRPPPPKSPPPPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLPPNPPSPAP 770

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+P P  +PS  P PS    PP+P P S  P  +   +P PP
Sbjct: 771  PSPPPPPSPS-IPPPSP--GPPSPEPPSPAPPSAAPPSPMPP 809

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 38/100 (38%), Positives = 52/100 (52%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +P P +  P +  PP+  PP+  PP+ A PP+  PP+  PP+PA  P+  PP+
Sbjct: 1091 PPSPAPPSPRPPSPEPPSPVPPSPPPPSPEPPSPA-PPSPPPPSLEPPSPA-PPSPPPPS 1148

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S   + P PS    PP+P P S  P      +P PP
Sbjct: 1149 PEPPSPAPSPPPPSP--EPPSPVPPSPPPPSPEPPSPAPP 1186

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 38/103 (36%), Positives = 52/103 (50%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA--SSPATS 174
            +P     ++P P  QP A   PP   PP+  PP + TPP+  PP   PP+P   + P+  
Sbjct: 1233 SPAPQAPSSPFPPPQPTAPTAPPPPFPPSPAPP-SPTPPSPEPPAPQPPSPTPHAPPSPE 1291

Query: 175  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP+PTP S    +P P +  SPP+P P    P      +P PP
Sbjct: 1292 PPSPTPPSPLPPSPEPPSP-SPPSPAPSVPSPPSPAPPSPMPP 1333

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 40/103 (38%), Positives = 52/103 (50%), Gaps = 4/103 (3%)
 Frame = +1

Query: 4    PTKP-PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            P+ P P  TP+P  +PP   +PP   PP  +PP   +PP   PP   PP+P   P   P 
Sbjct: 708  PSPPLPPVTPSPPPRPPPPKSPP---PPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLPPN 764

Query: 181  APTPASTPSTAPTPSTAGSPPA---PTPDSLGPGPSGADTPPP 300
             P+PA  PS  P PS +  PP+   P+P+   P P  A  P P
Sbjct: 765  PPSPA-PPSPPPPPSPSIPPPSPGPPSPEPPSPAPPSAAPPSP 806

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 41/113 (36%), Positives = 58/113 (51%), Gaps = 12/113 (10%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAA----TPPTATPPTATPPAPA---- 156
            +PT     +P P +  P +  PP+  PP+ +PP+ A    +PP+  PP+  PP+PA    
Sbjct: 1281 SPTPHAPPSPEPPSPTPPSPLPPSPEPPSPSPPSPAPSVPSPPSPAPPSPMPPSPAPLAP 1340

Query: 157  SSPATSPPAPTPASTPSTAPTPSTAGS----PPAPTPDSLGPGPSGADTPPPP 303
              P+ +PP+P P   PS  P P   G     PP+PTP S  P    + TPP P
Sbjct: 1341 QPPSPTPPSPAPPVPPSPEP-PVPPGPDPPLPPSPTPPSPQPPVPPSPTPPSP 1392

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 39/100 (39%), Positives = 46/100 (46%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P +PP   P P   PP+   PP    P   PP   +PP   PP  +PP   S P   PP 
Sbjct: 695 PPRPPR--PPPPPLPPSPPLPPVTPSPPPRPPPPKSPP---PPKPSPPPRPSPPPRPPPR 749

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P S P   P P    +PP+P P S  P PS +  PP P
Sbjct: 750 PLPPSPPPPPPLPP---NPPSPAPPSPPPPPSPSIPPPSP 786

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 39/104 (37%), Positives = 54/104 (51%), Gaps = 5/104 (4%)
 Frame = +1

Query: 4    PTKPPTAT--PAPKAQPPAAATPPTATPPTATPPAAAT--PPTATPPTATPPAPASSPAT 171
            P +PP     P+P   PP    PP+  PP+  PP + +  PP+  PP+  PP+PA  P+ 
Sbjct: 743  PPRPPPRPLPPSPPPPPPLPPNPPSPAPPSPPPPPSPSIPPPSPGPPSPEPPSPA-PPSA 801

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDS-LGPGPSGADTPPP 300
            +PP+P P S    +P P +   PP+P P S L P P      PP
Sbjct: 802  APPSPMPPSPAPPSPDPPSP-KPPSPVPPSPLPPSPEPPSPVPP 844

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 42/115 (36%), Positives = 52/115 (45%), Gaps = 15/115 (13%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPA--AATPPTATP-------PTATPPAAATPPTATPPTATPPAPA 156
            P+  P+A   P  QPP+  A +PP+  P       P   P A   PP   PP+  PP+P 
Sbjct: 1209 PSPAPSAPSPPSPQPPSPLAPSPPSPAPQAPSSPFPPPQPTAPTAPPPPFPPSPAPPSPT 1268

Query: 157  ----SSPATSPPAPTPASTPSTAPTPSTAGS--PPAPTPDSLGPGPSGADTPPPP 303
                  PA  PP+PTP + PS  P   T  S  PP+P P S  P       P PP
Sbjct: 1269 PPSPEPPAPQPPSPTPHAPPSPEPPSPTPPSPLPPSPEPPSPSPPSPAPSVPSPP 1323

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 37/103 (35%), Positives = 50/103 (48%), Gaps = 3/103 (2%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATP--PTATPPTATPPAAATPPTATPPTATPPA-PASSPAT 171
            +P  P  A P+P    PA  +P  P+  PP+  PP +  PP+  PP+  PP+ P +SP  
Sbjct: 795  SPAPPSAAPPSPMPPSPAPPSPDPPSPKPPSPVPP-SPLPPSPEPPSPVPPSPPPASPEP 853

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            + PAP     PS  P      SPP P+P+   P P     P P
Sbjct: 854  TSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPLPSP 896

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 36/105 (34%), Positives = 52/105 (49%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTAT-PPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            P  PP     P   PP+   PP+ + PP +  P +  PP+  PP+A PP+P   P+ +PP
Sbjct: 756  PPPPPLPPNPPSPAPPSPPPPPSPSIPPPSPGPPSPEPPSPAPPSAAPPSP-MPPSPAPP 814

Query: 181  APTPASTPSTAPTPST----AGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P S    +P P +    +  PP+P P S  P      +P PP
Sbjct: 815  SPDPPSPKPPSPVPPSPLPPSPEPPSPVPPSPPPASPEPTSPAPP 859

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 43/117 (36%), Positives = 56/117 (47%), Gaps = 16/117 (13%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATP----PAAATPPTATPPT---ATPPAPA- 156
            +P  P  A P+P    P   +P T +PP+  P    P+A +PP+  PP+    +PP+PA 
Sbjct: 1177 SPEPPSPAPPSPAPPLPLPPSPHTQSPPSPVPPSPAPSAPSPPSPQPPSPLAPSPPSPAP 1236

Query: 157  ---SSP-----ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
               SSP      T+P AP P   PS AP   T  SP  P P    P P    +P PP
Sbjct: 1237 QAPSSPFPPPQPTAPTAPPPPFPPSPAPPSPTPPSPEPPAPQPPSPTPHAPPSPEPP 1293

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 35/97 (36%), Positives = 43/97 (44%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           PP   P+P   P   + PP   PP + PP   +PP    P   PP     P+  PP P P
Sbjct: 703 PPPLPPSPPLPPVTPSPPPRPPPPKSPPPPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLP 762

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            + PS AP      SPP P   S+ P   G  +P PP
Sbjct: 763 PNPPSPAPP-----SPPPPPSPSIPPPSPGPPSPEPP 794

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 38/106 (35%), Positives = 50/106 (47%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPP---TATPPAAATP-PTATPPTATPPAPASSPAT 171
            P  PP  +P P +  P +  PP   PP   T +PP+   P P  + P+   P P S  A 
Sbjct: 1170 PPSPPPPSPEPPSPAPPSPAPPLPLPPSPHTQSPPSPVPPSPAPSAPSPPSPQPPSPLAP 1229

Query: 172  SPPAPTP--ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            SPP+P P   S+P   P P+   +PP P P S  P      +P PP
Sbjct: 1230 SPPSPAPQAPSSPFPPPQPTAPTAPPPPFPPSPAPPSPTPPSPEPP 1275

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 46/123 (37%), Positives = 48/123 (39%), Gaps = 23/123 (18%)
 Frame = +1

Query: 1   APTKPPTAT---PAPKAQPPAAATPPTATPPTATPPA-----AATPPTATPPT------- 135
           +P  PPT     P P + PPA   PP   P    PPA     AA P    PPT       
Sbjct: 627 SPPSPPTTPDVPPMPPSSPPAPVMPPAPPPQPPIPPASPLTPAAPPRPPLPPTWPGKWEG 686

Query: 136 ---ATPPAPASSPATSPP-----APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 291
                PP P   P   PP      P P  TPS  P P    SPP P P S  P PS    
Sbjct: 687 AWPFRPPIPPRPPRPPPPPLPPSPPLPPVTPSPPPRPPPPKSPPPPKP-SPPPRPSPPPR 745

Query: 292 PPP 300
           PPP
Sbjct: 746 PPP 748

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/100 (37%), Positives = 50/100 (50%), Gaps = 6/100 (6%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAAT--PPTATPPTATPPAPASSP-ATS 174
            P  P   +PAP +  P+A   P+  PP+  PP+ A   PP+   P +TP  P+ +P A +
Sbjct: 1389 PPSPQPPSPAPPSPAPSAPLQPSPDPPSPQPPSPAPGPPPSPPSPPSTPSPPSPAPLAPA 1448

Query: 175  PPAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGA 285
            PP P  A  P + P PS    P   P  TP S  P P+ A
Sbjct: 1449 PPVPPMAPQPPSPPLPSPPFPPQPSPTITPASPQPAPAAA 1488

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 39/109 (35%), Positives = 44/109 (40%), Gaps = 8/109 (7%)
 Frame = +1

Query: 1   APTKPPTATPAPKA-------QPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS 159
           AP +PP     P         +PP    PP   PP   PP+   PP    P   PP P S
Sbjct: 670 APPRPPLPPTWPGKWEGAWPFRPPIPPRPPRPPPPPL-PPSPPLPPVTPSPPPRPPPPKS 728

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPA-PTPDSLGPGPSGADTPPPP 303
            P   PP P+P   PS  P P     PP+ P P  L P P     P PP
Sbjct: 729 PP---PPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLPPNPPSPAPPSPP 774

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 42/114 (36%), Positives = 46/114 (40%), Gaps = 14/114 (12%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTAT-PPT----------ATPPAAATPPTATPPTA--TP 144
           P  PP   P P A P   A PP    PPT            PP    PP   PP    +P
Sbjct: 651 PPAPPPQPPIPPASPLTPAAPPRPPLPPTWPGKWEGAWPFRPPIPPRPPRPPPPPLPPSP 710

Query: 145 PAPASSPATSPPAPTPASTPSTAPTPSTAGS-PPAPTPDSLGPGPSGADTPPPP 303
           P P  +P+  P  P P S P   P+P    S PP P P  L P P     PPPP
Sbjct: 711 PLPPVTPSPPPRPPPPKSPPPPKPSPPPRPSPPPRPPPRPLPPSP-----PPPP 759

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 33/84 (39%), Positives = 45/84 (53%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPAT-SP 177
            AP +P    P+P  QPP+ A  P  +PP+  PP+  +PP+  P    PP P  +P   SP
Sbjct: 1406 APLQPSPDPPSP--QPPSPAPGPPPSPPS--PPSTPSPPSPAPLAPAPPVPPMAPQPPSP 1461

Query: 178  PAPTPASTPSTAPTPSTAGSPPAP 249
            P P+P   P  +PT + A   PAP
Sbjct: 1462 PLPSPPFPPQPSPTITPASPQPAP 1485

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 35/117 (29%), Positives = 40/117 (34%), Gaps = 16/117 (13%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPA---- 168
           AP  PP+    P   P   ++PP    P A PP    PP +    A PP P   P     
Sbjct: 624 APPSPPSPPTTPDVPPMPPSSPPAPVMPPAPPPQPPIPPASPLTPAAPPRPPLPPTWPGK 683

Query: 169 ------------TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                         PP P P   P + P P    SPP   P    P P     PP P
Sbjct: 684 WEGAWPFRPPIPPRPPRPPPPPLPPSPPLPPVTPSPPPRPPPPKSPPPPKPSPPPRP 740

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 38/113 (33%), Positives = 45/113 (39%), Gaps = 12/113 (10%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P +PP   PAP + P    TP     P ++PPA   PP   P    PPA   +PA  P 
Sbjct: 615 SPPQPPP-PPAPPSPPSPPTTPDVPPMPPSSPPAPVMPPAPPPQPPIPPASPLTPAAPPR 673

Query: 181 APTPAS-----------TPSTAPTPSTAGSPPAPTPDSLGP-GPSGADTPPPP 303
            P P +            P   P P     PP P    L P  PS    PPPP
Sbjct: 674 PPLPPTWPGKWEGAWPFRPPIPPRPPRPPPPPLPPSPPLPPVTPSPPPRPPPP 726

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 39/101 (38%), Positives = 51/101 (50%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  P  A P+P    P+A   P+  PP+  PP+ A  P  +PP  +PP+  S P+ +P 
Sbjct: 1391 SPQPPSPAPPSP---APSAPLQPSPDPPSPQPPSPAPGPPPSPP--SPPSTPSPPSPAPL 1445

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            AP P   P  AP P    SPP P+P    P PS   TP  P
Sbjct: 1446 APAP-PVPPMAPQPP---SPPLPSP-PFPPQPSPTITPASP 1481

[103][TOP]
>UniRef100_C1E8G6 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E8G6_9CHLO
          Length = 3204

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 46/109 (42%), Positives = 53/109 (48%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPP------AAATPPTATPPTATPPAPASSP 165
            P  PP  +P P   PPA + PP   PP  +PP      A A PP   PP  +PP P + P
Sbjct: 987  PDAPPAPSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPDAPAPPPPDAPPAPSPPPPDAPP 1046

Query: 166  ATSPPAPTP-ASTPSTAPTPSTAGSPPAP--TPDSLGPGPSGADTPPPP 303
            A SPP P+P A  PS  P    A SPP P   P    P    A +PPPP
Sbjct: 1047 APSPPPPSPDAPPPSPPPLAPPAPSPPPPPVVPSPPPPNAPTAPSPPPP 1095

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 45/106 (42%), Positives = 55/106 (51%), Gaps = 5/106 (4%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  PP A PAP   PP A   P+  PP A PPA + PP   PP  +PP P +  A +PP
Sbjct: 971  SPLPPPDAPPAPSPPPPDAPPAPSPPPPDA-PPAPSPPPPDAPPAPSPPPPDAPDAPAPP 1029

Query: 181  APTPASTPSTAPTPST-AGSPPAPTPDSLGPGP----SGADTPPPP 303
             P     PS  P  +  A SPP P+PD+  P P      A +PPPP
Sbjct: 1030 PPDAPPAPSPPPPDAPPAPSPPPPSPDAPPPSPPPLAPPAPSPPPP 1075

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 44/111 (39%), Positives = 54/111 (48%), Gaps = 11/111 (9%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA-PASSPATSPP 180
            P  PP  +P P   P A A PP   PP  +PP    PP  +PP  +P A P S P  +PP
Sbjct: 1009 PDAPPAPSPPPPDAPDAPAPPPPDAPPAPSPPPPDAPPAPSPPPPSPDAPPPSPPPLAPP 1068

Query: 181  APTPASTP----------STAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            AP+P   P           TAP+P    +P AP+P    PG   A +PPPP
Sbjct: 1069 APSPPPPPVVPSPPPPNAPTAPSPPPPDAPMAPSPPP--PGAPAAPSPPPP 1117

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 40/102 (39%), Positives = 48/102 (47%), Gaps = 2/102 (1%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP+ PP   P+P   PP  A P  + PP   PPA + PP   PP  +PP P + PA SPP
Sbjct: 961  APSPPPPDAPSPL--PPPDAPPAPSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPPAPSPP 1018

Query: 181  APTPASTPSTAP--TPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             P     P+  P   P     PP   P +  P P   D PPP
Sbjct: 1019 PPDAPDAPAPPPPDAPPAPSPPPPDAPPAPSPPPPSPDAPPP 1060

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/101 (40%), Positives = 49/101 (48%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            AP+ PP   P   A  P     P+  PP   PPA + PP   PP  +PP P + PA SPP
Sbjct: 948  APSPPPPDAPDAPAPSPPPPDAPSPLPPPDAPPAPSPPPPDAPPAPSPPPPDAPPAPSPP 1007

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P   + P+ +P P  A   PAP P    P PS    PPPP
Sbjct: 1008 PPD--APPAPSPPPPDAPDAPAPPPPDAPPAPS----PPPP 1042

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/113 (38%), Positives = 53/113 (46%), Gaps = 13/113 (11%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPP------TATPPAPASSP 165
            P  PP  +P P   PPA + PP   PP  +PP    PP  +PP         PP P + P
Sbjct: 976  PDAPPAPSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPDAPAPPPPDAPP 1035

Query: 166  ATS------PPAPTPASTPSTAPTPSTAG-SPPAPTPDSLGPGPSGADTPPPP 303
            A S      PPAP+P      AP PS    +PPAP+P    P P    +PPPP
Sbjct: 1036 APSPPPPDAPPAPSPPPPSPDAPPPSPPPLAPPAPSP----PPPPVVPSPPPP 1084

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 39/99 (39%), Positives = 48/99 (48%), Gaps = 2/99 (2%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
            PP  +P P   PPA A P  + PP   P A + PP   P   +PP P +  A SPP P  
Sbjct: 1230 PPAPSPPPPDAPPAPAEP--SPPPPNAPTAPSPPPPDAPVAPSPPPPNAPVAPSPPPPDA 1287

Query: 193  ASTPSTAP--TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             ++PS  P   P+    PP   P S  P P  A +PPPP
Sbjct: 1288 PTSPSPPPPLAPTAPSPPPPDAPSSPSPPPPDAPSPPPP 1326

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 43/112 (38%), Positives = 52/112 (46%), Gaps = 11/112 (9%)
 Frame = +1

Query: 1    APTKPPTATP---APKAQPPAAATPPTATPPTATPPAAATP-------PTATPPTATPPA 150
            AP  PP   P   AP   PP A   P  +PP    P A  P       P+  PP   PPA
Sbjct: 922  APAPPPPDAPDAPAPSPPPPDAPDAPAPSPPPPDAPDAPAPSPPPPDAPSPLPPPDAPPA 981

Query: 151  PASSPATSPPAPTPASTPST-APTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+  P  +PPAP+P    +  AP+P    +PPAP+P    P P   D P PP
Sbjct: 982  PSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPPAPSP----PPPDAPDAPAPP 1029

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/101 (43%), Positives = 51/101 (50%), Gaps = 4/101 (3%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
            PP A  AP   PP A   P+  PP A P A + PP   P + +PP P +  A SPP P  
Sbjct: 1251 PPNAPTAPSPPPPDAPVAPSPPPPNA-PVAPSPPPPDAPTSPSPPPPLAPTAPSPPPPDA 1309

Query: 193  ASTPSTAPTPSTAGSPPAP-TPDSLGPGPSGADT---PPPP 303
             S+PS  P P  A SPP P  P +  P P  A T   PPPP
Sbjct: 1310 PSSPS--PPPPDAPSPPPPDAPTAPSPPPPNAPTAPSPPPP 1348

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 40/101 (39%), Positives = 46/101 (45%), Gaps = 4/101 (3%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTA-TPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPT 189
            PP A PAP    P     PTA +PP    P A +PP    P A  P P  +P +  P P 
Sbjct: 1237 PPDAPPAPAEPSPPPPNAPTAPSPPPPDAPVAPSPPPPNAPVAPSPPPPDAPTSPSPPPP 1296

Query: 190  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT---PPPP 303
             A T  + P P    SP  P PD+  P P  A T   PPPP
Sbjct: 1297 LAPTAPSPPPPDAPSSPSPPPPDAPSPPPPDAPTAPSPPPP 1337

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 41/105 (39%), Positives = 46/105 (43%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1    APTKP-PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
            APT+P P   P     PPA    P    P   PP A   P  +PP A P APA  P  +P
Sbjct: 873  APTQPTPAPGPPLPGAPPAPVVVPQPDAPAPPPPDAPDAPAPSPPEA-PDAPAPPPPDAP 931

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP---PPP 303
             AP P+  P  AP       PP   PD+  P P   D P   PPP
Sbjct: 932  DAPAPSPPPPDAPDAPAPSPPPPDAPDAPAPSPPPPDAPSPLPPP 976

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 41/116 (35%), Positives = 47/116 (40%), Gaps = 15/116 (12%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPT----------ATPPTATPPA 150
            APT  P   P P A  P     PT   P   PP    PP           A PP   P A
Sbjct: 852  APTPTPAPVPEPSAPEPPPPDAPTQPTPAPGPPLPGAPPAPVVVPQPDAPAPPPPDAPDA 911

Query: 151  PASSPATSPPAPTPA-----STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PA SP  +P AP P        P+ +P P  A   PAP+P       + A +PPPP
Sbjct: 912  PAPSPPEAPDAPAPPPPDAPDAPAPSPPPPDAPDAPAPSPPPPDAPDAPAPSPPPP 967

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 43/106 (40%), Positives = 53/106 (50%), Gaps = 5/106 (4%)
 Frame = +1

Query: 1    APTKPPTATP-APKAQPPAAATPPTATPPTATPPAAATPPTA-TPPTATPPAPASSPATS 174
            AP+ PP   P AP   PP A   P+  PP A    +  PP A T P+  PP   SSP+  
Sbjct: 1257 APSPPPPDAPVAPSPPPPNAPVAPSPPPPDAPTSPSPPPPLAPTAPSPPPPDAPSSPSPP 1316

Query: 175  PP---APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP   +P P   P TAP+P    +P AP+P    P    A +PPPP
Sbjct: 1317 PPDAPSPPPPDAP-TAPSPPPPNAPTAPSPPP--PASPTAPSPPPP 1359

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 44/112 (39%), Positives = 52/112 (46%), Gaps = 11/112 (9%)
 Frame = +1

Query: 1    APTKPPTATP-APKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA-----SS 162
            AP  PP   P AP   PP A   P   PP A    A +PP    P A  P+P       +
Sbjct: 900  APAPPPPDAPDAPAPSPPEAPDAPAPPPPDAPDAPAPSPPPPDAPDAPAPSPPPPDAPDA 959

Query: 163  PATSPP---APTPASTPST--APTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PA SPP   AP+P   P    AP+P    +PPAP+P    P    A +PPPP
Sbjct: 960  PAPSPPPPDAPSPLPPPDAPPAPSPPPPDAPPAPSPPP--PDAPPAPSPPPP 1009

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 43/106 (40%), Positives = 52/106 (49%), Gaps = 6/106 (5%)
 Frame = +1

Query: 1    APTKPPTATP-APKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
            AP+ PP   P AP   PP A T P+  PP A  P A +PP    P++  P P  +P+  P
Sbjct: 1268 APSPPPPNAPVAPSPPPPDAPTSPSPPPPLA--PTAPSPPPPDAPSSPSPPPPDAPSPPP 1325

Query: 178  P-APTPASTP----STAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P APT  S P     TAP+P    SP AP+P    P P     P P
Sbjct: 1326 PDAPTAPSPPPPNAPTAPSPPPPASPTAPSP----PPPVAPQAPLP 1367

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/100 (37%), Positives = 42/100 (42%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P     A P P A    A +PP A    A PP  A  P A  P+  PP    +PA SPP 
Sbjct: 896  PQPDAPAPPPPDAPDAPAPSPPEAPDAPAPPPPDA--PDAPAPSPPPPDAPDAPAPSPPP 953

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P     P+ +P P  A SP  P      P P   D PP P
Sbjct: 954  PDAPDAPAPSPPPPDAPSPLPPPDAPPAPSPPPPDAPPAP 993

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 40/104 (38%), Positives = 47/104 (45%), Gaps = 8/104 (7%)
 Frame = +1

Query: 16   PTATPAPKAQP-PAAATPPTATPPTATPPAAATPPTATPPTAT----PPAPASSPATSP- 177
            P  TP P   P P+A  PP    PT   PA   P    PP       P APA  P  +P 
Sbjct: 851  PAPTPTPAPVPEPSAPEPPPPDAPTQPTPAPGPPLPGAPPAPVVVPQPDAPAPPPPDAPD 910

Query: 178  -PAPTPASTP-STAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             PAP+P   P + AP P  A   PAP+P       + A +PPPP
Sbjct: 911  APAPSPPEAPDAPAPPPPDAPDAPAPSPPPPDAPDAPAPSPPPP 954

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 40/98 (40%), Positives = 50/98 (51%), Gaps = 3/98 (3%)
 Frame = +1

Query: 1    APTKPPTATP-APKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
            AP+ PP   P +P   PP A T P+  PP A  P++ +PP    P  +PP P +  A SP
Sbjct: 1279 APSPPPPDAPTSPSPPPPLAPTAPSPPPPDA--PSSPSPPPPDAP--SPPPPDAPTAPSP 1334

Query: 178  PAPTPASTPSTAPTPS-TAGSPPAP-TPDSLGPGPSGA 285
            P P   + PS  P  S TA SPP P  P +  P P  A
Sbjct: 1335 PPPNAPTAPSPPPPASPTAPSPPPPVAPQAPLPVPKNA 1372

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 38/100 (38%), Positives = 44/100 (44%), Gaps = 1/100 (1%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSP-ATSP 177
            AP+ PP +  AP   PP  A P  + PP   PP   +PP    PTA  P P  +P A SP
Sbjct: 1047 APSPPPPSPDAPPPSPPPLAPPAPSPPP---PPVVPSPPPPNAPTAPSPPPPDAPMAPSP 1103

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
            P P   + PS  P       P AP    L P P     PP
Sbjct: 1104 PPPGAPAAPSPPP-------PDAPVVVVLAP-PISVPQPP 1135

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 38/97 (39%), Positives = 44/97 (45%), Gaps = 7/97 (7%)
 Frame = +1

Query: 1    APTKP----PTATPAPKAQPPAAATPPTATPPTAT---PPAAATPPTATPPTATPPAPAS 159
            APT P    P A  AP   PP A + P+  PP A    PP A T P+  PP A P AP+ 
Sbjct: 1287 APTSPSPPPPLAPTAPSPPPPDAPSSPSPPPPDAPSPPPPDAPTAPSPPPPNA-PTAPSP 1345

Query: 160  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP 270
             P  SP AP        +P P  A   P P P +  P
Sbjct: 1346 PPPASPTAP--------SPPPPVAPQAPLPVPKNACP 1374

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 33/84 (39%), Positives = 36/84 (42%)
 Frame = +1

Query: 52   AAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTA 231
            A A  PT TP     P+A  PP    PT   PAP      +PPAP     P  AP P   
Sbjct: 848  ACAPAPTPTPAPVPEPSAPEPPPPDAPTQPTPAPGPPLPGAPPAPVVVPQPD-APAPPPP 906

Query: 232  GSPPAPTPDSLGPGPSGADTPPPP 303
             +P AP P    P    A  PPPP
Sbjct: 907  DAPDAPAPSP--PEAPDAPAPPPP 928

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 29/82 (35%), Positives = 37/82 (45%)
 Frame = +1

Query: 58   ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGS 237
            A P     P   PPA + PP   PP    P+P    A + P+P P   P  AP+P    +
Sbjct: 1218 AEPVIVPVPAPDPPAPSPPPPDAPPAPAEPSPPPPNAPTAPSPPPPDAP-VAPSPPPPNA 1276

Query: 238  PPAPTPDSLGPGPSGADTPPPP 303
            P AP+P    P P    +P PP
Sbjct: 1277 PVAPSP----PPPDAPTSPSPP 1294

[104][TOP]
>UniRef100_B3XYC5 Chitin-binding lectin n=1 Tax=Solanum lycopersicum var. cerasiforme
           RepID=B3XYC5_SOLLC
          Length = 365

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 44/104 (42%), Positives = 55/104 (52%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTAT---PPTATPPAAATPPTATPPTATPPAPASSPAT- 171
           P+ PP + P P   PP  + PP +    PPT +PP    PP  +PP  +PP P+ SP   
Sbjct: 96  PSPPPPSPPPPSPSPPPPSPPPPSPSPPPPTPSPP----PPAPSPPPPSPPPPSPSPPPP 151

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           SPP P+P+  P T   P  + SPP PTP    P PS    PPPP
Sbjct: 152 SPPPPSPSPPPPTPSPPPPSPSPPPPTPSPPPPAPS----PPPP 191

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 39/102 (38%), Positives = 53/102 (51%), Gaps = 1/102 (0%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA-SSPATSP 177
           AP    +  P   + PP +  PP+ +PP  +PP  +  P+  PPT +PP PA S P  SP
Sbjct: 84  APQNCQSQCPHTPSPPPPSPPPPSPSPPPPSPPPPS--PSPPPPTPSPPPPAPSPPPPSP 141

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P+P+  P + P PS +  PP P+P    P P      PPP
Sbjct: 142 PPPSPSPPPPSPPPPSPSPPPPTPSPPPPSPSPPPPTPSPPP 183

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 37/91 (40%), Positives = 49/91 (53%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPT---ATPPAAATPPTATPPTATPPAPASSP-- 165
           +P+ PP + P P   PP    PPT +PP    + PP +  PP+ +PP  +PP P+ SP  
Sbjct: 107 SPSPPPPSPPPPSPSPP----PPTPSPPPPAPSPPPPSPPPPSPSPPPPSPPPPSPSPPP 162

Query: 166 -ATSPPAPTPASTPSTAPTPSTAGSPPAPTP 255
              SPP P+P+  P T   P  A SPP P P
Sbjct: 163 PTPSPPPPSPSPPPPTPSPPPPAPSPPPPYP 193

[105][TOP]
>UniRef100_A9STR8 Predicted protein (Fragment) n=1 Tax=Physcomitrella patens subsp.
           patens RepID=A9STR8_PHYPA
          Length = 325

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 46/104 (44%), Positives = 51/104 (49%), Gaps = 5/104 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAA---ATPPTATPPTATPPAPASSPATS 174
           P  PP   PAP A PP   TPP   PP   PP A   A PP+ +PP A  P P S P  S
Sbjct: 134 PILPPPPQPAPVAPPPIIVTPPPQVPPPVLPPPAPSTAPPPSISPPPANSPPPWSPPPAS 193

Query: 175 PP--APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           PP  +P P   PS +P PS   SPP P        P+ A  PPP
Sbjct: 194 PPQSSPPPPPPPSGSPPPSRESSPPPP--------PASAPAPPP 229

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 40/105 (38%), Positives = 46/105 (43%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPT-ATPPAPASSPATSPP 180
           P   PT+ P    QPP    PP  +PP   PP     P A PP   TPP     P   PP
Sbjct: 107 PPLDPTSPPPDPFQPPPFVPPPVESPPPILPPPPQPAPVAPPPIIVTPPPQVPPPVLPPP 166

Query: 181 APTPASTPSTAPTPSTA----GSPPAPTPDSLGPGPSGADTPPPP 303
           AP+ A  PS +P P+ +      PPA  P S  P P      PPP
Sbjct: 167 APSTAPPPSISPPPANSPPPWSPPPASPPQSSPPPPPPPSGSPPP 211

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 39/101 (38%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P   P+  P P   PP A +PP  +PP A+PP ++ PP   P  + PP+  SSP   PPA
Sbjct: 164 PPPAPSTAPPPSISPPPANSPPPWSPPPASPPQSSPPPPPPPSGSPPPSRESSP-PPPPA 222

Query: 184 PTPASTPSTAPTPST-AGSPPAPTPDSLGPGPSGADTPPPP 303
             PA  P+  P  S   GSPP     ++ P  +  D  PPP
Sbjct: 223 SAPAPPPTAVPPASAPRGSPPISLAPAVIPRITQPDFTPPP 263

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 43/129 (33%), Positives = 49/129 (37%), Gaps = 29/129 (22%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAA----------ATPPTATPPTATPPAAATPPTATPPTATPPAP 153
           P  PP ++P P   PP              PP   PP  +PP    PP    P A PP  
Sbjct: 92  PLLPPESSPPPNPSPPPLDPTSPPPDPFQPPPFVPPPVESPPPILPPPPQPAPVAPPPII 151

Query: 154 ASSPATSPPAPTPASTPSTAPTPSTA-------------------GSPPAPTPDSLGPGP 276
            + P   PP   P   PSTAP PS +                    SPP P P S  P P
Sbjct: 152 VTPPPQVPPPVLPPPAPSTAPPPSISPPPANSPPPWSPPPASPPQSSPPPPPPPSGSPPP 211

Query: 277 SGADTPPPP 303
           S   +PPPP
Sbjct: 212 SRESSPPPP 220

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 41/104 (39%), Positives = 54/104 (51%), Gaps = 8/104 (7%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           PP  +P P + PPA+  PP ++PP   PP+ + PP+    ++ PP PAS+PA  P A  P
Sbjct: 179 PPANSPPPWSPPPAS--PPQSSPPPPPPPSGSPPPSR--ESSPPPPPASAPAPPPTAVPP 234

Query: 193 ASTPSTAPTPSTAGS--PPAPTPDSLGP------GPSGADTPPP 300
           AS P  +P  S A +  P    PD   P      GPS A   PP
Sbjct: 235 ASAPRGSPPISLAPAVIPRITQPDFTPPPSTNHSGPSSALPSPP 278

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/112 (33%), Positives = 45/112 (40%), Gaps = 12/112 (10%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPP--TATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           P  PP  T +P A PP    PP     PP   PP ++ PP  +PP   P +P   P   P
Sbjct: 63  PAFPPAWTDSPPAPPPDTTAPPDPAGQPPPLLPPESSPPPNPSPPPLDPTSPPPDPFQPP 122

Query: 178 P-APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS---------GADTPPPP 303
           P  P P  +P     P    +P AP P  + P P             T PPP
Sbjct: 123 PFVPPPVESPPPILPPPPQPAPVAPPPIIVTPPPQVPPPVLPPPAPSTAPPP 174

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 39/95 (41%), Positives = 49/95 (51%), Gaps = 7/95 (7%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA---SSPATS 174
           P  PP ++P P   PP + +PP +   +  PP A+ P  A PPTA PPA A   S P + 
Sbjct: 191 PASPPQSSPPP--PPPPSGSPPPSRESSPPPPPASAP--APPPTAVPPASAPRGSPPISL 246

Query: 175 PPAPTPAST-PSTAPTPSTAGSPPA---PTPDSLG 267
            PA  P  T P   P PST  S P+   P+P S G
Sbjct: 247 APAVIPRITQPDFTPPPSTNHSGPSSALPSPPSSG 281

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 37/102 (36%), Positives = 41/102 (40%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPP-TATPPAAATPPTATPPTATPPAPASSPATSPP 180
           P K P A     AQ P     P   P  T +PPA     TA P  A  P P   P +SPP
Sbjct: 42  PPKGPKAFIGNPAQAPFDGNNPAFPPAWTDSPPAPPPDTTAPPDPAGQPPPLLPPESSPP 101

Query: 181 A-PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+P     T+P P     PP   P    P P     PPPP
Sbjct: 102 PNPSPPPLDPTSPPPDPFQPPPFVPPPVESPPPI---LPPPP 140

[106][TOP]
>UniRef100_A9SIY2 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SIY2_PHYPA
          Length = 741

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 52/108 (48%), Positives = 57/108 (52%), Gaps = 11/108 (10%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATP------PTATPPTATPPAAATPPT--ATPPTATPPAP-ASSP 165
           PP A   P   PP A  P      P   PPTAT P AATPP   A PPTATPPAP A SP
Sbjct: 24  PPVAVNPPVVPPPVATPPTIPPATPVVNPPTATVPPAATPPVPVAVPPTATPPAPVAVSP 83

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSP--PAPTPDSLGPGPSGADTPPPP 303
           A SPPAP  A  P+ +P P  A  P    P P +L P    + +PP P
Sbjct: 84  ALSPPAPV-AVPPTLSPPPPDALPPSVSTPPPPALSPPSPTSSSPPQP 130

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/107 (43%), Positives = 55/107 (51%), Gaps = 10/107 (9%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPA------AATPPTAT-PPTATPPAPASSPAT 171
           P  + P P A PP A  PP   PP ATPP          PPTAT PP ATPP P + P T
Sbjct: 13  PVVSPPTPNAVPPVAVNPPVVPPPVATPPTIPPATPVVNPPTATVPPAATPPVPVAVPPT 72

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPA---PTPDSLGPGPSGADTPPPP 303
           + P    A +P+ +P P+    PP    P PD+L P  S   TPPPP
Sbjct: 73  ATPPAPVAVSPALSP-PAPVAVPPTLSPPPPDALPPSVS---TPPPP 115

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 49/109 (44%), Positives = 57/109 (52%), Gaps = 13/109 (11%)
 Frame = +1

Query: 13  PPTATPAPKAQPPA-AATPPTATPPT--ATPPAAATP-PTATPPTATPPAPAS------- 159
           PPTAT  P A PP   A PPTATPP   A  PA + P P A PPT +PP P +       
Sbjct: 52  PPTATVPPAATPPVPVAVPPTATPPAPVAVSPALSPPAPVAVPPTLSPPPPDALPPSVST 111

Query: 160 --SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
              PA SPP+PT +S P   P P +A     P+P  L P P+   T PP
Sbjct: 112 PPPPALSPPSPTSSSPPQPTPVPPSAPGGTPPSPILLSPPPAVNRTSPP 160

[107][TOP]
>UniRef100_A8J1D8 Vegetative cell wall protein gp1 n=1 Tax=Chlamydomonas reinhardtii
           RepID=A8J1D8_CHLRE
          Length = 296

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/103 (41%), Positives = 60/103 (58%), Gaps = 3/103 (2%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           A   PP+  P+P   PP   TPP+ +PP+  PP+    P   PP+  PP+PA SP  SP 
Sbjct: 27  ANAHPPSPPPSPA--PPTPPTPPSPSPPSPVPPS----PAPVPPSPAPPSPAPSPPPSPA 80

Query: 181 APTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPP 300
            PTP+ +PS +P+PS + SP   P+P+P  + P PS   +P P
Sbjct: 81  PPTPSPSPSPSPSPSPSPSPSPSPSPSPSPI-PSPSPKPSPSP 122

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 38/86 (44%), Positives = 54/86 (62%), Gaps = 3/86 (3%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPTATPPTATPPAPAS-SPATSPPAPTPASTPSTA-PTPS 225
           +A   P + PP+  PP   TPP+ +PP+  PP+PA   P+ +PP+P P+  PS A PTPS
Sbjct: 26  SANAHPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPS 85

Query: 226 TAGSP-PAPTPDSLGPGPSGADTPPP 300
            + SP P+P+P S  P PS + +P P
Sbjct: 86  PSPSPSPSPSP-SPSPSPSPSPSPSP 110

[108][TOP]
>UniRef100_A6R0R5 Predicted protein n=1 Tax=Ajellomyces capsulatus NAm1
           RepID=A6R0R5_AJECN
          Length = 765

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/119 (40%), Positives = 51/119 (42%), Gaps = 19/119 (15%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP-------PTATPPTATPPA--------AATPPTATPPTA 138
           P  PPT+ PAP   PP A  P       PT  PP   PPA        A  PP   PPTA
Sbjct: 458 PAPPPTSAPAPPPPPPPAPAPGPVPSSSPTPPPPPPPPPAPAPASTGPAPPPPPPPPPTA 517

Query: 139 ----TPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                PP PA S +  PP P  A  P   P PS    PP P P   G   + A  PPPP
Sbjct: 518 GLPRPPPRPAPSNSVPPPPPPSAGAPPPPPPPSAGAPPPPPPPPPPGSAANSAGPPPPP 576

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 43/112 (38%), Positives = 50/112 (44%), Gaps = 15/112 (13%)
 Frame = +1

Query: 13  PPTATPAP----KAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           PP   P P     A PP +A  P   PP A  P      + TPP   PP PA +PA++ P
Sbjct: 446 PPQTAPGPLPVRPAPPPTSAPAPPPPPPPAPAPGPVPSSSPTPPPPPPPPPAPAPASTGP 505

Query: 181 APTP-------ASTPSTAPTPSTAGSPPAPTPDSLG----PGPSGADTPPPP 303
           AP P       A  P   P P+ + S P P P S G    P P  A  PPPP
Sbjct: 506 APPPPPPPPPTAGLPRPPPRPAPSNSVPPPPPPSAGAPPPPPPPSAGAPPPP 557

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 42/102 (41%), Positives = 48/102 (47%), Gaps = 3/102 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTA--TPPAAATPPTATPPTATPPAPASSPATSP 177
           P K P ATP P   PP     PT+TP +    PP  A  P    P   P +  + P   P
Sbjct: 416 PPKIPHATPPPP--PPRPQASPTSTPQSQHLLPPQTAPGPLPVRPAPPPTSAPAPPPPPP 473

Query: 178 PAPTPASTPSTAPT-PSTAGSPPAPTPDSLGPGPSGADTPPP 300
           PAP P   PS++PT P     PPAP P S GP P     PPP
Sbjct: 474 PAPAPGPVPSSSPTPPPPPPPPPAPAPASTGPAPPPPPPPPP 515

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 51/127 (40%), Positives = 56/127 (44%), Gaps = 30/127 (23%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATP------PTATPPTATPPAAATPPTA--TPPTATPPAPASSPA 168
           PP   P P+A P   +TP      P  T P   P   A PPT+   PP   PPAPA  P 
Sbjct: 424 PPPPPPRPQASP--TSTPQSQHLLPPQTAPGPLPVRPAPPPTSAPAPPPPPPPAPAPGPV 481

Query: 169 TS-----------PPAPTPAST----PSTAPTPSTAG---SPPAPTPDSLGPGP----SG 282
            S           PPAP PAST    P   P P TAG    PP P P +  P P    +G
Sbjct: 482 PSSSPTPPPPPPPPPAPAPASTGPAPPPPPPPPPTAGLPRPPPRPAPSNSVPPPPPPSAG 541

Query: 283 ADTPPPP 303
           A  PPPP
Sbjct: 542 APPPPPP 548

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 38/103 (36%), Positives = 49/103 (47%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1   APTKPPTATPA-PKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
           +P  PP   P  P A PP     P A+P T+TP +    P  T P   P  PA  P ++P
Sbjct: 408 SPGLPPALPPKIPHATPPPPPPRPQASP-TSTPQSQHLLPPQTAPGPLPVRPAPPPTSAP 466

Query: 178 -PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P P   P+  P PS++ +PP P P    P P+     PPP
Sbjct: 467 APPPPPPPAPAPGPVPSSSPTPPPPPPPPPAPAPASTGPAPPP 509

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 40/107 (37%), Positives = 50/107 (46%), Gaps = 6/107 (5%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATP--PTATPPAAATPPTATPPTATPPAPASSPATS 174
           AP  P      P  +  +   PP   P  P ATPP     P A+P T+TP +    P  +
Sbjct: 391 APQLPSRNPVLPARREVSPGLPPALPPKIPHATPPPPPPRPQASP-TSTPQSQHLLPPQT 449

Query: 175 PPAPTP---ASTPSTAPTPSTAGSPPAPTP-DSLGPGPSGADTPPPP 303
            P P P   A  P++AP P     PP P P  + GP PS + TPPPP
Sbjct: 450 APGPLPVRPAPPPTSAPAP-----PPPPPPAPAPGPVPSSSPTPPPP 491

[109][TOP]
>UniRef100_A5USV4 Putative uncharacterized protein n=1 Tax=Roseiflexus sp. RS-1
           RepID=A5USV4_ROSS1
          Length = 548

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/110 (48%), Positives = 63/110 (57%), Gaps = 12/110 (10%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAAT----PPTATP--PTATPPAAATP---PTATPPTATPPAPAS 159
           T PPTAT  P  +PP+A++    PPTA P  PTATP    TP   PTATP    PPAP +
Sbjct: 376 TPPPTATRVPPTEPPSASSTPQPPPTARPPRPTATPRPTITPTSAPTATP--TDPPAPTA 433

Query: 160 SPATSPPAP--TPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPP 300
           +P T PPAP  TP   P+  PTP+   +P PAPT     P P+   T PP
Sbjct: 434 TP-TDPPAPTATPTPAPTATPTPAPTATPTPAPTATPT-PAPTATPTDPP 481

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 57/114 (50%), Positives = 69/114 (60%), Gaps = 22/114 (19%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP--PTATP-PTATPPAA--ATP-----PTATP-----PTA 138
           PT+PP+A+  P  QPP  A P  PTATP PT TP +A  ATP     PTATP     PTA
Sbjct: 386 PTEPPSASSTP--QPPPTARPPRPTATPRPTITPTSAPTATPTDPPAPTATPTDPPAPTA 443

Query: 139 TP-PAPASSPATSP---PAPTPASTPSTAPTPSTAGSPPAPT---PDSLGPGPS 279
           TP PAP ++P  +P   P P P +TP+ APT +T   PPAPT    ++L P PS
Sbjct: 444 TPTPAPTATPTPAPTATPTPAPTATPTPAPT-ATPTDPPAPTATPTETLPPTPS 496

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 52/108 (48%), Positives = 56/108 (51%), Gaps = 9/108 (8%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP---PTATP---PTATP-PAPASS 162
           PT  PTATP     P A  T P A   T TP   ATP   PTATP   PTATP PAP ++
Sbjct: 417 PTSAPTATPTDPPAPTATPTDPPAPTATPTPAPTATPTPAPTATPTPAPTATPTPAPTAT 476

Query: 163 PATSPPAPTPASTPSTAPTPSTAGSPPA--PTPDSLGPGPSGADTPPP 300
           P T PPAPT   T +  PTPS   +  A  PT    G  PSG  T  P
Sbjct: 477 P-TDPPAPTATPTETLPPTPSITPTDEAGQPTVTPAGSEPSGMPTLTP 523

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 49/109 (44%), Positives = 57/109 (52%), Gaps = 10/109 (9%)
 Frame = +1

Query: 4   PTKPPTA-----TPAPKAQP-PAAATPPTAT--PPTATPPAAATPPTATPPTATPPAPAS 159
           PT PPT      TP P   P P A  PPTAT  PPT  P A++TP    PPTA PP P +
Sbjct: 352 PTAPPTEASPTNTPLPTNTPSPTATPPPTATRVPPTEPPSASSTPQP--PPTARPPRPTA 409

Query: 160 SP-ATSPPAPTPASTPSTAPTP-STAGSPPAPTPDSLGPGPSGADTPPP 300
           +P  T  P   P +TP+  P P +T   PPAPT     P P+   TP P
Sbjct: 410 TPRPTITPTSAPTATPTDPPAPTATPTDPPAPTATPT-PAPTATPTPAP 457

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 55/120 (45%), Positives = 62/120 (51%), Gaps = 20/120 (16%)
 Frame = +1

Query: 1   APTKPPTATPAPKA---QPPAAATPPTATP---PTATPPAAATP-PTATP---PTAT--- 141
           APT  PT  PAP A    PPA    PT  P   PT  P A  TP PTATP   PTAT   
Sbjct: 420 APTATPTDPPAPTATPTDPPAPTATPTPAPTATPTPAPTATPTPAPTATPTPAPTATPTD 479

Query: 142 PPAPASSPATSPPAPTPASTPST---APTPSTAGSPPAP----TPDSLGPGPSGADTPPP 300
           PPAP ++P  + P PTP+ TP+     PT + AGS P+     TP   G  PSG  T  P
Sbjct: 480 PPAPTATPTETLP-PTPSITPTDEAGQPTVTPAGSEPSGMPTLTPTPAGSEPSGMPTLTP 538

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 51/120 (42%), Positives = 57/120 (47%), Gaps = 25/120 (20%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTATP--------------PTATP-PAAATPPTAT--PPTATP 144
           PTATPAP++       PPT TP              PT TP P A  PPTAT  PPT  P
Sbjct: 331 PTATPAPRSPTATPPPPPTMTPTAPPTEASPTNTPLPTNTPSPTATPPPTATRVPPTEPP 390

Query: 145 PA---PASSPATSPPAPT----PASTPSTAPTPSTAGSPPAPTPDSLG-PGPSGADTPPP 300
            A   P   P   PP PT    P  TP++APT +T   PPAPT      P P+   TP P
Sbjct: 391 SASSTPQPPPTARPPRPTATPRPTITPTSAPT-ATPTDPPAPTATPTDPPAPTATPTPAP 449

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 41/100 (41%), Positives = 52/100 (52%), Gaps = 4/100 (4%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTATPPTAT-PPAAATPPTATPPTATPPAPASSPATSPPAP-T 189
           P ATP P ++PP  +  P    PTA+  PA    P    PTATPP P +   T+PP   +
Sbjct: 301 PIATPPPTSRPPRPSPTPGQIEPTASNAPAPTATPAPRSPTATPPPPPTMTPTAPPTEAS 360

Query: 190 PASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPPPP 303
           P +TP    TPS   +PP PT   + P   PS + TP PP
Sbjct: 361 PTNTPLPTNTPSPTATPP-PTATRVPPTEPPSASSTPQPP 399

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 44/108 (40%), Positives = 54/108 (50%), Gaps = 12/108 (11%)
 Frame = +1

Query: 7   TKPPTATPAP-KAQPPAAATP-PTATP----PTATPPAAAT-----PPTATPPTATP-PA 150
           ++PP  +P P + +P A+  P PTATP    PTATPP   T     PPT   PT TP P 
Sbjct: 309 SRPPRPSPTPGQIEPTASNAPAPTATPAPRSPTATPPPPPTMTPTAPPTEASPTNTPLPT 368

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
              SP  +PP PT    P T   P +A S P P P +  P P+    P
Sbjct: 369 NTPSPTATPP-PTATRVPPT--EPPSASSTPQPPPTARPPRPTATPRP 413

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 40/96 (41%), Positives = 46/96 (47%), Gaps = 2/96 (2%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPT--ATPPAPASSPATSP 177
           PT  PTATP P   P A  TP     PT  P   ATP    PPT   TP   A  P  +P
Sbjct: 453 PTPAPTATPTP--APTATPTPAPTATPTDPPAPTATPTETLPPTPSITPTDEAGQPTVTP 510

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA 285
               P+  P+  PTP  AGS P+  P +L P  +GA
Sbjct: 511 AGSEPSGMPTLTPTP--AGSEPSGMP-TLTPDDAGA 543

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 41/115 (35%), Positives = 49/115 (42%), Gaps = 15/115 (13%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTA---TPPTATPPA--------AATPPTATPPTATPP 147
           +P    TA+PAP   P      PT    T P A P          AATP    PPT+ PP
Sbjct: 253 SPVPIATASPAPSLPPTTPVEAPTTVEITAPEAAPQTGREPERVDAATPIATPPPTSRPP 312

Query: 148 APASSPA----TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P+ +P     T+  AP P +TP  AP   TA  PP PT     P    + T  P
Sbjct: 313 RPSPTPGQIEPTASNAPAPTATP--APRSPTATPPPPPTMTPTAPPTEASPTNTP 365

[110][TOP]
>UniRef100_Q4KXE0 Cold acclimation induced protein 2-1 n=1 Tax=Triticum aestivum
           RepID=Q4KXE0_WHEAT
          Length = 321

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 51/131 (38%), Positives = 70/131 (53%), Gaps = 30/131 (22%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATP-PAAATPPTATPPTATP-PAPASSPATS 174
           +P  PP+ TP   A  P+  +PP+ TPP+A P P+  +PP+ TPP+A P P+P S P+ +
Sbjct: 153 SPMSPPSMTPPSAAPMPSPMSPPSMTPPSAAPMPSPMSPPSMTPPSAAPMPSPMSPPSMT 212

Query: 175 PPA----PTPASTPSTAP------------------TPSTAGSP--PAPTPDSLG----P 270
           PP+    P+P S PS AP                  TP +  SP  PAP+P + G    P
Sbjct: 213 PPSAAPMPSPMSPPSMAPPSSEPMPSPMTPAAAPGTTPVSPASPAGPAPSPGTPGGGSSP 272

Query: 271 GPSGADTPPPP 303
           G  G+DT  PP
Sbjct: 273 GTPGSDTSSPP 283

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 45/106 (42%), Positives = 61/106 (57%), Gaps = 7/106 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQP-PAAATPPTATPPTATP-PAAATPPTATPPTATP-PAPASSPATS 174
           P  PP + P   A P P+  +PP+ TPP+A P P+  +PP+ TPP+A P P+P S P+ +
Sbjct: 136 PPPPPPSMPPSSAPPMPSPMSPPSMTPPSAAPMPSPMSPPSMTPPSAAPMPSPMSPPSMT 195

Query: 175 PPA----PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           PP+    P+P S PS  P PS A  P   +P S+ P PS    P P
Sbjct: 196 PPSAAPMPSPMSPPSMTP-PSAAPMPSPMSPPSMAP-PSSEPMPSP 239

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 44/126 (34%), Positives = 65/126 (51%), Gaps = 26/126 (20%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATP-PAAATPPTATPPTATP-PAPASSPATS 174
           +P  PP+ TP   A  P+  +PP+ TPP+A P P+  +PP+ TPP+A P P+P S P+ +
Sbjct: 170 SPMSPPSMTPPSAAPMPSPMSPPSMTPPSAAPMPSPMSPPSMTPPSAAPMPSPMSPPSMA 229

Query: 175 PPAP-------TPASTPSTAPTPSTAGSPPAPTPDSLGPGPS-----------------G 282
           PP+        TPA+ P T P    + + PAP+P + G G S                 G
Sbjct: 230 PPSSEPMPSPMTPAAAPGTTPVSPASPAGPAPSPGTPGGGSSPGTPGSDTSSPPAPAADG 289

Query: 283 ADTPPP 300
           A++  P
Sbjct: 290 ANSTTP 295

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 41/101 (40%), Positives = 55/101 (54%), Gaps = 5/101 (4%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASSPATSPPA-- 183
           PP   P P    P  + PP++ PP  +P    +PP+ TPP+A P P+P S P+ +PP+  
Sbjct: 131 PPGLLPPP----PPPSMPPSSAPPMPSP---MSPPSMTPPSAAPMPSPMSPPSMTPPSAA 183

Query: 184 --PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             P+P S PS  P PS A  P   +P S+ P PS A  P P
Sbjct: 184 PMPSPMSPPSMTP-PSAAPMPSPMSPPSMTP-PSAAPMPSP 222

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 39/91 (42%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +1

Query: 25  TPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPA-TSPPAPTPAST 201
           TP     PP    PP + PP++ PP    P   +PP+ TPP+ A  P+  SPP+ TP   
Sbjct: 130 TPPGLLPPP----PPPSMPPSSAPPM---PSPMSPPSMTPPSAAPMPSPMSPPSMTP--- 179

Query: 202 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
           PS AP PS   SPP+ TP S  P PS    P
Sbjct: 180 PSAAPMPSPM-SPPSMTPPSAAPMPSPMSPP 209

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 37/119 (31%), Positives = 57/119 (47%), Gaps = 25/119 (21%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATP-PAAATPPTATPPTA----TPPAPASSP 165
           +P  PP+ TP   A  P+  +PP+ TPP+A P P+  +PP+  PP++    +P  PA++P
Sbjct: 187 SPMSPPSMTPPSAAPMPSPMSPPSMTPPSAAPMPSPMSPPSMAPPSSEPMPSPMTPAAAP 246

Query: 166 ATSP--------PAP------------TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG 282
            T+P        PAP            TP S  S+ P P+  G+       +  P  +G
Sbjct: 247 GTTPVSPASPAGPAPSPGTPGGGSSPGTPGSDTSSPPAPAADGANSTTPGSAAAPVTAG 305

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 34/81 (41%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = +1

Query: 61  TPPTATPPTATPPAAATPPTATPPTATPPAPAS-SPATSPPAPTPASTPSTAPTPSTAGS 237
           TPP   PP   PP  + PP++ PP  +P +P S +P ++ P P+P S PS  P PS A  
Sbjct: 130 TPPGLLPP---PPPPSMPPSSAPPMPSPMSPPSMTPPSAAPMPSPMSPPSMTP-PSAAPM 185

Query: 238 PPAPTPDSLGPGPSGADTPPP 300
           P   +P S+ P PS A  P P
Sbjct: 186 PSPMSPPSMTP-PSAAPMPSP 205

[111][TOP]
>UniRef100_C7IZA4 Os02g0162200 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=C7IZA4_ORYSJ
          Length = 261

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 46/104 (44%), Positives = 62/104 (59%), Gaps = 9/104 (8%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPAS 198
           TAT    + PPA++T P   PPT+  PA+  P + +PP A+PP+P+SS A +P  P PAS
Sbjct: 135 TATATAPSPPPASSTAP---PPTSPAPASPPPSSPSPPPASPPSPSSSGAAAPTTPPPAS 191

Query: 199 TPSTAPTPS----TAGSPPAPTPDSLGPGPSGADTP-----PPP 303
           +P + PTP+    +A SPPAP P +  P   GA  P     PPP
Sbjct: 192 SPPSTPTPASPAPSASSPPAP-PSANAPSAQGARNPSATSSPPP 234

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 39/85 (45%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAAA---TPPTATPPTATP-PAPASSPATS 174
           T PP  +PAP + PP++ +PP A+PP+ +   AA   TPP A+ P +TP PA  +  A+S
Sbjct: 149 TAPPPTSPAPASPPPSSPSPPPASPPSPSSSGAAAPTTPPPASSPPSTPTPASPAPSASS 208

Query: 175 PPAPTPASTPST--APTPSTAGSPP 243
           PPAP  A+ PS   A  PS   SPP
Sbjct: 209 PPAPPSANAPSAQGARNPSATSSPP 233

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 33/99 (33%), Positives = 47/99 (47%), Gaps = 5/99 (5%)
 Frame = +1

Query: 1   APTKPPTATPAPK-AQPPA----AATPPTATPPTATPPAAATPPTATPPTATPPAPASSP 165
           AP  PP ++P+P  A PP+     A  PT  PP ++PP+  TP +  P  ++PPAP S+ 
Sbjct: 157 APASPPPSSPSPPPASPPSPSSSGAAAPTTPPPASSPPSTPTPASPAPSASSPPAPPSAN 216

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG 282
           A S       S  S+ P  +   +  A     L  G  G
Sbjct: 217 APSAQGARNPSATSSPPPAANGAAHAAVAASGLAAGIIG 255

[112][TOP]
>UniRef100_B8AI70 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8AI70_ORYSI
          Length = 261

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 46/104 (44%), Positives = 62/104 (59%), Gaps = 9/104 (8%)
 Frame = +1

Query: 19  TATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPAS 198
           TAT    + PPA++T P   PPT+  PA+  P + +PP A+PP+P+SS A +P  P PAS
Sbjct: 135 TATATAPSPPPASSTAP---PPTSPAPASPPPSSPSPPPASPPSPSSSGAAAPTTPPPAS 191

Query: 199 TPSTAPTPS----TAGSPPAPTPDSLGPGPSGADTP-----PPP 303
           +P + PTP+    +A SPPAP P +  P   GA  P     PPP
Sbjct: 192 SPPSTPTPASPAPSASSPPAP-PSANAPSAQGARNPSATSSPPP 234

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 39/85 (45%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAAA---TPPTATPPTATP-PAPASSPATS 174
           T PP  +PAP + PP++ +PP A+PP+ +   AA   TPP A+ P +TP PA  +  A+S
Sbjct: 149 TAPPPTSPAPASPPPSSPSPPPASPPSPSSSGAAAPTTPPPASSPPSTPTPASPAPSASS 208

Query: 175 PPAPTPASTPST--APTPSTAGSPP 243
           PPAP  A+ PS   A  PS   SPP
Sbjct: 209 PPAPPSANAPSAQGARNPSATSSPP 233

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 33/99 (33%), Positives = 47/99 (47%), Gaps = 5/99 (5%)
 Frame = +1

Query: 1   APTKPPTATPAPK-AQPPA----AATPPTATPPTATPPAAATPPTATPPTATPPAPASSP 165
           AP  PP ++P+P  A PP+     A  PT  PP ++PP+  TP +  P  ++PPAP S+ 
Sbjct: 157 APASPPPSSPSPPPASPPSPSSSGAAAPTTPPPASSPPSTPTPASPAPSASSPPAPPSAN 216

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG 282
           A S       S  S+ P  +   +  A     L  G  G
Sbjct: 217 APSAQGARNPSATSSPPPAANGAAHAAVAASGLAAGIIG 255

[113][TOP]
>UniRef100_A8IGC9 Fibrocystin-L-like protein n=1 Tax=Chlamydomonas reinhardtii
            RepID=A8IGC9_CHLRE
          Length = 4806

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 43/104 (41%), Positives = 56/104 (53%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAAT-PPTATPPTATPPAPASSPAT--- 171
            P KPP   P+P   PP    PP+ +PP+  PP+    PP+ TPP+  PP P+  PA    
Sbjct: 4613 PPKPPVP-PSPPPAPPMPPRPPSPSPPSPRPPSPPPRPPSPTPPSPKPPGPSPPPAPPSP 4671

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            SPP+P P S PS AP    +  PP+P+P S  P      +P PP
Sbjct: 4672 SPPSPAPPSPPSPAPPVPPSPVPPSPSPPSPAPPSPSPPSPLPP 4715

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 43/107 (40%), Positives = 55/107 (51%), Gaps = 6/107 (5%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQP-PAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS----- 162
            AP  P   +PAP + P PA   PP+  PP+ +PP+ A PP+ +PP+  PP P S      
Sbjct: 4667 APPSPSPPSPAPPSPPSPAPPVPPSPVPPSPSPPSPA-PPSPSPPSPLPPVPPSPLPPRP 4725

Query: 163  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+ +PP+P P   PS  P P    SPP   P   GP P     P PP
Sbjct: 4726 PSPTPPSPKPPRPPSPPPAPPVPPSPPPSPPVPPGPPPKPPSPPRPP 4772

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 41/102 (40%), Positives = 50/102 (49%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +P P    P A  PP   PP+  PP   +PP+ +PP+  PPAP   P+ SPP+
Sbjct: 4479 PPSPAPPSPRPPLPSPPAPRPPRPLPPSPRPPRPPSPPSPSPPSPRPPAP---PSPSPPS 4535

Query: 184  PTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P S   PS AP      SP  P+P   GP P     P PP
Sbjct: 4536 PRPPSPAPPSPAPPSPVPPSPAPPSPAPPGPLPPSPRPPAPP 4577

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 42/110 (38%), Positives = 53/110 (48%), Gaps = 9/110 (8%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS------ 162
            AP  P   +P P +  P +  PP+  PP+  PP+ A PP   PP+  PPAP S       
Sbjct: 4527 APPSPSPPSPRPPSPAPPSPAPPSPVPPSPAPPSPA-PPGPLPPSPRPPAPPSPSPPSPR 4585

Query: 163  -PATSPPAPTPASTPSTAPTPSTAGSPP--APTPDSLGPGPSGADTPPPP 303
             P+ +PP+P P + PS  P P    SPP   P P S  P P     PP P
Sbjct: 4586 PPSPNPPSPRPPAPPSPPPKPPVPPSPPPKPPVPPSPPPAPPMPPRPPSP 4635

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 43/104 (41%), Positives = 55/104 (52%), Gaps = 4/104 (3%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQP-PAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP 177
            +PT P    P P   P P + +PP+  PP+   PA   PP+  PP+ +PP+PA  P+ SP
Sbjct: 4651 SPTPPSPKPPGPSPPPAPPSPSPPSPAPPSPPSPAPPVPPSPVPPSPSPPSPAP-PSPSP 4709

Query: 178  PAPTPASTPSTAP--TPS-TAGSPPAPTPDSLGPGPSGADTPPP 300
            P+P P   PS  P   PS T  SP  P P S  P P    +PPP
Sbjct: 4710 PSPLPPVPPSPLPPRPPSPTPPSPKPPRPPSPPPAPPVPPSPPP 4753

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 41/104 (39%), Positives = 53/104 (50%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P   +P P +  P +  PP+  PP  +PPA   PP   PP+  PP P S P+ SPP+
Sbjct: 4464 PPSPRPPSPVPPSPVPPSPAPPSPRPPLPSPPAPR-PPRPLPPSPRPPRPPSPPSPSPPS 4522

Query: 184  PTPASTPSTAP----TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P + PS +P     PS A  PP+P P S  P      +P PP
Sbjct: 4523 PRPPAPPSPSPPSPRPPSPA--PPSPAPPSPVPPSPAPPSPAPP 4564

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 40/99 (40%), Positives = 56/99 (56%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP+ +P P  +PPA   PP+ +PP+  PP+ A PP+  PP+  PP+PA  P+ +PP 
Sbjct: 4512 PPSPPSPSP-PSPRPPA---PPSPSPPSPRPPSPA-PPSPAPPSPVPPSPA-PPSPAPPG 4565

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P P S    AP   +  SP  P+P+   P P    +PPP
Sbjct: 4566 PLPPSPRPPAPPSPSPPSPRPPSPNPPSPRPPAPPSPPP 4604

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 39/103 (37%), Positives = 53/103 (51%), Gaps = 4/103 (3%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS----SPAT 171
            P+ P  + P+P+   P + +PP+  PP+  PP+ A PP+  PP+  PP+PA      P+ 
Sbjct: 4513 PSPPSPSPPSPRPPAPPSPSPPSPRPPSPAPPSPA-PPSPVPPSPAPPSPAPPGPLPPSP 4571

Query: 172  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
             PPAP   S PS  P      SP  P P S  P P    +PPP
Sbjct: 4572 RPPAPPSPSPPSPRPPSPNPPSPRPPAPPSPPPKPPVPPSPPP 4614

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 42/105 (40%), Positives = 54/105 (51%), Gaps = 4/105 (3%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASS----PA 168
            AP  P   +P P   PP+  TPP+  PP+  PP+   PP+  PP+  PP+PA      P 
Sbjct: 4434 APPSPDPPSPPP-LPPPSPPTPPSPRPPSPRPPSPR-PPSPVPPSPVPPSPAPPSPRPPL 4491

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             SPPAP P      +P P    SPP+P+P S  P P    +P PP
Sbjct: 4492 PSPPAPRPPRPLPPSPRPPRPPSPPSPSPPS--PRPPAPPSPSPP 4534

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 42/106 (39%), Positives = 51/106 (48%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP-PTATPPAPASSPATSPP 180
            P  P    PAP +  P +  PP+  PP+  PPA  +PP   P P + PP P   P+  P 
Sbjct: 4566 PLPPSPRPPAPPSPSPPSPRPPSPNPPSPRPPAPPSPPPKPPVPPSPPPKPPVPPSPPPA 4625

Query: 181  APTPASTPSTAP----TPSTAGSPPAPTPDS-LGPGPSGADTPPPP 303
             P P   PS +P     PS    PP+PTP S   PGPS    PP P
Sbjct: 4626 PPMPPRPPSPSPPSPRPPSPPPRPPSPTPPSPKPPGPSPPPAPPSP 4671

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 42/102 (41%), Positives = 55/102 (53%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATP-PTATPPAAATPPTATPPTATPPAPAS-SPATSP 177
            P+  P A P+P  +PP   +PP   P P + PPA   PP   PP+ +PP+P   SP   P
Sbjct: 4592 PSPRPPAPPSPPPKPPVPPSPPPKPPVPPSPPPAPPMPPR--PPSPSPPSPRPPSPPPRP 4649

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P+PTP S     P+P  A  PP+P+P S  P P    +P PP
Sbjct: 4650 PSPTPPSPKPPGPSPPPA--PPSPSPPS--PAPPSPPSPAPP 4687

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 42/112 (37%), Positives = 51/112 (45%), Gaps = 11/112 (9%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-------PTATPPTATPPAPAS 159
            AP  P   +P P +  P +  PP   PP+  PPA  +P       P+  PP+  PPAP S
Sbjct: 4542 APPSPAPPSPVPPSPAPPSPAPPGPLPPSPRPPAPPSPSPPSPRPPSPNPPSPRPPAPPS 4601

Query: 160  SPATSP----PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P   P    P P P   PS  P P     PP+P+P S  P PS    PP P
Sbjct: 4602 PPPKPPVPPSPPPKPPVPPSPPPAPPMPPRPPSPSPPSPRP-PSPPPRPPSP 4652

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 41/103 (39%), Positives = 55/103 (53%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P+ P    P+P  +PP+  TPP+  PP  +PP A  PP+ +PP+  PP+P S     PP
Sbjct: 4634 SPSPPSPRPPSPPPRPPSP-TPPSPKPPGPSPPPA--PPSPSPPSPAPPSPPSPAPPVPP 4690

Query: 181  APTP--ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            +P P   S PS AP   +  SP  P P S  P    + TPP P
Sbjct: 4691 SPVPPSPSPPSPAPPSPSPPSPLPPVPPSPLPPRPPSPTPPSP 4733

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 40/101 (39%), Positives = 52/101 (51%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P +PP+ +P     P     PP+ TPP+  PP  + PP    P+   PAP S P+ +PP 
Sbjct: 4629 PPRPPSPSPPSPRPPSPPPRPPSPTPPSPKPPGPSPPPAPPSPSPPSPAPPSPPSPAPPV 4688

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDS-LGPGPSGADTPPPP 303
            P     PS +P PS A  PP+P+P S L P P     P PP
Sbjct: 4689 PPSPVPPSPSP-PSPA--PPSPSPPSPLPPVPPSPLPPRPP 4726

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 41/105 (39%), Positives = 52/105 (49%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS----SPAT 171
            P  PP+    P    PA + PP+  PP+  PP   +PP+  PP+ TPP P S    SPA 
Sbjct: 4251 PPAPPSPPSPPLPPSPAPSPPPSPAPPSPAPP---SPPSPAPPSPTPPGPPSPRLPSPA- 4306

Query: 172  SPPAPTPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSGADTPPPP 303
             PP+P  A +P   P+P+    SPP P P    P P     PP P
Sbjct: 4307 PPPSPGIAVSPPVPPSPAPPRPSPPVPPPSPAPPSPPQPPAPPSP 4351

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 40/105 (38%), Positives = 54/105 (51%), Gaps = 8/105 (7%)
 Frame = +1

Query: 10   KPPTATPAPKAQPPAAATPPTATPPTATP-PAAATPPTATPPTATPPAPAS--SPATSPP 180
            +PP+  P P +  P +  PP  +PP A P P+  +P   +PP+  PP P S   P+ SPP
Sbjct: 4641 RPPSPPPRPPSPTPPSPKPPGPSPPPAPPSPSPPSPAPPSPPSPAPPVPPSPVPPSPSPP 4700

Query: 181  APTPASTPSTAPTPSTAGS-----PPAPTPDSLGPGPSGADTPPP 300
            +P P S    +P P    S     PP+PTP S  P P    +PPP
Sbjct: 4701 SPAPPSPSPPSPLPPVPPSPLPPRPPSPTPPS--PKPPRPPSPPP 4743

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 37/101 (36%), Positives = 50/101 (49%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  P    P+P+   P + +PP+  PP+  PP+   P   +PP   PP P S P   P 
Sbjct: 4560 SPAPPGPLPPSPRPPAPPSPSPPSPRPPSPNPPSPRPPAPPSPP-PKPPVPPSPPPKPPV 4618

Query: 181  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P+P   P   P P +  SPP+P P S  P P  + TPP P
Sbjct: 4619 PPSPPPAPPMPPRPPSP-SPPSPRPPSPPPRPP-SPTPPSP 4657

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 38/106 (35%), Positives = 49/106 (46%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATP------PTATPPTATPPAAATPPTATPPTATPPAPASSP 165
            P  PP A P P  +PP+ + P      P   PP+ TPP+   P  + PP    P+P S  
Sbjct: 4619 PPSPPPAPPMPP-RPPSPSPPSPRPPSPPPRPPSPTPPSPKPPGPSPPPAPPSPSPPSPA 4677

Query: 166  ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              SPP+P P   PS  P   +  SP  P+P    P P    +P PP
Sbjct: 4678 PPSPPSPAPPVPPSPVPPSPSPPSPAPPSPSPPSPLPPVPPSPLPP 4723

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 37/103 (35%), Positives = 50/103 (48%), Gaps = 2/103 (1%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPAS--SPATS 174
            AP  P    P+P A  P    PP+  PP    P + +PP+  PP    P+P S   P+ +
Sbjct: 4483 APPSPRPPLPSPPAPRPPRPLPPSPRPPRPPSPPSPSPPSPRPPAPPSPSPPSPRPPSPA 4542

Query: 175  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP+P P S    +P P +  +PP P P S  P P    +P PP
Sbjct: 4543 PPSPAPPSPVPPSPAPPSP-APPGPLPPS--PRPPAPPSPSPP 4582

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 37/92 (40%), Positives = 47/92 (51%), Gaps = 1/92 (1%)
 Frame = +1

Query: 31   APKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPST 210
            AP +  P +  PP+  PP   PP+  TPP+  PP+  PP+P   P+  PP+P P S    
Sbjct: 4429 APPSPAPPSPDPPS--PPPLPPPSPPTPPSPRPPSPRPPSPRP-PSPVPPSPVPPSPAPP 4485

Query: 211  APTPSTAGSPPAPTPD-SLGPGPSGADTPPPP 303
            +P P    SPPAP P   L P P     P PP
Sbjct: 4486 SPRPPLP-SPPAPRPPRPLPPSPRPPRPPSPP 4516

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 40/106 (37%), Positives = 49/106 (46%), Gaps = 9/106 (8%)
 Frame = +1

Query: 13   PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPA--SSPATSPPAP 186
            PP   P P         PP A P   +PP   +P  + PP+  PP+PA  S P+ +PP+P
Sbjct: 4234 PPMPPPMPVLLNMVVFDPP-APPSPPSPPLPPSPAPSPPPSPAPPSPAPPSPPSPAPPSP 4292

Query: 187  TPASTPS-------TAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            TP   PS         P+P  A SPP P P    P PS    PP P
Sbjct: 4293 TPPGPPSPRLPSPAPPPSPGIAVSPPVP-PSPAPPRPSPPVPPPSP 4337

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 31/94 (32%), Positives = 41/94 (43%), Gaps = 2/94 (2%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP-- 177
            P  P   +P+P +  P + +PP+  PP    P    PP+ TPP+  PP P S P   P  
Sbjct: 4689 PPSPVPPSPSPPSPAPPSPSPPSPLPPVPPSPLPPRPPSPTPPSPKPPRPPSPPPAPPVP 4748

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 279
            P+P P+      P P     P  P      P PS
Sbjct: 4749 PSPPPSPPVPPGPPPKPPSPPRPPRLRLYSPFPS 4782

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 33/92 (35%), Positives = 46/92 (50%), Gaps = 4/92 (4%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPT----ATPPTATPPAPASSPA 168
            +P  P  A P+P +  P + TPP   PP+   P+ A PP+     +PP    PAP   P 
Sbjct: 4273 SPAPPSPAPPSPPSPAPPSPTPP--GPPSPRLPSPAPPPSPGIAVSPPVPPSPAP---PR 4327

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL 264
             SPP P P+  P + P P    +PP+P P  +
Sbjct: 4328 PSPPVPPPSPAPPSPPQPP---APPSPNPSGV 4356

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 35/104 (33%), Positives = 45/104 (43%), Gaps = 14/104 (13%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPP---TATPPAAATPPTATPPTA--TPPAPASSP 165
            +P+ P  A P+P    P    PP+  PP   + TPP+   P   +PP A   PP+P  SP
Sbjct: 4696 SPSPPSPAPPSPSPPSPLPPVPPSPLPPRPPSPTPPSPKPPRPPSPPPAPPVPPSPPPSP 4755

Query: 166  ATSP-PAPTPASTP--------STAPTPSTAGSPPAPTPDSLGP 270
               P P P P S P        S  P+   A  P A  P +  P
Sbjct: 4756 PVPPGPPPKPPSPPRPPRLRLYSPFPSQPFAAQPAAAQPTTAAP 4799

[114][TOP]
>UniRef100_A8I1E4 Hydroxyproline-rich cell wall protein n=1 Tax=Chlamydomonas
           reinhardtii RepID=A8I1E4_CHLRE
          Length = 398

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 47/123 (38%), Positives = 67/123 (54%), Gaps = 22/123 (17%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQP-----PAAATPPTATP---------PTATPPAAATP-------P 117
           +PT  P+ TP+PKA P     P A+  P+ TP         PT +P A+ +P       P
Sbjct: 251 SPTPTPSPTPSPKASPSPSPSPKASPSPSPTPSPKASPSPSPTPSPKASPSPSPSPKASP 310

Query: 118 TATPPTATPPAPASSPATSP-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
           + TP     P+P  SP  SP P+P+P+++P  +PTPS AG+ P P P +  P P+  + P
Sbjct: 311 SPTPSPKASPSPTPSPKASPSPSPSPSTSPKVSPTPSPAGTAPKPAP-TPSPSPTKKNKP 369

Query: 295 PPP 303
           PPP
Sbjct: 370 PPP 372

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 48/120 (40%), Positives = 65/120 (54%), Gaps = 20/120 (16%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP-PTATP---------PTATPPAAATP-PTATPPTATPPA 150
           P   P+ TP+PKA P    TP PT +P         P A+P  + TP P A+P  +  P+
Sbjct: 236 PIPTPSPTPSPKASPSPTPTPSPTPSPKASPSPSPSPKASPSPSPTPSPKASPSPSPTPS 295

Query: 151 PASSPATSP-----PAPTPASTPSTAPTPSTAGSP-PAPTPDS---LGPGPSGADTPPPP 303
           P +SP+ SP     P+PTP+   S +PTPS   SP P+P+P +   + P PS A T P P
Sbjct: 296 PKASPSPSPSPKASPSPTPSPKASPSPTPSPKASPSPSPSPSTSPKVSPTPSPAGTAPKP 355

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 33/104 (31%), Positives = 49/104 (47%), Gaps = 3/104 (2%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP---PTATPPTATPPAPASSPAT 171
           +P   P+ +P+PKA P    +P  +  PT +P A+ +P   P+ +P  +  P+PA +   
Sbjct: 295 SPKASPSPSPSPKASPSPTPSPKASPSPTPSPKASPSPSPSPSTSPKVSPTPSPAGTAPK 354

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P P+P+ T    P P     PPA  P      P     PPPP
Sbjct: 355 PAPTPSPSPTKKNKPPPPEDAPPPAEMPP-----PMEDSAPPPP 393

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 40/92 (43%), Positives = 51/92 (55%), Gaps = 9/92 (9%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPTATP-PTATP---PAPASSPATSP---PAPTPASTPST 210
           A A  P  TP     P A+  PT TP PT +P   P+P+ SP  SP   P P+P ++PS 
Sbjct: 231 AIANTPIPTPSPTPSPKASPSPTPTPSPTPSPKASPSPSPSPKASPSPSPTPSPKASPSP 290

Query: 211 APTPSTAGSP-PAPTPD-SLGPGPSGADTPPP 300
           +PTPS   SP P+P+P  S  P PS   +P P
Sbjct: 291 SPTPSPKASPSPSPSPKASPSPTPSPKASPSP 322

[115][TOP]
>UniRef100_Q9VAY4 CG5514, isoform A n=1 Tax=Drosophila melanogaster
           RepID=Q9VAY4_DROME
          Length = 1109

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 42/105 (40%), Positives = 45/105 (42%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  P T  P P   PP    PP   PPT  PP    PPT  PP   PPAP +     PP 
Sbjct: 394 PPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPP 453

Query: 184 PTPAST-PSTAPTPSTAGSPPAPTPDSLGPGPSGA----DTPPPP 303
           P P    P   P P+    PP P P  L P P  A    + PPPP
Sbjct: 454 PAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPP 498

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 41/110 (37%), Positives = 48/110 (43%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAAT---PPTAT---PPTATPPAAATPPTATPPTATPPAPASSP 165
           P  PP     P  QPPA+     PP  T   PP   PP    PP   PPT  PP P + P
Sbjct: 372 PPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPP 431

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL----GPGPSGADTPPPP 303
              PP P P + P+  P P     PP P P  +     P P+  + PPPP
Sbjct: 432 TVEPPPPPPPAPPTVEPPP-----PPPPAPTKVEPPPPPAPAEVEPPPPP 476

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 40/119 (33%), Positives = 49/119 (41%), Gaps = 22/119 (18%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAA----------------------ATPPTAT 126
           PP    +PK +PP  A P   +PP   PPA+                        PP   
Sbjct: 359 PPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPA 418

Query: 127 PPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PPT  PP P + P   PP P P + P+  P P     PPAPT     P P+ A+  PPP
Sbjct: 419 PPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPP---PPPAPTKVEPPPPPAPAEVEPPP 474

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 39/102 (38%), Positives = 44/102 (43%), Gaps = 6/102 (5%)
 Frame = +1

Query: 16  PTATPAP-KAQPPAAATP--PTATPPTATPPAAATPPTATPPTA---TPPAPASSPATSP 177
           P   PAP K  PP    P  P   PP   PP   +PP   PP +    PP P +     P
Sbjct: 346 PVQVPAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPP 405

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PAP P   P   P P T   PP P P ++ P P     PPPP
Sbjct: 406 PAP-PTLVPPPPPAPPTIKPPPPPAPPTVEPPP-----PPPP 441

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 41/97 (42%), Positives = 41/97 (42%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PPT  P P   PPA   PPT  PP   PPA   P    PP   PPAPA      PPA
Sbjct: 427 PPAPPTVEPPPPP-PPA---PPTVEPPPPPPPA---PTKVEPP--PPPAPAEVEPPPPPA 477

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
           PT    P   P P     PP P P    P    A TP
Sbjct: 478 PTELE-PPPPPAPPKVELPPPPAP----PKAEAAITP 509

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/98 (35%), Positives = 39/98 (39%), Gaps = 11/98 (11%)
 Frame = +1

Query: 43  QPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA-----PTPAST-- 201
           +P     PP   PP   PP     P   PP   PP   S P   PPA     P P  T  
Sbjct: 345 EPVQVPAPPKVNPP---PPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIE 401

Query: 202 PSTAPTPSTAGSPPAPTPDSLGPGPSGA----DTPPPP 303
           P   P P T   PP P P ++ P P  A    + PPPP
Sbjct: 402 PPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPP 439

[116][TOP]
>UniRef100_Q8MRP6 GH07623p n=1 Tax=Drosophila melanogaster RepID=Q8MRP6_DROME
          Length = 846

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 42/105 (40%), Positives = 45/105 (42%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  P T  P P   PP    PP   PPT  PP    PPT  PP   PPAP +     PP 
Sbjct: 131 PPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPP 190

Query: 184 PTPAST-PSTAPTPSTAGSPPAPTPDSLGPGPSGA----DTPPPP 303
           P P    P   P P+    PP P P  L P P  A    + PPPP
Sbjct: 191 PAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPP 235

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 41/110 (37%), Positives = 48/110 (43%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAAT---PPTAT---PPTATPPAAATPPTATPPTATPPAPASSP 165
           P  PP     P  QPPA+     PP  T   PP   PP    PP   PPT  PP P + P
Sbjct: 109 PPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPP 168

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL----GPGPSGADTPPPP 303
              PP P P + P+  P P     PP P P  +     P P+  + PPPP
Sbjct: 169 TVEPPPPPPPAPPTVEPPP-----PPPPAPTKVEPPPPPAPAEVEPPPPP 213

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 40/119 (33%), Positives = 49/119 (41%), Gaps = 22/119 (18%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAA----------------------ATPPTAT 126
           PP    +PK +PP  A P   +PP   PPA+                        PP   
Sbjct: 96  PPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPA 155

Query: 127 PPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PPT  PP P + P   PP P P + P+  P P     PPAPT     P P+ A+  PPP
Sbjct: 156 PPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPP---PPPAPTKVEPPPPPAPAEVEPPP 211

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 39/102 (38%), Positives = 44/102 (43%), Gaps = 6/102 (5%)
 Frame = +1

Query: 16  PTATPAP-KAQPPAAATP--PTATPPTATPPAAATPPTATPPTA---TPPAPASSPATSP 177
           P   PAP K  PP    P  P   PP   PP   +PP   PP +    PP P +     P
Sbjct: 83  PVQVPAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPP 142

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PAP P   P   P P T   PP P P ++ P P     PPPP
Sbjct: 143 PAP-PTLVPPPPPAPPTIKPPPPPAPPTVEPPP-----PPPP 178

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 41/97 (42%), Positives = 41/97 (42%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PPT  P P   PPA   PPT  PP   PPA   P    PP   PPAPA      PPA
Sbjct: 164 PPAPPTVEPPPPP-PPA---PPTVEPPPPPPPA---PTKVEPP--PPPAPAEVEPPPPPA 214

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
           PT    P   P P     PP P P    P    A TP
Sbjct: 215 PTELE-PPPPPAPPKVELPPPPAP----PKAEAAITP 246

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/98 (35%), Positives = 39/98 (39%), Gaps = 11/98 (11%)
 Frame = +1

Query: 43  QPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA-----PTPAST-- 201
           +P     PP   PP   PP     P   PP   PP   S P   PPA     P P  T  
Sbjct: 82  EPVQVPAPPKVNPP---PPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIE 138

Query: 202 PSTAPTPSTAGSPPAPTPDSLGPGPSGA----DTPPPP 303
           P   P P T   PP P P ++ P P  A    + PPPP
Sbjct: 139 PPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPP 176

[117][TOP]
>UniRef100_Q8IMM6 CG5514, isoform B n=1 Tax=Drosophila melanogaster
           RepID=Q8IMM6_DROME
          Length = 1150

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 42/105 (40%), Positives = 45/105 (42%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  P T  P P   PP    PP   PPT  PP    PPT  PP   PPAP +     PP 
Sbjct: 394 PPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPP 453

Query: 184 PTPAST-PSTAPTPSTAGSPPAPTPDSLGPGPSGA----DTPPPP 303
           P P    P   P P+    PP P P  L P P  A    + PPPP
Sbjct: 454 PAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPP 498

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 41/110 (37%), Positives = 48/110 (43%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAAT---PPTAT---PPTATPPAAATPPTATPPTATPPAPASSP 165
           P  PP     P  QPPA+     PP  T   PP   PP    PP   PPT  PP P + P
Sbjct: 372 PPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPP 431

Query: 166 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL----GPGPSGADTPPPP 303
              PP P P + P+  P P     PP P P  +     P P+  + PPPP
Sbjct: 432 TVEPPPPPPPAPPTVEPPP-----PPPPAPTKVEPPPPPAPAEVEPPPPP 476

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 40/119 (33%), Positives = 49/119 (41%), Gaps = 22/119 (18%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAA----------------------ATPPTAT 126
           PP    +PK +PP  A P   +PP   PPA+                        PP   
Sbjct: 359 PPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPA 418

Query: 127 PPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PPT  PP P + P   PP P P + P+  P P     PPAPT     P P+ A+  PPP
Sbjct: 419 PPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPP---PPPAPTKVEPPPPPAPAEVEPPP 474

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 39/102 (38%), Positives = 44/102 (43%), Gaps = 6/102 (5%)
 Frame = +1

Query: 16  PTATPAP-KAQPPAAATP--PTATPPTATPPAAATPPTATPPTA---TPPAPASSPATSP 177
           P   PAP K  PP    P  P   PP   PP   +PP   PP +    PP P +     P
Sbjct: 346 PVQVPAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPP 405

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PAP P   P   P P T   PP P P ++ P P     PPPP
Sbjct: 406 PAP-PTLVPPPPPAPPTIKPPPPPAPPTVEPPP-----PPPP 441

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 41/97 (42%), Positives = 41/97 (42%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PPT  P P   PPA   PPT  PP   PPA   P    PP   PPAPA      PPA
Sbjct: 427 PPAPPTVEPPPPP-PPA---PPTVEPPPPPPPA---PTKVEPP--PPPAPAEVEPPPPPA 477

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
           PT    P   P P     PP P P    P    A TP
Sbjct: 478 PTELE-PPPPPAPPKVELPPPPAP----PKAEAAITP 509

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/98 (35%), Positives = 39/98 (39%), Gaps = 11/98 (11%)
 Frame = +1

Query: 43  QPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA-----PTPAST-- 201
           +P     PP   PP   PP     P   PP   PP   S P   PPA     P P  T  
Sbjct: 345 EPVQVPAPPKVNPP---PPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIE 401

Query: 202 PSTAPTPSTAGSPPAPTPDSLGPGPSGA----DTPPPP 303
           P   P P T   PP P P ++ P P  A    + PPPP
Sbjct: 402 PPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPP 439

[118][TOP]
>UniRef100_B3MVK1 GF23569 n=1 Tax=Drosophila ananassae RepID=B3MVK1_DROAN
          Length = 708

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 48/118 (40%), Positives = 56/118 (47%), Gaps = 18/118 (15%)
 Frame = +1

Query: 4   PTKPPTATPAP----KAQPPAAATPPTATPPTATPPAAATPPTATPPTATPP----APAS 159
           PT PP     P     + PP    PPT TP T  PP    PPT TP T  PP     P +
Sbjct: 176 PTLPPPTCNPPPTSTTSAPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTPPPPTCNPPTT 235

Query: 160 SPATSPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGADTPPPP 303
           +P T+PP PT   P +TP T P P T  +PP  TP +  P P       +   TPPPP
Sbjct: 236 TPRTTPPPPTCNPPTTTPRTTPPPPTC-NPPKTTPQATQPPPTCNPPTMTPRTTPPPP 292

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/116 (42%), Positives = 57/116 (49%), Gaps = 19/116 (16%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTAT------PPA---PASSP 165
           PPT  P PK  P A   PPT  PPT TP     PPT +PPT T      PP    P ++P
Sbjct: 259 PPTCNP-PKTTPQATQPPPTCNPPTMTPRTTPPPPTCSPPTTTTRTTPPPPTCNPPTTTP 317

Query: 166 ATSPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGADTPPPP 303
            T+PP PT   P +TP T   P T  +PP  TP +  P P       +   TPPPP
Sbjct: 318 RTTPPPPTCNPPTTTPRTTQPPPTC-NPPTRTPRTTPPPPTCNPPTTTPRTTPPPP 372

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 48/124 (38%), Positives = 55/124 (44%), Gaps = 24/124 (19%)
 Frame = +1

Query: 4   PTKPPTATPAPKA-QPPAAATPPTATPPTATPPAAATPPTATPPTATPP----------- 147
           PT  PT  P P    PP   T  T  PPT  PP    PPT  PPT  PP           
Sbjct: 138 PTDSPTCKPPPPTCNPPPTTTTSTPPPPTCNPPPTEPPPTLPPPTCNPPPTSTTSAPPPT 197

Query: 148 --APASSPATSPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGADT 291
              P ++P T+PP PT   P +TP T P P T  +PP  TP +  P P       +   T
Sbjct: 198 CNPPTTTPRTTPPPPTCNPPTTTPRTTPPPPTC-NPPTTTPRTTPPPPTCNPPTTTPRTT 256

Query: 292 PPPP 303
           PPPP
Sbjct: 257 PPPP 260

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/116 (42%), Positives = 56/116 (48%), Gaps = 19/116 (16%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTAT------PPA---PASSP 165
           PPT  P PK  P A   PPT  P T TP     PPT  PPT T      PP    P ++P
Sbjct: 387 PPTCNP-PKTTPRATQPPPTCNPHTTTPRTTPPPPTCNPPTTTTRTTPPPPTCNPPTTTP 445

Query: 166 ATSPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGADTPPPP 303
            T+PP PT   P +TP T P P T  +PP  TP +  P P       +   TPPPP
Sbjct: 446 RTTPPPPTCNPPTTTPRTTPPPPTC-NPPTTTPRTTQPPPTCNPPTTTPRTTPPPP 500

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 46/111 (41%), Positives = 54/111 (48%), Gaps = 14/111 (12%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA----PASSPATSPP 180
           PPT TP     PP    PPT TP T  PP    PPT TP T  PP     P ++P T+PP
Sbjct: 200 PPTTTPRT-TPPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTPP 258

Query: 181 APT---PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA-------DTPPPP 303
            PT   P +TP     P T  +PP  TP +  P P+ +        TPPPP
Sbjct: 259 PPTCNPPKTTPQATQPPPTC-NPPTMTPRTTPPPPTCSPPTTTTRTTPPPP 308

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 51/125 (40%), Positives = 56/125 (44%), Gaps = 25/125 (20%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAAT------PPTATPPTATPPAAATPPTATPPT----ATPPAP 153
           PT  P  TP P    P   T      PPT  PP  TP A   PPT  PPT     TPP P
Sbjct: 233 PTTTPRTTPPPPTCNPPTTTPRTTPPPPTCNPPKTTPQATQPPPTCNPPTMTPRTTPPPP 292

Query: 154 ASSP-----ATSPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGAD 288
             SP      T+PP PT   P +TP T P P T  +PP  TP +  P P       +   
Sbjct: 293 TCSPPTTTTRTTPPPPTCNPPTTTPRTTPPPPTC-NPPTTTPRTTQPPPTCNPPTRTPRT 351

Query: 289 TPPPP 303
           TPPPP
Sbjct: 352 TPPPP 356

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 42/106 (39%), Positives = 46/106 (43%), Gaps = 7/106 (6%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAAT-----PPTATPPTATPPAAATPPTATPPTATPPAPASSPAT 171
           T P T  P P   PP   T     PPT  PPT TP     PPT  PPT TP      P  
Sbjct: 411 TTPRTTPPPPTCNPPTTTTRTTPPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTPPPPTC 470

Query: 172 SPPAPTPAST--PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           +PP  TP +T  P T   P+T      P P    P  +   TPPPP
Sbjct: 471 NPPTTTPRTTQPPPTCNPPTTTPRTTPPPPTCNPPTKTPRTTPPPP 516

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 44/110 (40%), Positives = 51/110 (46%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAAT------PPTATPPTATPPAAATPPTATPPTATPPAPASSP 165
           PT  P  TP P    P   T      PPT  PPT TP     PPT  PP  TP A    P
Sbjct: 217 PTTTPRTTPPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTPPPPTCNPPKTTPQATQPPP 276

Query: 166 ATSPPAPTPASTP----STAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             +PP  TP +TP     + PT +T  +PP PT +   P  +   TPPPP
Sbjct: 277 TCNPPTMTPRTTPPPPTCSPPTTTTRTTPPPPTCNP--PTTTPRTTPPPP 324

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 46/111 (41%), Positives = 53/111 (47%), Gaps = 14/111 (12%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPP----APASSPATSPP 180
           PPT TP     PP   +PPT T  T  PP    PPT TP T  PP     P ++P T+ P
Sbjct: 280 PPTMTPRT-TPPPPTCSPPTTTTRTTPPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTQP 338

Query: 181 APT---PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGADTPPPP 303
            PT   P  TP T P P T  +PP  TP +  P P       +   TPPPP
Sbjct: 339 PPTCNPPTRTPRTTPPPPTC-NPPTTTPRTTPPPPTCNPHTMTPRTTPPPP 388

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/129 (36%), Positives = 53/129 (41%), Gaps = 29/129 (22%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPP----APASSPAT 171
           PT  P  T      PP    PPT TP T  PP    PPT TP T  PP     P  +P T
Sbjct: 292 PTCSPPTTTTRTTPPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTQPPPTCNPPTRTPRT 351

Query: 172 SPPAPT---PASTPSTAPTPSTAG---------------SPPAPTPDSLGPGP------- 276
           +PP PT   P +TP T P P T                 +PP  TP +  P P       
Sbjct: 352 TPPPPTCNPPTTTPRTTPPPPTCNPHTMTPRTTPPPPTCNPPKTTPRATQPPPTCNPHTT 411

Query: 277 SGADTPPPP 303
           +   TPPPP
Sbjct: 412 TPRTTPPPP 420

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 40/89 (44%), Positives = 45/89 (50%), Gaps = 7/89 (7%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPP----APASSPATSPP 180
           PPT TP     PP    PPT TP T  PP    PPT TP T  PP     P ++P T+PP
Sbjct: 440 PPTTTPRT-TPPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTQPPPTCNPPTTTPRTTPP 498

Query: 181 APT---PASTPSTAPTPSTAGSPPAPTPD 258
            PT   P  TP T P P T  S  + TP+
Sbjct: 499 PPTCNPPTKTPRTTPPPPTYASNYSTTPN 527

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 47/118 (39%), Positives = 52/118 (44%), Gaps = 18/118 (15%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP------PTATPPTATPPAAATPPTATP----PTATPPAP 153
           PT  P  TP P    P   TP      PT  PP  TP A   PPT  P    P  TPP P
Sbjct: 361 PTTTPRTTPPPPTCNPHTMTPRTTPPPPTCNPPKTTPRATQPPPTCNPHTTTPRTTPPPP 420

Query: 154 ASSP-----ATSPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             +P      T+PP PT   P +TP T P P T  +PP  TP +         TPPPP
Sbjct: 421 TCNPPTTTTRTTPPPPTCNPPTTTPRTTPPPPTC-NPPTTTPRT---------TPPPP 468

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 42/110 (38%), Positives = 49/110 (44%), Gaps = 10/110 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATP------PTATPPTATPPAAATPPTATPPT----ATPPAP 153
           PT+ P  TP P    P   TP      PT  P T TP     PPT  PP     AT P P
Sbjct: 345 PTRTPRTTPPPPTCNPPTTTPRTTPPPPTCNPHTMTPRTTPPPPTCNPPKTTPRATQPPP 404

Query: 154 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             +P T+ P  TP       PT +T  +PP PT +   P  +   TPPPP
Sbjct: 405 TCNPHTTTPRTTPPPPTCNPPTTTTRTTPPPPTCNP--PTTTPRTTPPPP 452

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 44/117 (37%), Positives = 52/117 (44%), Gaps = 18/117 (15%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPA--------PASS 162
           T  PT T +P  +PP    PPT  PP  T  +   PPT  PP   PP         P  +
Sbjct: 133 TTDPTPTDSPTCKPP----PPTCNPPPTTTTSTPPPPTCNPPPTEPPPTLPPPTCNPPPT 188

Query: 163 PATSPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGADTPPPP 303
             TS P PT   P +TP T P P T  +PP  TP +  P P       +   TPPPP
Sbjct: 189 STTSAPPPTCNPPTTTPRTTPPPPTC-NPPTTTPRTTPPPPTCNPPTTTPRTTPPPP 244

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 40/105 (38%), Positives = 45/105 (42%), Gaps = 6/105 (5%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAP 186
           T+PP     P   P     PPT  PPT TP     PPT  P T TP      P  +PP  
Sbjct: 336 TQPPPTCNPPTRTPRTTPPPPTCNPPTTTPRTTPPPPTCNPHTMTPRTTPPPPTCNPPKT 395

Query: 187 TPAST---PSTAP---TPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           TP +T   P+  P   TP T   PP   P    P  +   TPPPP
Sbjct: 396 TPRATQPPPTCNPHTTTPRTTPPPPTCNP----PTTTTRTTPPPP 436

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 36/106 (33%), Positives = 47/106 (44%), Gaps = 5/106 (4%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPP----TATPPAPASSPA 168
           +P   P + P   +Q        T   PT +P     PPT  PP    T+TPP P  +P 
Sbjct: 111 SPPVTPPSCPDSTSQLSTITESTTDPTPTDSPTCKPPPPTCNPPPTTTTSTPPPPTCNPP 170

Query: 169 TSPPAPT-PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            + P PT P  T +  PT +T+  PP   P +  P      TPPPP
Sbjct: 171 PTEPPPTLPPPTCNPPPTSTTSAPPPTCNPPTTTP----RTTPPPP 212

[119][TOP]
>UniRef100_P41479 Uncharacterized 24.1 kDa protein in LEF4-P33 intergenic region n=1
           Tax=Autographa californica nucleopolyhedrovirus
           RepID=Y091_NPVAC
          Length = 224

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 47/103 (45%), Positives = 53/103 (51%), Gaps = 7/103 (6%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQ-PPAAATPPTATPPTATPPAAATPPTATP---PTATPPAPASSPAT 171
           PT PPT TP+P +  PP    PPT TP   TPP    PPT TP   P+  PP P  SP  
Sbjct: 52  PTPPPTPTPSPPSPTPPPTPIPPTPTP---TPPPTPIPPTPTPTPPPSPIPPTPTPSPPP 108

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG---PSGADT 291
           SP  PTP  +P  +P P T    P P+P  LG     PS  DT
Sbjct: 109 SPIPPTPTPSPPPSPIPPTPTPSPPPSPSPLGEPMYYPSNIDT 151

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 42/100 (42%), Positives = 50/100 (50%), Gaps = 4/100 (4%)
 Frame = +1

Query: 13  PPTATP-APKAQPPAAATPPTATPPTATPPAAATPPTAT---PPTATPPAPASSPATSPP 180
           PPT+ P  P   PP   TP   +PP+ TPP    PPT T   PPT  PP P  +P  SP 
Sbjct: 42  PPTSPPIVPLPTPPPTPTP---SPPSPTPPPTPIPPTPTPTPPPTPIPPTPTPTPPPSPI 98

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            PTP  +P  +P P T    P P+P    P PS   +P P
Sbjct: 99  PPTPTPSPPPSPIPPTPTPSPPPSPIPPTPTPSPPPSPSP 138

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 41/84 (48%), Positives = 45/84 (53%), Gaps = 4/84 (4%)
 Frame = +1

Query: 1   APTKPPT-ATPAPKAQPPAAATPPTATPPTATPPAAATPPTAT---PPTATPPAPASSPA 168
           +PT PPT   P P   PP    PPT   PT TPP +  PPT T   PP+  PP P  SP 
Sbjct: 64  SPTPPPTPIPPTPTPTPPPTPIPPT---PTPTPPPSPIPPTPTPSPPPSPIPPTPTPSPP 120

Query: 169 TSPPAPTPASTPSTAPTPSTAGSP 240
            SP  PTP  TPS  P+PS  G P
Sbjct: 121 PSPIPPTP--TPSPPPSPSPLGEP 142

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 37/93 (39%), Positives = 45/93 (48%), Gaps = 1/93 (1%)
 Frame = +1

Query: 28  PAPKAQPPAAATPPTATPPTATPPAAATPPTATPP-TATPPAPASSPATSPPAPTPASTP 204
           P P   PP  + PP    PT  P    +PP+ TPP T  PP P  +P  +P  PTP  TP
Sbjct: 35  PNPPIVPPPTS-PPIVPLPTPPPTPTPSPPSPTPPPTPIPPTPTPTPPPTPIPPTPTPTP 93

Query: 205 STAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             +P P T    P P+P    P PS   +P PP
Sbjct: 94  PPSPIPPTPTPSPPPSPIPPTPTPSPPPSPIPP 126

[120][TOP]
>UniRef100_A8L7J4 Putative RNA polymerase sigma factor n=1 Tax=Frankia sp. EAN1pec
           RepID=A8L7J4_FRASN
          Length = 524

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 52/115 (45%), Positives = 58/115 (50%), Gaps = 16/115 (13%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPA---AATPPTATPPTATPPAAATPPTATPPTATPPA----PASS 162
           P  PP   PAP   PP    A  PP  TPPT TPPA   P T   PT  PPA    PA+ 
Sbjct: 402 PAAPPA--PAPSTPPPPTTNAPAPPATTPPT-TPPATTGPTTTAGPTTAPPATTGPPATG 458

Query: 163 PATSPP---APTPASTPSTAPTPSTAGSPPAPT------PDSLGPGPSGADTPPP 300
             T+PP   AP PA+T   AP PSTA +P  PT      P +  PGP+G    PP
Sbjct: 459 TPTTPPDGEAPPPATTSEPAPPPSTAPAPAPPTSEAPAPPATTAPGPAGDQRLPP 513

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 45/139 (32%), Positives = 55/139 (39%), Gaps = 38/139 (27%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATP-PTATPPTA---------------------------TP 96
           AP+ PP   P     P A+  P PT  P  A                            P
Sbjct: 343 APSAPPGPLPTIARPPVASEAPSPTVVPTVAGAYTSRPGVSRPGQVVREVDTGQRGADQP 402

Query: 97  PAAATPPTATPPTAT---PPAPASSPATSPPA---PTPASTPSTAPTPSTAGSP----PA 246
            A   P  +TPP  T   P  PA++P T+PPA   PT  + P+TAP P+T G P    P 
Sbjct: 403 AAPPAPAPSTPPPPTTNAPAPPATTPPTTPPATTGPTTTAGPTTAP-PATTGPPATGTPT 461

Query: 247 PTPDSLGPGPSGADTPPPP 303
             PD   P P+    P PP
Sbjct: 462 TPPDGEAPPPATTSEPAPP 480

[121][TOP]
>UniRef100_Q9SET1 Cell wall-plasma membrane linker protein homolog n=1
           Tax=Arabidopsis thaliana RepID=Q9SET1_ARATH
          Length = 306

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/96 (45%), Positives = 48/96 (50%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PPT TP P    P   T P  TPPT TPP   TP T TPP  TPP P + P  +PP 
Sbjct: 134 PCPPPTPTPTPPVVTPPTPTHPVITPPTPTPP-VVTPATPTPPVITPPTP-TPPVITPPT 191

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 291
           PTP       PTP    +PP PTP +  P     DT
Sbjct: 192 PTPPVVTPPTPTPPVV-TPPTPTPPTPIPETCPIDT 226

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 45/111 (40%), Positives = 53/111 (47%), Gaps = 11/111 (9%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQP-PAAATPPTATPPTATP----------PAAATPPTATPPTATPPA 150
           PTKPP +TP P  +P P+   P T  PP +TP          P     PT TPP  TPP 
Sbjct: 92  PTKPPPSTPKPPTKPSPSTPKPSTTKPPPSTPKPPHHKPSPTPCPPPTPTPTPPVVTPPT 151

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P + P  +PP PTP       PTP    +PP PTP  + P      TP PP
Sbjct: 152 P-THPVITPPTPTPPVVTPATPTPPVI-TPPTPTPPVITP-----PTPTPP 195

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 45/107 (42%), Positives = 51/107 (47%), Gaps = 9/107 (8%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAA---------TPPTATPPTATPPAAATPPTATPPTATPPAPAS 159
           TKPP +TP P    P+           TPP  TPPT T P   TPPT TPP  TP  P +
Sbjct: 116 TKPPPSTPKPPHHKPSPTPCPPPTPTPTPPVVTPPTPTHPVI-TPPTPTPPVVTPATP-T 173

Query: 160 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P  +PP PTP       PTP    +PP PTP  + P      TP P
Sbjct: 174 PPVITPPTPTPPVITPPTPTPPVV-TPPTPTPPVVTPPTPTPPTPIP 219

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 42/104 (40%), Positives = 50/104 (48%), Gaps = 4/104 (3%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP-P 180
           PTKP      P  +PP    P T  PPT   P+   P T  PP +TP  P   P+ +P P
Sbjct: 77  PTKPHPHPKPPIVKPPTKPPPSTPKPPTKPSPSTPKPSTTKPPPSTPKPPHHKPSPTPCP 136

Query: 181 APTPASTPS--TAPTPS-TAGSPPAPTPDSLGPGPSGADTPPPP 303
            PTP  TP   T PTP+    +PP PTP  + P      TP PP
Sbjct: 137 PPTPTPTPPVVTPPTPTHPVITPPTPTPPVVTPA-----TPTPP 175

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 39/106 (36%), Positives = 49/106 (46%), Gaps = 8/106 (7%)
 Frame = +1

Query: 10  KPPTATPAPK--AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSP-- 177
           KPPT  P PK   +P     PP   PPT  PP+   PPT   P+   P+    P ++P  
Sbjct: 66  KPPTVKPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPSPSTPKPSTTKPPPSTPKP 125

Query: 178 ----PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
               P+PTP   P+  PTP    +PP PT   + P      TP PP
Sbjct: 126 PHHKPSPTPCPPPTPTPTPPVV-TPPTPTHPVITP-----PTPTPP 165

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 41/103 (39%), Positives = 45/103 (43%), Gaps = 6/103 (5%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPA--AATPPTATPPTATP-PAPASSPATSPPA 183
           PP  +PAP   P     PP   PP   PP   A  PPT  PPT  P P P + P   P  
Sbjct: 29  PPKPSPAPHKPPKHPVKPPK--PPAVKPPKPPAVKPPTPKPPTVKPHPKPPTKPHPHPKP 86

Query: 184 PT---PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P    P   P + P P T  SP  P P +  P PS   TP PP
Sbjct: 87  PIVKPPTKPPPSTPKPPTKPSPSTPKPSTTKPPPS---TPKPP 126

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 42/107 (39%), Positives = 47/107 (43%), Gaps = 9/107 (8%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATP-PAAAT-------PPTATPPTATPPAPAS 159
           P KPP   PA K   P A  PPT  PPT  P P   T       PP   PPT  PP+   
Sbjct: 43  PVKPPKP-PAVKPPKPPAVKPPTPKPPTVKPHPKPPTKPHPHPKPPIVKPPTKPPPSTPK 101

Query: 160 SPA-TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
            P   SP  P P++T     TP      P+PTP    P P+   TPP
Sbjct: 102 PPTKPSPSTPKPSTTKPPPSTPKPPHHKPSPTP---CPPPTPTPTPP 145

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 42/107 (39%), Positives = 44/107 (41%), Gaps = 7/107 (6%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATP--PTATPPTATPPAAAT-PPTATPPTATPPAPASSPAT 171
           AP KPP   P    +PPA   P  P   PPT  PP     P   T P   P  P   P T
Sbjct: 35  APHKPPKH-PVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTKPHPHPKPPIVKPPT 93

Query: 172 SPPAPTPASTPSTAPTPST----AGSPPAPTPDSLGPGPSGADTPPP 300
            PP  TP   P T P+PST       PP  TP      PS    PPP
Sbjct: 94  KPPPSTP--KPPTKPSPSTPKPSTTKPPPSTPKPPHHKPSPTPCPPP 138

[122][TOP]
>UniRef100_Q9FM99 Similarity to carbonic anhydrase n=1 Tax=Arabidopsis thaliana
           RepID=Q9FM99_ARATH
          Length = 350

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/98 (44%), Positives = 47/98 (47%), Gaps = 1/98 (1%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP-PTATPPAPASSPATSPPAP 186
           KPP   PAP   PP     P  TPP   P  A TPP   P P  TPP P  +PA +PP P
Sbjct: 27  KPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKP 86

Query: 187 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
            P      APTP      PAPTP    P P+ A TP P
Sbjct: 87  KP----KPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAP 120

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 45/101 (44%), Positives = 47/101 (46%), Gaps = 1/101 (0%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP-PTATPPAPASSPATSP 177
           APT PP   P P   PP     P  TPP   P  A TPP   P P  TPP P   PA +P
Sbjct: 36  APT-PPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTP 94

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P P P   P T P P  A + PAPTP    P P  A  P P
Sbjct: 95  PNPKPTPAP-TPPKPKPAPA-PAPTP---APKPKPAPKPAP 130

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/90 (42%), Positives = 44/90 (48%), Gaps = 8/90 (8%)
 Frame = +1

Query: 58  ATPPTATPPTATPPAAATPPTATP-PTATPPAPASSPATSPPAPTPAST-------PSTA 213
           ++ P   PP   P  A TPP   P P  TPP P   PA +PP P PA         P+ A
Sbjct: 21  SSAPAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPA 80

Query: 214 PTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           PTP      PAPTP +  P P+ A TPP P
Sbjct: 81  PTPPKPKPKPAPTPPN--PKPTPAPTPPKP 108

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/91 (41%), Positives = 43/91 (47%), Gaps = 5/91 (5%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP-PTATPPAPASSPATSP 177
           APT PP   P P   PP     P  TPP   P  A TPP   P P  TPP P  +PA +P
Sbjct: 47  APT-PPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTP 105

Query: 178 P----APTPASTPSTAPTPSTAGSPPAPTPD 258
           P    AP PA TP+  P P+   +P     D
Sbjct: 106 PKPKPAPAPAPTPAPKPKPAPKPAPGGEVED 136

[123][TOP]
>UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q8L685_VOLCA
          Length = 1009

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 39/100 (39%), Positives = 39/100 (39%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P  L P P     PPPP
Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 38/100 (38%), Positives = 41/100 (41%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P + PP +  PP  +PP   PP    PP   PP   PP P   P   PP 
Sbjct: 211 PPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 38/100 (38%), Positives = 40/100 (40%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP + P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 39/100 (39%), Positives = 39/100 (39%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P S  P P     PPPP
Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 39/100 (39%), Positives = 39/100 (39%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P    SPP P P    P P     PPPP
Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 38/101 (37%), Positives = 40/101 (39%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  PP + P P   PP    PP   PP   PP    PP   PP   PP P   P   PP
Sbjct: 228 SPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 38/100 (38%), Positives = 39/100 (39%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 38/100 (38%), Positives = 39/100 (39%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP+P P    P P     PPPP
Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 39/100 (39%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P    +PPPP
Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 37/97 (38%), Positives = 39/97 (40%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           PP+  P P + PP    PP   PP   PP    PP   PP   PP P   P   PP P P
Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P   P P     PP P P    P P     PPPP
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 37/100 (37%), Positives = 40/100 (40%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP     P   PP+   PP + PP   PP    PP   PP   PP P   P   PP 
Sbjct: 212 PSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 37/100 (37%), Positives = 40/100 (40%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  P   +P P + PP   +PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 216 PPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 38/100 (38%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   PS  P P     PP P P    P P     P PP
Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPP 710

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 37/100 (37%), Positives = 39/100 (39%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P   P + P P   PP  + PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 217 PPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 37/100 (37%), Positives = 39/100 (39%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP+  P     PP +  PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 218 PPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 37/100 (37%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP  +P P    P    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 221 PPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 37/99 (37%), Positives = 38/99 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P P   P   P P +   PP P P    P P     PPP
Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 37/101 (36%), Positives = 38/101 (37%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  P    P P   PP    PP   PP   PP    PP   PP   PP P   P   PP
Sbjct: 223 SPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 38/100 (38%), Positives = 39/100 (39%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P+P     PP P P    P P     PPPP
Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPP----PPPPPPPPPPPP 702

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 36/97 (37%), Positives = 40/97 (41%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTP 192
           PP  +P P    P +  PP+  PP  +PP    PP   PP   PP P   P   PP P P
Sbjct: 209 PPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268

Query: 193 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
              P   P P     PP P P    P P     PPPP
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 37/100 (37%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P+P    P    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 37/100 (37%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P+ PP     P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 38/100 (38%), Positives = 39/100 (39%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P + P P     PP P P    P P     PPPP
Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPP--PPPPPPPHPPPP 707

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 37/100 (37%), Positives = 38/100 (38%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP+  P     PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 37/100 (37%), Positives = 37/100 (37%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  P    P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 37/100 (37%), Positives = 37/100 (37%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PP P
Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 37/100 (37%), Positives = 37/100 (37%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P      PPP
Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 37/98 (37%), Positives = 37/98 (37%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           P P S P   P P     PP P P    P P     PP
Sbjct: 674 PLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 37/101 (36%), Positives = 38/101 (37%)
 Frame = +1

Query: 1   APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
           +P  P    P P   PP    PP   PP   PP    PP   PP   PP P   P   PP
Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294

Query: 181 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P   P   P P     PP P P    P P     PPPP
Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 37/100 (37%), Positives = 37/100 (37%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P   P   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P     PPPP
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 35/96 (36%), Positives = 40/96 (41%)
 Frame = +1

Query: 16  PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPA 195
           P +T      PP +  PP   PP+  PP+   PP + PP   PP P   P   PP P P 
Sbjct: 200 PVSTVIGYNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPP 259

Query: 196 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
             P   P P     PP P P    P P     PPPP
Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 36/99 (36%), Positives = 37/99 (37%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP 
Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P P      +P P     PP P P    P P     PPP
Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 36/100 (36%), Positives = 37/100 (37%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP    PP   PP   PP P   P   PP+
Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678

Query: 184 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           P P   P   P P     PP P P    P P       PP
Sbjct: 679 PPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPP 718

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 29/81 (35%), Positives = 32/81 (39%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
           P  PP   P P   PP    PP   PP   PP     P + PP   PP P   P   PP 
Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698

Query: 184 PTPASTPSTAPTPSTAGSPPA 246
           P P   P  +P P     PP+
Sbjct: 699 PPPPHPPPPSPPPLVPALPPS 719

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 30/85 (35%), Positives = 34/85 (40%)
 Frame = +1

Query: 49  PAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPST 228
           P    P +       PP +  PP   PP+  PP+P   P  SPP P P   P   P P  
Sbjct: 195 PCQCCPVSTVIGYNPPPPSPPPPPPLPPSPPPPSP-PPPPPSPPPPLPPPPPPPPPPPPP 253

Query: 229 AGSPPAPTPDSLGPGPSGADTPPPP 303
              PP P P    P P     PPPP
Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPP 278

[124][TOP]
>UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO
          Length = 2618

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 43/106 (40%), Positives = 52/106 (49%), Gaps = 6/106 (5%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P+ PP  +P P   PP  + PP + PP   PP A  PP   PP   PPAP+ SP   PP 
Sbjct: 2027 PSPPPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPP--PPPLPPPAPSPSPPPPPPP 2084

Query: 184  ----PTPASTPSTAPTPSTAGS--PPAPTPDSLGPGPSGADTPPPP 303
                P+P   P  AP P  A +  PP P+P    P P    +PPPP
Sbjct: 2085 WPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSPPPP 2130

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 40/102 (39%), Positives = 49/102 (48%), Gaps = 2/102 (1%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPT--ATPPAAATPPTATPPTATPPAPASSPATSP 177
            P  PP  +P+P   PP    PP+  PP   A PP AA  P   PP+ +PP P+  P  SP
Sbjct: 2068 PLPPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSP 2127

Query: 178  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P P+  P+  P P  +  P  P P S  P P      PPP
Sbjct: 2128 PPPPPSPPPAPLPPPPPSPPPSPPPPPSPPPSPPAPPPHPPP 2169

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 39/105 (37%), Positives = 47/105 (44%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P   P  +P P   PP   +PP  +PP  +PP    PP A  P   PP P  +P+ SPP 
Sbjct: 2021 PPNHPPPSPPPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPPPPLPPPAPSPSPPP 2080

Query: 184  PTPASTPSTAPTPSTAGSPP-----APTPDSLGPGPSGADTPPPP 303
            P P   P  +P P    +PP     AP P    P P     PPPP
Sbjct: 2081 PPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPP 2125

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 42/105 (40%), Positives = 48/105 (45%), Gaps = 5/105 (4%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  PP  +P P   PP A  PP   PP   PP A +P    PP   PP P S P   PPA
Sbjct: 2043 PPSPPPLSPPPPPPPPPAPLPP---PPPPLPPPAPSPSPPPPPPPWPPPP-SPPPPPPPA 2098

Query: 184  PTPAST-----PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P P +      P  +P+P     PP P+P    P P  A  PPPP
Sbjct: 2099 PPPGAAQAPWPPPPSPSPPPPSPPPPPSPPPPPPSPPPAPLPPPP 2143

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 45/106 (42%), Positives = 53/106 (50%), Gaps = 5/106 (4%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAP----ASSPA 168
            +P  PP   PAP   PP    PP A  P+  PP    PP  +PP   PPAP    A +P 
Sbjct: 2050 SPPPPPPPPPAP-LPPPPPPLPPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPW 2108

Query: 169  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL-GPGPSGADTPPPP 303
              PP+P+P   PS  P PS    PP+P P  L  P PS   +PPPP
Sbjct: 2109 PPPPSPSPPP-PSPPPPPSPPPPPPSPPPAPLPPPPPSPPPSPPPP 2153

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 40/98 (40%), Positives = 46/98 (46%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPA 183
            P  P    P P A PP AA  P   PP+ +PP    PP+  PP + PP P S P    P 
Sbjct: 2086 PPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPP----PPSPPPPPSPPPPPPSPPPAPLPP 2141

Query: 184  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
            P P+  PS  P PS   SPPAP P      P+    PP
Sbjct: 2142 PPPSPPPSPPPPPSPPPSPPAPPPHPPPEPPAPPSFPP 2179

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 40/104 (38%), Positives = 47/104 (45%), Gaps = 3/104 (2%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            A  K     P P    P  + PP  +PP    P   +PP  +PP   PP PA  P   PP
Sbjct: 2009 AAPKQYADAPRPPPNHPPPSPPPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPPPP 2068

Query: 181  APTPASTPSTAPTP---STAGSPPAPTPDSLGPGPSGADTPPPP 303
             P PA +PS  P P       SPP P P +  PG + A  PPPP
Sbjct: 2069 LPPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPP 2112

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 25/62 (40%), Positives = 32/62 (51%)
 Frame = +1

Query: 1    APTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPP 180
            +P  PP+  P P + PPA   PP  +PP + PP  + PP       +PPAP   P   PP
Sbjct: 2120 SPPPPPSPPPPPPSPPPAPLPPPPPSPPPSPPPPPSPPP-------SPPAPPPHPPPEPP 2172

Query: 181  AP 186
            AP
Sbjct: 2173 AP 2174

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 28/77 (36%), Positives = 32/77 (41%)
 Frame = +1

Query: 73   ATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPT 252
            A  P     A   PP   PP + PP P+  P  SPP P+P       P P      P P 
Sbjct: 2008 AAAPKQYADAPRPPPNHPPP-SPPPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPP 2066

Query: 253  PDSLGPGPSGADTPPPP 303
            P    P PS +  PPPP
Sbjct: 2067 PPLPPPAPSPSPPPPPP 2083

[125][TOP]
>UniRef100_A7J8U3 AGP6 (Fragment) n=1 Tax=Pinus squamata RepID=A7J8U3_9CONI
          Length = 227

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 55/130 (42%), Positives = 60/130 (46%), Gaps = 37/130 (28%)
 Frame = +1

Query: 1   APTKP------PTATPAPKAQPPAAA-------TPPTATPPTATPPAAATPPTATPPTAT 141
           APTKP      PT  P P  +PPA A        PP ATPP A PP A TPP A PP A 
Sbjct: 82  APTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPVA-TPPVAAPPVAV 140

Query: 142 PPAPASSPATSPPAPTPAST---------------PSTAPTPSTAGSPPAP--------- 249
           PPA  S PA  PP   PA +               P+ APTPS   SPP+P         
Sbjct: 141 PPA--SPPAIPPPVQAPAPSHHKHKKKKKKHHHHGPAPAPTPSALKSPPSPPLGSPGPST 198

Query: 250 TPDSLGPGPS 279
           + DS  P PS
Sbjct: 199 SADSFAPAPS 208

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 53/164 (32%), Positives = 56/164 (34%), Gaps = 66/164 (40%)
 Frame = +1

Query: 10  KPPTAT------------------------------------PAPKAQPPAAATPPTATP 81
           KPPT T                                    PAP    P  A PPT  P
Sbjct: 44  KPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKP 103

Query: 82  PTATP-------PAAATPPTATPPTATPPA--------PASSPATSPPAPTPAST----- 201
           P   P       P  ATPP A PP ATPP         PAS PA  PP   PA +     
Sbjct: 104 PAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKHK 163

Query: 202 ----------PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                     P+ APTPS   SPP+P   S GP  S     P P
Sbjct: 164 KKKKKHHHHGPAPAPTPSALKSPPSPPLGSPGPSTSADSFAPAP 207

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 48/129 (37%), Positives = 55/129 (42%), Gaps = 28/129 (21%)
 Frame = +1

Query: 1   APTKP--PTAT------PAPKAQPPAAATPPTATPPTATPPAA--ATPPTATPPTATPPA 150
           APTKP  P A       PAP    P  A PPT  PP   P  A  + PP ATPP A PP 
Sbjct: 69  APTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPV 128

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSP------------------PAPTPDSLGPGP 276
            A+ P  +PP   P ++P   P P  A +P                  PAPTP +L   P
Sbjct: 129 -ATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKHKKKKKKHHHHGPAPAPTPSALKSPP 187

Query: 277 SGADTPPPP 303
           S     P P
Sbjct: 188 SPPLGSPGP 196

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 44/103 (42%), Positives = 46/103 (44%), Gaps = 10/103 (9%)
 Frame = +1

Query: 1   APTKP-----PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASS 162
           APTKP     P   P   A P A A  PT   P  T P  A PPT  PP   P  AP S+
Sbjct: 56  APTKPTPPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSA 115

Query: 163 P--ATSPPAPTPASTPSTAPTPSTA--GSPPAPTPDSLGPGPS 279
           P  AT P A  P +TP  A  P      SPPA  P    P PS
Sbjct: 116 PPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 158

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 43/103 (41%), Positives = 47/103 (45%), Gaps = 4/103 (3%)
 Frame = +1

Query: 1   APT--KPPTATPAPKAQPPAAATPPTATPPT-ATPPAAATPPTATPPTATPPAPASSPAT 171
           APT  KPPT  PA     P    PPT TP   A  P   TPP A     T PAP  +PA 
Sbjct: 25  APTTAKPPTTAPAAPVSTPK---PPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVAPAV 81

Query: 172 SPPAPTPAST-PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           +P  P P  T P+ AP P+T   PPA  P           TPP
Sbjct: 82  APTKPAPPVTAPTKAPPPTT--KPPAVAPVKAPVSAPPVATPP 122

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 34/84 (40%), Positives = 38/84 (45%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTA 231
           A A P TA PPT  P A  + P   PPT TP APA     +P  PTP   P+ APT    
Sbjct: 22  APAAPTTAKPPTTAPAAPVSTPK--PPTTTPVAPA----VAPTKPTPPVAPAVAPTKPAP 75

Query: 232 GSPPAPTPDSLGPGPSGADTPPPP 303
              PA  P    P  +     PPP
Sbjct: 76  PVAPAVAPTKPAPPVTAPTKAPPP 99

[126][TOP]
>UniRef100_A7J8U2 AGP6 (Fragment) n=1 Tax=Pinus gerardiana RepID=A7J8U2_PINGE
          Length = 227

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 55/130 (42%), Positives = 60/130 (46%), Gaps = 37/130 (28%)
 Frame = +1

Query: 1   APTKP------PTATPAPKAQPPAAA-------TPPTATPPTATPPAAATPPTATPPTAT 141
           APTKP      PT  P P  +PPA A        PP ATPP A PP A TPP A PP A 
Sbjct: 82  APTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPVA-TPPVAAPPVAV 140

Query: 142 PPAPASSPATSPPAPTPAST---------------PSTAPTPSTAGSPPAP--------- 249
           PPA  S PA  PP   PA +               P+ APTPS   SPP+P         
Sbjct: 141 PPA--SPPAIPPPVQAPAPSHHKHKKKKKKHHHHGPTPAPTPSALKSPPSPPLGSPGPST 198

Query: 250 TPDSLGPGPS 279
           + DS  P PS
Sbjct: 199 SADSFAPAPS 208

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 53/164 (32%), Positives = 56/164 (34%), Gaps = 66/164 (40%)
 Frame = +1

Query: 10  KPPTAT------------------------------------PAPKAQPPAAATPPTATP 81
           KPPT T                                    PAP    P  A PPT  P
Sbjct: 44  KPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKP 103

Query: 82  PTATP-------PAAATPPTATPPTATPPA--------PASSPATSPPAPTPAST----- 201
           P   P       P  ATPP A PP ATPP         PAS PA  PP   PA +     
Sbjct: 104 PAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKHK 163

Query: 202 ----------PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
                     P+ APTPS   SPP+P   S GP  S     P P
Sbjct: 164 KKKKKHHHHGPTPAPTPSALKSPPSPPLGSPGPSTSADSFAPAP 207

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 47/125 (37%), Positives = 54/125 (43%), Gaps = 24/125 (19%)
 Frame = +1

Query: 1   APTKP--PTAT------PAPKAQPPAAATPPTATPPTATPPAA--ATPPTATPPTATPPA 150
           APTKP  P A       PAP    P  A PPT  PP   P  A  + PP ATPP A PP 
Sbjct: 69  APTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPV 128

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSPP--------------APTPDSLGPGPSGAD 288
            A+ P  +PP   P ++P   P P  A +P                PTP    P PS   
Sbjct: 129 -ATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKHKKKKKKHHHHGPTP---APTPSALK 184

Query: 289 TPPPP 303
           +PP P
Sbjct: 185 SPPSP 189

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 44/103 (42%), Positives = 46/103 (44%), Gaps = 10/103 (9%)
 Frame = +1

Query: 1   APTKP-----PTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASS 162
           APTKP     P   P   A P A A  PT   P  T P  A PPT  PP   P  AP S+
Sbjct: 56  APTKPTPPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSA 115

Query: 163 P--ATSPPAPTPASTPSTAPTPSTA--GSPPAPTPDSLGPGPS 279
           P  AT P A  P +TP  A  P      SPPA  P    P PS
Sbjct: 116 PPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 158

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 43/103 (41%), Positives = 47/103 (45%), Gaps = 4/103 (3%)
 Frame = +1

Query: 1   APT--KPPTATPAPKAQPPAAATPPTATPPT-ATPPAAATPPTATPPTATPPAPASSPAT 171
           APT  KPPT  PA     P    PPT TP   A  P   TPP A     T PAP  +PA 
Sbjct: 25  APTTAKPPTTAPAAPVSTPK---PPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVAPAV 81

Query: 172 SPPAPTPAST-PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 297
           +P  P P  T P+ AP P+T   PPA  P           TPP
Sbjct: 82  APTKPAPPVTAPTKAPPPTT--KPPAVAPVKAPVSAPPVATPP 122

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 34/84 (40%), Positives = 38/84 (45%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTA 231
           A A P TA PPT  P A  + P   PPT TP APA     +P  PTP   P+ APT    
Sbjct: 22  APAAPTTAKPPTTAPAAPVSTPK--PPTTTPVAPA----VAPTKPTPPVAPAVAPTKPAP 75

Query: 232 GSPPAPTPDSLGPGPSGADTPPPP 303
              PA  P    P  +     PPP
Sbjct: 76  PVAPAVAPTKPAPPVTAPTKAPPP 99

[127][TOP]
>UniRef100_A7J8T1 AGP6 (Fragment) n=1 Tax=Pinus monticola RepID=A7J8T1_PINMO
          Length = 214

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 55/130 (42%), Positives = 60/130 (46%), Gaps = 37/130 (28%)
 Frame = +1

Query: 1   APTKP------PTATPAPKAQPPAAA-------TPPTATPPTATPPAAATPPTATPPTAT 141
           APTKP      PT  P P  +PPA A        PP ATPP A PP A TPP A PP A 
Sbjct: 69  APTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVA-TPPVAAPPVAV 127

Query: 142 PPAPASSPATSPPAPTPAST---------------PSTAPTPSTAGSPPAP--------- 249
           PPA  S PA  PP   PA +               P+ APTPS   SPP+P         
Sbjct: 128 PPA--SPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPPSPPLGSPGPST 185

Query: 250 TPDSLGPGPS 279
           + DS  P PS
Sbjct: 186 SADSFAPAPS 195

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/129 (37%), Positives = 55/129 (42%), Gaps = 28/129 (21%)
 Frame = +1

Query: 1   APTKP--PTAT------PAPKAQPPAAATPPTATPPTATPPAA--ATPPTATPPTATPPA 150
           APTKP  P A       PAP    P  A PPT  PP   P  A  + PP ATPP A PP 
Sbjct: 56  APTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPV 115

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSP------------------PAPTPDSLGPGP 276
            A+ P  +PP   P ++P   P P  A +P                  PAPTP +L   P
Sbjct: 116 -ATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPP 174

Query: 277 SGADTPPPP 303
           S     P P
Sbjct: 175 SPPLGSPGP 183

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 39/101 (38%), Positives = 42/101 (41%), Gaps = 4/101 (3%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTA--TPPTATPPAAATPPTATPPTATPPA--PASSPATSP 177
           KPPT TP   A  P    PP A    PT   P    P  A PPT  PPA  PA +P ++P
Sbjct: 44  KPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAP 103

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P  TP        TP  A  P A  P S    P     P P
Sbjct: 104 PVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAP 144

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 48/117 (41%), Positives = 50/117 (42%), Gaps = 17/117 (14%)
 Frame = +1

Query: 1   APT--KPPTATPAPKAQPPAAATPPTATP------PT--ATPPAAATPPTATPPTATPPA 150
           APT  KPPT  PA     P    PPT TP      PT  A P A A  PT   P  T P 
Sbjct: 25  APTTAKPPTTAPAAPVSTPK---PPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPT 81

Query: 151 PASSPATSPPAPTPASTPSTAP---TPSTA----GSPPAPTPDSLGPGPSGADTPPP 300
            A  P T PPA  PA  P +AP   TP  A     +PP   P    P  S    PPP
Sbjct: 82  KAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPP 138

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 33/85 (38%), Positives = 39/85 (45%), Gaps = 3/85 (3%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTA 231
           A A P TA PPT  P A  + P   PPT TP APA +P    P   PA  P+    P TA
Sbjct: 22  APAAPTTAKPPTTAPAAPVSTP--KPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTA 79

Query: 232 ---GSPPAPTPDSLGPGPSGADTPP 297
                PP   P ++ P  +    PP
Sbjct: 80  PTKAPPPTTKPPAVAPAKAPVSAPP 104

[128][TOP]
>UniRef100_A7J8S8 AGP6 (Fragment) n=1 Tax=Pinus monticola RepID=A7J8S8_PINMO
          Length = 214

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 55/130 (42%), Positives = 60/130 (46%), Gaps = 37/130 (28%)
 Frame = +1

Query: 1   APTKP------PTATPAPKAQPPAAA-------TPPTATPPTATPPAAATPPTATPPTAT 141
           APTKP      PT  P P  +PPA A        PP ATPP A PP A TPP A PP A 
Sbjct: 69  APTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPVA-TPPVAAPPVAV 127

Query: 142 PPAPASSPATSPPAPTPAST---------------PSTAPTPSTAGSPPAP--------- 249
           PPA  S PA  PP   PA +               P+ APTPS   SPP+P         
Sbjct: 128 PPA--SPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPPSPPLGSPGPST 185

Query: 250 TPDSLGPGPS 279
           + DS  P PS
Sbjct: 186 SADSFAPAPS 195

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 53/151 (35%), Positives = 56/151 (37%), Gaps = 53/151 (35%)
 Frame = +1

Query: 10  KPPTAT-----------------------PAPKAQPPAAATPPTATPPTATP-------P 99
           KPPT T                       PAP    P  A PPT  PP   P       P
Sbjct: 44  KPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAP 103

Query: 100 AAATPPTATPPTATPPA--------PASSPATSPPAPTPAST---------------PST 210
             ATPP A PP ATPP         PAS PA  PP   PA +               P+ 
Sbjct: 104 PVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAP 163

Query: 211 APTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           APTPS   SPP+P   S GP  S     P P
Sbjct: 164 APTPSALKSPPSPPLGSPGPSTSADSFAPAP 194

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 48/129 (37%), Positives = 55/129 (42%), Gaps = 28/129 (21%)
 Frame = +1

Query: 1   APTKP--PTAT------PAPKAQPPAAATPPTATPPTATPPAA--ATPPTATPPTATPPA 150
           APTKP  P A       PAP    P  A PPT  PP   P  A  + PP ATPP A PP 
Sbjct: 56  APTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPV 115

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSP------------------PAPTPDSLGPGP 276
            A+ P  +PP   P ++P   P P  A +P                  PAPTP +L   P
Sbjct: 116 -ATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPP 174

Query: 277 SGADTPPPP 303
           S     P P
Sbjct: 175 SPPLGSPGP 183

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 44/109 (40%), Positives = 47/109 (43%), Gaps = 12/109 (11%)
 Frame = +1

Query: 10  KPPTATPA-PKAQP-PAAATP--PTATPPTATPPAA-ATPPTATPPTATPPAPASSPATS 174
           KPPT  PA P + P P   TP  P   P   TPP A A  PT   P  T P  A  P T 
Sbjct: 30  KPPTTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTK 89

Query: 175 PPAPTPASTPSTAP---TPSTA----GSPPAPTPDSLGPGPSGADTPPP 300
           PPA  P   P +AP   TP  A     +PP   P    P  S    PPP
Sbjct: 90  PPAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPP 138

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 33/85 (38%), Positives = 39/85 (45%), Gaps = 3/85 (3%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTA 231
           A A P TA PPT  P A  + P   PPT TP APA +P    P   PA  P+    P TA
Sbjct: 22  APAVPTTAKPPTTAPAAPVSTP--KPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTA 79

Query: 232 ---GSPPAPTPDSLGPGPSGADTPP 297
                PP   P ++ P  +    PP
Sbjct: 80  PTKAPPPTTKPPAVAPVKAPVSAPP 104

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 30/73 (41%), Positives = 34/73 (46%)
 Frame = +1

Query: 85  TATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL 264
           T    A A P TA PPT  P AP S+P   PP  TP + P+ APT  T    PA  P   
Sbjct: 17  TVLATAPAVPTTAKPPTTAPAAPVSTP--KPPTTTPVA-PAVAPTKPTPPVAPAVAPTKP 73

Query: 265 GPGPSGADTPPPP 303
            P  +     PPP
Sbjct: 74  APPVTAPTKAPPP 86

[129][TOP]
>UniRef100_A7J8S6 AGP6 (Fragment) n=1 Tax=Pinus monticola RepID=A7J8S6_PINMO
          Length = 214

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 55/130 (42%), Positives = 60/130 (46%), Gaps = 37/130 (28%)
 Frame = +1

Query: 1   APTKP------PTATPAPKAQPPAAA-------TPPTATPPTATPPAAATPPTATPPTAT 141
           APTKP      PT  P P  +PPA A        PP ATPP A PP A TPP A PP A 
Sbjct: 69  APTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVA-TPPVAAPPVAV 127

Query: 142 PPAPASSPATSPPAPTPAST---------------PSTAPTPSTAGSPPAP--------- 249
           PPA  S PA  PP   PA +               P+ APTPS   SPP+P         
Sbjct: 128 PPA--SPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPPSPPLGSPGPST 185

Query: 250 TPDSLGPGPS 279
           + DS  P PS
Sbjct: 186 SADSFAPAPS 195

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 53/151 (35%), Positives = 56/151 (37%), Gaps = 53/151 (35%)
 Frame = +1

Query: 10  KPPTAT-----------------------PAPKAQPPAAATPPTATPPTATP-------P 99
           KPPT T                       PAP    P  A PPT  PP   P       P
Sbjct: 44  KPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAP 103

Query: 100 AAATPPTATPPTATPPA--------PASSPATSPPAPTPAST---------------PST 210
             ATPP A PP ATPP         PAS PA  PP   PA +               P+ 
Sbjct: 104 PVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAP 163

Query: 211 APTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           APTPS   SPP+P   S GP  S     P P
Sbjct: 164 APTPSALKSPPSPPLGSPGPSTSADSFAPAP 194

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/129 (37%), Positives = 55/129 (42%), Gaps = 28/129 (21%)
 Frame = +1

Query: 1   APTKP--PTAT------PAPKAQPPAAATPPTATPPTATPPAA--ATPPTATPPTATPPA 150
           APTKP  P A       PAP    P  A PPT  PP   P  A  + PP ATPP A PP 
Sbjct: 56  APTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPV 115

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSP------------------PAPTPDSLGPGP 276
            A+ P  +PP   P ++P   P P  A +P                  PAPTP +L   P
Sbjct: 116 -ATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPP 174

Query: 277 SGADTPPPP 303
           S     P P
Sbjct: 175 SPPLGSPGP 183

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 48/114 (42%), Positives = 51/114 (44%), Gaps = 14/114 (12%)
 Frame = +1

Query: 1   APT--KPPTATPA-PKAQP-PAAATP--PTATPPTATPPAA-ATPPTATPPTATPPAPAS 159
           APT  KPPT  PA P + P P   TP  P   P   TPP A A  PT   P  T P  A 
Sbjct: 25  APTTAKPPTTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAP 84

Query: 160 SPATSPPAPTPASTPSTAP---TPSTA----GSPPAPTPDSLGPGPSGADTPPP 300
            P T PPA  PA  P +AP   TP  A     +PP   P    P  S    PPP
Sbjct: 85  PPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPP 138

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 33/85 (38%), Positives = 39/85 (45%), Gaps = 3/85 (3%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTA 231
           A A P TA PPT  P A  + P   PPT TP APA +P    P   PA  P+    P TA
Sbjct: 22  APAAPTTAKPPTTAPAAPVSTP--KPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTA 79

Query: 232 ---GSPPAPTPDSLGPGPSGADTPP 297
                PP   P ++ P  +    PP
Sbjct: 80  PTKAPPPTTKPPAVAPAKAPVSAPP 104

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 33/79 (41%), Positives = 37/79 (46%)
 Frame = +1

Query: 67  PTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPA 246
           P      AT PAA  P TA PPT  P AP S+P   PP  TP + P+ APT  T    PA
Sbjct: 13  PLVDTVLATAPAA--PTTAKPPTTAPAAPVSTP--KPPTTTPVA-PAVAPTKPTPPVAPA 67

Query: 247 PTPDSLGPGPSGADTPPPP 303
             P    P  +     PPP
Sbjct: 68  VAPTKPAPPVTAPTKAPPP 86

[130][TOP]
>UniRef100_A7J8S3 AGP6 (Fragment) n=1 Tax=Pinus monticola RepID=A7J8S3_PINMO
          Length = 214

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 55/130 (42%), Positives = 60/130 (46%), Gaps = 37/130 (28%)
 Frame = +1

Query: 1   APTKP------PTATPAPKAQPPAAA-------TPPTATPPTATPPAAATPPTATPPTAT 141
           APTKP      PT  P P  +PPA A        PP ATPP A PP A TPP A PP A 
Sbjct: 69  APTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPVA-TPPVAAPPVAV 127

Query: 142 PPAPASSPATSPPAPTPAST---------------PSTAPTPSTAGSPPAP--------- 249
           PPA  S PA  PP   PA +               P+ APTPS   SPP+P         
Sbjct: 128 PPA--SPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPPSPPLGSPGPST 185

Query: 250 TPDSLGPGPS 279
           + DS  P PS
Sbjct: 186 SADSFAPAPS 195

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 53/151 (35%), Positives = 56/151 (37%), Gaps = 53/151 (35%)
 Frame = +1

Query: 10  KPPTAT-----------------------PAPKAQPPAAATPPTATPPTATP-------P 99
           KPPT T                       PAP    P  A PPT  PP   P       P
Sbjct: 44  KPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAP 103

Query: 100 AAATPPTATPPTATPPA--------PASSPATSPPAPTPAST---------------PST 210
             ATPP A PP ATPP         PAS PA  PP   PA +               P+ 
Sbjct: 104 PVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAP 163

Query: 211 APTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           APTPS   SPP+P   S GP  S     P P
Sbjct: 164 APTPSALKSPPSPPLGSPGPSTSADSFAPAP 194

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 48/129 (37%), Positives = 55/129 (42%), Gaps = 28/129 (21%)
 Frame = +1

Query: 1   APTKP--PTAT------PAPKAQPPAAATPPTATPPTATPPAA--ATPPTATPPTATPPA 150
           APTKP  P A       PAP    P  A PPT  PP   P  A  + PP ATPP A PP 
Sbjct: 56  APTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPV 115

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSP------------------PAPTPDSLGPGP 276
            A+ P  +PP   P ++P   P P  A +P                  PAPTP +L   P
Sbjct: 116 -ATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPP 174

Query: 277 SGADTPPPP 303
           S     P P
Sbjct: 175 SPPLGSPGP 183

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 47/114 (41%), Positives = 50/114 (43%), Gaps = 14/114 (12%)
 Frame = +1

Query: 1   APT--KPPTATPA-PKAQP-PAAATP--PTATPPTATPPAA-ATPPTATPPTATPPAPAS 159
           APT  KPPT  PA P + P P   TP  P   P   TPP A A  PT   P  T P  A 
Sbjct: 25  APTTAKPPTTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAP 84

Query: 160 SPATSPPAPTPASTPSTAP---TPSTA----GSPPAPTPDSLGPGPSGADTPPP 300
            P T PPA  P   P +AP   TP  A     +PP   P    P  S    PPP
Sbjct: 85  PPTTKPPAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPP 138

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 33/85 (38%), Positives = 39/85 (45%), Gaps = 3/85 (3%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTA 231
           A A P TA PPT  P A  + P   PPT TP APA +P    P   PA  P+    P TA
Sbjct: 22  APAAPTTAKPPTTAPAAPVSTP--KPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTA 79

Query: 232 ---GSPPAPTPDSLGPGPSGADTPP 297
                PP   P ++ P  +    PP
Sbjct: 80  PTKAPPPTTKPPAVAPVKAPVSAPP 104

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 33/79 (41%), Positives = 37/79 (46%)
 Frame = +1

Query: 67  PTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPA 246
           P      AT PAA  P TA PPT  P AP S+P   PP  TP + P+ APT  T    PA
Sbjct: 13  PLVDTVLATAPAA--PTTAKPPTTAPAAPVSTP--KPPTTTPVA-PAVAPTKPTPPVAPA 67

Query: 247 PTPDSLGPGPSGADTPPPP 303
             P    P  +     PPP
Sbjct: 68  VAPTKPAPPVTAPTKAPPP 86

[131][TOP]
>UniRef100_A7J8R6 AGP6 (Fragment) n=1 Tax=Pinus chiapensis RepID=A7J8R6_9CONI
          Length = 214

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 55/130 (42%), Positives = 60/130 (46%), Gaps = 37/130 (28%)
 Frame = +1

Query: 1   APTKP------PTATPAPKAQPPAAA-------TPPTATPPTATPPAAATPPTATPPTAT 141
           APTKP      PT  P P  +PPA A        PP ATPP A PP A TPP A PP A 
Sbjct: 69  APTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPVA-TPPVAAPPVAV 127

Query: 142 PPAPASSPATSPPAPTPAST---------------PSTAPTPSTAGSPPAP--------- 249
           PPA  S PA  PP   PA +               P+ APTPS   SPP+P         
Sbjct: 128 PPA--SPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPPSPPLGSPGPST 185

Query: 250 TPDSLGPGPS 279
           + DS  P PS
Sbjct: 186 SADSFAPAPS 195

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 53/151 (35%), Positives = 56/151 (37%), Gaps = 53/151 (35%)
 Frame = +1

Query: 10  KPPTAT-----------------------PAPKAQPPAAATPPTATPPTATP-------P 99
           KPPT T                       PAP    P  A PPT  PP   P       P
Sbjct: 44  KPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAP 103

Query: 100 AAATPPTATPPTATPPA--------PASSPATSPPAPTPAST---------------PST 210
             ATPP A PP ATPP         PAS PA  PP   PA +               P+ 
Sbjct: 104 PVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAP 163

Query: 211 APTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           APTPS   SPP+P   S GP  S     P P
Sbjct: 164 APTPSALKSPPSPPLGSPGPSTSADSFAPAP 194

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 48/129 (37%), Positives = 55/129 (42%), Gaps = 28/129 (21%)
 Frame = +1

Query: 1   APTKP--PTAT------PAPKAQPPAAATPPTATPPTATPPAA--ATPPTATPPTATPPA 150
           APTKP  P A       PAP    P  A PPT  PP   P  A  + PP ATPP A PP 
Sbjct: 56  APTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPV 115

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSP------------------PAPTPDSLGPGP 276
            A+ P  +PP   P ++P   P P  A +P                  PAPTP +L   P
Sbjct: 116 -ATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPP 174

Query: 277 SGADTPPPP 303
           S     P P
Sbjct: 175 SPPLGSPGP 183

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 47/114 (41%), Positives = 50/114 (43%), Gaps = 14/114 (12%)
 Frame = +1

Query: 1   APT--KPPTATPA-PKAQP-PAAATP--PTATPPTATPPAA-ATPPTATPPTATPPAPAS 159
           APT  KPPT  PA P + P P   TP  P   P   TPP A A  PT   P  T P  A 
Sbjct: 25  APTTAKPPTTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAP 84

Query: 160 SPATSPPAPTPASTPSTAP---TPSTA----GSPPAPTPDSLGPGPSGADTPPP 300
            P T PPA  P   P +AP   TP  A     +PP   P    P  S    PPP
Sbjct: 85  PPTTKPPAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPP 138

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 33/85 (38%), Positives = 39/85 (45%), Gaps = 3/85 (3%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTA 231
           A A P TA PPT  P A  + P   PPT TP APA +P    P   PA  P+    P TA
Sbjct: 22  APAAPTTAKPPTTAPAAPVSTP--KPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTA 79

Query: 232 ---GSPPAPTPDSLGPGPSGADTPP 297
                PP   P ++ P  +    PP
Sbjct: 80  PTKAPPPTTKPPAVAPVKAPVSAPP 104

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 34/82 (41%), Positives = 38/82 (46%)
 Frame = +1

Query: 58  ATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTAGS 237
           A  P      AT PAA  P TA PPT  P AP S+P   PP  TP + P+ APT  T   
Sbjct: 10  AEEPLVDTVLATAPAA--PTTAKPPTTAPAAPVSTP--KPPTTTPVA-PAVAPTKPTPPV 64

Query: 238 PPAPTPDSLGPGPSGADTPPPP 303
            PA  P    P  +     PPP
Sbjct: 65  APAVAPTKPAPPVTAPTKAPPP 86

[132][TOP]
>UniRef100_A7J8R5 AGP6 (Fragment) n=1 Tax=Pinus ayacahuite RepID=A7J8R5_9CONI
          Length = 214

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 55/130 (42%), Positives = 60/130 (46%), Gaps = 37/130 (28%)
 Frame = +1

Query: 1   APTKP------PTATPAPKAQPPAAA-------TPPTATPPTATPPAAATPPTATPPTAT 141
           APTKP      PT  P P  +PPA A        PP ATPP A PP A TPP A PP A 
Sbjct: 69  APTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVA-TPPVAAPPVAV 127

Query: 142 PPAPASSPATSPPAPTPAST---------------PSTAPTPSTAGSPPAP--------- 249
           PPA  S PA  PP   PA +               P+ APTPS   SPP+P         
Sbjct: 128 PPA--SPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPPSPPLGSPGPST 185

Query: 250 TPDSLGPGPS 279
           + DS  P PS
Sbjct: 186 SADSFAPAPS 195

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/129 (37%), Positives = 55/129 (42%), Gaps = 28/129 (21%)
 Frame = +1

Query: 1   APTKP--PTAT------PAPKAQPPAAATPPTATPPTATPPAA--ATPPTATPPTATPPA 150
           APTKP  P A       PAP    P  A PPT  PP   P  A  + PP ATPP A PP 
Sbjct: 56  APTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPV 115

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSP------------------PAPTPDSLGPGP 276
            A+ P  +PP   P ++P   P P  A +P                  PAPTP +L   P
Sbjct: 116 -ATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPP 174

Query: 277 SGADTPPPP 303
           S     P P
Sbjct: 175 SPPLGSPGP 183

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 39/101 (38%), Positives = 42/101 (41%), Gaps = 4/101 (3%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTA--TPPTATPPAAATPPTATPPTATPPA--PASSPATSP 177
           KPPT TP   A  P    PP A    PT   P    P  A PPT  PPA  PA +P ++P
Sbjct: 44  KPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAP 103

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P  TP        TP  A  P A  P S    P     P P
Sbjct: 104 PVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAP 144

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 48/117 (41%), Positives = 50/117 (42%), Gaps = 17/117 (14%)
 Frame = +1

Query: 1   APT--KPPTATPAPKAQPPAAATPPTATP------PT--ATPPAAATPPTATPPTATPPA 150
           APT  KPPT  PA     P    PPT TP      PT  A P A A  PT   P  T P 
Sbjct: 25  APTTAKPPTTAPAAPVSTPK---PPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPT 81

Query: 151 PASSPATSPPAPTPASTPSTAP---TPSTA----GSPPAPTPDSLGPGPSGADTPPP 300
            A  P T PPA  PA  P +AP   TP  A     +PP   P    P  S    PPP
Sbjct: 82  KAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPP 138

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 33/85 (38%), Positives = 39/85 (45%), Gaps = 3/85 (3%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTA 231
           A A P TA PPT  P A  + P   PPT TP APA +P    P   PA  P+    P TA
Sbjct: 22  APAAPTTAKPPTTAPAAPVSTP--KPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTA 79

Query: 232 ---GSPPAPTPDSLGPGPSGADTPP 297
                PP   P ++ P  +    PP
Sbjct: 80  PTKAPPPTTKPPAVAPAKAPVSAPP 104

[133][TOP]
>UniRef100_A7J8Q9 AGP6 (Fragment) n=1 Tax=Pinus ayacahuite var. veitchii
           RepID=A7J8Q9_9CONI
          Length = 214

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 55/130 (42%), Positives = 60/130 (46%), Gaps = 37/130 (28%)
 Frame = +1

Query: 1   APTKP------PTATPAPKAQPPAAA-------TPPTATPPTATPPAAATPPTATPPTAT 141
           APTKP      PT  P P  +PPA A        PP ATPP A PP A TPP A PP A 
Sbjct: 69  APTKPVPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVA-TPPVAAPPVAV 127

Query: 142 PPAPASSPATSPPAPTPAST---------------PSTAPTPSTAGSPPAP--------- 249
           PPA  S PA  PP   PA +               P+ APTPS   SPP+P         
Sbjct: 128 PPA--SPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPPSPPLGSPGPST 185

Query: 250 TPDSLGPGPS 279
           + DS  P PS
Sbjct: 186 SADSFAPAPS 195

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 48/129 (37%), Positives = 54/129 (41%), Gaps = 28/129 (21%)
 Frame = +1

Query: 1   APTKP-PTATPA--PKAQPPAAATPPTATPPTATPPAAA-------TPPTATPPTATPPA 150
           APTKP P   PA  P    P    P  A PPT  PPA A        PP ATPP A PP 
Sbjct: 56  APTKPAPPVAPAVAPTKPVPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPV 115

Query: 151 PASSPATSPPAPTPASTPSTAPTPSTAGSP------------------PAPTPDSLGPGP 276
            A+ P  +PP   P ++P   P P  A +P                  PAPTP +L   P
Sbjct: 116 -ATPPVAAPPVAVPPASPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPP 174

Query: 277 SGADTPPPP 303
           S     P P
Sbjct: 175 SPPLGSPGP 183

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 39/101 (38%), Positives = 42/101 (41%), Gaps = 4/101 (3%)
 Frame = +1

Query: 10  KPPTATPAPKAQPPAAATPPTA--TPPTATPPAAATPPTATPPTATPPA--PASSPATSP 177
           KPPT TP   A  P    PP A    PT   P    P  A PPT  PPA  PA +P ++P
Sbjct: 44  KPPTTTPVAPAVAPTKPAPPVAPAVAPTKPVPPVTAPTKAPPPTTKPPAVAPAKAPVSAP 103

Query: 178 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           P  TP        TP  A  P A  P S    P     P P
Sbjct: 104 PVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAP 144

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 48/117 (41%), Positives = 50/117 (42%), Gaps = 17/117 (14%)
 Frame = +1

Query: 1   APT--KPPTATPAPKAQPPAAATPPTATP------PT--ATPPAAATPPTATPPTATPPA 150
           APT  KPPT  PA     P    PPT TP      PT  A P A A  PT   P  T P 
Sbjct: 25  APTTAKPPTTAPAAPVSTPK---PPTTTPVAPAVAPTKPAPPVAPAVAPTKPVPPVTAPT 81

Query: 151 PASSPATSPPAPTPASTPSTAP---TPSTA----GSPPAPTPDSLGPGPSGADTPPP 300
            A  P T PPA  PA  P +AP   TP  A     +PP   P    P  S    PPP
Sbjct: 82  KAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPP 138

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 33/85 (38%), Positives = 39/85 (45%), Gaps = 3/85 (3%)
 Frame = +1

Query: 52  AAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAPTPASTPSTAPTPSTA 231
           A A P TA PPT  P A  + P   PPT TP APA +P    P   PA  P+    P TA
Sbjct: 22  APAAPTTAKPPTTAPAAPVSTP--KPPTTTPVAPAVAPTKPAPPVAPAVAPTKPVPPVTA 79

Query: 232 ---GSPPAPTPDSLGPGPSGADTPP 297
                PP   P ++ P  +    PP
Sbjct: 80  PTKAPPPTTKPPAVAPAKAPVSAPP 104

[134][TOP]
>UniRef100_Q7U3X4 Putative uncharacterized protein n=1 Tax=Synechococcus sp. WH 8102
            RepID=Q7U3X4_SYNPX
          Length = 2014

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 50/107 (46%), Positives = 59/107 (55%), Gaps = 8/107 (7%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATP-PTATP---PTATP-PAPASSPA 168
            PT   T TP P A P    TP     PT TP A  TP P+ATP   P+ATP P+P+++P 
Sbjct: 1572 PTPSVTPTPTPSATPTPTPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATP- 1630

Query: 169  TSPPAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPP 300
            T  P PTP  TPS  PTPS + +P   P+ TP    P PS   TP P
Sbjct: 1631 TPTPTPTPTPTPSATPTPSPSATPTPSPSATPT---PSPSATPTPSP 1674

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 44/106 (41%), Positives = 55/106 (51%), Gaps = 7/106 (6%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATPPTATP-PAPASSPATSP- 177
            PT  PT TP P   P A  TP  +  PT +P A  TP  +  PT TP P P  +P+ +P 
Sbjct: 1588 PTPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTPTPTPTPTPTPSATPT 1647

Query: 178  --PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPP 300
              P+ TP  +PS  PTPS + +P   P+ TP    P PS   TP P
Sbjct: 1648 PSPSATPTPSPSATPTPSPSATPTPSPSATPT---PSPSATPTPSP 1690

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 53/117 (45%), Positives = 66/117 (56%), Gaps = 18/117 (15%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATP---PTATP---PTATP---PAAATPPTATP-----PTAT 141
            PT  PT TP P   P  +ATP   P+ATP   P+ATP   P+A   PT TP     P+AT
Sbjct: 1586 PTPTPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTPTPTPTPTPTPSAT 1645

Query: 142  P-PAPASSPATSPPAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPP 300
            P P+P+++P  SP A TP  +PS  PTPS + +P   P+ TP    P PS   TP P
Sbjct: 1646 PTPSPSATPTPSPSA-TPTPSPSATPTPSPSATPTPSPSATPT---PSPSATPTPSP 1698

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 52/105 (49%), Positives = 65/105 (61%), Gaps = 6/105 (5%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATPPTATP-PTATPPAAATP-PTATP---PTATP-PAPASSP 165
            PT  P+ATP P    P+A   PT TP PT TP A  TP P+ATP   P+ATP P+P+++P
Sbjct: 1614 PTPSPSATPTPS---PSATPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATP 1670

Query: 166  ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
              SP A TP  +PS  PTPS + + P P+P S  P PS + TP P
Sbjct: 1671 TPSPSA-TPTPSPSATPTPSPSAT-PTPSP-SATPTPSPSATPDP 1712

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 50/110 (45%), Positives = 65/110 (59%), Gaps = 12/110 (10%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATP-PTATPP-TATPPAAATP---PTATP---PTATP-PAPA 156
            P+   T TP+P A P    TP PT TP  T TP  +ATP   P+ATP   P+ATP P+P+
Sbjct: 1616 PSPSATPTPSPSATPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTPSPS 1675

Query: 157  SSPATSPPAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPP 297
            ++P  SP A TP  +PS  PTPS + +P   P+ TPD   P P+ +D  P
Sbjct: 1676 ATPTPSPSA-TPTPSPSATPTPSPSATPTPSPSATPD---PTPTASDELP 1721

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 46/102 (45%), Positives = 57/102 (55%), Gaps = 5/102 (4%)
 Frame = +1

Query: 10   KPPTATPAPKAQPPAAATPPTATPP-TATPPAAATP-PTATP-PTATP-PAPASSPATSP 177
            + P    A  +   + +T PT TP  T TP  +ATP PT TP PT TP P P+++P  SP
Sbjct: 1551 RTPGFVAARSSGTTSDSTTPTPTPSVTPTPTPSATPTPTPTPTPTPTPTPTPSATPTPSP 1610

Query: 178  PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPP 300
             A TP  +PS  PTPS + +P P PTP    P PS   TP P
Sbjct: 1611 SA-TPTPSPSATPTPSPSATPTPTPTPTPT-PTPSATPTPSP 1650

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 40/103 (38%), Positives = 52/103 (50%), Gaps = 6/103 (5%)
 Frame = +1

Query: 4    PTKPPTATPAPKAQPPAAATP-PTATPP-----TATPPAAATPPTATPPTATPPAPASSP 165
            PT  P+ATP P   P A  TP P+ATP      T TP  +ATP   TP  +  P P+ S 
Sbjct: 1646 PTPSPSATPTPS--PSATPTPSPSATPTPSPSATPTPSPSATP---TPSPSATPTPSPS- 1699

Query: 166  ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 294
              + P P+P++TP   PTP+ +   P    D LG     + TP
Sbjct: 1700 --ATPTPSPSATPD--PTPTASDELPVDVSD-LGSDDISSLTP 1737

[135][TOP]
>UniRef100_Q42366 Hydroxyproline-rich Glycoprotein (HRGP) n=1 Tax=Zea mays
           RepID=Q42366_MAIZE
          Length = 328

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 53/110 (48%), Positives = 56/110 (50%), Gaps = 14/110 (12%)
 Frame = +1

Query: 13  PPTATPAPKAQPPA---AATPPTATPPTATP---PAAATP-PTATPPTAT----PPAPAS 159
           PPT TP+PK  PP      TPP  TPPT TP   P   TP PT TPPT T    PP P  
Sbjct: 81  PPTYTPSPKPTPPTYTPTPTPPKPTPPTYTPAPTPHKPTPKPTPTPPTYTPTPKPPTPKP 140

Query: 160 SPAT---SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           +P T   SP  PTP  TP T  TPS     P PTP +  P P    T PP
Sbjct: 141 TPPTYTPSPKPPTPKPTPPTY-TPSPKPPTPKPTPPTYTPSPKPPATKPP 189

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 42/99 (42%), Positives = 50/99 (50%), Gaps = 2/99 (2%)
 Frame = +1

Query: 13  PPTATPAPK--AQPPAAATPPTATPPTATPPAAATPPTATPPTATPPAPASSPATSPPAP 186
           PPT TP+PK    P    TPPT TP    P    TPPT TP +  PP P  +P T  P+P
Sbjct: 227 PPTYTPSPKPPTHPTPKPTPPTYTPSPKPPTPKPTPPTYTP-SPKPPTPKPTPPTYTPSP 285

Query: 187 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            P +   T PT +    PPA  P +  P P  + TP PP
Sbjct: 286 KPPTPKPTPPTYTPTPKPPATKPPTYTPTPPVSHTPSPP 324

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 46/103 (44%), Positives = 53/103 (51%), Gaps = 6/103 (5%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATP-PTATPPTATPPAAATPPTATPPTAT----PPAPASSPATSP 177
           PPT TP+PK  PPA   P P  TPPT TP      P  TPPT T    PP P  +P T  
Sbjct: 174 PPTYTPSPK--PPATKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPTPKPTPPTYT 231

Query: 178 PAPTPASTPSTAPTPST-AGSPPAPTPDSLGPGPSGADTPPPP 303
           P+P P + P+  PTP T   SP  PTP    P  + +  PP P
Sbjct: 232 PSPKPPTHPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPTP 274

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 46/103 (44%), Positives = 49/103 (47%), Gaps = 7/103 (6%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTAT----PPTATPPAPASSPAT--- 171
           PPT TP+PK   P   TPPT TP    P    TPPT T    PP   PP P  +P T   
Sbjct: 142 PPTYTPSPKPPTPKP-TPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPPTPKPTPPTYTP 200

Query: 172 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPP 300
           SP  PTP  TP T  TPS     P PTP +  P P     P P
Sbjct: 201 SPKPPTPKPTPPTY-TPSPKPPTPKPTPPTYTPSPKPPTHPTP 242

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 46/104 (44%), Positives = 49/104 (47%), Gaps = 7/104 (6%)
 Frame = +1

Query: 13  PPTATPAPKAQPPAAATPPTATPPTATPPAAATPPTATP----PTATPPAPASSPATSPP 180
           PPT TP PK   P   TPPT TP    P    TPPT TP    PT  P  P  +P+  PP
Sbjct: 126 PPTYTPTPKPPTPKP-TPPTYTPSPKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPP 184

Query: 181 A---PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
           A   PTP  TP T  TPS     P PTP +  P P      P P
Sbjct: 185 ATKPPTPKPTPPTY-TPSPKPPTPKPTPPTYTPSPKPPTPKPTP 227

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 45/107 (42%), Positives = 49/107 (45%), Gaps = 10/107 (9%)
 Frame = +1

Query: 13  PPTATPAP---KAQPPAAATPPTATPPTATPPAAATPPTATP----PTATPPAPASSPAT 171
           PPT TPAP   K  P    TPPT TP    P    TPPT TP    PT  P  P  +P+ 
Sbjct: 106 PPTYTPAPTPHKPTPKPTPTPPTYTPTPKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSP 165

Query: 172 SPPAPTP---ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPPP 303
            PP P P     TPS  P P+T    P PTP +  P P      P P
Sbjct: 166 KPPTPKPTPPTYTPSPKP-PATKPPTPKPTPPTYTPSPKPPTPKPTP 211

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 49/109 (44%), Positives = 53/109 (48%), Gaps = 9/109 (8%)
 Frame = +1

Query: 4   PTKPPTATPAPKAQP----PAAATPPTA---TPPTATPPAAATPPTATPPTATPPAPASS 162
           P KPPT  P P   P    P    PP     TPPT TP    TPPT TP T TPP P  +
Sbjct: 49  PEKPPTKGPKPDKPPKEHGPKPEKPPKEHKPTPPTYTPSPKPTPPTYTP-TPTPPKP--T 105

Query: 163 PATSPPAPTP-ASTPSTAPTPST-AGSPPAPTPDSLGPGPSGADTPPPP 303
           P T  PAPTP   TP   PTP T   +P  PTP    P  + +  PP P
Sbjct: 106 PPTYTPAPTPHKPTPKPTPTPPTYTPTPKPPTPKPTPPTYTPSPKPPTP 154

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 46/110 (41%), Positives = 49/110 (44%), Gaps = 11/110 (10%)
 Frame = +1

Query: 7   TKPPTATPAPKAQPPAAATP-PTATPPTATPPAAATPPTATPPTATP-------PAPASS 162
           TKPPT  P P    P+   P P  TPPT TP      P  TPPT TP       P P  +
Sbjct: 186 TKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPTHPT