BB935825 ( RCC08681 )

[UP]


[1][TOP]
>UniRef100_UPI0001982DB4 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982DB4
          Length = 214

 Score =  167 bits (424), Expect = 3e-40
 Identities = 83/117 (70%), Positives = 90/117 (76%), Gaps = 8/117 (6%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGG----GYGGGGG 270
           S +DGR+KAV+VTGPDG  VQG+R GGGG GG  RGGGGYGGGG YGGG    GY GGGG
Sbjct: 56  SSDDGRTKAVDVTGPDGNPVQGSRGGGGGRGG--RGGGGYGGGGGYGGGGGGYGYNGGGG 113

Query: 269 YGGGRGGGGYGGSG---GGYGGGGRGGGRG-GGGGGGGSCYSCGESGHFARDCPTSA 111
            GGGRGG G GG G   GGYGGGG GGG G GGGGGGG+CY+CGE GH ARDC  S+
Sbjct: 114 RGGGRGGRGGGGGGRSSGGYGGGGYGGGGGYGGGGGGGACYNCGEEGHLARDCSQSS 170

[2][TOP]
>UniRef100_A5BQ96 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BQ96_VITVI
          Length = 219

 Score =  162 bits (410), Expect = 1e-38
 Identities = 84/124 (67%), Positives = 91/124 (73%), Gaps = 15/124 (12%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGY-GGGGGYG- 264
           S +DGR+KAV+VTGPDG  VQG+R GGGG GG  RGGGGYGGGG  GGGGY GGGGGYG 
Sbjct: 56  SSDDGRTKAVDVTGPDGNPVQGSRGGGGGRGG--RGGGGYGGGG--GGGGYGGGGGGYGY 111

Query: 263 ----------GGRGGGGYGGSGGGYGGGGRGGG---RGGGGGGGGSCYSCGESGHFARDC 123
                     GGRGGGG G S GGYGGGG GGG    GGGGGGGG+CY+CGE GH ARDC
Sbjct: 112 NGGGGRGGGRGGRGGGGGGRSSGGYGGGGYGGGGGYGGGGGGGGGACYNCGEEGHLARDC 171

Query: 122 PTSA 111
             S+
Sbjct: 172 SQSS 175

[3][TOP]
>UniRef100_A9NNT8 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NNT8_PICSI
          Length = 205

 Score =  161 bits (407), Expect = 2e-38
 Identities = 81/109 (74%), Positives = 86/109 (78%), Gaps = 5/109 (4%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGY-GGGGGYGGG 258
           +N GR+KA++VTGPDGA VQG   GGGGG G  RGGGG G GG  GGGGY GGGGGYGGG
Sbjct: 59  ENGGRTKALDVTGPDGAFVQGNSGGGGGGRGGGRGGGGGGYGG--GGGGYGGGGGGYGGG 116

Query: 257 --RGGGGYGGSGGGYGGGGRGGGRGG--GGGGGGSCYSCGESGHFARDC 123
              GGGG+ G GGG  GGGRGGGRGG  GGGGGGSCY CGESGHFARDC
Sbjct: 117 GYGGGGGWNGGGGGGRGGGRGGGRGGGAGGGGGGSCYKCGESGHFARDC 165

[4][TOP]
>UniRef100_P27484 Glycine-rich protein 2 n=1 Tax=Nicotiana sylvestris
           RepID=GRP2_NICSY
          Length = 214

 Score =  160 bits (406), Expect = 3e-38
 Identities = 84/117 (71%), Positives = 87/117 (74%), Gaps = 9/117 (7%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGG-GSYGGGGYGGGGGYGG 261
           S  DGR+KAV+VTGPDGA VQG R GGGGGGG  RGGGGYGGG G YGGGG GG  GYGG
Sbjct: 61  SGGDGRTKAVDVTGPDGAAVQGGRGGGGGGGG--RGGGGYGGGSGGYGGGGRGGSRGYGG 118

Query: 260 G----RGGGGYGGS---GGGYGGGGRGGGRGGGGGGGGS-CYSCGESGHFARDCPTS 114
           G     GGGGYGG    GGG GG G GGG GGGG GGGS C+ CGESGHFARDC  S
Sbjct: 119 GDGGYGGGGGYGGGSRYGGGGGGYGGGGGYGGGGSGGGSGCFKCGESGHFARDCSQS 175

[5][TOP]
>UniRef100_B9H173 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H173_POPTR
          Length = 207

 Score =  155 bits (393), Expect = 1e-36
 Identities = 84/151 (55%), Positives = 89/151 (58%), Gaps = 41/151 (27%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGG------------------GGGGYERGGGGYGG 312
           + +DGR+KAV+VT P G  VQG R GGG                  GGGGY  GGGGYGG
Sbjct: 57  NSDDGRTKAVDVTAPGGNPVQGIRSGGGFGGGSGGRGGGRGGGGYGGGGGYGGGGGGYGG 116

Query: 311 GG------SYGGGGYGGGGGYGGGRGGGG----------------YGGSGGGYGGGGRGG 198
           GG        GGGGYGGGGGYGGG GGGG                 GGSGGG GGG  GG
Sbjct: 117 GGYGGGRRGGGGGGYGGGGGYGGGGGGGGGCYSCGESGHMARDCPQGGSGGGGGGGRYGG 176

Query: 197 GR-GGGGGGGGSCYSCGESGHFARDCPTSAR 108
           G  GGGGGGGG CY+CG SGHFARDCP S R
Sbjct: 177 GNGGGGGGGGGGCYNCGGSGHFARDCPNSGR 207

[6][TOP]
>UniRef100_Q41188 Glycine-rich protein n=1 Tax=Arabidopsis thaliana
           RepID=Q41188_ARATH
          Length = 203

 Score =  149 bits (376), Expect = 9e-35
 Identities = 80/140 (57%), Positives = 86/140 (61%), Gaps = 31/140 (22%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGG--GGGGGYERG-GGGYGGGGSYGGGGYGGGGGYG 264
           DN+ R KA++V+GPDGA VQG   GG  GG GG+  G GGG G GG YGGGG G GG  G
Sbjct: 64  DNNNRPKAIDVSGPDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGG 123

Query: 263 GGRGG--------------------GGYGGSGGGYGGGGR--------GGGRGGGGGGGG 168
           GGRGG                    GGYGG GGGYGGGG         GGG  GGGGGGG
Sbjct: 124 GGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183

Query: 167 SCYSCGESGHFARDCPTSAR 108
           SCYSCGESGHFARDC +  R
Sbjct: 184 SCYSCGESGHFARDCTSGGR 203

[7][TOP]
>UniRef100_Q75QN9 Cold shock domain protein 2 n=1 Tax=Triticum aestivum
           RepID=Q75QN9_WHEAT
          Length = 205

 Score =  144 bits (364), Expect = 2e-33
 Identities = 78/143 (54%), Positives = 85/143 (59%), Gaps = 39/143 (27%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRR-------------GGGGGGGYERGGGGYGGGGS-YGG 294
           +DGR+KA +VT P G  + G  R             GG GGGGY  GGGGYGGGG  YGG
Sbjct: 59  DDGRTKATDVTAPGGGALAGGSRPSEGGGDRGGRGGGGYGGGGYGGGGGGYGGGGGGYGG 118

Query: 293 GG--YGGGGGYGGGRGGGGYGGS----------------------GGGYGGGGRGGGRG- 189
           GG  YGGGGGYGGG GGG YGG                       GGG GGGG GGG G 
Sbjct: 119 GGGSYGGGGGYGGGGGGGRYGGGSGGGRECYKCGEEGHISRDCPQGGGGGGGGYGGGGGR 178

Query: 188 GGGGGGGSCYSCGESGHFARDCP 120
           GGGGGGG C+SCGESGHF+R+CP
Sbjct: 179 GGGGGGGGCFSCGESGHFSRECP 201

[8][TOP]
>UniRef100_Q84UR8 Os08g0129200 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q84UR8_ORYSJ
          Length = 197

 Score =  144 bits (363), Expect = 3e-33
 Identities = 76/137 (55%), Positives = 83/137 (60%), Gaps = 30/137 (21%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRR---------GGGGGGGYERGGGGYGGGGS-YGGG- 291
           S NDGR+KAV+VT P G  + G  R         GGGGGGG   G  GYGGGG  YGGG 
Sbjct: 58  SGNDGRTKAVDVTAPGGGALTGGSRPSGGGDRGYGGGGGGGRYGGDRGYGGGGGGYGGGD 117

Query: 290 -GYGGGGGYGGGRGGGGY------------------GGSGGGYGGGGRGGGRGGGGGGGG 168
            GYGGGGGYGGG GGG                    GG GGGYGGGG G   GGGGGGGG
Sbjct: 118 RGYGGGGGYGGGGGGGSRACYKCGEEGHMARDCSQGGGGGGGYGGGGGGYRGGGGGGGGG 177

Query: 167 SCYSCGESGHFARDCPT 117
            CY+CGE+GH AR+CP+
Sbjct: 178 GCYNCGETGHIARECPS 194

[9][TOP]
>UniRef100_A2YQW2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2YQW2_ORYSI
          Length = 193

 Score =  141 bits (355), Expect = 3e-32
 Identities = 76/133 (57%), Positives = 85/133 (63%), Gaps = 26/133 (19%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQG-TRRGGGGGGGYERGGGG--YGG----GGSYGGG--GY 285
           S NDGR+KAV+VT P G  + G +R  GGG  GY  GGGG  YGG    GG YGGG  GY
Sbjct: 58  SGNDGRTKAVDVTAPGGGALSGGSRPSGGGDRGYGGGGGGGRYGGDRGYGGGYGGGDRGY 117

Query: 284 GGGGGYGGGRGGG---------GY--------GGSGGGYGGGGRGGGRGGGGGGGGSCYS 156
           GGGGGYGGG GG          G+        GG GGGYGGGG G   GGGGGGGG CY+
Sbjct: 118 GGGGGYGGGGGGSRACYKCGEEGHMARDCSQGGGGGGGYGGGGGGYRGGGGGGGGGGCYN 177

Query: 155 CGESGHFARDCPT 117
           CGE+GH AR+CP+
Sbjct: 178 CGETGHIARECPS 190

[10][TOP]
>UniRef100_C0PLI2 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0PLI2_MAIZE
          Length = 249

 Score =  140 bits (352), Expect = 6e-32
 Identities = 79/153 (51%), Positives = 88/153 (57%), Gaps = 48/153 (31%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGY-ERGGGGYGGGG------------SYGGG 291
           +DGR+KAV+VTGPDG+ V+G   GGGGGGGY  RGGGG GGGG            S GGG
Sbjct: 61  DDGRTKAVDVTGPDGSFVRGGGGGGGGGGGYGSRGGGGSGGGGRSYGGSWGGGRRSGGGG 120

Query: 290 GYG-------------------GGGGY-GGGRGGGGYGGSGGGYGG-------------- 213
           G G                   GGGGY GGG GGGGYGG GGG GG              
Sbjct: 121 GPGACYKCGEPGHMARDCPSADGGGGYGGGGYGGGGYGGGGGGGGGCFKCGEPGHMARDC 180

Query: 212 -GGRGGGRGGGGGGGGSCYSCGESGHFARDCPT 117
             G GG  GGGGGGGG CY+CG++GH ARDCP+
Sbjct: 181 SSGGGGYGGGGGGGGGGCYNCGQAGHMARDCPS 213

[11][TOP]
>UniRef100_C0PAD4 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0PAD4_MAIZE
          Length = 281

 Score =  140 bits (352), Expect = 6e-32
 Identities = 79/153 (51%), Positives = 88/153 (57%), Gaps = 48/153 (31%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGY-ERGGGGYGGGG------------SYGGG 291
           +DGR+KAV+VTGPDG+ V+G   GGGGGGGY  RGGGG GGGG            S GGG
Sbjct: 93  SDGRTKAVDVTGPDGSFVRGGGGGGGGGGGYGSRGGGGSGGGGRSYGGSWGGGRRSGGGG 152

Query: 290 GYG-------------------GGGGY-GGGRGGGGYGGSGGGYGG-------------- 213
           G G                   GGGGY GGG GGGGYGG GGG GG              
Sbjct: 153 GPGACYKCGEPGHMARDCPSADGGGGYGGGGYGGGGYGGGGGGGGGCFKCGEPGHMARDC 212

Query: 212 -GGRGGGRGGGGGGGGSCYSCGESGHFARDCPT 117
             G GG  GGGGGGGG CY+CG++GH ARDCP+
Sbjct: 213 SSGGGGYGGGGGGGGGGCYNCGQAGHMARDCPS 245

[12][TOP]
>UniRef100_B4FXR6 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4FXR6_MAIZE
          Length = 303

 Score =  140 bits (352), Expect = 6e-32
 Identities = 79/153 (51%), Positives = 88/153 (57%), Gaps = 48/153 (31%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGY-ERGGGGYGGGG------------SYGGG 291
           +DGR+KAV+VTGPDG+ V+G   GGGGGGGY  RGGGG GGGG            S GGG
Sbjct: 115 DDGRTKAVDVTGPDGSFVRGGGGGGGGGGGYGSRGGGGSGGGGRSYGGSWGGGRRSGGGG 174

Query: 290 GYG-------------------GGGGY-GGGRGGGGYGGSGGGYGG-------------- 213
           G G                   GGGGY GGG GGGGYGG GGG GG              
Sbjct: 175 GPGACYKCGEPGHMARDCPSADGGGGYGGGGYGGGGYGGGGGGGGGCFKCGEPGHMARDC 234

Query: 212 -GGRGGGRGGGGGGGGSCYSCGESGHFARDCPT 117
             G GG  GGGGGGGG CY+CG++GH ARDCP+
Sbjct: 235 SSGGGGYGGGGGGGGGGCYNCGQAGHMARDCPS 267

[13][TOP]
>UniRef100_C4JBR4 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C4JBR4_MAIZE
          Length = 240

 Score =  138 bits (348), Expect = 2e-31
 Identities = 75/146 (51%), Positives = 85/146 (58%), Gaps = 41/146 (28%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGY-ERGGGGYGGGGSYGGGGYGGGGGYGGG- 258
           +DGR+KAV+VTGPDG+ V+G   GGGGGGGY  RGGGG GGGG   GG +GGG   GGG 
Sbjct: 61  DDGRTKAVDVTGPDGSFVRGGGGGGGGGGGYGSRGGGGSGGGGRSYGGSWGGGRRSGGGG 120

Query: 257 ---------------------RGGGGYGGSGGGYGGGGRGGGRGGG-------------- 183
                                 GGGGYG  GGGYGGGG GGG GGG              
Sbjct: 121 GPGACYKCGEPGHMARDCPSADGGGGYG--GGGYGGGGYGGGGGGGGGCFKCGEPGHMAR 178

Query: 182 ----GGGGGSCYSCGESGHFARDCPT 117
               GGGGG CY+CG++GH ARDCP+
Sbjct: 179 DCSSGGGGGGCYNCGQAGHMARDCPS 204

[14][TOP]
>UniRef100_Q38896 Glycine-rich protein 2b n=2 Tax=Arabidopsis thaliana
           RepID=GRP2B_ARATH
          Length = 201

 Score =  138 bits (347), Expect = 2e-31
 Identities = 76/128 (59%), Positives = 78/128 (60%), Gaps = 24/128 (18%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGG-GGYG-G 261
           DN GR KA+ V+GPDGA VQG   GGG  GG    GGG G GG  GGG YGGG GG G G
Sbjct: 68  DNSGRPKAIEVSGPDGAPVQGNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSG 127

Query: 260 GRGGGGYGGS-----------------GGGYGGGGRG-----GGRGGGGGGGGSCYSCGE 147
           GRGGGG   S                 GGGY GGG G     GG GGGGGGG SCYSCGE
Sbjct: 128 GRGGGGGDNSCFKCGEPGHMARECSQGGGGYSGGGGGGRYGSGGGGGGGGGGLSCYSCGE 187

Query: 146 SGHFARDC 123
           SGHFARDC
Sbjct: 188 SGHFARDC 195

[15][TOP]
>UniRef100_C5XT04 Putative uncharacterized protein Sb04g001720 n=1 Tax=Sorghum
           bicolor RepID=C5XT04_SORBI
          Length = 251

 Score =  136 bits (343), Expect = 6e-31
 Identities = 75/155 (48%), Positives = 87/155 (56%), Gaps = 50/155 (32%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQG-TRRGGGGGGGY-ERGGGGYGGGGSYGGGGYGGGGGYGGG 258
           +DGR+KAV+VTGPDG+ V+G +  GGGGGGGY  RGGGG GGGG   GG +GGG   GGG
Sbjct: 61  DDGRTKAVDVTGPDGSYVKGGSGGGGGGGGGYGSRGGGGSGGGGRSYGGSWGGGRRSGGG 120

Query: 257 -----------------------RGGGGYGGSGGGYGG---------------------- 213
                                   GGGGYGG GGGYGG                      
Sbjct: 121 GGAGACYKCGEPGHMARDCPSADGGGGGYGGGGGGYGGGGGGCFKCGEPGHMARDCPSGG 180

Query: 212 ---GGRGGGRGGGGGGGGSCYSCGESGHFARDCPT 117
              GG GGG  GGGGGGG+CY+CG++GH ARDCP+
Sbjct: 181 GGYGGGGGGGYGGGGGGGACYNCGQTGHMARDCPS 215

[16][TOP]
>UniRef100_C0P2C3 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0P2C3_MAIZE
          Length = 187

 Score =  136 bits (342), Expect = 8e-31
 Identities = 76/141 (53%), Positives = 83/141 (58%), Gaps = 36/141 (25%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGG-- 258
           +DGR+KAV+VTGPDG+ V+G             GGGGYGGGG YGGGGYGGGGG GGG  
Sbjct: 61  DDGRTKAVDVTGPDGSFVRG-------------GGGGYGGGG-YGGGGYGGGGGGGGGCF 106

Query: 257 -------------RGGGGYGGSGGGYG------------------GGGRGGGRGGGGGGG 171
                         GGGGYGG GGG G                  GGG GGGR GGGGGG
Sbjct: 107 KCGEPGHMARDCSSGGGGYGGGGGGGGGGCYNCGQAGHMARDCPSGGGGGGGRFGGGGGG 166

Query: 170 G---SCYSCGESGHFARDCPT 117
           G   SCY+CGE+GH ARDCPT
Sbjct: 167 GGDRSCYNCGEAGHIARDCPT 187

[17][TOP]
>UniRef100_Q75QN8 Cold shock domain protein 3 n=1 Tax=Triticum aestivum
           RepID=Q75QN8_WHEAT
          Length = 231

 Score =  135 bits (340), Expect = 1e-30
 Identities = 79/172 (45%), Positives = 86/172 (50%), Gaps = 65/172 (37%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGG--------------------GGGGGYERGGGGYGG 312
           +DGR+KA +VT P G  + G  R G                    GGGGGY  GGGGYGG
Sbjct: 59  DDGRTKASDVTAPGGGALSGGSRPGEGGGDRGGRGGYGGGGGGYGGGGGGYGGGGGGYGG 118

Query: 311 GGS-YGGGGYGGGGGYG-----------------------GGRGGGGYGGSGGGY----- 219
           GG  YGGGGYGGGGG G                       GG GGGGYGG GGG      
Sbjct: 119 GGGGYGGGGYGGGGGGGRGCYKCGEDGHISRDCPQGGGGGGGYGGGGYGGGGGGGRECYK 178

Query: 218 ---------------GGGGRGGGRG-GGGGGGGSCYSCGESGHFARDCPTSA 111
                          GGGG GGG G GGGGGGG C+SCGESGHF+R+CP  A
Sbjct: 179 CGEEGHISRDCPQGGGGGGYGGGGGRGGGGGGGGCFSCGESGHFSRECPNKA 230

[18][TOP]
>UniRef100_B6TP60 Glycine-rich protein 2b n=1 Tax=Zea mays RepID=B6TP60_MAIZE
          Length = 208

 Score =  133 bits (335), Expect = 5e-30
 Identities = 76/151 (50%), Positives = 83/151 (54%), Gaps = 41/151 (27%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRR----GGGGGGGYERGGGGYGGGGS----------Y 300
           S NDGR+KA++VT P G  + G  R     GGG GGY  G  GYGGGG           Y
Sbjct: 58  SGNDGRAKALDVTAPGGGPLAGGERPDGGNGGGRGGYGGGDRGYGGGGDRGYGGGGDRGY 117

Query: 299 GGG--GYGGGG--GYGGGRGGGGYGGSGGGYGGGGRGGGRG------------------- 189
           GGG  GYGGGG  GYGG RG GG GG GGGYGGGG GGGRG                   
Sbjct: 118 GGGDRGYGGGGDRGYGGDRGYGGGGGYGGGYGGGGGGGGRGCFKCGEEGHMARDCSQGGG 177

Query: 188 --GGGGG--GGSCYSCGESGHFARDCPTSAR 108
             GGGGG  G  CY+CG+ GH +RDCP   R
Sbjct: 178 YGGGGGGGRGSECYNCGQEGHISRDCPNKRR 208

[19][TOP]
>UniRef100_B6SP06 Glycine-rich protein 2b n=1 Tax=Zea mays RepID=B6SP06_MAIZE
          Length = 208

 Score =  133 bits (335), Expect = 5e-30
 Identities = 76/151 (50%), Positives = 83/151 (54%), Gaps = 41/151 (27%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRR----GGGGGGGYERGGGGYGGGGS--YGGGG---- 288
           S NDGR+KA++VT P G  + G  R     GGG GGY  G  GYGGGG   YGGGG    
Sbjct: 58  SGNDGRAKALDVTAPGGGPLAGGERPDGGNGGGRGGYGGGDRGYGGGGDRGYGGGGDRGY 117

Query: 287 ------YGGGG--GYGGGRGGGGYGGSGGGYGGGGRGGGRG------------------- 189
                 YGGGG  GYGG RG GG GG GGGYGGGG GGGRG                   
Sbjct: 118 GXGDRGYGGGGDRGYGGDRGYGGGGGYGGGYGGGGGGGGRGCFKCGEEGHMARDCSQGGG 177

Query: 188 --GGGGG--GGSCYSCGESGHFARDCPTSAR 108
             GGGGG  G  CY+CG+ GH +RDCP   R
Sbjct: 178 YGGGGGGGRGSECYNCGQEGHISRDCPNKRR 208

[20][TOP]
>UniRef100_Q8LPA7 Cold shock protein-1 n=1 Tax=Triticum aestivum RepID=Q8LPA7_WHEAT
          Length = 229

 Score =  133 bits (334), Expect = 7e-30
 Identities = 77/170 (45%), Positives = 84/170 (49%), Gaps = 63/170 (37%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRR--------------------GGGGGGGYERGGGGYGG 312
           +DGR+KA +VT P G  + G  R                    GGGGGGGY  GGGGYGG
Sbjct: 59  DDGRTKASDVTAPGGGALSGGSRPGDGGGDRGGRGGYGGGGYGGGGGGGGYGGGGGGYGG 118

Query: 311 GGSYGGGGYGG------------------GGGYGGGRGGGGYGGSGGG------------ 222
           GG   GGG GG                  GGG GGG GGGGYGG GGG            
Sbjct: 119 GGGGYGGGGGGRGCYKCGEEGHISRDCPQGGGGGGGYGGGGYGGGGGGGRECYKCGEEGH 178

Query: 221 ------YGGGGRGGGRG-------GGGGGGGSCYSCGESGHFARDCPTSA 111
                  GGGG GGG G       GGGGGGG C+SCGESGHF+R+CP  A
Sbjct: 179 ISRDCPQGGGGGGGGGGYGGGGGRGGGGGGGGCFSCGESGHFSRECPNKA 228

[21][TOP]
>UniRef100_Q6YUR8 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=Q6YUR8_ORYSJ
          Length = 241

 Score =  132 bits (333), Expect = 9e-30
 Identities = 76/145 (52%), Positives = 84/145 (57%), Gaps = 43/145 (29%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGY--ERGGGGYGGGG-----SYGGGGYGGGGG 270
           DGR+KAV+VTGPDG+ V+G   GGGGGGG    RGGGG GGGG     S+GGG   GGGG
Sbjct: 62  DGRTKAVDVTGPDGSFVKGGAGGGGGGGGGFGSRGGGGSGGGGRSYGGSWGGGRRSGGGG 121

Query: 269 YGGG---------------RGGG----GYGGSGGGYGGG-----------------GRGG 198
            GGG                GGG    G GG GGG GGG                 G GG
Sbjct: 122 PGGGCFKCGESGHMARDCFNGGGVGVGGGGGGGGGAGGGCFKCGEMGHMARDCFNSGGGG 181

Query: 197 GRGGGGGGGGSCYSCGESGHFARDC 123
           G GGGGGGGG+CY+CGE+GH ARDC
Sbjct: 182 GGGGGGGGGGACYNCGETGHLARDC 206

[22][TOP]
>UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q8L685_VOLCA
          Length = 1009

 Score =  131 bits (330), Expect = 2e-29
 Identities = 56/77 (72%), Positives = 56/77 (72%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P  L PS P
Sbjct: 664 PPPPPPPPPPPLPPSPP 680

 Score =  129 bits (325), Expect = 8e-29
 Identities = 55/77 (71%), Positives = 55/77 (71%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP L P    P  P
Sbjct: 669 PPPPPPLPPSPPPPPPP 685

 Score =  129 bits (323), Expect = 1e-28
 Identities = 54/77 (70%), Positives = 56/77 (72%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP  +P +  P  P
Sbjct: 668 PPPPPPPLPPSPPPPPP 684

 Score =  128 bits (322), Expect = 2e-28
 Identities = 57/86 (66%), Positives = 57/86 (66%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP 
Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PPPPPPP   P    P  P
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPP 318

 Score =  127 bits (320), Expect = 3e-28
 Identities = 56/83 (67%), Positives = 56/83 (67%)
 Frame = +1

Query: 151 PQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPP 330
           P L   PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPP
Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297

Query: 331 PRS*PPPPPPPRLVP*TLAPSGP 399
           P   PPPPPPP   P    P  P
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPP 320

 Score =  127 bits (320), Expect = 3e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 663 PPPPPPPPPPPPLPPSP 679

 Score =  127 bits (320), Expect = 3e-28
 Identities = 58/87 (66%), Positives = 59/87 (67%), Gaps = 4/87 (4%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*L----PPPP*PPPPR 336
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP L    PPPP PPPP 
Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689

Query: 337 S*PPPPPPPRLVP*TLAPSGPVTLTAL 417
             PPPPPPP   P    PS P  + AL
Sbjct: 690 PPPPPPPPPPPPPHPPPPSPPPLVPAL 716

 Score =  127 bits (319), Expect = 4e-28
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP 
Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PPPPPPP   P    P  P
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPP 319

 Score =  127 bits (319), Expect = 4e-28
 Identities = 55/80 (68%), Positives = 55/80 (68%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655

Query: 349 PPPPPRLVP*TLAPSGPVTL 408
           PPPPP   P    P  P  L
Sbjct: 656 PPPPPPPPPPPPPPPPPPPL 675

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 305 PPPPPPPPPPPPPPPPP 321

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 306 PPPPPPPPPPPPPPPPP 322

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 307 PPPPPPPPPPPPPPPPP 323

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 308 PPPPPPPPPPPPPPPPP 324

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 309 PPPPPPPPPPPPPPPPP 325

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 310 PPPPPPPPPPPPPPPPP 326

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 311 PPPPPPPPPPPPPPPPP 327

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 312 PPPPPPPPPPPPPPPPP 328

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 313 PPPPPPPPPPPPPPPPP 329

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 314 PPPPPPPPPPPPPPPPP 330

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 315 PPPPPPPPPPPPPPPPP 331

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 316 PPPPPPPPPPPPPPPPP 332

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 317 PPPPPPPPPPPPPPPPP 333

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 318 PPPPPPPPPPPPPPPPP 334

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 319 PPPPPPPPPPPPPPPPP 335

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 320 PPPPPPPPPPPPPPPPP 336

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 321 PPPPPPPPPPPPPPPPP 337

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 322 PPPPPPPPPPPPPPPPP 338

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 323 PPPPPPPPPPPPPPPPP 339

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 324 PPPPPPPPPPPPPPPPP 340

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 325 PPPPPPPPPPPPPPPPP 341

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 326 PPPPPPPPPPPPPPPPP 342

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 327 PPPPPPPPPPPPPPPPP 343

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 328 PPPPPPPPPPPPPPPPP 344

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 329 PPPPPPPPPPPPPPPPP 345

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 330 PPPPPPPPPPPPPPPPP 346

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 331 PPPPPPPPPPPPPPPPP 347

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 332 PPPPPPPPPPPPPPPPP 348

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 333 PPPPPPPPPPPPPPPPP 349

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 334 PPPPPPPPPPPPPPPPP 350

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 335 PPPPPPPPPPPPPPPPP 351

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 336 PPPPPPPPPPPPPPPPP 352

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 337 PPPPPPPPPPPPPPPPP 353

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 338 PPPPPPPPPPPPPPPPP 354

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 339 PPPPPPPPPPPPPPPPP 355

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 340 PPPPPPPPPPPPPPPPP 356

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 341 PPPPPPPPPPPPPPPPP 357

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 342 PPPPPPPPPPPPPPPPP 358

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 343 PPPPPPPPPPPPPPPPP 359

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 344 PPPPPPPPPPPPPPPPP 360

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 345 PPPPPPPPPPPPPPPPP 361

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 346 PPPPPPPPPPPPPPPPP 362

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 347 PPPPPPPPPPPPPPPPP 363

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 348 PPPPPPPPPPPPPPPPP 364

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 349 PPPPPPPPPPPPPPPPP 365

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 350 PPPPPPPPPPPPPPPPP 366

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 351 PPPPPPPPPPPPPPPPP 367

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 352 PPPPPPPPPPPPPPPPP 368

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 353 PPPPPPPPPPPPPPPPP 369

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 354 PPPPPPPPPPPPPPPPP 370

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 355 PPPPPPPPPPPPPPPPP 371

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 356 PPPPPPPPPPPPPPPPP 372

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 357 PPPPPPPPPPPPPPPPP 373

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 358 PPPPPPPPPPPPPPPPP 374

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 359 PPPPPPPPPPPPPPPPP 375

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 360 PPPPPPPPPPPPPPPPP 376

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 361 PPPPPPPPPPPPPPPPP 377

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 362 PPPPPPPPPPPPPPPPP 378

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 363 PPPPPPPPPPPPPPPPP 379

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 364 PPPPPPPPPPPPPPPPP 380

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 365 PPPPPPPPPPPPPPPPP 381

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 366 PPPPPPPPPPPPPPPPP 382

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 367 PPPPPPPPPPPPPPPPP 383

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 368 PPPPPPPPPPPPPPPPP 384

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 369 PPPPPPPPPPPPPPPPP 385

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 370 PPPPPPPPPPPPPPPPP 386

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 371 PPPPPPPPPPPPPPPPP 387

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 372 PPPPPPPPPPPPPPPPP 388

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 373 PPPPPPPPPPPPPPPPP 389

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 374 PPPPPPPPPPPPPPPPP 390

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 375 PPPPPPPPPPPPPPPPP 391

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 376 PPPPPPPPPPPPPPPPP 392

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 377 PPPPPPPPPPPPPPPPP 393

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 378 PPPPPPPPPPPPPPPPP 394

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 379 PPPPPPPPPPPPPPPPP 395

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 380 PPPPPPPPPPPPPPPPP 396

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 381 PPPPPPPPPPPPPPPPP 397

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 382 PPPPPPPPPPPPPPPPP 398

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 383 PPPPPPPPPPPPPPPPP 399

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 384 PPPPPPPPPPPPPPPPP 400

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 385 PPPPPPPPPPPPPPPPP 401

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 386 PPPPPPPPPPPPPPPPP 402

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 387 PPPPPPPPPPPPPPPPP 403

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 388 PPPPPPPPPPPPPPPPP 404

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 389 PPPPPPPPPPPPPPPPP 405

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 390 PPPPPPPPPPPPPPPPP 406

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 391 PPPPPPPPPPPPPPPPP 407

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 392 PPPPPPPPPPPPPPPPP 408

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 393 PPPPPPPPPPPPPPPPP 409

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 394 PPPPPPPPPPPPPPPPP 410

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 395 PPPPPPPPPPPPPPPPP 411

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 396 PPPPPPPPPPPPPPPPP 412

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 397 PPPPPPPPPPPPPPPPP 413

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 398 PPPPPPPPPPPPPPPPP 414

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 399 PPPPPPPPPPPPPPPPP 415

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 400 PPPPPPPPPPPPPPPPP 416

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 401 PPPPPPPPPPPPPPPPP 417

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 402 PPPPPPPPPPPPPPPPP 418

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 403 PPPPPPPPPPPPPPPPP 419

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 404 PPPPPPPPPPPPPPPPP 420

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 405 PPPPPPPPPPPPPPPPP 421

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 406 PPPPPPPPPPPPPPPPP 422

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 407 PPPPPPPPPPPPPPPPP 423

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 408 PPPPPPPPPPPPPPPPP 424

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 409 PPPPPPPPPPPPPPPPP 425

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 410 PPPPPPPPPPPPPPPPP 426

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 411 PPPPPPPPPPPPPPPPP 427

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 412 PPPPPPPPPPPPPPPPP 428

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 413 PPPPPPPPPPPPPPPPP 429

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 414 PPPPPPPPPPPPPPPPP 430

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 415 PPPPPPPPPPPPPPPPP 431

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 416 PPPPPPPPPPPPPPPPP 432

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 417 PPPPPPPPPPPPPPPPP 433

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 418 PPPPPPPPPPPPPPPPP 434

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 419 PPPPPPPPPPPPPPPPP 435

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 420 PPPPPPPPPPPPPPPPP 436

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 421 PPPPPPPPPPPPPPPPP 437

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 422 PPPPPPPPPPPPPPPPP 438

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 423 PPPPPPPPPPPPPPPPP 439

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 424 PPPPPPPPPPPPPPPPP 440

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 425 PPPPPPPPPPPPPPPPP 441

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 426 PPPPPPPPPPPPPPPPP 442

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 427 PPPPPPPPPPPPPPPPP 443

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 428 PPPPPPPPPPPPPPPPP 444

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 429 PPPPPPPPPPPPPPPPP 445

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 430 PPPPPPPPPPPPPPPPP 446

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 431 PPPPPPPPPPPPPPPPP 447

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 432 PPPPPPPPPPPPPPPPP 448

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 433 PPPPPPPPPPPPPPPPP 449

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 434 PPPPPPPPPPPPPPPPP 450

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 435 PPPPPPPPPPPPPPPPP 451

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 436 PPPPPPPPPPPPPPPPP 452

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 437 PPPPPPPPPPPPPPPPP 453

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 438 PPPPPPPPPPPPPPPPP 454

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 439 PPPPPPPPPPPPPPPPP 455

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 440 PPPPPPPPPPPPPPPPP 456

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 441 PPPPPPPPPPPPPPPPP 457

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 442 PPPPPPPPPPPPPPPPP 458

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 443 PPPPPPPPPPPPPPPPP 459

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 444 PPPPPPPPPPPPPPPPP 460

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 445 PPPPPPPPPPPPPPPPP 461

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 446 PPPPPPPPPPPPPPPPP 462

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 447 PPPPPPPPPPPPPPPPP 463

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 448 PPPPPPPPPPPPPPPPP 464

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 449 PPPPPPPPPPPPPPPPP 465

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 450 PPPPPPPPPPPPPPPPP 466

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 451 PPPPPPPPPPPPPPPPP 467

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 452 PPPPPPPPPPPPPPPPP 468

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 453 PPPPPPPPPPPPPPPPP 469

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 454 PPPPPPPPPPPPPPPPP 470

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 455 PPPPPPPPPPPPPPPPP 471

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 456 PPPPPPPPPPPPPPPPP 472

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 457 PPPPPPPPPPPPPPPPP 473

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 458 PPPPPPPPPPPPPPPPP 474

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 459 PPPPPPPPPPPPPPPPP 475

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 460 PPPPPPPPPPPPPPPPP 476

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 461 PPPPPPPPPPPPPPPPP 477

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 462 PPPPPPPPPPPPPPPPP 478

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 463 PPPPPPPPPPPPPPPPP 479

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 464 PPPPPPPPPPPPPPPPP 480

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 465 PPPPPPPPPPPPPPPPP 481

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 466 PPPPPPPPPPPPPPPPP 482

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 467 PPPPPPPPPPPPPPPPP 483

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 468 PPPPPPPPPPPPPPPPP 484

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 469 PPPPPPPPPPPPPPPPP 485

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 470 PPPPPPPPPPPPPPPPP 486

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 471 PPPPPPPPPPPPPPPPP 487

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 472 PPPPPPPPPPPPPPPPP 488

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 473 PPPPPPPPPPPPPPPPP 489

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 474 PPPPPPPPPPPPPPPPP 490

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 475 PPPPPPPPPPPPPPPPP 491

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 476 PPPPPPPPPPPPPPPPP 492

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 477 PPPPPPPPPPPPPPPPP 493

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 478 PPPPPPPPPPPPPPPPP 494

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 479 PPPPPPPPPPPPPPPPP 495

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 480 PPPPPPPPPPPPPPPPP 496

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 481 PPPPPPPPPPPPPPPPP 497

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 482 PPPPPPPPPPPPPPPPP 498

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 483 PPPPPPPPPPPPPPPPP 499

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 484 PPPPPPPPPPPPPPPPP 500

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 485 PPPPPPPPPPPPPPPPP 501

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 486 PPPPPPPPPPPPPPPPP 502

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 487 PPPPPPPPPPPPPPPPP 503

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 488 PPPPPPPPPPPPPPPPP 504

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 489 PPPPPPPPPPPPPPPPP 505

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 490 PPPPPPPPPPPPPPPPP 506

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 491 PPPPPPPPPPPPPPPPP 507

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 492 PPPPPPPPPPPPPPPPP 508

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 493 PPPPPPPPPPPPPPPPP 509

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 494 PPPPPPPPPPPPPPPPP 510

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 495 PPPPPPPPPPPPPPPPP 511

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 496 PPPPPPPPPPPPPPPPP 512

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 497 PPPPPPPPPPPPPPPPP 513

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 498 PPPPPPPPPPPPPPPPP 514

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 499 PPPPPPPPPPPPPPPPP 515

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 500 PPPPPPPPPPPPPPPPP 516

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 501 PPPPPPPPPPPPPPPPP 517

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 502 PPPPPPPPPPPPPPPPP 518

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 503 PPPPPPPPPPPPPPPPP 519

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 504 PPPPPPPPPPPPPPPPP 520

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 505 PPPPPPPPPPPPPPPPP 521

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 506 PPPPPPPPPPPPPPPPP 522

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 507 PPPPPPPPPPPPPPPPP 523

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 508 PPPPPPPPPPPPPPPPP 524

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 509 PPPPPPPPPPPPPPPPP 525

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 510 PPPPPPPPPPPPPPPPP 526

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 511 PPPPPPPPPPPPPPPPP 527

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 512 PPPPPPPPPPPPPPPPP 528

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 513 PPPPPPPPPPPPPPPPP 529

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 514 PPPPPPPPPPPPPPPPP 530

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 515 PPPPPPPPPPPPPPPPP 531

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 516 PPPPPPPPPPPPPPPPP 532

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 517 PPPPPPPPPPPPPPPPP 533

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 518 PPPPPPPPPPPPPPPPP 534

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 519 PPPPPPPPPPPPPPPPP 535

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 520 PPPPPPPPPPPPPPPPP 536

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 521 PPPPPPPPPPPPPPPPP 537

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 522 PPPPPPPPPPPPPPPPP 538

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 523 PPPPPPPPPPPPPPPPP 539

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 524 PPPPPPPPPPPPPPPPP 540

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 525 PPPPPPPPPPPPPPPPP 541

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 526 PPPPPPPPPPPPPPPPP 542

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 527 PPPPPPPPPPPPPPPPP 543

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 528 PPPPPPPPPPPPPPPPP 544

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 529 PPPPPPPPPPPPPPPPP 545

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 530 PPPPPPPPPPPPPPPPP 546

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 531 PPPPPPPPPPPPPPPPP 547

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 532 PPPPPPPPPPPPPPPPP 548

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 533 PPPPPPPPPPPPPPPPP 549

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 534 PPPPPPPPPPPPPPPPP 550

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 535 PPPPPPPPPPPPPPPPP 551

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 536 PPPPPPPPPPPPPPPPP 552

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 537 PPPPPPPPPPPPPPPPP 553

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 538 PPPPPPPPPPPPPPPPP 554

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 539 PPPPPPPPPPPPPPPPP 555

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 540 PPPPPPPPPPPPPPPPP 556

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 541 PPPPPPPPPPPPPPPPP 557

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 542 PPPPPPPPPPPPPPPPP 558

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 543 PPPPPPPPPPPPPPPPP 559

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 544 PPPPPPPPPPPPPPPPP 560

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 545 PPPPPPPPPPPPPPPPP 561

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 546 PPPPPPPPPPPPPPPPP 562

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 547 PPPPPPPPPPPPPPPPP 563

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 548 PPPPPPPPPPPPPPPPP 564

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 549 PPPPPPPPPPPPPPPPP 565

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 550 PPPPPPPPPPPPPPPPP 566

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 551 PPPPPPPPPPPPPPPPP 567

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 552 PPPPPPPPPPPPPPPPP 568

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 553 PPPPPPPPPPPPPPPPP 569

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 554 PPPPPPPPPPPPPPPPP 570

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 555 PPPPPPPPPPPPPPPPP 571

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 556 PPPPPPPPPPPPPPPPP 572

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 557 PPPPPPPPPPPPPPPPP 573

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 558 PPPPPPPPPPPPPPPPP 574

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 559 PPPPPPPPPPPPPPPPP 575

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 560 PPPPPPPPPPPPPPPPP 576

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 561 PPPPPPPPPPPPPPPPP 577

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 562 PPPPPPPPPPPPPPPPP 578

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 563 PPPPPPPPPPPPPPPPP 579

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 564 PPPPPPPPPPPPPPPPP 580

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 565 PPPPPPPPPPPPPPPPP 581

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 566 PPPPPPPPPPPPPPPPP 582

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 567 PPPPPPPPPPPPPPPPP 583

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 568 PPPPPPPPPPPPPPPPP 584

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 569 PPPPPPPPPPPPPPPPP 585

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 570 PPPPPPPPPPPPPPPPP 586

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 571 PPPPPPPPPPPPPPPPP 587

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 572 PPPPPPPPPPPPPPPPP 588

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 573 PPPPPPPPPPPPPPPPP 589

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 574 PPPPPPPPPPPPPPPPP 590

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 575 PPPPPPPPPPPPPPPPP 591

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 576 PPPPPPPPPPPPPPPPP 592

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 577 PPPPPPPPPPPPPPPPP 593

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 578 PPPPPPPPPPPPPPPPP 594

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 579 PPPPPPPPPPPPPPPPP 595

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 580 PPPPPPPPPPPPPPPPP 596

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 581 PPPPPPPPPPPPPPPPP 597

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 582 PPPPPPPPPPPPPPPPP 598

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 583 PPPPPPPPPPPPPPPPP 599

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 584 PPPPPPPPPPPPPPPPP 600

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 585 PPPPPPPPPPPPPPPPP 601

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 586 PPPPPPPPPPPPPPPPP 602

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 587 PPPPPPPPPPPPPPPPP 603

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 588 PPPPPPPPPPPPPPPPP 604

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 589 PPPPPPPPPPPPPPPPP 605

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 590 PPPPPPPPPPPPPPPPP 606

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 591 PPPPPPPPPPPPPPPPP 607

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 592 PPPPPPPPPPPPPPPPP 608

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 593 PPPPPPPPPPPPPPPPP 609

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 594 PPPPPPPPPPPPPPPPP 610

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 595 PPPPPPPPPPPPPPPPP 611

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 596 PPPPPPPPPPPPPPPPP 612

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 597 PPPPPPPPPPPPPPPPP 613

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 598 PPPPPPPPPPPPPPPPP 614

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 599 PPPPPPPPPPPPPPPPP 615

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 600 PPPPPPPPPPPPPPPPP 616

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 601 PPPPPPPPPPPPPPPPP 617

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 602 PPPPPPPPPPPPPPPPP 618

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 603 PPPPPPPPPPPPPPPPP 619

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 604 PPPPPPPPPPPPPPPPP 620

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 605 PPPPPPPPPPPPPPPPP 621

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 606 PPPPPPPPPPPPPPPPP 622

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 607 PPPPPPPPPPPPPPPPP 623

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 608 PPPPPPPPPPPPPPPPP 624

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 609 PPPPPPPPPPPPPPPPP 625

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 610 PPPPPPPPPPPPPPPPP 626

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 611 PPPPPPPPPPPPPPPPP 627

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 612 PPPPPPPPPPPPPPPPP 628

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 613 PPPPPPPPPPPPPPPPP 629

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 614 PPPPPPPPPPPPPPPPP 630

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 615 PPPPPPPPPPPPPPPPP 631

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 616 PPPPPPPPPPPPPPPPP 632

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 617 PPPPPPPPPPPPPPPPP 633

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 618 PPPPPPPPPPPPPPPPP 634

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 619 PPPPPPPPPPPPPPPPP 635

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 620 PPPPPPPPPPPPPPPPP 636

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 621 PPPPPPPPPPPPPPPPP 637

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 622 PPPPPPPPPPPPPPPPP 638

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 623 PPPPPPPPPPPPPPPPP 639

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 624 PPPPPPPPPPPPPPPPP 640

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 625 PPPPPPPPPPPPPPPPP 641

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 626 PPPPPPPPPPPPPPPPP 642

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 627 PPPPPPPPPPPPPPPPP 643

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 628 PPPPPPPPPPPPPPPPP 644

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 629 PPPPPPPPPPPPPPPPP 645

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 630 PPPPPPPPPPPPPPPPP 646

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 631 PPPPPPPPPPPPPPPPP 647

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 632 PPPPPPPPPPPPPPPPP 648

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 633 PPPPPPPPPPPPPPPPP 649

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 634 PPPPPPPPPPPPPPPPP 650

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 635 PPPPPPPPPPPPPPPPP 651

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 636 PPPPPPPPPPPPPPPPP 652

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 637 PPPPPPPPPPPPPPPPP 653

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 638 PPPPPPPPPPPPPPPPP 654

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 639 PPPPPPPPPPPPPPPPP 655

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 640 PPPPPPPPPPPPPPPPP 656

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 641 PPPPPPPPPPPPPPPPP 657

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 642 PPPPPPPPPPPPPPPPP 658

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 643 PPPPPPPPPPPPPPPPP 659

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 644 PPPPPPPPPPPPPPPPP 660

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 645 PPPPPPPPPPPPPPPPP 661

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 646 PPPPPPPPPPPPPPPPP 662

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 647 PPPPPPPPPPPPPPPPP 663

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 648 PPPPPPPPPPPPPPPPP 664

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 649 PPPPPPPPPPPPPPPPP 665

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 650 PPPPPPPPPPPPPPPPP 666

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 651 PPPPPPPPPPPPPPPPP 667

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 652 PPPPPPPPPPPPPPPPP 668

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 653 PPPPPPPPPPPPPPPPP 669

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 654 PPPPPPPPPPPPPPPPP 670

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 655 PPPPPPPPPPPPPPPPP 671

 Score =  126 bits (317), Expect = 7e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 661 PPPPPPPPPPPPPPLPP 677

 Score =  125 bits (313), Expect = 2e-27
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PP P S PP
Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 682 PPPPPPPPPPPPPPPPP 698

 Score =  125 bits (313), Expect = 2e-27
 Identities = 60/95 (63%), Positives = 61/95 (64%), Gaps = 5/95 (5%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP-----*PPPPPYPPPP*LPPPP*PPPP 333
           PPPPPPPP PPP PPPP PPP PP PPPP PPP      PPPPP PPPP  PPPP PPPP
Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700

Query: 334 RS*PPPPPPPRLVP*TLAPSGPVTLTALDRPSLSD 438
              PPPP PP LVP  L PS  V + A   P   D
Sbjct: 701 PPHPPPPSPPPLVP-ALPPSCEVCIVARLLPPAFD 734

 Score =  124 bits (310), Expect = 4e-27
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     PPPP PPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP 
Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PPPPPPP   P    P  P
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPP 312

 Score =  124 bits (310), Expect = 4e-27
 Identities = 53/77 (68%), Positives = 53/77 (68%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 677

Query: 349 PPPPPRLVP*TLAPSGP 399
            PPPP   P    P  P
Sbjct: 678 SPPPPPPPPPPPPPPPP 694

 Score =  124 bits (310), Expect = 4e-27
 Identities = 53/77 (68%), Positives = 53/77 (68%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP    P
Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 680 PPPPPPPPPPPPPPPPP 696

 Score =  124 bits (310), Expect = 4e-27
 Identities = 53/77 (68%), Positives = 53/77 (68%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PP P   PP
Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 685 PPPPPPPPPPPPPPPPP 701

 Score =  123 bits (309), Expect = 6e-27
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P L   PPPP PPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP 
Sbjct: 215 PPPPPLPPSPPPPSPPP-PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PPPPPPP   P    P  P
Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPP 299

 Score =  123 bits (309), Expect = 6e-27
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     P PPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP 
Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PPPPPPP   P    P  P
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPP 315

 Score =  123 bits (309), Expect = 6e-27
 Identities = 53/77 (68%), Positives = 53/77 (68%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   P 
Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 679 PPPPPPPPPPPPPPPPP 695

 Score =  123 bits (309), Expect = 6e-27
 Identities = 53/77 (68%), Positives = 53/77 (68%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP P PP   PP
Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 683 PPPPPPPPPPPPPPPPP 699

 Score =  122 bits (306), Expect = 1e-26
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPPPP PP P P PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP 
Sbjct: 221 PPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PPPPPPP   P    P  P
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPP 306

 Score =  122 bits (305), Expect = 2e-26
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP      PPPP PP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP 
Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PPPPPPP   P    P  P
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPP 311

 Score =  120 bits (302), Expect = 4e-26
 Identities = 52/77 (67%), Positives = 52/77 (67%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PP PPPPP  PP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 211 PPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 271 PPPPPPPPPPPPPPPPP 287

 Score =  119 bits (297), Expect = 1e-25
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP      PP PPPP PPP PP P PPPLPP PPPP PPP PPPPP PPPP  PPPP 
Sbjct: 211 PPSPPPPPPLPPSPPPPSPPPPPPSP-PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PPPPPPP   P    P  P
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPP 295

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 32/48 (66%), Positives = 33/48 (68%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPP 285
           P  P L   PPPPPPPP PPP PPPP PPP PP+PPPP PPP  P  P
Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALP 717

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 36/57 (63%), Positives = 36/57 (63%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPP 312
           P  P    LPP PPPPP PPP PPP  PPP PP PPPP PPP P PPP  P   LPP
Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPPP--PPPPPPPPPPPHPPP-PSPPPLVPA--LPP 718

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 32/54 (59%), Positives = 32/54 (59%), Gaps = 1/54 (1%)
 Frame = +1

Query: 241 YPPPPRPPP*PPP-PPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           Y PPP  PP PPP PP PPPP  PPPP  PPP   PPPPPPP   P    P  P
Sbjct: 207 YNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPP 260

[23][TOP]
>UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q0P2_IXOSC
          Length = 170

 Score =  131 bits (329), Expect = 3e-29
 Identities = 54/68 (79%), Positives = 54/68 (79%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 34  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93

Query: 349 PPPPPRLV 372
           PPPPPRLV
Sbjct: 94  PPPPPRLV 101

 Score =  129 bits (325), Expect = 8e-29
 Identities = 55/79 (69%), Positives = 57/79 (72%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 29  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88

Query: 349 PPPPPRLVP*TLAPSGPVT 405
           PPPPP   P  L  S P++
Sbjct: 89  PPPPPPPPPPRLVTSRPLS 107

 Score =  129 bits (323), Expect = 1e-28
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 20  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79

Query: 349 PPPPPRLVP*TLAPSGPVTLTALDRP 426
           PPPPP   P    P  P       RP
Sbjct: 80  PPPPPPPPPPPPPPPPPPPRLVTSRP 105

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 61  PPPPPPPPPPPPPPPPP 77

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 62  PPPPPPPPPPPPPPPPP 78

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 63  PPPPPPPPPPPPPPPPP 79

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 64  PPPPPPPPPPPPPPPPP 80

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 5   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 65  PPPPPPPPPPPPPPPPP 81

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 6   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 66  PPPPPPPPPPPPPPPPP 82

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 7   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 67  PPPPPPPPPPPPPPPPP 83

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 8   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 68  PPPPPPPPPPPPPPPPP 84

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 9   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 69  PPPPPPPPPPPPPPPPP 85

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 10  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 70  PPPPPPPPPPPPPPPPP 86

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 11  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 71  PPPPPPPPPPPPPPPPP 87

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 12  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 72  PPPPPPPPPPPPPPPPP 88

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 13  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 73  PPPPPPPPPPPPPPPPP 89

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 14  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 74  PPPPPPPPPPPPPPPPP 90

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 15  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 75  PPPPPPPPPPPPPPPPP 91

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 16  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 76  PPPPPPPPPPPPPPPPP 92

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 17  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 77  PPPPPPPPPPPPPPPPP 93

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 18  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 78  PPPPPPPPPPPPPPPPP 94

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 19  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 79  PPPPPPPPPPPPPPPPP 95

[24][TOP]
>UniRef100_B6U2B9 Glycine-rich protein 2b n=1 Tax=Zea mays RepID=B6U2B9_MAIZE
          Length = 208

 Score =  131 bits (329), Expect = 3e-29
 Identities = 75/151 (49%), Positives = 82/151 (54%), Gaps = 41/151 (27%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRR----GGGGGGGYERGGGGYGGGGS----------Y 300
           S NDG +KA++VT P G  + G  R     GGG GGY  G  GYGGGG           Y
Sbjct: 58  SGNDGXAKALDVTAPGGGPLAGGERPDGGNGGGRGGYGGGDRGYGGGGDRGYGGGXDRGY 117

Query: 299 GGG--GYGGGG--GYGGGRGGGGYGGSGGGYGGGGRGGGRG------------------- 189
           GGG  GYGGGG  GYGG RG GG GG GGGYGGGG GGGRG                   
Sbjct: 118 GGGDRGYGGGGDRGYGGDRGYGGGGGYGGGYGGGGGGGGRGCFKCGEEGHMARDCSQGGG 177

Query: 188 --GGGGGG--GSCYSCGESGHFARDCPTSAR 108
             GGGGGG    CY+CG+ GH +RDCP   R
Sbjct: 178 YGGGGGGGRXSECYNCGQEGHISRDCPNKRR 208

[25][TOP]
>UniRef100_C5YGM9 Putative uncharacterized protein Sb06g029650 n=1 Tax=Sorghum
           bicolor RepID=C5YGM9_SORBI
          Length = 215

 Score =  130 bits (327), Expect = 5e-29
 Identities = 70/115 (60%), Positives = 75/115 (65%), Gaps = 10/115 (8%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRR--GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYG 264
           S  DGR+KA++VT P G N+ G  R  GG GGGG   GGGG  G G  G  GYGGGGGYG
Sbjct: 58  SGQDGRTKAMDVTAPGGGNLAGGERPDGGHGGGGRYGGGGGDRGYGGGGDRGYGGGGGYG 117

Query: 263 GGR----GGGG---YGGSGG-GYGGGGRGGGRGGGGGGGGSCYSCGESGHFARDC 123
           GG     GGGG   YGG G  GYG GG GGG GGGGGGG  C+ CGE GH ARDC
Sbjct: 118 GGGDRGYGGGGDRVYGGGGDRGYGRGG-GGGYGGGGGGGRGCFKCGEEGHMARDC 171

[26][TOP]
>UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7QFW8_IXOSC
          Length = 185

 Score =  129 bits (325), Expect = 8e-29
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 5   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 349 PPPPPRLVP*TLAPSGPVTLTALDRPS 429
           PPPPP   P    P  P  L    R S
Sbjct: 65  PPPPPPPPPPPPPPPPPPQLCCFGRKS 91

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 61  PPPPPPPPPPPPPPPPP 77

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 62  PPPPPPPPPPPPPPPPP 78

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 63  PPPPPPPPPPPPPPPPP 79

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 64  PPPPPPPPPPPPPPPPP 80

[27][TOP]
>UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae
           RepID=A7UVF7_ANOGA
          Length = 147

 Score =  129 bits (323), Expect = 1e-28
 Identities = 53/69 (76%), Positives = 53/69 (76%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 32  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91

Query: 349 PPPPPRLVP 375
           PPPPP L P
Sbjct: 92  PPPPPPLPP 100

 Score =  128 bits (321), Expect = 2e-28
 Identities = 54/74 (72%), Positives = 54/74 (72%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 27  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86

Query: 349 PPPPPRLVP*TLAP 390
           PPPPP   P  L P
Sbjct: 87  PPPPPPPPPPPLPP 100

 Score =  125 bits (313), Expect = 2e-27
 Identities = 56/89 (62%), Positives = 57/89 (64%)
 Frame = +1

Query: 151 PQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPP 330
           P L    PPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPP
Sbjct: 20  PHLLPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79

Query: 331 PRS*PPPPPPPRLVP*TLAPSGPVTLTAL 417
           P   PPPPPPP   P    P  P  +  L
Sbjct: 80  PPPPPPPPPPPPPPPPPPLPPPPRNIIPL 108

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 34/56 (60%), Positives = 34/56 (60%)
 Frame = +1

Query: 232 LPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           LP   PP  PPP PPPPP PPPP  PPPP PPPP   PPPPPPP   P    P  P
Sbjct: 19  LPHLLPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74

[28][TOP]
>UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae
            RepID=UPI000186983E
          Length = 1411

 Score =  128 bits (322), Expect = 2e-28
 Identities = 55/77 (71%), Positives = 55/77 (71%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 892  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P   AP  P
Sbjct: 952  PPPPPPPPPPPGAPPPP 968

 Score =  128 bits (321), Expect = 2e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 889  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 949  PPPPPPPPPPPPPPGAP 965

 Score =  128 bits (321), Expect = 2e-28
 Identities = 55/80 (68%), Positives = 55/80 (68%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 893  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952

Query: 349  PPPPPRLVP*TLAPSGPVTL 408
            PPPPP   P    P  P  L
Sbjct: 953  PPPPPPPPPPGAPPPPPPAL 972

 Score =  127 bits (320), Expect = 3e-28
 Identities = 56/86 (65%), Positives = 57/86 (66%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
            P +P     PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP 
Sbjct: 851  PTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910

Query: 322  PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPPP   PPPPPPP   P    P  P
Sbjct: 911  PPPPPPPPPPPPPPPPPPPPPPPPPP 936

 Score =  127 bits (319), Expect = 4e-28
 Identities = 54/76 (71%), Positives = 54/76 (71%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 888  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947

Query: 349  PPPPPRLVP*TLAPSG 396
            PPPPP   P    P G
Sbjct: 948  PPPPPPPPPPPPPPPG 963

 Score =  127 bits (319), Expect = 4e-28
 Identities = 54/77 (70%), Positives = 55/77 (71%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 897  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P+ P
Sbjct: 957  PPPPPPGAPPPPPPALP 973

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 861  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 921  PPPPPPPPPPPPPPPPP 937

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 862  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 922  PPPPPPPPPPPPPPPPP 938

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 863  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 923  PPPPPPPPPPPPPPPPP 939

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 864  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 924  PPPPPPPPPPPPPPPPP 940

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 865  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 925  PPPPPPPPPPPPPPPPP 941

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 866  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 926  PPPPPPPPPPPPPPPPP 942

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 867  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 927  PPPPPPPPPPPPPPPPP 943

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 868  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 928  PPPPPPPPPPPPPPPPP 944

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 869  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 929  PPPPPPPPPPPPPPPPP 945

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 870  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 930  PPPPPPPPPPPPPPPPP 946

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 871  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 931  PPPPPPPPPPPPPPPPP 947

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 872  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 932  PPPPPPPPPPPPPPPPP 948

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 873  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 933  PPPPPPPPPPPPPPPPP 949

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 874  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 934  PPPPPPPPPPPPPPPPP 950

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 875  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 935  PPPPPPPPPPPPPPPPP 951

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 876  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 936  PPPPPPPPPPPPPPPPP 952

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 877  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 937  PPPPPPPPPPPPPPPPP 953

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 878  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 938  PPPPPPPPPPPPPPPPP 954

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 879  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 939  PPPPPPPPPPPPPPPPP 955

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 880  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 940  PPPPPPPPPPPPPPPPP 956

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 881  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 941  PPPPPPPPPPPPPPPPP 957

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 882  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 942  PPPPPPPPPPPPPPPPP 958

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 883  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 943  PPPPPPPPPPPPPPPPP 959

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 884  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 944  PPPPPPPPPPPPPPPPP 960

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 885  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 945  PPPPPPPPPPPPPPPPP 961

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 886  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945

Query: 349  PPPPPRLVP*TLAPSGP 399
            PPPPP   P    P  P
Sbjct: 946  PPPPPPPPPPPPPPPPP 962

 Score =  126 bits (316), Expect = 9e-28
 Identities = 52/69 (75%), Positives = 52/69 (75%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP    P
Sbjct: 906  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAP 965

Query: 349  PPPPPRLVP 375
            PPPPP L P
Sbjct: 966  PPPPPALPP 974

 Score =  125 bits (313), Expect = 2e-27
 Identities = 55/83 (66%), Positives = 55/83 (66%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 901  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960

Query: 349  PPPPPRLVP*TLAPSGPVTLTAL 417
            PP  P   P  L P  P    AL
Sbjct: 961  PPGAPPPPPPALPPGAPPPPPAL 983

 Score =  122 bits (306), Expect = 1e-26
 Identities = 53/84 (63%), Positives = 56/84 (66%)
 Frame = +1

Query: 148  SPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PP 327
            +P + + P  PPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PP
Sbjct: 844  APMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903

Query: 328  PPRS*PPPPPPPRLVP*TLAPSGP 399
            PP   PPPPPPP   P    P  P
Sbjct: 904  PPPPPPPPPPPPPPPPPPPPPPPP 927

 Score =  115 bits (287), Expect = 2e-24
 Identities = 48/69 (69%), Positives = 49/69 (71%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  P  P PPPP   P 
Sbjct: 916  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALPPG 975

Query: 349  PPPPPRLVP 375
             PPPP  +P
Sbjct: 976  APPPPPALP 984

 Score =  102 bits (255), Expect = 1e-20
 Identities = 46/75 (61%), Positives = 46/75 (61%)
 Frame = +1

Query: 175  PPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPP 354
            P P     P  PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PPPP
Sbjct: 843  PAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902

Query: 355  PPPRLVP*TLAPSGP 399
            PPP   P    P  P
Sbjct: 903  PPPPPPPPPPPPPPP 917

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 28/53 (52%), Positives = 28/53 (52%)
 Frame = +1

Query: 241 YPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           Y P P     P  PP PPPP  PPPP PPPP   PPPPPPP   P    P  P
Sbjct: 841 YEPAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893

[29][TOP]
>UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PKI2_IXOSC
          Length = 154

 Score =  128 bits (321), Expect = 2e-28
 Identities = 57/87 (65%), Positives = 57/87 (65%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 29  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88

Query: 349 PPPPPRLVP*TLAPSGPVTLTALDRPS 429
           PPPPP   P    P  P     L  PS
Sbjct: 89  PPPPPPPPPPPPPPPPPPQREHLPVPS 115

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 61  PPPPPPPPPPPPPPPPP 77

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 62  PPPPPPPPPPPPPPPPP 78

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 63  PPPPPPPPPPPPPPPPP 79

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 64  PPPPPPPPPPPPPPPPP 80

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 5   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 65  PPPPPPPPPPPPPPPPP 81

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 6   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 66  PPPPPPPPPPPPPPPPP 82

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 7   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 67  PPPPPPPPPPPPPPPPP 83

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 8   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 68  PPPPPPPPPPPPPPPPP 84

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 9   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 69  PPPPPPPPPPPPPPPPP 85

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 10  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 70  PPPPPPPPPPPPPPPPP 86

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 11  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 71  PPPPPPPPPPPPPPPPP 87

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 12  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 72  PPPPPPPPPPPPPPPPP 88

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 13  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 73  PPPPPPPPPPPPPPPPP 89

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 14  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 74  PPPPPPPPPPPPPPPPP 90

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 15  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 75  PPPPPPPPPPPPPPPPP 91

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 16  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 76  PPPPPPPPPPPPPPPPP 92

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 17  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 77  PPPPPPPPPPPPPPPPP 93

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 18  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 78  PPPPPPPPPPPPPPPPP 94

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 19  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 79  PPPPPPPPPPPPPPPPP 95

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 20  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 80  PPPPPPPPPPPPPPPPP 96

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 21  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 81  PPPPPPPPPPPPPPPPP 97

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 22  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 82  PPPPPPPPPPPPPPPPP 98

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 23  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 83  PPPPPPPPPPPPPPPPP 99

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 24  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 84  PPPPPPPPPPPPPPPPP 100

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 25  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 85  PPPPPPPPPPPPPPPPP 101

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 26  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 86  PPPPPPPPPPPPPPPPP 102

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 27  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 87  PPPPPPPPPPPPPPPPP 103

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 28  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 88  PPPPPPPPPPPPPPPPP 104

[30][TOP]
>UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q3U3_IXOSC
          Length = 137

 Score =  127 bits (320), Expect = 3e-28
 Identities = 54/76 (71%), Positives = 54/76 (71%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 6   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65

Query: 349 PPPPPRLVP*TLAPSG 396
           PPPPP   P    P G
Sbjct: 66  PPPPPPPPPPPPPPGG 81

 Score =  127 bits (319), Expect = 4e-28
 Identities = 54/76 (71%), Positives = 54/76 (71%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 5   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 349 PPPPPRLVP*TLAPSG 396
           PPPPP   P    P G
Sbjct: 65  PPPPPPPPPPPPPPPG 80

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 61  PPPPPPPPPPPPPPPPP 77

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 62  PPPPPPPPPPPPPPPPP 78

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 63  PPPPPPPPPPPPPPPPP 79

[31][TOP]
>UniRef100_A5BG48 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BG48_VITVI
          Length = 247

 Score =  127 bits (320), Expect = 3e-28
 Identities = 78/182 (42%), Positives = 88/182 (48%), Gaps = 79/182 (43%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRR-----GGGGGGGYERGGGGYG------------GGGSY 300
           DGR+KAV+VTGPDG++VQG++R     GGGGGG   R GGGYG            GGG+ 
Sbjct: 61  DGRTKAVDVTGPDGSSVQGSKRDXYGGGGGGGGRGGRSGGGYGSGWRTGDRGGNGGGGAA 120

Query: 299 ---------------------GGGGYGGGGGYGGG------------------RGGGGYG 237
                                GGGG GGGGG GGG                   GGGG G
Sbjct: 121 CYNCGGTGHLARDCVRRNNGGGGGGXGGGGGGGGGGCYTCGQPGHLARDCSRPSGGGGGG 180

Query: 236 GSGGGY-----------------------GGGGRGGGRGGGGGGGGSCYSCGESGHFARD 126
           G GG Y                       GGGG GGGR GGGGGGG CY+CG+ GHFAR+
Sbjct: 181 GGGGCYNCGDYGHLARDCTLESGXAGRFGGGGGGGGGRFGGGGGGGGCYNCGQEGHFARE 240

Query: 125 CP 120
           CP
Sbjct: 241 CP 242

[32][TOP]
>UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium
           modesticaldum Ice1 RepID=B0TGJ1_HELMI
          Length = 256

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/71 (76%), Positives = 54/71 (76%), Gaps = 2/71 (2%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPR--PPP*PPPPPYPPPP*LPPPP*PPPPRS* 342
           PPPPPPPP PPP PPPP PPP PP PPPPR  PPP PPPPP PPPP  PPPP PPPP   
Sbjct: 36  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95

Query: 343 PPPPPPPRLVP 375
           PPPPPPPR  P
Sbjct: 96  PPPPPPPRPCP 106

 Score =  124 bits (311), Expect = 3e-27
 Identities = 53/77 (68%), Positives = 53/77 (68%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP P P PPPPP PPPP  PPPP PPPP   PP
Sbjct: 34  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPP 93

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 94  PPPPPPPPPRPCPPPPP 110

 Score =  124 bits (310), Expect = 4e-27
 Identities = 53/77 (68%), Positives = 53/77 (68%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPP P PPPP  PPPP PPPP   PP
Sbjct: 28  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPP 87

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 88  PPPPPPPPPPPPPPPRP 104

 Score =  123 bits (309), Expect = 6e-27
 Identities = 53/77 (68%), Positives = 53/77 (68%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP P PP  PPPP PPPP   PP
Sbjct: 26  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPP 85

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 86  PPPPPPPPPPPPPPPPP 102

 Score =  119 bits (297), Expect = 1e-25
 Identities = 51/75 (68%), Positives = 51/75 (68%)
 Frame = +1

Query: 175 PPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPP 354
           PPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPP   PPPP PPPP   PPPP
Sbjct: 24  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPP 83

Query: 355 PPPRLVP*TLAPSGP 399
           PPP   P    P  P
Sbjct: 84  PPPPPPPPPPPPPPP 98

 Score =  118 bits (295), Expect = 2e-25
 Identities = 52/73 (71%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PP P PPP PP PPPP PPP PPPPP PPPP  PPPP PPPPR  PP
Sbjct: 50  PPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPP--PPPPPPPPPRPCPP 107

Query: 349 PPP----PPRLVP 375
           PPP    PP   P
Sbjct: 108 PPPARPCPPPCPP 120

 Score =  104 bits (260), Expect = 3e-21
 Identities = 49/81 (60%), Positives = 51/81 (62%), Gaps = 2/81 (2%)
 Frame = +1

Query: 163 QLPPPPPPPPR--PPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPR 336
           ++P  P  P R  PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP P PP 
Sbjct: 11  KVPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPP 70

Query: 337 S*PPPPPPPRLVP*TLAPSGP 399
             PPPPPPP   P    P  P
Sbjct: 71  PPPPPPPPPPPPPPPPPPPPP 91

 Score =  102 bits (253), Expect = 2e-20
 Identities = 47/77 (61%), Positives = 47/77 (61%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           P  P  P  P    PPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPPR  PP
Sbjct: 10  PKVPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPP 69

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 70  PPPPPPPPPPPPPPPPP 86

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 53/132 (40%), Positives = 54/132 (40%), Gaps = 58/132 (43%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP P P PP PPPP PPP PPPPP PPPP  PPPP PPPPR  PP
Sbjct: 48  PPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPP 107

Query: 349 P------PPP-------------------------------------------------- 360
           P      PPP                                                  
Sbjct: 108 PPPARPCPPPCPPKHECGLPEPCPQVEPIAGEPMPIPPCAPMPMPMPMEPIGRQPLPIPM 167

Query: 361 --PRLVP*TLAP 390
             P   P  + P
Sbjct: 168 PMPPCAPMPVEP 179

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 45/78 (57%), Positives = 47/78 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     PPPPPPPP PPP PPPP PPP PP PPPP PPP PP P  PPPP  P PP 
Sbjct: 59  PPPPPPRPCPPPPPPPPPPPPPPPPP-PPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPP 117

Query: 322 PPPPRS*PPPPPPPRLVP 375
            PP      P P P++ P
Sbjct: 118 CPPKHECGLPEPCPQVEP 135

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 41/72 (56%), Positives = 41/72 (56%)
 Frame = +1

Query: 184 PPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPP 363
           PP   P  P  P  P     PPPP PPP PPPPP PPPP  PPPP PPPP   PPPPPPP
Sbjct: 5   PPTGYPKVPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 364 RLVP*TLAPSGP 399
           R  P    P  P
Sbjct: 65  RPCPPPPPPPPP 76

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 44/81 (54%), Positives = 46/81 (56%), Gaps = 5/81 (6%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP--*LPPP-P*PPPPRS 339
           PPPPPPPP PPP PPPP PPP PP P PP PP  P PPP PP     LP P P   P   
Sbjct: 80  PPPPPPPPPPPPPPPPP-PPPPPPRPCPPPPPARPCPPPCPPKHECGLPEPCPQVEPIAG 138

Query: 340 *PPPPPP--PRLVP*TLAPSG 396
            P P PP  P  +P  + P G
Sbjct: 139 EPMPIPPCAPMPMPMPMEPIG 159

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 38/70 (54%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +1

Query: 193 RPPPRPPPP*P-PPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRL 369
           R PP   P  P  P+ P    P PPP PPPPP PPPP  PPPP PPPP   PPPPPPP  
Sbjct: 3   RKPPTGYPKVPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62

Query: 370 VP*TLAPSGP 399
            P    P  P
Sbjct: 63  PPRPCPPPPP 72

[33][TOP]
>UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA
          Length = 599

 Score =  125 bits (313), Expect = 2e-27
 Identities = 54/78 (69%), Positives = 55/78 (70%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPPPPPPP PPP PPPP PPP PP PPPP PPP PP PP PPPP  PPPP 
Sbjct: 231 PPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290

Query: 322 PPPPRS*PPPPPPPRLVP 375
           PPPP   PPPPPPP + P
Sbjct: 291 PPPP---PPPPPPPPVYP 305

 Score =  121 bits (304), Expect = 2e-26
 Identities = 55/79 (69%), Positives = 55/79 (69%), Gaps = 5/79 (6%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPP-----PRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*L 306
           P SP L   PPPPPPP     P PPP PPPP PPP PP PPPP PPP PPPPP PPPP  
Sbjct: 218 PPSP-LPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPS 276

Query: 307 PPPP*PPPPRS*PPPPPPP 363
           PPPP PPPP   PPPPPPP
Sbjct: 277 PPPPPPPPPPPPPPPPPPP 295

 Score =  119 bits (298), Expect = 1e-25
 Identities = 54/80 (67%), Positives = 54/80 (67%), Gaps = 3/80 (3%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPP---LPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS* 342
           PPPPPPP PPP PPPP PPP    PP PPPP PPP PPPPP PPPP  PPPP PPPP   
Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPP--PPPPSPPPPPPP 283

Query: 343 PPPPPPPRLVP*TLAPSGPV 402
           PPPPPPP   P    P  PV
Sbjct: 284 PPPPPPPPPPPPPPPPPPPV 303

 Score =  110 bits (274), Expect = 6e-23
 Identities = 50/78 (64%), Positives = 50/78 (64%), Gaps = 2/78 (2%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPP--PP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P 345
           PP P PP PPP PP  PP  PP PP PPPP PPP PPPPP PPPP  PPPP PPPP   P
Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSP 277

Query: 346 PPPPPPRLVP*TLAPSGP 399
           PPPPPP   P    P  P
Sbjct: 278 PPPPPPPPPPPPPPPPPP 295

 Score =  110 bits (274), Expect = 6e-23
 Identities = 49/76 (64%), Positives = 49/76 (64%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPP 351
           P PP PP PPP  PPP PPP PP PPP  PP  PPPPP PPPP  PPPP PPPP S PPP
Sbjct: 221 PLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280

Query: 352 PPPPRLVP*TLAPSGP 399
           PPPP   P    P  P
Sbjct: 281 PPPPPPPPPPPPPPPP 296

 Score =  104 bits (259), Expect = 3e-21
 Identities = 48/78 (61%), Positives = 48/78 (61%)
 Frame = +1

Query: 166 LPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P 345
           LP P  PP   PP PPPP PP  PP PPPP PPP P PPP PPPP  PPPP PPPP   P
Sbjct: 212 LPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPP--PPPPPPPPPPPPP 269

Query: 346 PPPPPPRLVP*TLAPSGP 399
           PPPPPP   P    P  P
Sbjct: 270 PPPPPPSPPPPPPPPPPP 287

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 42/62 (67%), Positives = 42/62 (67%)
 Frame = +1

Query: 178 PPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPP 357
           P P P  PP P PP PPP PP  PPP PPP PPPPP  PPP  PPPP PPPP   PPPPP
Sbjct: 211 PLPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPP 270

Query: 358 PP 363
           PP
Sbjct: 271 PP 272

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 39/68 (57%), Positives = 39/68 (57%)
 Frame = +1

Query: 196 PPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP 375
           P P P  P P PLPP PPPP P   P PPP PPPP  PPPP PPP    PPPPPPP   P
Sbjct: 211 PLPLPNAP-PSPLPPSPPPPPP---PSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPP 266

Query: 376 *TLAPSGP 399
               P  P
Sbjct: 267 PPPPPPPP 274

[34][TOP]
>UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q852P0_VOLCA
          Length = 606

 Score =  122 bits (307), Expect = 9e-27
 Identities = 53/77 (68%), Positives = 53/77 (68%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP  PP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPP  S PP
Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPP 266

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPP P   P    PS P
Sbjct: 267 PPPSPSPPPPPPPPSPP 283

 Score =  117 bits (294), Expect = 3e-25
 Identities = 49/68 (72%), Positives = 49/68 (72%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPP 351
           PPPPPPP PPP PPPP PPP PP PPPP PPP PP PP PPPP  P PP PPP  S PPP
Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPP 276

Query: 352 PPPPRLVP 375
           PPPP   P
Sbjct: 277 PPPPSPPP 284

 Score =  115 bits (289), Expect = 1e-24
 Identities = 52/81 (64%), Positives = 52/81 (64%), Gaps = 4/81 (4%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP----P*PPPPR 336
           PPPPP PP PPP PPPP PPP PP PPPP PPP PPPPP P PP  PPP    P PPPP 
Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPS 270

Query: 337 S*PPPPPPPRLVP*TLAPSGP 399
             PPPPPPP   P    P  P
Sbjct: 271 PSPPPPPPPPSPPPAPPPFVP 291

 Score =  108 bits (271), Expect = 1e-22
 Identities = 52/81 (64%), Positives = 52/81 (64%), Gaps = 3/81 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPP--PPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP 315
           P  P     PPPPPP  PP PPP PPPP PPP PP PPPP PPP PPPPP P PP  PP 
Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP-PPPPPSPSPPPPPPS 270

Query: 316 P*PPPPRS*P-PPPPPPRLVP 375
           P PPPP   P PPP PP  VP
Sbjct: 271 PSPPPPPPPPSPPPAPPPFVP 291

 Score =  107 bits (267), Expect = 4e-22
 Identities = 48/71 (67%), Positives = 48/71 (67%)
 Frame = +1

Query: 181 PPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPP 360
           P PP PPP PPPP PPP PP PPPP PPP PPPPP P P   PPPP PPPP S PPPPPP
Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP---PPPPPPPPPPSPPPPPPP 259

Query: 361 PRLVP*TLAPS 393
           P   P    PS
Sbjct: 260 PSPSPPPPPPS 270

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 37/57 (64%), Positives = 37/57 (64%)
 Frame = +1

Query: 229 PLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P PP PPPP PPP PPPPP PPPP  PPPP PPPP   PPPPPPP   P    P  P
Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 259

[35][TOP]
>UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK6_CHLRE
          Length = 738

 Score =  122 bits (305), Expect = 2e-26
 Identities = 55/87 (63%), Positives = 57/87 (65%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPP-P*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P  P   + PPP PPPP PPP PPP P PPP PP PPPPRPPP  PPPP PPPP  PPP 
Sbjct: 312 PPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPS 371

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPPP   PPPPPPPR  P +  P  P
Sbjct: 372 PPPPPPPSPPPPPPPRPPPPSPPPPSP 398

 Score =  120 bits (300), Expect = 6e-26
 Identities = 53/86 (61%), Positives = 54/86 (62%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP PPP  PPP PP PPPP PPP  PPPP PPPP  P PP 
Sbjct: 354 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPP 413

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPPR  PP PPPP   P +  P  P
Sbjct: 414 PPPPRPPPPSPPPPSPPPPSPPPPSP 439

 Score =  118 bits (296), Expect = 2e-25
 Identities = 55/94 (58%), Positives = 56/94 (59%), Gaps = 8/94 (8%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP PPP PP PPPP PPP PPP P PPPP  PPPP 
Sbjct: 237 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPS 296

Query: 322 PPPPR--------S*PPPPPPPRLVP*TLAPSGP 399
           PPPP           PPPPPPPR  P +  P  P
Sbjct: 297 PPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSP 330

 Score =  116 bits (291), Expect = 7e-25
 Identities = 56/95 (58%), Positives = 57/95 (60%), Gaps = 9/95 (9%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP------*PPPLPPYPPPPRPPP*P---PPPPYPP 294
           P SP     PPPPPPP  PPP PPPP       PPP PP PPPP PPP P   PPPP PP
Sbjct: 335 PPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPP 394

Query: 295 PP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP  PPP  PPPP   PPPPPPPR  P +  P  P
Sbjct: 395 PPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSP 429

 Score =  115 bits (289), Expect = 1e-24
 Identities = 54/83 (65%), Positives = 55/83 (66%), Gaps = 6/83 (7%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPP------LPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPP 330
           PPPPPPP  PPP PPPP PPP       PP PPPPRPPP  PPPP PPPP   PPP PPP
Sbjct: 284 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPP---PPPSPPP 340

Query: 331 PRS*PPPPPPPRLVP*TLAPSGP 399
           P S PPPPPPPR  P +  P  P
Sbjct: 341 PPS-PPPPPPPRPPPPSPPPPSP 362

 Score =  114 bits (286), Expect = 3e-24
 Identities = 53/87 (60%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PP-PLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P  P     PPPP PPP PPPRPPPP PP P PP PPPP PPP  PPPP PPPP  P PP
Sbjct: 262 PPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPP 321

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            P PP   PPPPPPP   P    P  P
Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPSPPPPP 348

 Score =  114 bits (285), Expect = 3e-24
 Identities = 53/87 (60%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPP-PPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P SP     PPPPPP PP PPP  PPP PPP PP PPPP PPP  PPPP PPPP  PPP 
Sbjct: 252 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPS 311

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPPP   PPPP PP   P    P  P
Sbjct: 312 PPPPPPPRPPPPSPPPPSPPPPPPPSP 338

 Score =  114 bits (285), Expect = 3e-24
 Identities = 52/86 (60%), Positives = 53/86 (61%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP PPP PP P PP P P PPPPP PPPP  P PP 
Sbjct: 289 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPP--PSPPP 346

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPPR  PP PPPP   P +  P  P
Sbjct: 347 PPPPRPPPPSPPPPSPPPPSPPPPSP 372

 Score =  114 bits (284), Expect = 4e-24
 Identities = 53/87 (60%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPP-PPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P SP     PPPPPP PP PP  PPPP P P PP PPPP PPP  PPPP PPPP  P PP
Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 381

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPPPR  PP PPPP   P +  P  P
Sbjct: 382 PPPPPRPPPPSPPPPSPPPPSPPPPPP 408

 Score =  112 bits (281), Expect = 1e-23
 Identities = 55/88 (62%), Positives = 55/88 (62%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYP-PPPRPPP*PPPPPYPPPP*LP-PP 315
           P SP     PPP PPPP PPP PPP  PPP PP P PPP PPP PPPPP PPPP  P PP
Sbjct: 294 PPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPP 353

Query: 316 P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P  PPP S PPP PPP   P    PS P
Sbjct: 354 PPSPPPPSPPPPSPPPPSPPPPPPPSPP 381

 Score =  112 bits (280), Expect = 1e-23
 Identities = 51/82 (62%), Positives = 52/82 (63%), Gaps = 6/82 (7%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*P------PPP 333
           PPPPPPP PPP PPP  PPP PP PPPP PPP  PPPP PPPP  PPPP P      PPP
Sbjct: 268 PPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPP 327

Query: 334 RS*PPPPPPPRLVP*TLAPSGP 399
            S PPPPPP    P +  P  P
Sbjct: 328 PSPPPPPPPSPPPPPSPPPPPP 349

 Score =  112 bits (279), Expect = 2e-23
 Identities = 50/78 (64%), Positives = 50/78 (64%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPP  
Sbjct: 202 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 260

Query: 322 PPPPRS*PPPPPPPRLVP 375
           PPPP   PPPPPPP   P
Sbjct: 261 PPPPPPSPPPPPPPSPPP 278

 Score =  112 bits (279), Expect = 2e-23
 Identities = 51/78 (65%), Positives = 51/78 (65%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPP  
Sbjct: 212 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPP--PPPSP 268

Query: 322 PPPPRS*PPPPPPPRLVP 375
           PPPP   PPPPPPPR  P
Sbjct: 269 PPPPPPSPPPPPPPRPPP 286

 Score =  111 bits (278), Expect = 2e-23
 Identities = 53/88 (60%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPP--RPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP 315
           P SP     PPP PPPP PPP   PPP  PPP PP P PP P P PPPPP PPPP  P P
Sbjct: 217 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 276

Query: 316 P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P PPPPR  PPPPPPP   P +  P  P
Sbjct: 277 PPPPPPR--PPPPPPPSPPPPSPPPPSP 302

 Score =  111 bits (277), Expect = 3e-23
 Identities = 54/90 (60%), Positives = 54/90 (60%), Gaps = 4/90 (4%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPP--RPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP 315
           P SP     PPP PPPP PPP   PPP  PPP PP PPPP PPP PPP P PPPP  PPP
Sbjct: 227 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPP 286

Query: 316 P*P--PPPRS*PPPPPPPRLVP*TLAPSGP 399
           P P  PPP S PPP PPP   P    P  P
Sbjct: 287 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 316

 Score =  111 bits (277), Expect = 3e-23
 Identities = 54/88 (61%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP-*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P SP     P PPPPPP  PP PPPP  PPP PP PPPP PPP  PPPP PPPP  PPPP
Sbjct: 257 PPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 316

Query: 319 *P-PPPRS*PPPPPPPRLVP*TLAPSGP 399
            P PPP S PPP PPP   P    P  P
Sbjct: 317 PPRPPPPSPPPPSPPPPPPPSPPPPPSP 344

 Score =  110 bits (275), Expect = 5e-23
 Identities = 54/88 (61%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 192 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPS 249

Query: 322 PPPPRS*P--PPPPPPRLVP*TLAPSGP 399
           PPPP   P  PPPPPP   P    PS P
Sbjct: 250 PPPPSPPPPSPPPPPPPSPPPPPPPSPP 277

 Score =  109 bits (273), Expect = 8e-23
 Identities = 51/88 (57%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPP--PRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP 315
           P  P+     PPPP P  P PPP  PPP PPP PP PPPPRPPP  PPPP PPPP  PPP
Sbjct: 347 PPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPP 406

Query: 316 P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P P PP   PP PPPP   P +  P  P
Sbjct: 407 PPPSPPPPPPPRPPPPSPPPPSPPPPSP 434

 Score =  108 bits (271), Expect = 1e-22
 Identities = 49/77 (63%), Positives = 50/77 (64%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP PPPP   PP
Sbjct: 191 PPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPSPPPPSPPPP 248

Query: 349 PPPPPRLVP*TLAPSGP 399
            PPPP   P +  P  P
Sbjct: 249 SPPPPSPPPPSPPPPPP 265

 Score =  108 bits (269), Expect = 2e-22
 Identities = 53/79 (67%), Positives = 53/79 (67%), Gaps = 5/79 (6%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPP--PPRPPPRPPPP*PPPLPPYPP--PPRPPP*PPPPPYP-PPP*L 306
           P SP     PPPPPP  PP PPPRPPPP PPP  P PP  PP PPP PPPPP P PPP  
Sbjct: 364 PPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPS 423

Query: 307 PPPP*PPPPRS*PPPPPPP 363
           PPPP PPPP   PPPP PP
Sbjct: 424 PPPPSPPPPS--PPPPSPP 440

 Score =  104 bits (260), Expect = 3e-21
 Identities = 50/85 (58%), Positives = 51/85 (60%)
 Frame = +1

Query: 145 DSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*P 324
           D   L Q   P PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP P
Sbjct: 178 DCCPLSQANVPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPSP 235

Query: 325 PPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPP   PP PPPP   P +  P  P
Sbjct: 236 PPPSPPPPSPPPPSPPPPSPPPPSP 260

[36][TOP]
>UniRef100_UPI00019830CC PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019830CC
          Length = 241

 Score =  121 bits (303), Expect = 3e-26
 Identities = 75/176 (42%), Positives = 84/176 (47%), Gaps = 73/176 (41%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRR-----GGGGGGGYERGGGGYGGG------GSYGGGGY- 285
           DGR+KAV+VTGPDG++VQG++R     GGGGGG   R GGGYG G      G  GGGG  
Sbjct: 61  DGRTKAVDVTGPDGSSVQGSKRDNYGGGGGGGGRGGRSGGGYGSGWRTGDRGGNGGGGAA 120

Query: 284 --------------------GGGGGYGGGRGGGGY-----------------GGSGGGYG 216
                               GGGGG GGG GGGG                  GG GGG G
Sbjct: 121 CYNCGGTGHLARDCVRRNNGGGGGGSGGGGGGGGCYTCGQPGHLARDCSRPSGGGGGGGG 180

Query: 215 ------------------------GGGRGGGRGGGGGGGGSCYSCGESGHFARDCP 120
                                   GGG GGG G  GGGGG CY+CG+ GHFAR+CP
Sbjct: 181 CYNCGDYGHLARDCTLESGSAGRFGGGGGGGGGRFGGGGGGCYNCGQEGHFARECP 236

[37][TOP]
>UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata
           RepID=UPI000192638B
          Length = 557

 Score =  120 bits (302), Expect = 4e-26
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 266 PPPPPPPPPPPPPPPPPCPPPCPP-PPPPCPPPPPPPPPCPPPP--PPPPPPPPPCPPPP 322

Query: 349 PPPPP 363
           PPPPP
Sbjct: 323 PPPPP 327

 Score =  117 bits (292), Expect = 5e-25
 Identities = 63/137 (45%), Positives = 70/137 (51%), Gaps = 5/137 (3%)
 Frame = +1

Query: 4   KYKDKIKTKIATLKT*KNQLNHPHFTIKVKHREI*RALVGQSLAK*-----PDSPQL*QL 168
           K + K+ TK+   K  KN        + +K        +G S         P +P     
Sbjct: 189 KNQPKLSTKLPKRKKNKNVKATKKEDVSIKAASSAEVNLGDSCCPSAAPCHPPAPPPCPP 248

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPP PPP PPP PPPP PPP PP PPPP PPP  PPP  PPPP  PPPP PPPP   PP
Sbjct: 249 PPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPP 308

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P    P  P
Sbjct: 309 PPPPPPPPPCPPPPPPP 325

 Score =  113 bits (283), Expect = 6e-24
 Identities = 50/76 (65%), Positives = 50/76 (65%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPP 351
           PPPPPPP PPP PPPP PPP  P P PP PPP PPPPP PPP   PPPP PPPP   PPP
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPP 321

Query: 352 PPPPRLVP*TLAPSGP 399
           PPPP   P    P  P
Sbjct: 322 PPPPPPCPPPCPPPCP 337

 Score =  111 bits (278), Expect = 2e-23
 Identities = 51/77 (66%), Positives = 51/77 (66%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP  PPP PPP PP PPPP PPP  PPPP PPPP  PPPP PPPP   PP
Sbjct: 270 PPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPP--PPPPCPPPP---PP 324

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPP P   P    P  P
Sbjct: 325 PPPCPPPCPPPCPPPCP 341

 Score =  111 bits (278), Expect = 2e-23
 Identities = 51/79 (64%), Positives = 51/79 (64%), Gaps = 2/79 (2%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPP--PP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS* 342
           PPPPPPPP PPP PP  PP PPP PP PPPP P P PPPPP PPPP  PPPP PPPP   
Sbjct: 271 PPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPP 330

Query: 343 PPPPPPPRLVP*TLAPSGP 399
           P PPP P   P    P  P
Sbjct: 331 PCPPPCPPPCPPPPPPCPP 349

 Score =  111 bits (278), Expect = 2e-23
 Identities = 52/88 (59%), Positives = 55/88 (62%), Gaps = 1/88 (1%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPP  PPP PPPP PPP PP PPPP P P P PPP PPP   PPPP PPPP   PP
Sbjct: 297 PPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPPCPPPPCPPPP 356

Query: 349 -PPPPPRLVP*TLAPSGPVTLTALDRPS 429
            PPPPP   P    P  P+  T ++  S
Sbjct: 357 CPPPPPPCPPACPIPPPPMETTEVETQS 384

 Score =  110 bits (275), Expect = 5e-23
 Identities = 50/77 (64%), Positives = 50/77 (64%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP P P PP PPPP PPP PPPPP PPP   PPPP PP P   PP
Sbjct: 275 PPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPP 334

Query: 349 PPPPPRLVP*TLAPSGP 399
           P PPP   P    P  P
Sbjct: 335 PCPPPCPPPPPPCPPPP 351

 Score =  107 bits (266), Expect = 5e-22
 Identities = 50/79 (63%), Positives = 50/79 (63%), Gaps = 6/79 (7%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPP--RPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP 315
           P  P     PPPPPPPP PPP   PPPP PPP PP  PPP PPP PPPPP  PPP  PPP
Sbjct: 296 PPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPPCPPPPCPPP 355

Query: 316 P*PPPPRS*PP----PPPP 360
           P PPPP   PP    PPPP
Sbjct: 356 PCPPPPPPCPPACPIPPPP 374

 Score =  104 bits (260), Expect = 3e-21
 Identities = 49/79 (62%), Positives = 49/79 (62%), Gaps = 3/79 (3%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LP---PPP*PPPPRS* 342
           PPPPPP  PPP PPPP PPP PP PPPP P P PPPPP P PP  P   PPP PPPP   
Sbjct: 288 PPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPPC 347

Query: 343 PPPPPPPRLVP*TLAPSGP 399
           PPPP PP   P    P  P
Sbjct: 348 PPPPCPPPPCPPPPPPCPP 366

[38][TOP]
>UniRef100_Q31DH1 RNA-binding region RNP-1 n=1 Tax=Prochlorococcus marinus str. MIT
           9312 RepID=Q31DH1_PROM9
          Length = 222

 Score =  120 bits (302), Expect = 4e-26
 Identities = 62/100 (62%), Positives = 66/100 (66%), Gaps = 5/100 (5%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGG--GYERGGGGYGGG---GSYGGGGYGGGGGYGG 261
           GR   +N   P G+   G+RRGG GGG  G   GGGGYGGG   G YGGGG GGGGGYGG
Sbjct: 69  GRPLRINKAEPRGSG--GSRRGGRGGGNNGGGYGGGGYGGGNNGGGYGGGGGGGGGGYGG 126

Query: 260 GRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G  GGGYGG GGGYGGG  GGG GGGGGG G   + G  G
Sbjct: 127 GNNGGGYGGGGGGYGGGNNGGGYGGGGGGYGGGNNGGGYG 166

 Score =  108 bits (269), Expect = 2e-22
 Identities = 55/99 (55%), Positives = 58/99 (58%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGG 258
           S   GR    N  G  G    G   GGG GGG   GGGGYGGG + GGG  GGGGGYGGG
Sbjct: 85  SRRGGRGGGNNGGGYGGGGYGGGNNGGGYGGGGGGGGGGYGGGNN-GGGYGGGGGGYGGG 143

Query: 257 RGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
             GGGYGG GGGYGGG  GGG GGG     + Y+   SG
Sbjct: 144 NNGGGYGGGGGGYGGGNNGGGYGGGNPEPKTSYTNNSSG 182

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 38/62 (61%), Positives = 40/62 (64%), Gaps = 2/62 (3%)
 Frame = -3

Query: 317 GGGGSYGGGGYGGGGGYGGGRGGGGYGG--SGGGYGGGGRGGGRGGGGGGGGSCYSCGES 144
           G GGS  GG   GGG  GGG GGGGYGG  +GGGYGGGG GGG G GGG  G  Y  G  
Sbjct: 81  GSGGSRRGGR--GGGNNGGGYGGGGYGGGNNGGGYGGGGGGGGGGYGGGNNGGGYGGGGG 138

Query: 143 GH 138
           G+
Sbjct: 139 GY 140

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 36/86 (41%), Positives = 37/86 (43%), Gaps = 1/86 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGS-YGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           G  G N  G   GGGGG G    GGGYGGGG  YGGG  GGG G G       Y  +  G
Sbjct: 123 GYGGGNNGGGYGGGGGGYGGGNNGGGYGGGGGGYGGGNNGGGYGGGNPEPKTSYTNNSSG 182

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGES 144
             G      R  G     S Y  G S
Sbjct: 183 AEG---WEDRSYGNSSENSEYESGRS 205

[39][TOP]
>UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f.
           nagariensis RepID=Q9SBM1_VOLCA
          Length = 409

 Score =  120 bits (300), Expect = 6e-26
 Identities = 55/91 (60%), Positives = 58/91 (63%), Gaps = 5/91 (5%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRP-----PPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*L 306
           P +P   + PPPPPPPP PPP+P     P P PPP PP PPPP PPP PPPPP PPPP  
Sbjct: 57  PPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPP-- 114

Query: 307 PPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP PPPP   PPPPPPP   P    P  P
Sbjct: 115 PPPPPPPPPSPPPPPPPPPPPPPNPPPPPPP 145

 Score =  120 bits (300), Expect = 6e-26
 Identities = 56/88 (63%), Positives = 57/88 (64%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPP--PPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP 315
           P SP     PPPP  PPPP PPP PPPP PPP PP PPPP P P PPPPP PPPP  PPP
Sbjct: 82  PPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPP 141

Query: 316 P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P PPPP S  PPP PP   P +  PS P
Sbjct: 142 PPPPPPPSPSPPPSPPPSPPPSPPPSPP 169

 Score =  116 bits (290), Expect = 9e-25
 Identities = 50/74 (67%), Positives = 50/74 (67%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  PQ    P P PPPP PPP PPPP PPP PP PP P PPP PPPPP P PP  PPPP 
Sbjct: 74  PPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPP 133

Query: 322 PPPPRS*PPPPPPP 363
           PPPP   PPPPPPP
Sbjct: 134 PPPPNPPPPPPPPP 147

 Score =  115 bits (288), Expect = 2e-24
 Identities = 53/79 (67%), Positives = 54/79 (68%), Gaps = 2/79 (2%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P- 345
           PPPPPPPP P P PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP P PP S P 
Sbjct: 100 PPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPP-PPPPPNPPPPPPPPPPSPSPPPSPPP 158

Query: 346 -PPPPPPRLVP*TLAPSGP 399
            PPP PP   P +  PS P
Sbjct: 159 SPPPSPPPSPPPSPPPSPP 177

 Score =  114 bits (286), Expect = 3e-24
 Identities = 53/86 (61%), Positives = 55/86 (63%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P    LPP P PPP PPP  PPP PPP PP PPP  PPP PPPPP PP P  PPPP 
Sbjct: 73  PPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPP 132

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP + PPPPPPP   P +  PS P
Sbjct: 133 PPPPPNPPPPPPPPPPSP-SPPPSPP 157

 Score =  112 bits (280), Expect = 1e-23
 Identities = 58/101 (57%), Positives = 59/101 (58%), Gaps = 5/101 (4%)
 Frame = +1

Query: 112 ALVGQSLAK*PDSPQL*QLPPPPPPPP-----RPPPRPPPP*PPPLPPYPPPPRPPP*PP 276
           ALV    A  P SP     PP  PPP       PPP PPPP PPP PP PP P PPP PP
Sbjct: 33  ALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPP-PP 91

Query: 277 PPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPP PPPP  PPPP PPPP S PPPPPPP   P +  P  P
Sbjct: 92  PPPVPPPP--PPPPPPPPPPSPPPPPPPPPPPPPSPPPPPP 130

 Score =  112 bits (280), Expect = 1e-23
 Identities = 52/87 (59%), Positives = 54/87 (62%), Gaps = 10/87 (11%)
 Frame = +1

Query: 169 PPPPPPPPRPP----PRPPPP*PPPLPP------YPPPPRPPP*PPPPPYPPPP*LPPPP 318
           PPPPPPPP+PP    P PPPP PPP+PP       PPPP  PP PPPPP PPPP  PPPP
Sbjct: 70  PPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPP 129

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPPP    PPPPPP   P    P  P
Sbjct: 130 PPPPPPPPNPPPPPPPPPPSPSPPPSP 156

 Score =  111 bits (278), Expect = 2e-23
 Identities = 49/77 (63%), Positives = 50/77 (64%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPP PP PPP PPPP P P PP PPPP PPP PPPPP PPPP   PPP PPP     P
Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSP 164

Query: 349 PPPPPRLVP*TLAPSGP 399
           PP PP   P +  PS P
Sbjct: 165 PPSPPPSPPPSPPPSPP 181

 Score =  110 bits (275), Expect = 5e-23
 Identities = 52/86 (60%), Positives = 54/86 (62%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP      PPP  PP PPP PPPP PPP  P PPPPRPPP  PPPP PPPP  PPPP 
Sbjct: 219 PPSPSPPSPRPPPRRPPFPPPSPPPPRPPP--PAPPPPRPPPPSPPPPLPPPP-SPPPPL 275

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP  +P +  P  P
Sbjct: 276 PPPPSPPPPSPPPPSPLPPSPRPPKP 301

 Score =  108 bits (270), Expect = 2e-22
 Identities = 53/87 (60%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPP-P*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P SP+    P P PP PRPPPR PP P P P PP PPPP PPP  PPPP PPPP LPPPP
Sbjct: 214 PPSPRP---PSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPP-LPPPP 269

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPPP   PP PPPP   P +  P  P
Sbjct: 270 SPPPPLPPPPSPPPPSPPPPSPLPPSP 296

 Score =  108 bits (269), Expect = 2e-22
 Identities = 51/83 (61%), Positives = 52/83 (62%), Gaps = 6/83 (7%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPP------PP*LPPPP*PPP 330
           PPPPPPPP PPP PPPP PPP  P PPPP PPP P PPP PP      PP  PPP  PP 
Sbjct: 116 PPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPS 175

Query: 331 PRS*PPPPPPPRLVP*TLAPSGP 399
           P   PPP PPPR  P +  PS P
Sbjct: 176 PPPSPPPSPPPRPPP-SPPPSPP 197

 Score =  107 bits (267), Expect = 4e-22
 Identities = 50/80 (62%), Positives = 50/80 (62%), Gaps = 2/80 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPP--PP*LPPP 315
           P SP     PPPPPPPP PPP PPPP PPP PP P PP PPP PPP P PP  PP  PPP
Sbjct: 108 PPSP-----PPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPP 162

Query: 316 P*PPPPRS*PPPPPPPRLVP 375
             PP P   PPP PPP   P
Sbjct: 163 SPPPSPPPSPPPSPPPSPPP 182

 Score =  107 bits (267), Expect = 4e-22
 Identities = 48/77 (62%), Positives = 49/77 (63%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP P P PP  PPP PPP PPP P P PP  PPP  PP P   PP
Sbjct: 130 PPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPP 189

Query: 349 PPPPPRLVP*TLAPSGP 399
           P PPP   P +  PS P
Sbjct: 190 PSPPPSPPP-SPPPSPP 205

 Score =  107 bits (267), Expect = 4e-22
 Identities = 48/75 (64%), Positives = 50/75 (66%)
 Frame = +1

Query: 151 PQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPP 330
           P+    PPP PPPPRPPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP PPP
Sbjct: 231 PRRPPFPPPSPPPPRPPPPAPPP-PRPPPPSPPPPLPPPPSPPPPLPPPP-SPPPPSPPP 288

Query: 331 PRS*PPPPPPPRLVP 375
           P   PP P PP+  P
Sbjct: 289 PSPLPPSPRPPKPSP 303

 Score =  107 bits (266), Expect = 5e-22
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPPPPPPP PPP PPPP PPP P   PPP PPP PPP P P PP  PPP  
Sbjct: 122 PPSP-----PPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSP 176

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP P   PPP PPP   P +  PS P
Sbjct: 177 PPSPPPSPPPRPPPSPPP-SPPPSPP 201

 Score =  106 bits (264), Expect = 9e-22
 Identities = 47/77 (61%), Positives = 48/77 (62%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           P PPPPPP PPP PP P PPP PP PPPP PPP PPPPP  P P   PPP PPP     P
Sbjct: 109 PSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSP 168

Query: 349 PPPPPRLVP*TLAPSGP 399
           PP PP   P +  PS P
Sbjct: 169 PPSPPPSPPPSPPPSPP 185

 Score =  105 bits (262), Expect = 2e-21
 Identities = 54/105 (51%), Positives = 56/105 (53%), Gaps = 19/105 (18%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP------- 300
           P SP   + PPP PPPPRPPP  PPP P P PP PPPP PPP  PPPP PPPP       
Sbjct: 238 PPSPPPPRPPPPAPPPPRPPPPSPPP-PLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSP 296

Query: 301 ------------*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
                         PPPP PPPPR  PP P PPR  P +  P  P
Sbjct: 297 RPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRP 341

 Score =  105 bits (261), Expect = 2e-21
 Identities = 48/76 (63%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRP-PPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P 345
           PPPPPPPP P P P PPP PPP PP  PPP PPP PPP P P PP  PPP  PP P   P
Sbjct: 141 PPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSP 200

Query: 346 PPPPPPRLVP*TLAPS 393
           PP PPPR  P    PS
Sbjct: 201 PPSPPPRPPPSPNPPS 216

 Score =  105 bits (261), Expect = 2e-21
 Identities = 53/104 (50%), Positives = 55/104 (52%), Gaps = 17/104 (16%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPP-----------------PRPPPP*PPPLPPYPPPPRPPP* 270
           P  P      PPP PPPRPP                 PRPPP  PP  PP PPPPRPPP 
Sbjct: 190 PSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPP 249

Query: 271 PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPV 402
            PPPP PPPP  PPPP PPPP   PP PPPP   P +  P  P+
Sbjct: 250 APPPPRPPPP-SPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPL 292

 Score =  104 bits (259), Expect = 3e-21
 Identities = 53/94 (56%), Positives = 54/94 (57%), Gaps = 8/94 (8%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPP-RPPPP*PPPLPPYPPPPRPP-------P*PPPPPYPPP 297
           P SP     PPP PPPP PPP  PPPP PPP  P PP PRPP       P P PPP  PP
Sbjct: 258 PPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPP 317

Query: 298 P*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P  PPPP P PPR  PP PPPPR  P +  P  P
Sbjct: 318 PPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRP 351

 Score =  103 bits (256), Expect = 8e-21
 Identities = 49/89 (55%), Positives = 50/89 (56%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPP---P*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPP 312
           P  P     PPPPPP P PPP PPP   P PPP PP  PPP PPP PPP P P PP  PP
Sbjct: 134 PPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPP 193

Query: 313 PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P  PP P   PPP PPP   P +  P  P
Sbjct: 194 PSPPPSPPPSPPPRPPPSPNPPSPRPPSP 222

 Score =  102 bits (254), Expect = 1e-20
 Identities = 52/92 (56%), Positives = 52/92 (56%), Gaps = 14/92 (15%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPP--------RPPPP*PP------PLPPYPPPPRPPP*PPP 279
           P SP     PPP PPPP PPP        RPP P PP      P PP PPPPRPPP  P 
Sbjct: 268 PPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPN 327

Query: 280 PPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP 375
           PP PPPP  PPPP PPPP   PP PPPP   P
Sbjct: 328 PPRPPPP-SPPPPRPPPPSPNPPRPPPPSPSP 358

 Score =  101 bits (251), Expect = 3e-20
 Identities = 47/80 (58%), Positives = 47/80 (58%), Gaps = 2/80 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPP--PPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP 315
           P  P     PPPPPP  PP PPP PP P PPP PP  PPP PPP PPP P P PP  PPP
Sbjct: 123 PSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 182

Query: 316 P*PPPPRS*PPPPPPPRLVP 375
             PP P   PPP PPP   P
Sbjct: 183 SPPPRPPPSPPPSPPPSPPP 202

 Score =  100 bits (250), Expect = 4e-20
 Identities = 52/105 (49%), Positives = 53/105 (50%), Gaps = 19/105 (18%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRP---PPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LP- 309
           P  P      PPP PPP PPP P   PPP PPP PP  PPP PPP PPP P PP P  P 
Sbjct: 162 PSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPS 221

Query: 310 ---------------PPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
                          PPP PPPPR  PP PPPPR  P +  P  P
Sbjct: 222 PSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLP 266

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/82 (59%), Positives = 51/82 (62%), Gaps = 7/82 (8%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPP----P 300
           P SP+    PP P PP  P PRPPPP PPP    PP P PPRPPP  PPPP PPP    P
Sbjct: 293 PPSPR----PPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNP 348

Query: 301 *LPPPP*PPPPRS*PPPPPPPR 366
             PPPP P PP+  PPP PPPR
Sbjct: 349 PRPPPPSPSPPKPPPPPSPPPR 370

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 50/79 (63%), Positives = 51/79 (64%), Gaps = 2/79 (2%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPP PPPPRPPP  P P P P PP PPPPRPPP  P PP PPPP  P PP PPPP S PP
Sbjct: 312 PPPNPPPPRPPPPSPNP-PRPPPPSPPPPRPPPPSPNPPRPPPP-SPSPPKPPPPPSPPP 369

Query: 349 PPP--PPRLVP*TLAPSGP 399
            PP  PPR  P    P+ P
Sbjct: 370 RPPRRPPR--PPRRPPTAP 386

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 51/94 (54%), Positives = 53/94 (56%), Gaps = 8/94 (8%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*P-PPLP-------PYPPPPRPPP*PPPPPYPPP 297
           P  P     PP PPPP  PPP P PP P PP P       P PPPP PPP  PPPP P P
Sbjct: 269 PSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNP 328

Query: 298 P*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P  PPPP PPPPR  PP P PPR  P + +P  P
Sbjct: 329 P-RPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKP 361

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 48/87 (55%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP      PPP PPP PPP PPP  PPP PP  PPP PPP PPP P P PP  PPP  
Sbjct: 147 PPSPS-----PPPSPPPSPPPSPPPS-PPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSP 200

Query: 322 PPPPRS*PPPPP-PPRLVP*TLAPSGP 399
           PP P   PPP P PP   P + +P  P
Sbjct: 201 PPSPPPRPPPSPNPPSPRPPSPSPPSP 227

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 47/82 (57%), Positives = 47/82 (57%), Gaps = 4/82 (4%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPP---P*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPP 312
           P  P      PPP PPP PPP PPP   P PPP PP  PPP PPP PPP P P PP  PP
Sbjct: 150 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPP 209

Query: 313 P-P*PPPPRS*PPPPPPPRLVP 375
           P P PP PR   P PP PR  P
Sbjct: 210 PSPNPPSPRPPSPSPPSPRPPP 231

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 44/78 (56%), Positives = 46/78 (58%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P +P   + PPP P PPRPPP  PPP P P PP P PPRPPP  P PP PPP   PP P 
Sbjct: 313 PPNPPPPRPPPPSPNPPRPPPPSPPP-PRPPPPSPNPPRPPPPSPSPPKPPP---PPSPP 368

Query: 322 PPPPRS*PPPPPPPRLVP 375
           P PPR  P PP  P   P
Sbjct: 369 PRPPRRPPRPPRRPPTAP 386

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 45/95 (47%), Positives = 47/95 (49%), Gaps = 11/95 (11%)
 Frame = +1

Query: 148 SPQL*QLPPPPPPPPRPP-------PRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*L 306
           SP     P   PPP R P       P  PPP  PP P  PPP  PPP P  P +PPPP  
Sbjct: 13  SPHALGAPARKPPPRRSPVVALVETPAAPPPGSPP-PGTPPPGVPPPTPSGPEHPPPP-P 70

Query: 307 PPPP*PP----PPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP PP    PP   PPPPPPP + P    P  P
Sbjct: 71  PPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPP 105

[40][TOP]
>UniRef100_A9SBU8 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SBU8_PHYPA
          Length = 198

 Score =  119 bits (299), Expect = 8e-26
 Identities = 69/136 (50%), Positives = 76/136 (55%), Gaps = 27/136 (19%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGT--RRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYG 264
           S  DGR+KA+ VTGP GA VQG   RR G GGGG    GGG GGG  +GGG   G G   
Sbjct: 66  SSEDGRTKALAVTGPGGAFVQGASYRRDGYGGGGR---GGGEGGGRGFGGGAARGRGR-- 120

Query: 263 GGRGGGGYGGSGGGYGGGGR-------------------------GGGRGGGGGGGGSCY 159
           GGRG GG+GG  GG GGG R                         GGG GGG GG  SCY
Sbjct: 121 GGRGSGGFGGERGGVGGGDRSCYNCGEGGHMARDCQNESTGNARQGGGGGGGVGGSRSCY 180

Query: 158 SCGESGHFARDCPTSA 111
           +CGE+GHFARDC  +A
Sbjct: 181 TCGEAGHFARDCTPAA 196

[41][TOP]
>UniRef100_B7PWI8 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PWI8_IXOSC
          Length = 117

 Score =  119 bits (299), Expect = 8e-26
 Identities = 56/73 (76%), Positives = 57/73 (78%)
 Frame = -3

Query: 386 ANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGG 207
           AN  G+RRGGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG
Sbjct: 45  ANEAGSRRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104

Query: 206 RGGGRGGGGGGGG 168
            GGG GGGGGGGG
Sbjct: 105 GGGGGGGGGGGGG 117

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/64 (67%), Positives = 43/64 (67%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 53  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112

Query: 218 GGGG 207
           GGGG
Sbjct: 113 GGGG 116

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/64 (67%), Positives = 43/64 (67%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 54  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113

Query: 218 GGGG 207
           GGGG
Sbjct: 114 GGGG 117

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 42/72 (58%), Positives = 44/72 (61%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRG 252
           N+  S+     G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG G
Sbjct: 46  NEAGSRRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 105

Query: 251 GGGYGGSGGGYG 216
           GGG GG GGG G
Sbjct: 106 GGGGGGGGGGGG 117

[42][TOP]
>UniRef100_UPI0001862007 hypothetical protein BRAFLDRAFT_58365 n=1 Tax=Branchiostoma
           floridae RepID=UPI0001862007
          Length = 178

 Score =  119 bits (298), Expect = 1e-25
 Identities = 62/86 (72%), Positives = 62/86 (72%), Gaps = 9/86 (10%)
 Frame = -3

Query: 386 ANVQGTRRGGGGGGGYE-RGGGGYGGGGSY---GGGGYGG--GGGYGGGRGGGGYGGSGG 225
           A  QG RRGGGGGGGY  RGGGGYGGGG Y   GGGGYGG  GGG G G GGGGYGG GG
Sbjct: 81  AKPQGERRGGGGGGGYRGRGGGGYGGGGGYRGRGGGGYGGSYGGGGGYGGGGGGYGGGGG 140

Query: 224 GYGGGGRGGGRGGGGG---GGGSCYS 156
            YGGGG GGG  GGGG   GGG  YS
Sbjct: 141 SYGGGGYGGGSYGGGGGSYGGGGNYS 166

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 41/72 (56%), Positives = 42/72 (58%), Gaps = 15/72 (20%)
 Frame = -3

Query: 389 GANVQGTRRGG-----GGGGGYERGGGGYGGGG-SYGGGGYGGG--GGYGGGRGGGG--- 243
           G   +G   GG     GGGGGY  GGGGYGGGG SYGGGGYGGG  GG GG  GGGG   
Sbjct: 107 GGGYRGRGGGGYGGSYGGGGGYGGGGGGYGGGGGSYGGGGYGGGSYGGGGGSYGGGGNYS 166

Query: 242 ----YGGSGGGY 219
               Y    GGY
Sbjct: 167 QQQQYDQGYGGY 178

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 41/69 (59%), Positives = 41/69 (59%), Gaps = 10/69 (14%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGY-GGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG---- 225
           G    G   GG  GGGY  GGGGY GGGGSYGGGGY GGG YGG  GGG YGG G     
Sbjct: 114 GGGGYGGSYGG--GGGYGGGGGGYGGGGGSYGGGGY-GGGSYGG--GGGSYGGGGNYSQQ 168

Query: 224 -----GYGG 213
                GYGG
Sbjct: 169 QQYDQGYGG 177

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 41/70 (58%), Positives = 41/70 (58%), Gaps = 14/70 (20%)
 Frame = -3

Query: 308 GSYGGGGYG------GGGGYGG-----GRGGGGYGGS---GGGYGGGGRGGGRGGGGGGG 171
           G   GGG G      GGGGYGG     GRGGGGYGGS   GGGYGGGG G G GGG  GG
Sbjct: 85  GERRGGGGGGGYRGRGGGGYGGGGGYRGRGGGGYGGSYGGGGGYGGGGGGYGGGGGSYGG 144

Query: 170 GSCYSCGESG 141
           G  Y  G  G
Sbjct: 145 GG-YGGGSYG 153

[43][TOP]
>UniRef100_A7NV84 Chromosome chr18 scaffold_1, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7NV84_VITVI
          Length = 189

 Score =  119 bits (297), Expect = 1e-25
 Identities = 66/129 (51%), Positives = 72/129 (55%), Gaps = 22/129 (17%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGG-GYGGGGSY---------------- 300
           DGR+KAV VT   G+   G   G G  GG  RGG  GYGGGG+                 
Sbjct: 62  DGRTKAVEVTAVRGSYSSGGGGGRGFSGGRSRGGNDGYGGGGACYNCGRTGHLARDCYQG 121

Query: 299 -GGG--GYGGGGGYGGGRGGGGY--GGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGHF 135
            GGG  GYGGGGGY  G GGGGY  G  GGGY  G  GGG   G GGG +CY+CGE GHF
Sbjct: 122 SGGGRRGYGGGGGYSAGAGGGGYSAGAGGGGYSAGAGGGGYSFGAGGG-ACYNCGEEGHF 180

Query: 134 ARDCPTSAR 108
           ARDCP   +
Sbjct: 181 ARDCPNGQK 189

[44][TOP]
>UniRef100_Q3HRT2 Putative glycine-rich protein n=1 Tax=Picea glauca
           RepID=Q3HRT2_PICGL
          Length = 156

 Score =  117 bits (294), Expect = 3e-25
 Identities = 61/105 (58%), Positives = 67/105 (63%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR 255
           +N GR+KA++VTGPDGA VQG   GGGGG    RGGG        GGGG GGGGG     
Sbjct: 59  ENGGRTKALDVTGPDGAFVQGNSGGGGGG----RGGGR-------GGGGAGGGGGSCYKC 107

Query: 254 GGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGHFARDCP 120
           G  G+       GGGG G G GGGG GGGSCY CG+ GHFARDCP
Sbjct: 108 GESGHFARDCTSGGGGGGNGGGGGGAGGGSCYQCGDFGHFARDCP 152

[45][TOP]
>UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK5_CHLRE
          Length = 853

 Score =  117 bits (293), Expect = 4e-25
 Identities = 53/86 (61%), Positives = 54/86 (62%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PP  PPP  PPP PP PPPP PPP PPP P PPPP  PPPP 
Sbjct: 242 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 301

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PPPPPPP   P +  P  P
Sbjct: 302 PPPPS--PPPPPPPSPPPPSPPPPSP 325

 Score =  116 bits (290), Expect = 9e-25
 Identities = 51/79 (64%), Positives = 52/79 (65%), Gaps = 3/79 (3%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP---*PPPPRS* 342
           PPPPPPP PPP PPP  PPP PP PPPP PPP  PPPP PPPP  PPPP    PPPP   
Sbjct: 330 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 389

Query: 343 PPPPPPPRLVP*TLAPSGP 399
           PPPPPPP   P +  P  P
Sbjct: 390 PPPPPPPSPPPPSPPPPSP 408

 Score =  116 bits (290), Expect = 9e-25
 Identities = 54/88 (61%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP PPP PP PPPP PPP PPP P PPPP  PPPP 
Sbjct: 405 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 464

Query: 322 P--PPPRS*PPPPPPPRLVP*TLAPSGP 399
           P  PPP S PPP PPP   P    P  P
Sbjct: 465 PPSPPPPSPPPPSPPPPSPPPPSPPPPP 492

 Score =  116 bits (290), Expect = 9e-25
 Identities = 51/78 (65%), Positives = 51/78 (65%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     PPPP PPP PPP PPPP PPP PP PPPP PPP  PPPP PPPP  PPP  
Sbjct: 430 PPPPPSPPPPPPPSPPPPPPPSPPPP-PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 488

Query: 322 PPPPRS*PPPPPPPRLVP 375
           PPPP   PPPPPPP   P
Sbjct: 489 PPPPPPSPPPPPPPSPPP 506

 Score =  116 bits (290), Expect = 9e-25
 Identities = 51/79 (64%), Positives = 52/79 (65%), Gaps = 3/79 (3%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP---*PPPPRS* 342
           PPPPPPP PPP PPP  PPP PP PPPP PPP  PPPP PPPP  PPPP    PPPP   
Sbjct: 444 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 503

Query: 343 PPPPPPPRLVP*TLAPSGP 399
           PPPPPPP   P +  P  P
Sbjct: 504 PPPPPPPSPPPPSPPPPSP 522

 Score =  115 bits (289), Expect = 1e-24
 Identities = 49/69 (71%), Positives = 49/69 (71%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPP PPP PPP PPPP PPP PP PPPP PPP  PPPP PPPP  PPP  PPPP   PP
Sbjct: 325 PPPPSPPPPPPPSPPPP-PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 383

Query: 349 PPPPPRLVP 375
           PPPPP   P
Sbjct: 384 PPPPPSPPP 392

 Score =  115 bits (288), Expect = 2e-24
 Identities = 54/86 (62%), Positives = 54/86 (62%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPPPPP P PP  PPP  PPP PP PPPP PPP PPP P PPPP  PPPP 
Sbjct: 299 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 358

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP S PPP PPP   P    PS P
Sbjct: 359 PPPP-SPPPPSPPPPSPPPPPPPSPP 383

 Score =  115 bits (287), Expect = 2e-24
 Identities = 51/83 (61%), Positives = 52/83 (62%), Gaps = 6/83 (7%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPP------LPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPP 330
           PPPPPPP  PPP PPPP PPP       PP PPPP PPP PPP P PPPP  PPPP PPP
Sbjct: 346 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 405

Query: 331 PRS*PPPPPPPRLVP*TLAPSGP 399
           P   PP PPPP   P +  P  P
Sbjct: 406 PSPPPPSPPPPSPPPPSPPPPSP 428

 Score =  115 bits (287), Expect = 2e-24
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP PPPP PPP PP PPPP PPP PPP P PPPP  PPPP 
Sbjct: 415 PPSPPPPSPPPPSPPPP-PPPSPPPP-PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 472

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP S PPP PPP   P    PS P
Sbjct: 473 PPPP-SPPPPSPPPPSPPPPPPPSPP 497

 Score =  114 bits (286), Expect = 3e-24
 Identities = 50/78 (64%), Positives = 50/78 (64%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP PPP PP P PP P P PPPPP PPPP  PPP  
Sbjct: 214 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 273

Query: 322 PPPPRS*PPPPPPPRLVP 375
           PPPP   PPPPPPP   P
Sbjct: 274 PPPPPPSPPPPPPPSPPP 291

 Score =  114 bits (286), Expect = 3e-24
 Identities = 52/86 (60%), Positives = 53/86 (61%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PP  PPP  PPP PP PPPP PPP  PPPP PPPP  PPP  
Sbjct: 224 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP--PPPSP 281

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PPPPPPP   P +  P  P
Sbjct: 282 PPPPPPSPPPPPPPSPPPPSPPPPSP 307

 Score =  114 bits (286), Expect = 3e-24
 Identities = 54/90 (60%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP-*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P  P     PPPP PPP PPP PPPP  PPP PP PPPP PPP  PPPP PPPP  PPPP
Sbjct: 275 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPP 334

Query: 319 ---*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
               PPPP   PPPPPPP   P +  P  P
Sbjct: 335 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 364

 Score =  114 bits (286), Expect = 3e-24
 Identities = 50/76 (65%), Positives = 50/76 (65%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPP 351
           PPPPPPP PPP PPP  PPP PP PPPP PPP  PPPP PPPP  PPPP PPPP   PPP
Sbjct: 374 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPSPPPPSPPPPP 432

Query: 352 PPPPRLVP*TLAPSGP 399
           PP P   P    P  P
Sbjct: 433 PPSPPPPPPPSPPPPP 448

 Score =  114 bits (285), Expect = 3e-24
 Identities = 53/86 (61%), Positives = 54/86 (62%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP PPP PP PPPP PP  PPPPP PPPP  PPPP 
Sbjct: 351 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP--PPPPPSPPPP-SPPPPS 407

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 408 PPPPSPPPPSPPPPSPPPPSPPPPPP 433

 Score =  114 bits (285), Expect = 3e-24
 Identities = 56/91 (61%), Positives = 56/91 (61%), Gaps = 5/91 (5%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRP---PPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPP 312
           P SP     PPP PPPP PPP P   PPP PPP PP PPPP PPP  PPPP PPPP  PP
Sbjct: 356 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP-SPP 414

Query: 313 PP*PPPPRS*P--PPPPPPRLVP*TLAPSGP 399
           PP PPPP   P  PPPPPP   P    PS P
Sbjct: 415 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 445

 Score =  114 bits (285), Expect = 3e-24
 Identities = 51/83 (61%), Positives = 52/83 (62%), Gaps = 6/83 (7%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPP------LPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPP 330
           PPPPPPP  PPP PPPP PPP       PP PPPP PPP PPP P PPPP  PPPP PPP
Sbjct: 460 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 519

Query: 331 PRS*PPPPPPPRLVP*TLAPSGP 399
           P   PP PPPP   P +  P  P
Sbjct: 520 PSPPPPSPPPPSPPPPSPPPPPP 542

 Score =  114 bits (284), Expect = 4e-24
 Identities = 55/90 (61%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*P---PPPPYPPPP*LPP 312
           P  P     PPP PPPP PPP  PPP PPP PP PPPP PPP P   PPPP PPPP  PP
Sbjct: 250 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 309

Query: 313 PP*P-PPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP P PPP S PPP PPP   P    PS P
Sbjct: 310 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 339

 Score =  114 bits (284), Expect = 4e-24
 Identities = 54/93 (58%), Positives = 55/93 (59%), Gaps = 7/93 (7%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PP-------PPPYPPPP 300
           P SP     PPP PPPP PPP  PPP PPP PP PPPP PPP PP       PPP  PPP
Sbjct: 465 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 524

Query: 301 *LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             PPPP PPPP   PPPPPPP   P +  P  P
Sbjct: 525 PSPPPPSPPPPS--PPPPPPPSPPPPSPPPPSP 555

 Score =  114 bits (284), Expect = 4e-24
 Identities = 52/84 (61%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP-P*PPPPRS*PP 348
           PPPPPPP PPP PPP  PPP PP PPPP PPP  PPPP PPPP  PPP P PPPP S PP
Sbjct: 488 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 547

Query: 349 PPPPPRLVP*TLAPSGPVTLTALD 420
           P PPP   P        ++LT  D
Sbjct: 548 PSPPPPSPPPPCQVCVYISLTVSD 571

 Score =  113 bits (283), Expect = 6e-24
 Identities = 53/77 (68%), Positives = 53/77 (68%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPP PPP PPP PPPP PPP PP PPPP PPP  PPPP PPPP  PPPP PPPP S PP
Sbjct: 483 PPPPSPPPPPPPSPPPP-PPPSPPPPPPPSPPPPSPPPPSPPPP-SPPPPSPPPP-SPPP 539

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPP    P    PS P
Sbjct: 540 PPPPSPPPPSPPPPSPP 556

 Score =  112 bits (281), Expect = 1e-23
 Identities = 49/78 (62%), Positives = 49/78 (62%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     PPP PPPP PP  PPPP P P PP PPPP PPP  PPPP PPPP  PPP  
Sbjct: 369 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 428

Query: 322 PPPPRS*PPPPPPPRLVP 375
           PPPP   PPPPPPP   P
Sbjct: 429 PPPPPPSPPPPPPPSPPP 446

 Score =  112 bits (281), Expect = 1e-23
 Identities = 51/80 (63%), Positives = 51/80 (63%), Gaps = 3/80 (3%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS 339
           PPPPPPP  PPP PPPP PPP    PP PPPP PPP  PPPP PP P  PPPP PPPP  
Sbjct: 390 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 449

Query: 340 *PPPPPPPRLVP*TLAPSGP 399
             PPPPPP   P    PS P
Sbjct: 450 PSPPPPPPPSPPPPPPPSPP 469

 Score =  112 bits (280), Expect = 1e-23
 Identities = 53/81 (65%), Positives = 53/81 (65%), Gaps = 4/81 (4%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPY--PPPP*LPPPP*PPPPRS* 342
           PPPP PPP PPP PPPP PPP PP PPPP PPP  PPPP   PPPP  PPPP PPPP   
Sbjct: 268 PPPPSPPPPPPPSPPPP-PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 326

Query: 343 P--PPPPPPRLVP*TLAPSGP 399
           P  PPPPPP   P    PS P
Sbjct: 327 PPSPPPPPPPSPPPPPPPSPP 347

 Score =  112 bits (280), Expect = 1e-23
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP PPP  PPP PP P PP P P PPPPP PPPP  P PP 
Sbjct: 294 PPSP-----PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 348

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 349 PPPPSPPPPSPPPPSPPPPSPPPPSP 374

 Score =  112 bits (280), Expect = 1e-23
 Identities = 53/88 (60%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PP--PPPYPPPP*LPPP 315
           P SP     PPP PPPP PPP  PPP PPP PP PPPP PPP PP  PPP  PPP  PPP
Sbjct: 312 PPSP-----PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 366

Query: 316 P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P PPPP   PPPPP P   P    P  P
Sbjct: 367 PSPPPPSPPPPPPPSPPPPPPPSPPPPP 394

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/89 (60%), Positives = 54/89 (60%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPP-PPRPPPRPPPP*PPPLPPYPPPPRPPP*PP--PPPYPPPP*LPP 312
           P SP     PPPPPP PP PPP  PPP PPP PP PPPP PPP PP  PPP  PPP  PP
Sbjct: 420 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 479

Query: 313 PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP PPPP   PPPPP P   P    P  P
Sbjct: 480 PPSPPPPSPPPPPPPSPPPPPPPSPPPPP 508

 Score =  112 bits (279), Expect = 2e-23
 Identities = 52/89 (58%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP*LPP 312
           P  P     PPPP PPP PPP PPPP PPP    PP PPPP PPP  PPPP PPPP  P 
Sbjct: 376 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 435

Query: 313 PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP PPPP   PPPPP P   P    P  P
Sbjct: 436 PPPPPPPSPPPPPPPSPPPPPPPSPPPPP 464

 Score =  111 bits (278), Expect = 2e-23
 Identities = 53/78 (67%), Positives = 53/78 (67%), Gaps = 4/78 (5%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPP--PPRPPPRPPPP*PP-PLPPYPPPPRPPP*PPPPPYPPPP*LPP 312
           P SP     PPPPPP  PP PPP PPPP PP P PP PPPP PPP  PPPP PPPP  PP
Sbjct: 480 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 539

Query: 313 PP*P-PPPRS*PPPPPPP 363
           PP P PPP S PPP PPP
Sbjct: 540 PPPPSPPPPSPPPPSPPP 557

 Score =  111 bits (277), Expect = 3e-23
 Identities = 52/86 (60%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     PPP PPPP PPP  PPP PPP PP P PP P P PPPPP PPPP  PP P 
Sbjct: 232 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP-PPPSPP 290

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP S PPP PPP   P    PS P
Sbjct: 291 PPPPPSPPPPSPPPPSPPPPPPPSPP 316

 Score =  111 bits (277), Expect = 3e-23
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP  PP P  PPPP P P PPPPP PPPP  PPP  
Sbjct: 395 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP--PPPSP 452

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PPPPPPP   P +  P  P
Sbjct: 453 PPPPPPSPPPPPPPSPPPPSPPPPSP 478

 Score =  110 bits (276), Expect = 4e-23
 Identities = 55/90 (61%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPR-PPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYP-PPP*LPPP 315
           P  P     PPP PPPP  PPP PPPP PPP PP  PPP PPP PPPPP P PPP  PPP
Sbjct: 302 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 361

Query: 316 P*PPPPRS*P--PPPPPPRLVP*TLAPSGP 399
           P PPPP   P  PPPPPP   P    PS P
Sbjct: 362 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 391

 Score =  110 bits (276), Expect = 4e-23
 Identities = 52/87 (59%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPP-RPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P SP     PPP PPPP PPP  PPPP PPP PP  PPP PPP PPPPP P PP  PPP 
Sbjct: 400 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 459

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPPP   PPPP PP   P   +P  P
Sbjct: 460 PPPPPPPSPPPPSPPPPSPPPPSPPPP 486

 Score =  110 bits (274), Expect = 6e-23
 Identities = 50/80 (62%), Positives = 50/80 (62%), Gaps = 2/80 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPP--RPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP 315
           P SP     PPP PPPP PPP   PPP  PPP PP PPPP PPP  PPPP PPPP  P P
Sbjct: 204 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSP 263

Query: 316 P*PPPPRS*PPPPPPPRLVP 375
           P P PP   PPPPPPP   P
Sbjct: 264 PPPSPPPPSPPPPPPPSPPP 283

 Score =  109 bits (273), Expect = 8e-23
 Identities = 52/85 (61%), Positives = 54/85 (63%), Gaps = 1/85 (1%)
 Frame = +1

Query: 148 SPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*P- 324
           +P +   PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP P 
Sbjct: 186 TPGIPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 244

Query: 325 PPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPP S PPP PPP   P    PS P
Sbjct: 245 PPPPSPPPPSPPPPPPPSPPPPSPP 269

 Score =  109 bits (273), Expect = 8e-23
 Identities = 54/89 (60%), Positives = 54/89 (60%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*--PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP 315
           P SP     PPP PPPP PPP  PPP   PPP PP P PP P P PPPPP PPPP  PPP
Sbjct: 194 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253

Query: 316 -P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            P PPPP S PPP PPP   P    PS P
Sbjct: 254 SPPPPPPPSPPPPSPPPPSPPPPPPPSPP 282

 Score =  108 bits (271), Expect = 1e-22
 Identities = 49/86 (56%), Positives = 50/86 (58%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     PPP PPPP PP  PPP  PPP PP P PP P P PPPPP PPPP  P PP 
Sbjct: 447 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 506

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 507 PPPPSPPPPSPPPPSPPPPSPPPPSP 532

 Score =  107 bits (268), Expect = 3e-22
 Identities = 54/91 (59%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 142 PDSPQL*QLPPP-PPP--PPRPPPRPPPP*PPPLPPYPPPPRPPP--*PPPPPYPPPP*L 306
           P SP     PPP PPP  PP PPP PPP  PPP PP PPPP PPP   PPPPP  PPP  
Sbjct: 260 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPS 319

Query: 307 PPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP PPPP   PPPPP P   P    P  P
Sbjct: 320 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 350

 Score =  107 bits (267), Expect = 4e-22
 Identities = 48/74 (64%), Positives = 48/74 (64%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPPPPP P PPP P PP P P PP PPPP PPP  PPPP PPP   PPPP 
Sbjct: 493 PPSP-----PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PPPPS 544

Query: 322 PPPPRS*PPPPPPP 363
           PPPP   PP PPPP
Sbjct: 545 PPPPSPPPPSPPPP 558

 Score =  105 bits (263), Expect = 1e-21
 Identities = 54/95 (56%), Positives = 54/95 (56%), Gaps = 9/95 (9%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*--PPPLPPYP-PPPRPPP*PPPP------PYPP 294
           P SP     PPP PPPP PPP  PPP   PPP PP P PPP PPP PPPP      P PP
Sbjct: 199 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258

Query: 295 PP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP  PPPP PPPP   PPPPP P   P    P  P
Sbjct: 259 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 293

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 40/66 (60%), Positives = 40/66 (60%)
 Frame = +1

Query: 202 PRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*T 381
           P   P  P P PP PPPP PPP  PPPP PPPP  PPPP PPPP S PPP PPP   P  
Sbjct: 183 PISTPGIPSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPSPPPP-SPPPPSPPPPSPPPP 240

Query: 382 LAPSGP 399
             PS P
Sbjct: 241 PPPSPP 246

[46][TOP]
>UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S9_EHV86
          Length = 621

 Score =  117 bits (292), Expect = 5e-25
 Identities = 54/89 (60%), Positives = 55/89 (61%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP*LPP 312
           P SP     PPPPPPP  PPP PPPP PPP    PP PPPP PPP  PPPP PPPP  PP
Sbjct: 251 PPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 310

Query: 313 PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P  PPPP S PP PPPP   P +  P  P
Sbjct: 311 PSPPPPPPSPPPSPPPPSPPPPSPPPPSP 339

 Score =  115 bits (287), Expect = 2e-24
 Identities = 53/86 (61%), Positives = 54/86 (62%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP P PP PPP PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 131 PPSPPPPSPPPPSPPPPSPPPPPSPP-PPPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPS 188

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 189 PPPPSPPPPSPPPPSPPPPSPPPPSP 214

 Score =  115 bits (287), Expect = 2e-24
 Identities = 57/91 (62%), Positives = 57/91 (62%), Gaps = 5/91 (5%)
 Frame = +1

Query: 142 PDSPQL*QLPPP--PPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP*L 306
           P SP     PPP  PPPPP PPP PPPP PPP    PP PPPP PPP  PPPP PPPP  
Sbjct: 356 PPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 415

Query: 307 PPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP PPPP S PPP PPP   P    PS P
Sbjct: 416 PPPPSPPPP-SPPPPSPPPPSPPSPPPPSPP 445

 Score =  114 bits (286), Expect = 3e-24
 Identities = 55/90 (61%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPP-RPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP*LP 309
           P SP     PPPPPPPP PPP  PPPP PPP    PP PPPP PPP  PPPP PPPP  P
Sbjct: 146 PPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP-SP 204

Query: 310 PPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPP PPPP   PP PPPP   P +  P  P
Sbjct: 205 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 234

 Score =  114 bits (286), Expect = 3e-24
 Identities = 54/90 (60%), Positives = 54/90 (60%), Gaps = 4/90 (4%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYP----PPP*LP 309
           P SP     PPP PPPP PPP PP P P P PP PPPP PPP  PPPP P    PPP  P
Sbjct: 351 PPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 410

Query: 310 PPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPP PPPP S PPP PPP   P    PS P
Sbjct: 411 PPPSPPPPPSPPPPSPPPPSPPPPSPPSPP 440

 Score =  114 bits (285), Expect = 3e-24
 Identities = 55/90 (61%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = +1

Query: 142 PDSPQL*QLPPP-PPPPPRPPPRPPPP*PP---PLPPYPPPPRPPP*PPPPPYPPPP*LP 309
           P SP     PPP PPPPP PPP PPPP PP   P PP PPPP PPP  PPPP PPPP  P
Sbjct: 136 PPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP-SP 194

Query: 310 PPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPP PPPP   PP PPPP   P +  P  P
Sbjct: 195 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 224

 Score =  114 bits (285), Expect = 3e-24
 Identities = 55/90 (61%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = +1

Query: 142 PDSPQL*QLPPPP-PPPPRPPPRPPPP*PP---PLPPYPPPPRPPP*PPPPPYPPPP*LP 309
           P SP     PPPP PPPP PPP PPPP PP   P PP PPPP PPP  PPPP PPPP  P
Sbjct: 141 PPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP-SP 199

Query: 310 PPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPP PPPP   PP PPPP   P +  P  P
Sbjct: 200 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 229

 Score =  114 bits (285), Expect = 3e-24
 Identities = 52/86 (60%), Positives = 53/86 (61%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP PP  PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 290 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPP-SPPPPS 348

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 349 PPPPSPPPPSPPPPSPPPPSPPPPPP 374

 Score =  113 bits (283), Expect = 6e-24
 Identities = 55/96 (57%), Positives = 56/96 (58%), Gaps = 10/96 (10%)
 Frame = +1

Query: 142 PDSPQL*QLPPP--PPPPPRPPPRPPPP*PPPL--------PPYPPPPRPPP*PPPPPYP 291
           P SP     PPP  PPPPP PPP PPPP PPP         PP PPPP PPP  PPPP P
Sbjct: 300 PPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 359

Query: 292 PPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPP  PPP  PPPP S PP PPPP   P +  P  P
Sbjct: 360 PPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSP 395

 Score =  113 bits (283), Expect = 6e-24
 Identities = 53/87 (60%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP PP  PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 346 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPP-SPPPPS 404

Query: 322 PPPPRS*PP-PPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPPP   P +  P  P
Sbjct: 405 PPPPSPPPPSPPPPPSPPPPSPPPPSP 431

 Score =  113 bits (282), Expect = 7e-24
 Identities = 52/88 (59%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYP--PPP*LPPP 315
           P SP     PPP PPPP PPP  PPP  PP PP PPPP PPP  PPPP P  PPP  PPP
Sbjct: 387 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPP 446

Query: 316 P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P PPPP   PP PPPP   P +  P  P
Sbjct: 447 PSPPPPSPPPPSPPPPSPPPPSPPPPSP 474

 Score =  112 bits (281), Expect = 1e-23
 Identities = 54/86 (62%), Positives = 55/86 (63%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 196 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPS 253

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP S PPPPPPP   P +  P  P
Sbjct: 254 PPPP-SPPPPPPPPSPPPPSPPPPSP 278

 Score =  112 bits (280), Expect = 1e-23
 Identities = 53/86 (61%), Positives = 53/86 (61%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 186 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPS 243

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P    PS P
Sbjct: 244 PPPPSPPPPSPPPPSPPPPPPPPSPP 269

 Score =  112 bits (280), Expect = 1e-23
 Identities = 52/86 (60%), Positives = 53/86 (61%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 211 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPP--PPPPS 267

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 268 PPPPSPPPPSPPPPSPPPPSPPPPSP 293

 Score =  112 bits (280), Expect = 1e-23
 Identities = 51/78 (65%), Positives = 51/78 (65%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP PPPP PPP  P PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 241 PPSPPPPSPPPPSPPPPSPPPPPPPPSPPP--PSPPPPSPPPPSPPPPSPPPP-SPPPPS 297

Query: 322 PPPPRS*PPPPPPPRLVP 375
           PPPP   PP PPPP   P
Sbjct: 298 PPPPSPPPPSPPPPSPPP 315

 Score =  112 bits (279), Expect = 2e-23
 Identities = 52/86 (60%), Positives = 53/86 (61%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 161 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPS 218

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 219 PPPPSPPPPSPPPPSPPPPSPPPPSP 244

 Score =  112 bits (279), Expect = 2e-23
 Identities = 52/86 (60%), Positives = 53/86 (61%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 166 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPS 223

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 224 PPPPSPPPPSPPPPSPPPPSPPPPSP 249

 Score =  112 bits (279), Expect = 2e-23
 Identities = 52/86 (60%), Positives = 53/86 (61%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 171 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPS 228

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 229 PPPPSPPPPSPPPPSPPPPSPPPPSP 254

 Score =  112 bits (279), Expect = 2e-23
 Identities = 52/86 (60%), Positives = 53/86 (61%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 176 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPS 233

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 234 PPPPSPPPPSPPPPSPPPPSPPPPSP 259

 Score =  112 bits (279), Expect = 2e-23
 Identities = 53/86 (61%), Positives = 54/86 (62%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP PPPPP PPPP  PPPP 
Sbjct: 221 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPP-PPPPPSPPPP-SPPPPS 277

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 278 PPPPSPPPPSPPPPSPPPPSPPPPSP 303

 Score =  112 bits (279), Expect = 2e-23
 Identities = 53/89 (59%), Positives = 54/89 (60%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPP---PRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPP 312
           P SP     PPP PPPP PP   P PP P PPP PP PPPP PPP  PPPP PPPP  PP
Sbjct: 231 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPP-SPP 289

Query: 313 PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP PPPP   PP PPPP   P +  P  P
Sbjct: 290 PPSPPPPSPPPPSPPPPSPPPPSPPPPPP 318

 Score =  112 bits (279), Expect = 2e-23
 Identities = 52/89 (58%), Positives = 53/89 (59%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP*LPP 312
           P SP     PP PPPP  PPP PPPP PPP    PP PPPP PPP  PPPP PPPP   P
Sbjct: 317 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSP 376

Query: 313 PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP PPPP   PP PPPP   P +  P  P
Sbjct: 377 PPSPPPPSPPPPSPPPPSPPPPSPPPPSP 405

 Score =  112 bits (279), Expect = 2e-23
 Identities = 52/86 (60%), Positives = 53/86 (61%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 436 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPS 493

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 494 PPPPSPPPPSPPPPSPPPPSPPPPSP 519

 Score =  111 bits (278), Expect = 2e-23
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP   PPP 
Sbjct: 265 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPS 323

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 324 PPPPSPPPPSPPPPSPPPPSPPPPSP 349

 Score =  111 bits (278), Expect = 2e-23
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP P PP  PPPP 
Sbjct: 270 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPS 328

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 329 PPPPSPPPPSPPPPSPPPPSPPPPSP 354

 Score =  111 bits (278), Expect = 2e-23
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP PP PP  PPP  PPPP 
Sbjct: 275 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPS 333

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 334 PPPPSPPPPSPPPPSPPPPSPPPPSP 359

 Score =  111 bits (278), Expect = 2e-23
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP  PP PP  PPP PPP  PPPP PPPP  PPPP 
Sbjct: 285 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPP-SPPPPS 343

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 344 PPPPSPPPPSPPPPSPPPPSPPPPSP 369

 Score =  111 bits (278), Expect = 2e-23
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP P PP  PPPP 
Sbjct: 326 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPS 384

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 385 PPPPSPPPPSPPPPSPPPPSPPPPSP 410

 Score =  111 bits (278), Expect = 2e-23
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP PP PP  PPP  PPPP 
Sbjct: 331 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPS 389

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 390 PPPPSPPPPSPPPPSPPPPSPPPPSP 415

 Score =  111 bits (278), Expect = 2e-23
 Identities = 54/89 (60%), Positives = 55/89 (61%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPR--PPPRPPPP*PP-PLPPYPPPPRPPP*PPPPPYPPPP*LPP 312
           P SP     PPPP PPP   PPP PPPP PP P PP PPPP PPP  PPPP PPPP  PP
Sbjct: 407 PPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPP-SPP 465

Query: 313 PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP PPPP   PP PPPP   P +  P  P
Sbjct: 466 PPSPPPPSPPPPSPPPPSPPPPSPPPPSP 494

 Score =  111 bits (277), Expect = 3e-23
 Identities = 50/80 (62%), Positives = 52/80 (65%), Gaps = 3/80 (3%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PP---PLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS 339
           PPP PPP +PPP PPPP PP   P PP PPPP PPP PP PP PPPP  PPPP PPPP  
Sbjct: 116 PPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPP-PPSPPPPPPPPSPPPPSPPPPSP 174

Query: 340 *PPPPPPPRLVP*TLAPSGP 399
            PP PPPP   P +  P  P
Sbjct: 175 PPPSPPPPSPPPPSPPPPSP 194

 Score =  111 bits (277), Expect = 3e-23
 Identities = 52/86 (60%), Positives = 53/86 (61%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 181 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPS 238

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P +  P  P
Sbjct: 239 PPPPSPPPPSPPPPSPPPPSPPPPPP 264

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 367 PSPPPPPPSPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPS 425

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PPPP PP   P +  P  P
Sbjct: 426 PPPPS--PPPPSPPSPPPPSPPPPSP 449

 Score =  110 bits (275), Expect = 5e-23
 Identities = 54/94 (57%), Positives = 55/94 (58%), Gaps = 8/94 (8%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPP--RPPPP------*PPPLPPYPPPPRPPP*PPPPPYPPP 297
           P SP     PPP PPPP PPP   PPPP       PPP PP PPPP PPP  PPPP PPP
Sbjct: 397 PPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPP 456

Query: 298 P*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P  PPPP PPPP   PP PPPP   P +  P  P
Sbjct: 457 P-SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 489

 Score =  110 bits (275), Expect = 5e-23
 Identities = 50/80 (62%), Positives = 51/80 (63%), Gaps = 3/80 (3%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS 339
           PPPP PPP  PP PPPP PPP    PP PPPP PPP  PPPP PPPP  PPPP PPPP  
Sbjct: 426 PPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPSPPPPSP 484

Query: 340 *PPPPPPPRLVP*TLAPSGP 399
            PP PPPP   P +  P  P
Sbjct: 485 PPPSPPPPSPPPPSPPPPSP 504

 Score =  110 bits (275), Expect = 5e-23
 Identities = 50/80 (62%), Positives = 51/80 (63%), Gaps = 3/80 (3%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS 339
           PPPP PP  PPP PPPP PPP    PP PPPP PPP  PPPP PPPP  PPPP PPPP  
Sbjct: 431 PPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPSPPPPSP 489

Query: 340 *PPPPPPPRLVP*TLAPSGP 399
            PP PPPP   P +  P  P
Sbjct: 490 PPPSPPPPSPPPPSPPPPSP 509

 Score =  110 bits (274), Expect = 6e-23
 Identities = 53/86 (61%), Positives = 54/86 (62%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 451 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPS 508

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PPPP PP   P +  PS P
Sbjct: 509 PPPPS--PPPPSPPPSPPPSHPPSHP 532

 Score =  109 bits (273), Expect = 8e-23
 Identities = 52/86 (60%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP  PP PP  PPP PPP  PPPP PPPP  PPPP 
Sbjct: 341 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPP-SPPPPS 399

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P    PS P
Sbjct: 400 PPPPSPPPPSPPPPSPPP---PPSPP 422

 Score =  109 bits (273), Expect = 8e-23
 Identities = 51/88 (57%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPP--P*LPPP 315
           P SP     PPP PPPP PPP  PPP  PP P  PPPP PPP  PPPP PPP  P  PPP
Sbjct: 382 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPP 441

Query: 316 P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P PPPP   PP PPPP   P +  P  P
Sbjct: 442 PSPPPPSPPPPSPPPPSPPPPSPPPPSP 469

 Score =  109 bits (273), Expect = 8e-23
 Identities = 51/88 (57%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP--*PPPPPYPPPP*LPPP 315
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP   P PPP  PPP  PPP
Sbjct: 392 PPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPP 451

Query: 316 P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P PPPP   PP PPPP   P +  P  P
Sbjct: 452 PSPPPPSPPPPSPPPPSPPPPSPPPPSP 479

 Score =  109 bits (272), Expect = 1e-22
 Identities = 52/93 (55%), Positives = 53/93 (56%), Gaps = 7/93 (7%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPP-------LPPYPPPPRPPP*PPPPPYPPPP 300
           P SP   Q PP PPPP  PPP PPPP PPP        PP PPPP  PP P PPP  PPP
Sbjct: 117 PPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPP 176

Query: 301 *LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             PPPP PPPP   PP PPPP   P +  P  P
Sbjct: 177 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 209

 Score =  109 bits (272), Expect = 1e-22
 Identities = 51/88 (57%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*--PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP 315
           P SP     PPP PPPP PPP  PPP   PPP PP PPPP  PP P PPP  PPP  PPP
Sbjct: 226 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPP 285

Query: 316 P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P PPPP   PP PPPP   P +  P  P
Sbjct: 286 PSPPPPSPPPPSPPPPSPPPPSPPPPSP 313

 Score =  109 bits (272), Expect = 1e-22
 Identities = 52/89 (58%), Positives = 53/89 (59%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PP---PLPPYPPPPRPPP*PPPPPYPPPP*LPP 312
           P SP     PPPP PPP  PP P PP PP   P PP PPPP PPP  PPPP PPPP  PP
Sbjct: 412 PPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP-SPP 470

Query: 313 PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP PPPP   PP PPPP   P +  P  P
Sbjct: 471 PPSPPPPSPPPPSPPPPSPPPPSPPPPSP 499

 Score =  108 bits (270), Expect = 2e-22
 Identities = 54/92 (58%), Positives = 55/92 (59%), Gaps = 6/92 (6%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PP---PLPPYPPPPRPPP*P-PPPPYPPPP*LP 309
           P SP     PP PPPP  PPP PPPP PP   P PP PPPP PPP P PPPP PPPP  P
Sbjct: 373 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPP 432

Query: 310 P--PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P  PP PPPP   PP PPPP   P +  P  P
Sbjct: 433 PPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 464

 Score =  107 bits (267), Expect = 4e-22
 Identities = 52/82 (63%), Positives = 53/82 (64%), Gaps = 5/82 (6%)
 Frame = +1

Query: 169 PPPPPP-PPRPPPRPPPP*PP---PLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPR 336
           PPPP P PP PPP PPPP PP   P PP PPPP PPP  PPPP PPPP  PPPP PPPP 
Sbjct: 249 PPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPSPPPPS 307

Query: 337 S*PP-PPPPPRLVP*TLAPSGP 399
             PP PPPPP   P +  P  P
Sbjct: 308 PPPPSPPPPPPSPPPSPPPPSP 329

 Score =  107 bits (266), Expect = 5e-22
 Identities = 53/92 (57%), Positives = 54/92 (58%), Gaps = 6/92 (6%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPP---RPPPRPPPP*PP---PLPPYPPPPRPPP*PPPPPYPPPP* 303
           P  P      PPPP PP    PPP PPPP PP   P PP PPPP PPP  PPPP PPPP 
Sbjct: 434 PSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP- 492

Query: 304 LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPPP PPPP   PP PPPP   P +  PS P
Sbjct: 493 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPP 524

 Score =  102 bits (255), Expect = 1e-20
 Identities = 47/81 (58%), Positives = 50/81 (61%), Gaps = 3/81 (3%)
 Frame = +1

Query: 166 LPPPPPPPPRPPPRPPPP*PPPLPP---YPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPR 336
           +PP  PPP  PP +PPP  PPP PP    PPP  PPP PPPPP PPPP  PPPP PPPP 
Sbjct: 111 IPPTTPPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPP--PPPPSPPPPS 168

Query: 337 S*PPPPPPPRLVP*TLAPSGP 399
             PP PPPP   P +  P  P
Sbjct: 169 PPPPSPPPPSPPPPSPPPPSP 189

 Score =  102 bits (253), Expect = 2e-20
 Identities = 54/101 (53%), Positives = 60/101 (59%), Gaps = 3/101 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP-P 318
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPP P
Sbjct: 461 PPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 519

Query: 319 *PPPPRS*PPPPPP--PRLVP*TLAPSGPVTLTALDRPSLS 435
            P PP S PP  PP  P + P  L P+   T T L++  ++
Sbjct: 520 PPSPPPSHPPSHPPMHPPMHPPFLPPT---TSTGLNKTQIT 557

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 33/65 (50%), Positives = 34/65 (52%), Gaps = 12/65 (18%)
 Frame = +1

Query: 241 YPPPPRPPP*PP------------PPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TL 384
           Y PP  PPP PP            PPP  PPP  PPPP PPPP S PPPPPPP   P + 
Sbjct: 110 YIPPTTPPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSP 169

Query: 385 APSGP 399
            P  P
Sbjct: 170 PPPSP 174

[47][TOP]
>UniRef100_Q6YNS1 Putative glycine-rich RNA-binding protein n=1 Tax=Prunus avium
           RepID=Q6YNS1_PRUAV
          Length = 178

 Score =  117 bits (292), Expect = 5e-25
 Identities = 63/101 (62%), Positives = 67/101 (66%), Gaps = 5/101 (4%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGG-GGGYERGGGG--YGGGGSYGGGGY--GGGGGYG 264
           DGR+  VN      A  +G+  GGGG GGGY RGGGG  YGGGG YGGGG   GGGGGY 
Sbjct: 75  DGRNITVNE-----AQSRGSGGGGGGNGGGYSRGGGGGGYGGGGGYGGGGRREGGGGGYS 129

Query: 263 GGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            G GGGGYG  GGGYGGGGR  G  GGG GGG+ YS G  G
Sbjct: 130 RGGGGGGYGSGGGGYGGGGRREGGYGGGEGGGARYSRGSGG 170

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 39/59 (66%), Positives = 40/59 (67%), Gaps = 5/59 (8%)
 Frame = -3

Query: 299 GGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGR--GGGRG---GGGGGGGSCYSCGESGH 138
           GGGG G GGGY  G GGGGYGG GGGYGGGGR  GGG G   GGGGGG   Y  G  G+
Sbjct: 90  GGGGGGNGGGYSRGGGGGGYGG-GGGYGGGGRREGGGGGYSRGGGGGG---YGSGGGGY 144

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 44/71 (61%), Positives = 44/71 (61%), Gaps = 6/71 (8%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGG----GGYGGGRGGGG--YG 237
           G  G    G RR  GGGGGY RGGGG GG GS GGGGYGGG    GGYGGG GGG     
Sbjct: 110 GGGGGYGGGGRRE-GGGGGYSRGGGG-GGYGS-GGGGYGGGGRREGGYGGGEGGGARYSR 166

Query: 236 GSGGGYGGGGR 204
           GSGG  GG  R
Sbjct: 167 GSGGSEGGSWR 177

[48][TOP]
>UniRef100_A8HQ72 SR protein factor n=1 Tax=Chlamydomonas reinhardtii
           RepID=A8HQ72_CHLRE
          Length = 338

 Score =  117 bits (292), Expect = 5e-25
 Identities = 65/107 (60%), Positives = 67/107 (62%), Gaps = 14/107 (13%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTR---------RGG--GGGGGYERGGGGYGGGGSY--GGGG 288
           D R  A  V G DG   QG R         RGG  GGGGG+  GGGG+GGGG    GGGG
Sbjct: 51  DERDAADAVRGRDGIEFQGQRLRVEVSHGRRGGAGGGGGGFGGGGGGFGGGGGGYGGGGG 110

Query: 287 YGGGGGYGGGRGGGGYGGSGGGYGGGGRG-GGRGGGGGGGGSCYSCG 150
           YGGGGG G G GGGGYGG GGGYGGGG G GG GGG GGGG   S G
Sbjct: 111 YGGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGSGGGGGGRSLG 157

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 32/65 (49%), Positives = 33/65 (50%), Gaps = 9/65 (13%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSY---------GGGGYGGGGGYGGGRGGG 246
           G  G    G   GGGGGGGY  GGGGYGGGG           GGGG  GGGG G   G  
Sbjct: 100 GGGGGYGGGGGYGGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGSGGGGGGRSLGPN 159

Query: 245 GYGGS 231
            +G S
Sbjct: 160 PFGPS 164

[49][TOP]
>UniRef100_B7PE98 Glycine rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PE98_IXOSC
          Length = 156

 Score =  117 bits (292), Expect = 5e-25
 Identities = 56/81 (69%), Positives = 57/81 (70%)
 Frame = -3

Query: 383 NVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGR 204
           N+QG   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG 
Sbjct: 32  NIQGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91

Query: 203 GGGRGGGGGGGGSCYSCGESG 141
           GGG GGGGGGGG     G  G
Sbjct: 92  GGGGGGGGGGGGGGGGGGGGG 112

 Score =  115 bits (289), Expect = 1e-24
 Identities = 57/92 (61%), Positives = 59/92 (64%)
 Frame = -3

Query: 416 KAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYG 237
           +  N+ G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG G
Sbjct: 29  RCYNIQGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88

Query: 236 GSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 89  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120

 Score =  114 bits (284), Expect = 4e-24
 Identities = 55/88 (62%), Positives = 58/88 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 67  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 126

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESGHF 135
           GGGG GGG GGGGGGGG  +   +  H+
Sbjct: 127 GGGGGGGGGGGGGGGGGERFKNYKRNHY 154

 Score =  113 bits (282), Expect = 8e-24
 Identities = 57/88 (64%), Positives = 57/88 (64%)
 Frame = -3

Query: 404 VTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           V G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GG
Sbjct: 36  VGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGGG GGG GGGGGGGG     G  G
Sbjct: 96  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 123

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/84 (66%), Positives = 56/84 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 61  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGE 147
           GGGG GGG GGGGGGGG     GE
Sbjct: 121 GGGGGGGGGGGGGGGGGGGGGGGE 144

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 39  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 99  GGGGGGGGGGGGGGGGGGGGGGGGGG 124

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 40  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGGGGGG 125

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 41  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 101 GGGGGGGGGGGGGGGGGGGGGGGGGG 126

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 42  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGG 127

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 43  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 103 GGGGGGGGGGGGGGGGGGGGGGGGGG 128

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 44  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGGGGGG 129

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 45  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 105 GGGGGGGGGGGGGGGGGGGGGGGGGG 130

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 46  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 105

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 106 GGGGGGGGGGGGGGGGGGGGGGGGGG 131

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 47  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 106

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 107 GGGGGGGGGGGGGGGGGGGGGGGGGG 132

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 48  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 108 GGGGGGGGGGGGGGGGGGGGGGGGGG 133

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 49  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGGGG 134

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 50  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 110 GGGGGGGGGGGGGGGGGGGGGGGGGG 135

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 51  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGG 136

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 52  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGG 137

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 53  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGG 138

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 54  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGG 139

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 55  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGG 140

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 56  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGG 141

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 57  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 117 GGGGGGGGGGGGGGGGGGGGGGGGGG 142

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 58  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 118 GGGGGGGGGGGGGGGGGGGGGGGGGG 143

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 40/66 (60%), Positives = 40/66 (60%)
 Frame = -3

Query: 338 ERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCY 159
           E  G  Y      G GG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG   
Sbjct: 22  EGAGKKYRCYNIQGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81

Query: 158 SCGESG 141
             G  G
Sbjct: 82  GGGGGG 87

[50][TOP]
>UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1
           Tax=Vitis vinifera RepID=UPI0001982DE4
          Length = 569

 Score =  116 bits (291), Expect = 7e-25
 Identities = 49/74 (66%), Positives = 50/74 (67%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P+    PPP PPPP PP  PPPP PPP PP  PPP P P PPPPP PPPP  PPPP 
Sbjct: 125 PPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPP 184

Query: 322 PPPPRS*PPPPPPP 363
           PPPP   PPPPPPP
Sbjct: 185 PPPPPPPPPPPPPP 198

 Score =  114 bits (285), Expect = 3e-24
 Identities = 47/65 (72%), Positives = 47/65 (72%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPP  PPP  PPP PPP PP PP P PPP P PPP PPPP  PPPP PPPP   PP
Sbjct: 138 PPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 197

Query: 349 PPPPP 363
           PPPPP
Sbjct: 198 PPPPP 202

 Score =  111 bits (277), Expect = 3e-23
 Identities = 52/86 (60%), Positives = 52/86 (60%), Gaps = 4/86 (4%)
 Frame = +1

Query: 169 PPPPP----PPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPR 336
           PPPPP    PPP PP  PPPP P P PP  PPP PPP PPPPP PPPP  P PP PPPP 
Sbjct: 122 PPPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPP 181

Query: 337 S*PPPPPPPRLVP*TLAPSGPVTLTA 414
             PPPPPPP   P    P  PV   A
Sbjct: 182 PPPPPPPPPPPPPPPPPPPPPVDRNA 207

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 44/66 (66%), Positives = 45/66 (68%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     PPPPPP P PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP 
Sbjct: 144 PSPPPPPSPPPPPPPSPPPPPSPPPP-PPPSPPPPPPPPPPPPPPPPPPPPPP--PPPPP 200

Query: 322 PPPPRS 339
           PP  R+
Sbjct: 201 PPVDRN 206

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 46/84 (54%), Positives = 46/84 (54%), Gaps = 7/84 (8%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPP-------P*PPPPPYPPPP*LPPPP*PP 327
           PPP      PPP P P  PPP PP PPPP PP       P PPPPP PPPP  PPPP PP
Sbjct: 113 PPPEYEEGCPPPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPP 172

Query: 328 PPRS*PPPPPPPRLVP*TLAPSGP 399
            P   PPPPPPP   P    P  P
Sbjct: 173 SPPPPPPPPPPPPPPPPPPPPPPP 196

[51][TOP]
>UniRef100_UPI000155382B PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI000155382B
          Length = 492

 Score =  116 bits (291), Expect = 7e-25
 Identities = 57/86 (66%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 146 GGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGGRGGG GGGGGGGG     G  G
Sbjct: 206 GGGGRGGGGGGGGGGGGGGDGGGRGG 231

 Score =  116 bits (290), Expect = 9e-25
 Identities = 59/95 (62%), Positives = 59/95 (62%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           GR       G  G    G  RGGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGG
Sbjct: 209 GRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGG 268

Query: 245 GYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 269 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 303

 Score =  115 bits (288), Expect = 2e-24
 Identities = 59/98 (60%), Positives = 59/98 (60%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR 255
           D  GR       G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG 
Sbjct: 225 DGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 284

Query: 254 GGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 285 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 322

 Score =  115 bits (287), Expect = 2e-24
 Identities = 57/86 (66%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G DG    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 223 GGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 282

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 283 GGGGGGGGGGGGGGGGGGGGGGGGGG 308

 Score =  115 bits (287), Expect = 2e-24
 Identities = 57/86 (66%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G DG    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 242 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 301

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 302 GGGGGGGGGGGGGGGGGGGGGGGGGG 327

 Score =  114 bits (285), Expect = 3e-24
 Identities = 58/88 (65%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG--GYGGSGG 225
           G  G  V G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGG  G GG GG
Sbjct: 159 GGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 218

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGGG GGGRGGGGGGGG     G+ G
Sbjct: 219 GGGGGGDGGGRGGGGGGGGGGGGGGDGG 246

 Score =  114 bits (285), Expect = 3e-24
 Identities = 56/86 (65%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG + GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 224 GDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 283

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 284 GGGGGGGGGGGGGGGGGGGGGGGGGG 309

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/86 (66%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 263 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 322

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G SG
Sbjct: 323 GGGGGGGGGGGGGGGGGGGGGGGGSG 348

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/86 (66%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 267 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 326

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG   S G  G
Sbjct: 327 GGGGGGGGGGGGGGGGGGGGSGGGGG 352

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/86 (66%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 270 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 329

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGGS    G  G
Sbjct: 330 GGGGGGGGGGGGGGGGGSGGGGGGGG 355

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/86 (66%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GGSGGG 
Sbjct: 292 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGG 351

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 352 GGGGGGGGGGGGGGGGGGGGGGGGGG 377

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/86 (66%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGGS GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 316 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGG 375

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 376 GGGGGGGGGGGGGGGGGGGGGGGGGG 401

 Score =  113 bits (283), Expect = 6e-24
 Identities = 56/86 (65%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G+  GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 338 GGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 397

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 398 GGGGGGGGGGGGGGGGGGGGGGGGGG 423

 Score =  113 bits (282), Expect = 8e-24
 Identities = 56/86 (65%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   G GG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 201

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGGRGGGGGGGG     G+ G
Sbjct: 202 GGGGGGGGRGGGGGGGGGGGGGGDGG 227

 Score =  113 bits (282), Expect = 8e-24
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 264 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 323

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 324 GGGGGGGGGGGGGGGGGGGGGGGSGG 349

 Score =  113 bits (282), Expect = 8e-24
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 266 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 325

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 326 GGGGGGGGGGGGGGGGGGGGGSGGGG 351

 Score =  113 bits (282), Expect = 8e-24
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 269 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 328

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 329 GGGGGGGGGGGGGGGGGGSGGGGGGG 354

 Score =  113 bits (282), Expect = 8e-24
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 327 GGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 386

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 387 GGGGGGGGGGGGGGGGGGGGGGGGGG 412

 Score =  113 bits (282), Expect = 8e-24
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 340 GGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 399

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 400 GGGGGGGGGGGGGGGGGGGGGGGGGG 425

 Score =  112 bits (281), Expect = 1e-23
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 128 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGG 187

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GGGGGGGG
Sbjct: 188 GGGGGGGGGGGGGGGGG 204

 Score =  112 bits (281), Expect = 1e-23
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGG 192

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GGGGGGGG
Sbjct: 193 GGGGGGGGGGGGGGGGG 209

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G +  G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 239 GGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 298

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 299 GGGGGGGGGGGGGGGGGGGGGGGGGG 324

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 243 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 302

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 303 GGGGGGGGGGGGGGGGGGGGGGGGGG 328

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 268 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 327

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 328 GGGGGGGGGGGGGGGGGGGSGGGGGG 353

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 279 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 338

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 339 GGGGGGGGSGGGGGGGGGGGGGGGGG 364

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 283 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 342

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 343 GGGGSGGGGGGGGGGGGGGGGGGGGG 368

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 288 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGS 347

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 348 GGGGGGGGGGGGGGGGGGGGGGGGGG 373

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 295 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGG 354

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 355 GGGGGGGGGGGGGGGGGGGGGGGGGG 380

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 300 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGG 359

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 360 GGGGGGGGGGGGGGGGGGGGGGGGGG 385

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 304 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGG 363

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 364 GGGGGGGGGGGGGGGGGGGGGGGGGG 389

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 310 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGG 369

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 370 GGGGGGGGGGGGGGGGGGGGGGGGGG 395

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 315 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGG 374

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 375 GGGGGGGGGGGGGGGGGGGGGGGGGG 400

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 321 GGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 380

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 381 GGGGGGGGGGGGGGGGGGGGGGGGGG 406

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 326 GGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 385

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 386 GGGGGGGGGGGGGGGGGGGGGGGGGG 411

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 328 GGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 387

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 388 GGGGGGGGGGGGGGGGGGGGGGGGGG 413

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 336 GGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 395

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 396 GGGGGGGGGGGGGGGGGGGGGGGGGG 421

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 337 GGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 396

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 397 GGGGGGGGGGGGGGGGGGGGGGGGGG 422

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 341 GGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 400

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 401 GGGGGGGGGGGGGGGGGGGGGGGGGG 426

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G +  G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 342 GGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 401

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 402 GGGGGGGGGGGGGGGGGGGGGGGGGG 427

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G+   G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 343 GGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 402

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 403 GGGGGGGGGGGGGGGGGGGGGGGGGG 428

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 345 GGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 404

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 405 GGGGGGGGGGGGGGGGGGGGGGGGGG 430

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 346 GSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 405

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 406 GGGGGGGGGGGGGGGGGGGGGGGGGG 431

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/87 (64%), Positives = 57/87 (65%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           +G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG
Sbjct: 347 SGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 406

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGGG GGG GGGGGGGG     G  G
Sbjct: 407 GGGGGGGGGGGGGGGGGGGGGGGGGGG 433

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 88  GGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGG 147

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GGGGGGGG
Sbjct: 148 GGGGGGGGGGGGGGGGG 164

 Score =  112 bits (280), Expect = 1e-23
 Identities = 53/74 (71%), Positives = 53/74 (71%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 94  GGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGG 153

Query: 182 GGGGGSCYSCGESG 141
           GGGGG     G  G
Sbjct: 154 GGGGGGGGGGGVGG 167

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G  V G    GGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 113 GGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGG 172

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 173 GGGGGGGGGGGGGGGGGGGGGGGGGG 198

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G R GGGGGGG   GGG  GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 219 GGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 278

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 279 GGGGGGGGGGGGGGGGGGGGGGGGGG 304

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 238 GGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 297

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 298 GGGGGGGGGGGGGGGGGGGGGGGGGG 323

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 245 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 304

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 305 GGGGGGGGGGGGGGGGGGGGGGGGGG 330

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 246 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 305

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 306 GGGGGGGGGGGGGGGGGGGGGGGGGG 331

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 247 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 306

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 307 GGGGGGGGGGGGGGGGGGGGGGGGGG 332

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 248 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 307

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 308 GGGGGGGGGGGGGGGGGGGGGGGGGG 333

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 249 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 308

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 309 GGGGGGGGGGGGGGGGGGGGGGGGGG 334

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 250 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 309

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 310 GGGGGGGGGGGGGGGGGGGGGGGGGG 335

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 251 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 310

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 311 GGGGGGGGGGGGGGGGGGGGGGGGGG 336

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 252 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 311

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 312 GGGGGGGGGGGGGGGGGGGGGGGGGG 337

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 253 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 312

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 313 GGGGGGGGGGGGGGGGGGGGGGGGGG 338

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 254 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 313

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 314 GGGGGGGGGGGGGGGGGGGGGGGGGG 339

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 255 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 314

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 315 GGGGGGGGGGGGGGGGGGGGGGGGGG 340

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 256 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 315

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 316 GGGGGGGGGGGGGGGGGGGGGGGGGG 341

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 257 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 316

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 317 GGGGGGGGGGGGGGGGGGGGGGGGGG 342

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 258 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 317

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 318 GGGGGGGGGGGGGGGGGGGGGGGGGG 343

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 259 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 318

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 319 GGGGGGGGGGGGGGGGGGGGGGGGGG 344

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 260 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 319

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 320 GGGGGGGGGGGGGGGGGGGGGGGGGG 345

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 261 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 320

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 321 GGGGGGGGGGGGGGGGGGGGGGGGGG 346

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 349 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 408

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 409 GGGGGGGGGGGGGGGGGGGGGGGGGG 434

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 350 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 409

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 410 GGGGGGGGGGGGGGGGGGGGGGGGGG 435

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 351 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 410

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 411 GGGGGGGGGGGGGGGGGGGGGGGGGG 436

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 352 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 411

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 412 GGGGGGGGGGGGGGGGGGGGGGGGGG 437

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 353 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 412

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 413 GGGGGGGGGGGGGGGGGGGGGGGGGG 438

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 354 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 413

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 414 GGGGGGGGGGGGGGGGGGGGGGGGGG 439

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 355 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 414

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 415 GGGGGGGGGGGGGGGGGGGGGGGGGG 440

 Score =  112 bits (280), Expect = 1e-23
 Identities = 55/84 (65%), Positives = 56/84 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 360 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 419

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGE 147
           GGGG GGG GGGGGGGG     G+
Sbjct: 420 GGGGGGGGGGGGGGGGGGGGGVGQ 443

 Score =  112 bits (279), Expect = 2e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 118 GVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGG 177

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 178 GGGGGGGGGGGGGGGGGGGGGGGGGG 203

 Score =  111 bits (278), Expect = 2e-23
 Identities = 53/74 (71%), Positives = 53/74 (71%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGG 193

Query: 182 GGGGGSCYSCGESG 141
           GGGGG     G  G
Sbjct: 194 GGGGGGGGGGGGGG 207

 Score =  110 bits (276), Expect = 4e-23
 Identities = 56/95 (58%), Positives = 59/95 (62%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           G S+    +G  G +  G R GG GGGG   GGGG GGGG  GGGG GGGGG  GG GGG
Sbjct: 27  GGSRGGGCSGCGGGSGGGGRGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGG 86

Query: 245 GYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G G  GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 87  GGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGG 121

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 93  GGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGG 152

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGG GGGG     G  G
Sbjct: 153 GGGGGGGGGGGGVGGGGGGGGGGGGG 178

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   G GGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 106 GGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGV 165

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 166 GGGGGGGGGGGGGGGGGGGGGGGGGG 191

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/83 (66%), Positives = 55/83 (66%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G  V G   GGGGGGG   GGGG GGGG  GGGG GGGGG GG  GGGG GG GGG GGG
Sbjct: 122 GGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGG 181

Query: 209 GRGGGRGGGGGGGGSCYSCGESG 141
           G GGG GGGGGGGG     G  G
Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGG 204

 Score =  110 bits (274), Expect = 6e-23
 Identities = 57/89 (64%), Positives = 57/89 (64%), Gaps = 3/89 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGG---GYGGGGGYGGGRGGGGYGGSG 228
           G  G    G   GGGGGGG  RGGGG GGGG  GGG   G GGGGG GGG GGGG GG G
Sbjct: 189 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGG 248

Query: 227 GGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG GGGG GGG GGGGGGGG     G  G
Sbjct: 249 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 277

 Score =  110 bits (274), Expect = 6e-23
 Identities = 57/88 (64%), Positives = 57/88 (64%), Gaps = 2/88 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGG--GSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           G  G    G  RGGGGGGG   GGGG GGG  G  GGGG GGGGG GGG GGGG GG GG
Sbjct: 199 GGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGG 258

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGGG GGG GGGGGGGG     G  G
Sbjct: 259 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 286

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 271 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 330

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGG      G  G
Sbjct: 331 GGGGGGGGGGGGGGGGSGGGGGGGGG 356

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 272 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 331

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGG G     G  G
Sbjct: 332 GGGGGGGGGGGGGGGSGGGGGGGGGG 357

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 273 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 332

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGG GG     G  G
Sbjct: 333 GGGGGGGGGGGGGGSGGGGGGGGGGG 358

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 274 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 333

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGG GGG     G  G
Sbjct: 334 GGGGGGGGGGGGGSGGGGGGGGGGGG 359

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 275 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 334

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGG GGGG     G  G
Sbjct: 335 GGGGGGGGGGGGSGGGGGGGGGGGGG 360

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 276 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 335

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GG GGGGG     G  G
Sbjct: 336 GGGGGGGGGGGSGGGGGGGGGGGGGG 361

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 277 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 336

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG G GGGGGG     G  G
Sbjct: 337 GGGGGGGGGGSGGGGGGGGGGGGGGG 362

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 278 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 337

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG  GGGGGGG     G  G
Sbjct: 338 GGGGGGGGGSGGGGGGGGGGGGGGGG 363

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 280 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 339

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GG  GGGGGGGG     G  G
Sbjct: 340 GGGGGGGSGGGGGGGGGGGGGGGGGG 365

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 281 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 340

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG G G GGGGGGGG     G  G
Sbjct: 341 GGGGGGSGGGGGGGGGGGGGGGGGGG 366

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 282 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 341

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG  GG GGGGGGGG     G  G
Sbjct: 342 GGGGGSGGGGGGGGGGGGGGGGGGGG 367

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 284 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 343

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGG  GGG GGGGGGGG     G  G
Sbjct: 344 GGGSGGGGGGGGGGGGGGGGGGGGGG 369

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 285 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 344

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG G GGG GGGGGGGG     G  G
Sbjct: 345 GGSGGGGGGGGGGGGGGGGGGGGGGG 370

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 286 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 345

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GG GGG GGGGGGGG     G  G
Sbjct: 346 GSGGGGGGGGGGGGGGGGGGGGGGGG 371

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 287 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 346

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGG GGG GGGGGGGG     G  G
Sbjct: 347 SGGGGGGGGGGGGGGGGGGGGGGGGG 372

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GG  
Sbjct: 289 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSG 348

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 349 GGGGGGGGGGGGGGGGGGGGGGGGGG 374

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG G G 
Sbjct: 290 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGG 349

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 350 GGGGGGGGGGGGGGGGGGGGGGGGGG 375

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG G  GGG 
Sbjct: 293 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGG 352

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 353 GGGGGGGGGGGGGGGGGGGGGGGGGG 378

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG  G GGG 
Sbjct: 294 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGG 353

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 354 GGGGGGGGGGGGGGGGGGGGGGGGGG 379

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGG  GG GGG 
Sbjct: 296 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGG 355

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 356 GGGGGGGGGGGGGGGGGGGGGGGGGG 381

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GG G GG GGG 
Sbjct: 297 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGG 356

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 357 GGGGGGGGGGGGGGGGGGGGGGGGGG 382

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG G GG GG GGG 
Sbjct: 298 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGG 357

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 358 GGGGGGGGGGGGGGGGGGGGGGGGGG 383

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG  GGG GG GGG 
Sbjct: 299 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGG 358

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 359 GGGGGGGGGGGGGGGGGGGGGGGGGG 384

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GG  GGGG GG GGG 
Sbjct: 301 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGG 360

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 361 GGGGGGGGGGGGGGGGGGGGGGGGGG 386

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG G G GGGG GG GGG 
Sbjct: 302 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGG 361

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 362 GGGGGGGGGGGGGGGGGGGGGGGGGG 387

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG  GG GGGG GG GGG 
Sbjct: 303 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGG 362

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 363 GGGGGGGGGGGGGGGGGGGGGGGGGG 388

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGG  GGG GGGG GG GGG 
Sbjct: 305 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGG 364

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 365 GGGGGGGGGGGGGGGGGGGGGGGGGG 390

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGG G GGG GGGG GG GGG 
Sbjct: 306 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGG 365

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 366 GGGGGGGGGGGGGGGGGGGGGGGGGG 391

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GG GG GGG GGGG GG GGG 
Sbjct: 307 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGG 366

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 367 GGGGGGGGGGGGGGGGGGGGGGGGGG 392

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG G GGG GGG GGGG GG GGG 
Sbjct: 308 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGG 367

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 368 GGGGGGGGGGGGGGGGGGGGGGGGGG 393

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG  GGGG GGG GGGG GG GGG 
Sbjct: 309 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGG 368

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 369 GGGGGGGGGGGGGGGGGGGGGGGGGG 394

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGG  GGGGG GGG GGGG GG GGG 
Sbjct: 311 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGG 370

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 371 GGGGGGGGGGGGGGGGGGGGGGGGGG 396

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GG G GGGGG GGG GGGG GG GGG 
Sbjct: 312 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGG 371

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 372 GGGGGGGGGGGGGGGGGGGGGGGGGG 397

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  G GG GGGGG GGG GGGG GG GGG 
Sbjct: 313 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGG 372

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 373 GGGGGGGGGGGGGGGGGGGGGGGGGG 398

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG   GGG GGGGG GGG GGGG GG GGG 
Sbjct: 314 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGG 373

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 374 GGGGGGGGGGGGGGGGGGGGGGGGGG 399

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGG   GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 317 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 376

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 377 GGGGGGGGGGGGGGGGGGGGGGGGGG 402

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GG G  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 318 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 377

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 378 GGGGGGGGGGGGGGGGGGGGGGGGGG 403

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG G GG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 319 GGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 378

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 379 GGGGGGGGGGGGGGGGGGGGGGGGGG 404

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG  GGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 320 GGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 379

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 380 GGGGGGGGGGGGGGGGGGGGGGGGGG 405

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGG  GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 322 GGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 381

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 382 GGGGGGGGGGGGGGGGGGGGGGGGGG 407

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GG G GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 323 GGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 382

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 383 GGGGGGGGGGGGGGGGGGGGGGGGGG 408

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   G GG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 324 GGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 383

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 384 GGGGGGGGGGGGGGGGGGGGGGGGGG 409

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG    GGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 325 GGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 384

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 385 GGGGGGGGGGGGGGGGGGGGGGGGGG 410

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGG    GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 329 GGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 388

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 389 GGGGGGGGGGGGGGGGGGGGGGGGGG 414

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGG G   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 330 GGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 389

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 390 GGGGGGGGGGGGGGGGGGGGGGGGGG 415

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGG GG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 331 GGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 390

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 391 GGGGGGGGGGGGGGGGGGGGGGGGGG 416

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGG GGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 332 GGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 391

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 392 GGGGGGGGGGGGGGGGGGGGGGGGGG 417

 Score =  109 bits (273), Expect = 8e-23
 Identities = 56/88 (63%), Positives = 57/88 (64%), Gaps = 2/88 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR--GGGGYGGSGG 225
           G  G    G+  GGGGGGG   GGGG GGGG  GGGG GGGGG GGG   GGGG GG GG
Sbjct: 71  GGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGG 130

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGGG GGG GGGGGGGG     G  G
Sbjct: 131 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 158

 Score =  109 bits (273), Expect = 8e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 99  GGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 158

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG G G GGGGGGGG     G  G
Sbjct: 159 GGGGGGVGGGGGGGGGGGGGGGGGGG 184

 Score =  109 bits (273), Expect = 8e-23
 Identities = 56/88 (63%), Positives = 56/88 (63%)
 Frame = -3

Query: 404 VTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           V G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG  GG GGGG GG GG
Sbjct: 119 VGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGG 178

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGGG GGG GGGGGGGG     G  G
Sbjct: 179 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 206

 Score =  109 bits (272), Expect = 1e-22
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG G GG GG GGG 
Sbjct: 70  GGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGG 129

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 130 GGGGGGGGGGGGGGGGGGGGGGGGGG 155

 Score =  109 bits (272), Expect = 1e-22
 Identities = 57/95 (60%), Positives = 57/95 (60%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           G    V   G  G    G   GGGGGGG   GGGG GGGG  GGG  GGGGG GGG GGG
Sbjct: 120 GGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGG 179

Query: 245 GYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGG 214

 Score =  109 bits (272), Expect = 1e-22
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  G GG GGGGG GGG GGGG GG GGG 
Sbjct: 131 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGG 190

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 191 GGGGGGGGGGGGGGGGGGGRGGGGGG 216

 Score =  109 bits (272), Expect = 1e-22
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG G GG  GGGG GGGGG GGGRGGGG GG GGG 
Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGG 241

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG G GGG GGGGGGGG     G  G
Sbjct: 242 GGDGGGGGGGGGGGGGGGGGGGGGGG 267

 Score =  109 bits (272), Expect = 1e-22
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGG G  RGGGG GGGG  GGG  GGGGG GGG GGGG GG GGG 
Sbjct: 208 GGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGG 267

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 268 GGGGGGGGGGGGGGGGGGGGGGGGGG 293

 Score =  108 bits (271), Expect = 1e-22
 Identities = 57/88 (64%), Positives = 57/88 (64%), Gaps = 2/88 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGGS GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 59  GGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118

Query: 218 --GGGGRGGGRGGGGGGGGSCYSCGESG 141
             GGGG GGG GGGGGGGG     G  G
Sbjct: 119 VGGGGGVGGGGGGGGGGGGGGGGGGGGG 146

 Score =  108 bits (271), Expect = 1e-22
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGG GGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 110 GGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGG 169

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 170 GGGGGGGGGGGGGGGGGGGGGGGGGG 195

 Score =  108 bits (270), Expect = 2e-22
 Identities = 57/95 (60%), Positives = 57/95 (60%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           G    V   G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGG  GGG GGG
Sbjct: 114 GGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGG 173

Query: 245 GYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 174 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 208

 Score =  108 bits (270), Expect = 2e-22
 Identities = 54/86 (62%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G   +G   GGGGGGG    GGG GGGG  GGGG GGG G GGG GGGG GG GGG 
Sbjct: 203 GGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGG 262

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 263 GGGGGGGGGGGGGGGGGGGGGGGGGG 288

 Score =  108 bits (269), Expect = 2e-22
 Identities = 56/87 (64%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGG-GYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           G  G    G   GGGGGGG   GGG G GGGG  GGGG GGGGG GGG GGGG GG GGG
Sbjct: 100 GGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 159

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGGG GGG GGGGGGGG     G  G
Sbjct: 160 GGGGGVGGGGGGGGGGGGGGGGGGGGG 186

 Score =  108 bits (269), Expect = 2e-22
 Identities = 54/86 (62%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG + GG G GGGG  GGGG G GGG GGG GGGG GG GGG 
Sbjct: 205 GGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGG 264

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 265 GGGGGGGGGGGGGGGGGGGGGGGGGG 290

 Score =  107 bits (268), Expect = 3e-22
 Identities = 53/83 (63%), Positives = 54/83 (65%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G+  GGGGGGG   GGGG GGGG  GGGG G GGG GGG G GG GG GGG GGG
Sbjct: 44  GGRGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGG 103

Query: 209 GRGGGRGGGGGGGGSCYSCGESG 141
           G GGG GGGGGGGG     G  G
Sbjct: 104 GGGGGGGGGGGGGGGVGGGGGVG 126

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG G GG GG GGG 
Sbjct: 79  GSGGGGGGGGGSGGGGGGG---GGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGG 135

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGG 161

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/88 (62%), Positives = 55/88 (62%)
 Frame = -3

Query: 404 VTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           V G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GG
Sbjct: 165 VGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 224

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
             GG G GGG GGGGGGGG     G  G
Sbjct: 225 DGGGRGGGGGGGGGGGGGGDGGGGGGGG 252

 Score =  107 bits (268), Expect = 3e-22
 Identities = 56/88 (63%), Positives = 56/88 (63%), Gaps = 2/88 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG--GYGGSGG 225
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGG  G GG GG
Sbjct: 178 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGG 237

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGGG GGG GGGGGGGG     G  G
Sbjct: 238 GGGGGGDGGGGGGGGGGGGGGGGGGGGG 265

 Score =  107 bits (267), Expect = 4e-22
 Identities = 55/87 (63%), Positives = 57/87 (65%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           +G  G    G+  GGGGGGG   GGGG GGGG  GGGG GGG G GGG GGGG GG GGG
Sbjct: 80  SGGGGGGGGGSGGGGGGGGG---GGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGG 136

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGGG GGG GGGGGGGG     G  G
Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGG 163

 Score =  107 bits (267), Expect = 4e-22
 Identities = 56/89 (62%), Positives = 56/89 (62%), Gaps = 3/89 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGS---G 228
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG    G
Sbjct: 173 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGG 232

Query: 227 GGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG GGGG GGG GGGGGGGG     G  G
Sbjct: 233 GGGGGGGGGGGDGGGGGGGGGGGGGGGGG 261

 Score =  107 bits (266), Expect = 5e-22
 Identities = 52/77 (67%), Positives = 52/77 (67%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGG  GGG GGGG GG GGG 
Sbjct: 48  GGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGG 107

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GG GGGGG
Sbjct: 108 GGGGGGGGGGGVGGGGG 124

 Score =  107 bits (266), Expect = 5e-22
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 154 GGGGGGGGGGGVGGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 210

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGG GG     G  G
Sbjct: 211 GGGGGGGGGGGGGGDGGGRGGGGGGG 236

 Score =  107 bits (266), Expect = 5e-22
 Identities = 54/86 (62%), Positives = 54/86 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GG GG GGG GGGG GG GGG 
Sbjct: 170 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGR 229

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGG GG     G  G
Sbjct: 230 GGGGGGGGGGGGGGDGGGGGGGGGGG 255

 Score =  106 bits (265), Expect = 7e-22
 Identities = 54/86 (62%), Positives = 54/86 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGG  GGGG  GGGG GG GG GGG GGGG GG GGG 
Sbjct: 204 GGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGG 263

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 264 GGGGGGGGGGGGGGGGGGGGGGGGGG 289

 Score =  106 bits (264), Expect = 9e-22
 Identities = 58/102 (56%), Positives = 58/102 (56%), Gaps = 3/102 (2%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGG 258
           S   GR       G  G    G   GGGGGGG   GGGG GGGG  GGG  GGGGG GGG
Sbjct: 41  SGGGGRGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGG 100

Query: 257 RGGGGYGGSGGGYGGG---GRGGGRGGGGGGGGSCYSCGESG 141
            GGGG GG GGG GGG   G GGG GGGGGGGG     G  G
Sbjct: 101 GGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGG 142

 Score =  106 bits (264), Expect = 9e-22
 Identities = 54/86 (62%), Positives = 54/86 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGG GG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 64  GGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGG 123

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GG GGG GGGGGGGG     G  G
Sbjct: 124 GVGGGGGGGGGGGGGGGGGGGGGGGG 149

 Score =  106 bits (264), Expect = 9e-22
 Identities = 54/86 (62%), Positives = 54/86 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GG G GG  GG 
Sbjct: 69  GGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGG 128

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 129 GGGGGGGGGGGGGGGGGGGGGGGGGG 154

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/71 (63%), Positives = 45/71 (63%)
 Frame = -3

Query: 353 GGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGG 174
           G  G  RGGG  G GG  GGGG GGG G GGG GGGG GG GGG GGGG GGG GG GGG
Sbjct: 24  GYSGGSRGGGCSGCGGGSGGGGRGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGG 83

Query: 173 GGSCYSCGESG 141
           GG     G  G
Sbjct: 84  GGGGGGSGGGG 94

[52][TOP]
>UniRef100_B4FQQ2 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4FQQ2_MAIZE
          Length = 134

 Score =  116 bits (290), Expect = 9e-25
 Identities = 62/108 (57%), Positives = 64/108 (59%), Gaps = 36/108 (33%)
 Frame = -3

Query: 332 GGGGYGGGGSYGGGGYGGGGGYGGG---------------RGGGGYGGSGGGYG------ 216
           GGGGYGGGG YGGGGYGGGGG GGG                GGGGYGG GGG G      
Sbjct: 28  GGGGYGGGG-YGGGGYGGGGGGGGGCFKCGEPGHMARDCSSGGGGYGGGGGGGGGGCYNC 86

Query: 215 ------------GGGRGGGRGGGGGGGG---SCYSCGESGHFARDCPT 117
                       GGG GGGR GGGGGGG   SCY+CGE+GH ARDCPT
Sbjct: 87  GQAGHMARDCPSGGGGGGGRFGGGGGGGGDRSCYNCGEAGHIARDCPT 134

[53][TOP]
>UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2Z7_EHV86
          Length = 516

 Score =  115 bits (289), Expect = 1e-24
 Identities = 53/81 (65%), Positives = 54/81 (66%), Gaps = 3/81 (3%)
 Frame = +1

Query: 166 LPPPPPPPPRPPPRPPPP*PPPLP--PYPPPPRPPP*PPPPPYPP-PP*LPPPP*PPPPR 336
           LPPP PPPP PPP PPPP PPP P  P PPPP PPP  PPPP PP PP  PPPP PPPP 
Sbjct: 44  LPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPS 103

Query: 337 S*PPPPPPPRLVP*TLAPSGP 399
             PP PPPP   P +  PS P
Sbjct: 104 PPPPSPPPPSPPPPSPPPSPP 124

 Score =  112 bits (279), Expect = 2e-23
 Identities = 52/88 (59%), Positives = 55/88 (62%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPP--P 315
           P SP     PP PPPP  PPP PPPP PP  PP PPPP PPP  PPPP PPPP  PP  P
Sbjct: 64  PPSPS----PPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 119

Query: 316 P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P  PPP   PP PPPP   P +++PS P
Sbjct: 120 PPSPPPSPSPPSPPPPSPPPPSISPSPP 147

 Score =  107 bits (267), Expect = 4e-22
 Identities = 53/89 (59%), Positives = 53/89 (59%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPP---P*LPP 312
           P SP     PPP PPPP PPP  PPP PPPLPP  PPP  PP  PPPP PPP   P  PP
Sbjct: 19  PPSP-----PPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPP 73

Query: 313 PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP PPPP   PPPP PP   P    PS P
Sbjct: 74  PPSPPPPS--PPPPSPPSPPPSPPPPSPP 100

 Score =  100 bits (249), Expect = 5e-20
 Identities = 53/99 (53%), Positives = 55/99 (55%), Gaps = 13/99 (13%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPP--------PRPPPP*PP---PLPPYPPPPRPPP*PPPPPY 288
           P SP     PPP PPPP PP        P PPPP PP   P PP PPPP PPP PPP P 
Sbjct: 69  PPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPS 128

Query: 289 PPPP*LPPPP*PPPP--RS*PPPPPPPRLVP*TLAPSGP 399
           PP    PPPP PPPP     PPPPPPP     + +PS P
Sbjct: 129 PPS---PPPPSPPPPSISPSPPPPPPPWWQAPSASPSPP 164

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 49/104 (47%), Positives = 53/104 (50%), Gaps = 8/104 (7%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     P PPPP P PP  PPP  PPP PP  PPP P P  PPPP PPPP + P P 
Sbjct: 88  PSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPP 147

Query: 322 PPPP--------RS*PPPPPPPRLVP*TLAPSGPVTLTALDRPS 429
           PPPP           PPPPPPP     + +PS P    +   PS
Sbjct: 148 PPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPS 191

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 54/136 (39%), Positives = 59/136 (43%), Gaps = 50/136 (36%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPP-----------P*PPPLPPYPPPPRPP-------- 264
           P SP     PPP PPPP PPP PPP           P PP + P PPPP PP        
Sbjct: 101 PPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSAS 160

Query: 265 --P*PPPPPY---------PPPP*L--------------------PPPP*PPPPRS*PPP 351
             P PPPPP+         PPPP +                    PPPP PPPP   PPP
Sbjct: 161 PSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPP 220

Query: 352 PPPPRLVP*TLAPSGP 399
           PPPP   P   +P+ P
Sbjct: 221 PPPPPPPPSPPSPNPP 236

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 51/111 (45%), Positives = 55/111 (49%), Gaps = 25/111 (22%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPP--------PRPPPRPPP----------P*PPPLPPYPP---PPR 258
           P  P +   PPPPPPP        P PPP PPP          P PP + P PP    P 
Sbjct: 137 PPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPT 196

Query: 259 PPP----*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPP      PPPP PPPP  PPPP PPPP   PPP PP    P + +PS P
Sbjct: 197 PPPPSASPSPPPPSPPPPSPPPPPPPPPP---PPPSPPSPNPPPSASPSPP 244

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 47/88 (53%), Positives = 48/88 (54%), Gaps = 12/88 (13%)
 Frame = +1

Query: 142 PDSPQL*QLPP----PPPPPPRPPPRPPPP*PPPL--PPYPPPPRPPP*PPPPPYPPPP* 303
           P  P +   PP    P PPPP   P PPPP PPP   PP PPPP PPP  PP P PPP  
Sbjct: 180 PPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSA 239

Query: 304 LPPPP------*PPPPRS*PPPPPPPRL 369
            P PP       PPPP   PPPPPPP L
Sbjct: 240 SPSPPFGRSLRSPPPP---PPPPPPPGL 264

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 32/59 (54%), Positives = 34/59 (57%), Gaps = 6/59 (10%)
 Frame = +1

Query: 241 YPPPPRPPP*PPPPPYPPPP*LP------PPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           Y  PP PPP  PPPP PPPP  P      PPP PPPP   PPP PPP L P + +P  P
Sbjct: 16  YATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPS--PPPSPPPPLPPPSPSPPSP 72

[54][TOP]
>UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J4Y2_HUMAN
          Length = 253

 Score =  115 bits (289), Expect = 1e-24
 Identities = 56/92 (60%), Positives = 57/92 (61%), Gaps = 6/92 (6%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPP----P*PPPPPYPPPP*LPPPP*--PPP 330
           PPPPPPPP  PP PPPP PPP PP PPPP PP    P PP PP PPPP  PPPP   PPP
Sbjct: 7   PPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPP 66

Query: 331 PRS*PPPPPPPRLVP*TLAPSGPVTLTALDRP 426
           P S PPPPPPP   P    PS P  L +   P
Sbjct: 67  PPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPP 98

 Score =  113 bits (282), Expect = 7e-24
 Identities = 55/96 (57%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPP-P*PPPPPYPPPP*LPPPP 318
           P SP     P PPPPPP PPP PPP  P PLPP PPPP PP P PPPP  PPPP   PPP
Sbjct: 14  PSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPP 73

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRP 426
            PPPP   PPPPPPP   P   +P  P  L +   P
Sbjct: 74  PPPPPS--PPPPPPPSPPPPLPSPPPPPPLPSPPPP 107

 Score =  111 bits (278), Expect = 2e-23
 Identities = 57/90 (63%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*P-PPPPYPPPP*LPPPP 318
           P SP    L  PPPPPP PPP PPPP PPP PP PPPP PPP P PPPP  PP  LPP P
Sbjct: 132 PPSPPPPPLLSPPPPPPSPPP-PPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSP 190

Query: 319 *PPPPRS*PPPP---PPPRLVP*TLAPSGP 399
            PPPP S PPPP   PPP  +P   APS P
Sbjct: 191 PPPPPPSPPPPPPPSPPPPPLPSPPAPSPP 220

 Score =  109 bits (272), Expect = 1e-22
 Identities = 51/81 (62%), Positives = 51/81 (62%), Gaps = 4/81 (4%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPP  PPPLP  PPPP  P  PPPPP P  P  PPP  PPPP S PP
Sbjct: 71  PPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPP 130

Query: 349 ----PPPPPRLVP*TLAPSGP 399
               PPPPP L P    PS P
Sbjct: 131 PPPSPPPPPLLSPPPPPPSPP 151

 Score =  108 bits (271), Expect = 1e-22
 Identities = 57/101 (56%), Positives = 57/101 (56%), Gaps = 15/101 (14%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PP-------------PLPPYPPPPRPP-P*PPP 279
           P SP     PPPPP PP PPP PPPP PP             PLPP PPPP PP P PPP
Sbjct: 147 PPSPP----PPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPP 202

Query: 280 PPYPPPP*LPPPP*PPPPR-S*PPPPPPPRLVP*TLAPSGP 399
           PP PPPP LP PP P PP    PPPPPPP   P    PS P
Sbjct: 203 PPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPP 243

 Score =  107 bits (268), Expect = 3e-22
 Identities = 57/101 (56%), Positives = 57/101 (56%), Gaps = 15/101 (14%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPP---RPPPRPPPP*PPPLPPYPPPPRPPP-----*PPPPPYPPP 297
           P  P    LP PPPPPP    PPP PP P PPPL P PPPP PPP      PPPPP PPP
Sbjct: 93  PSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPP 152

Query: 298 P*LPPPP*PPPPRS*PPP-------PPPPRLVP*TLAPSGP 399
           P  PPP  PPPP S PPP       PPPP   P  L PS P
Sbjct: 153 P--PPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPP 191

 Score =  107 bits (268), Expect = 3e-22
 Identities = 53/89 (59%), Positives = 54/89 (60%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*P---PPPPYPPPP*LPP 312
           P SP    LPPPPP PP P P  PPP PPP PP PPPP PPP P   PP P PP P LPP
Sbjct: 171 PPSP----LPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPP 226

Query: 313 PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP PPP    PPPPPPP   P +  P  P
Sbjct: 227 PPPPPPS---PPPPPPPSPPPPSPPPPPP 252

 Score =  107 bits (267), Expect = 4e-22
 Identities = 53/87 (60%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYP-PPP*LPPPP 318
           P SP     P PPPPPP  PP PPP  PPP P  PPPP PPP PPPPP P PPP LP PP
Sbjct: 37  PPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPP 96

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPPP   PPPPPP    P    PS P
Sbjct: 97  -PPPPLPSPPPPPPLPSSPPPPPPSPP 122

 Score =  107 bits (266), Expect = 5e-22
 Identities = 51/82 (62%), Positives = 51/82 (62%), Gaps = 4/82 (4%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLP-PYPPPPRPPP*PPPPPYPPPP*L---P 309
           P  P     PPPPPPP  PPP P PP PPPLP P PPPP P   PPPPP PPPP L   P
Sbjct: 71  PPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPP 130

Query: 310 PPP*PPPPRS*PPPPPPPRLVP 375
           PPP PPPP    PPPPPP   P
Sbjct: 131 PPPSPPPPPLLSPPPPPPSPPP 152

 Score =  106 bits (265), Expect = 7e-22
 Identities = 55/93 (59%), Positives = 56/93 (60%), Gaps = 7/93 (7%)
 Frame = +1

Query: 142 PDSPQL*QLPPPP--PPPPRPPPRPPPP*PP-PLPPYPPPPRPPP*PPPPPYPP----PP 300
           P  P   Q PPPP  PPPP PPP PPPP PP P PP P PP PPP P PPP PP    PP
Sbjct: 56  PPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPP 115

Query: 301 *LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             PPPP PPPP   PPPPPP    P  L+P  P
Sbjct: 116 --PPPPSPPPPPLSPPPPPPSPPPPPLLSPPPP 146

 Score =  106 bits (264), Expect = 9e-22
 Identities = 54/93 (58%), Positives = 55/93 (59%), Gaps = 7/93 (7%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPP---PRPPPP*PPPLPPYPPPPRPPP---*PPPPPYPPPP* 303
           P SP      PPPPPPP PP   P  PPP PPP PP PPP +PPP    PPPPP PP P 
Sbjct: 22  PPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPP 81

Query: 304 LPPPP*PPPPRS*PPPPPP-PRLVP*TLAPSGP 399
            PPPP PPPP   PPPPPP P   P    PS P
Sbjct: 82  PPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSP 114

 Score =  106 bits (264), Expect = 9e-22
 Identities = 57/103 (55%), Positives = 57/103 (55%), Gaps = 17/103 (16%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPP--------PPRPPPRPPPP---*PPPLPPYPPPPRPPP*PPPPPY 288
           P  P L   PPPPPP        PP PPP PPPP    PPP PP PPPP PP  PPPPP 
Sbjct: 105 PPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPS 164

Query: 289 PPPP*LPPPP*PPPPRS*P------PPPPPPRLVP*TLAPSGP 399
           PPPP  PP P PPPP S P      PPPPPP   P    PS P
Sbjct: 165 PPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPP 207

 Score =  103 bits (256), Expect = 8e-21
 Identities = 55/101 (54%), Positives = 56/101 (55%), Gaps = 14/101 (13%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPP-----PPRPPPRPPPP*PPPLP--PYPPPPRPPP----*PPPPPY 288
           P  P     PPP PP     PP PPP P PP PPPLP  P PPPP PPP     PPPPP 
Sbjct: 75  PPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPS 134

Query: 289 PPPP*L---PPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPV 402
           PPPP L   PPPP  PPP   P PPPPP   P  L P  P+
Sbjct: 135 PPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPL 175

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 29/49 (59%), Positives = 29/49 (59%), Gaps = 6/49 (12%)
 Frame = +1

Query: 271 PPPPPYPPPP*LPP--PP*PPPPRS*P----PPPPPPRLVP*TLAPSGP 399
           PPPPP PPPP  PP  PP PPPP   P    PPPPPP   P  L PS P
Sbjct: 1   PPPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPP 49

[55][TOP]
>UniRef100_C0Z2E8 AT4G38680 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2E8_ARATH
          Length = 204

 Score =  115 bits (289), Expect = 1e-24
 Identities = 64/116 (55%), Positives = 69/116 (59%), Gaps = 23/116 (19%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGG--GGGGGYERG-GGGYGGGGSYGGGGYGGGGGYG 264
           DN+ R KA++V+GPDGA VQG   GG  GG GG+  G GGG G GG YGGGG G GG  G
Sbjct: 64  DNNNRPKAIDVSGPDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGG 123

Query: 263 GGRGG--------------------GGYGGSGGGYGGGGRGGGRGGGGGGGGSCYS 156
           GGRGG                    GGYGG GGGYGGGG  GG GGG GGGG   S
Sbjct: 124 GGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRLLS 179

[56][TOP]
>UniRef100_Q5TU53 AGAP002965-PA (Fragment) n=1 Tax=Anopheles gambiae
           RepID=Q5TU53_ANOGA
          Length = 212

 Score =  115 bits (289), Expect = 1e-24
 Identities = 59/95 (62%), Positives = 59/95 (62%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           GR K     G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGG
Sbjct: 6   GRGKGKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65

Query: 245 GYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 66  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100

 Score =  114 bits (286), Expect = 3e-24
 Identities = 57/86 (66%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G   QG   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 5   GGRGKGKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 65  GGGGGGGGGGGGGGGGGGGGGGGGGG 90

 Score =  112 bits (281), Expect = 1e-23
 Identities = 58/96 (60%), Positives = 60/96 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 18  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESGHFARDCPTSA 111
           GGGG GGG GGGGGGGG     G  G +     TS+
Sbjct: 78  GGGGGGGGGGGGGGGGGGGGGGGGVGAYGSVRSTSS 113

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 16  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 76  GGGGGGGGGGGGGGGGGGGGGGGGGG 101

 Score =  105 bits (261), Expect = 2e-21
 Identities = 50/76 (65%), Positives = 53/76 (69%)
 Frame = -3

Query: 368 RRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRG 189
           ++ GG G G + GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG G
Sbjct: 2   KKKGGRGKGKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61

Query: 188 GGGGGGGSCYSCGESG 141
           GGGGGGG     G  G
Sbjct: 62  GGGGGGGGGGGGGGGG 77

 Score =  103 bits (258), Expect = 5e-21
 Identities = 50/76 (65%), Positives = 52/76 (68%)
 Frame = -3

Query: 368 RRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRG 189
           ++GG G G    GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG G
Sbjct: 3   KKGGRGKGKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 62

Query: 188 GGGGGGGSCYSCGESG 141
           GGGGGGG     G  G
Sbjct: 63  GGGGGGGGGGGGGGGG 78

 Score =  100 bits (250), Expect = 4e-20
 Identities = 54/91 (59%), Positives = 54/91 (59%), Gaps = 13/91 (14%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 34  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93

Query: 218 GGGGRGGG-------------RGGGGGGGGS 165
           GGGG GGG             RG GGG GGS
Sbjct: 94  GGGGGGGGVGAYGSVRSTSSDRGRGGGTGGS 124

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 44/78 (56%), Positives = 45/78 (57%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG  G+ G  
Sbjct: 49  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGAYGSV 108

Query: 218 GGGGRGGGRGGGGGGGGS 165
                  GRGGG GG  S
Sbjct: 109 RSTSSDRGRGGGTGGSPS 126

[57][TOP]
>UniRef100_B9Q6L7 RNA recognition motif-containing protein, putative n=1
           Tax=Toxoplasma gondii VEG RepID=B9Q6L7_TOXGO
          Length = 510

 Score =  115 bits (289), Expect = 1e-24
 Identities = 55/80 (68%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGY-GGGRGGGGYGGSGGGYGGGGRGG 198
           G  RGG GG G   GGGGYGGGG  GGGGYGGGGGY GGG GGGGYGG  GGYGGGG GG
Sbjct: 281 GMGRGGYGGHGSPYGGGGYGGGGYGGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGG 340

Query: 197 GRGGGGGGGGSCYSCGESGH 138
             GGG GGG   Y  G  G+
Sbjct: 341 YGGGGYGGGNGGYGGGGGGY 360

 Score =  111 bits (277), Expect = 3e-23
 Identities = 58/88 (65%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGG-GGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           G  G    G+  GGGG GGG   GGGGYGGGG YGGGGYGGGG YGGG GG G GG  GG
Sbjct: 283 GRGGYGGHGSPYGGGGYGGGGYGGGGGYGGGGGYGGGGYGGGG-YGGGNGGYG-GGGNGG 340

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           YGGGG GGG GG GGGGG  Y  G  G+
Sbjct: 341 YGGGGYGGGNGGYGGGGGG-YGGGGGGY 367

 Score =  104 bits (260), Expect = 3e-21
 Identities = 63/118 (53%), Positives = 64/118 (54%), Gaps = 27/118 (22%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGG--GGGYERGGGGYGGGGSYGGGGYG--------------GGGGY 267
           G  G+   G   GGGG  GGG   GGGGYGGGG YGGGGYG              GGGGY
Sbjct: 288 GGHGSPYGGGGYGGGGYGGGGGYGGGGGYGGGG-YGGGGYGGGNGGYGGGGNGGYGGGGY 346

Query: 266 GGGR-----GGGGYGGSGGGYGGGGRGGGRGGGGG------GGGSCYSCGESGHFARD 126
           GGG      GGGGYGG GGGYGG G GGG GGGGG      GGG  YS     H   D
Sbjct: 347 GGGNGGYGGGGGGYGGGGGGYGGYGGGGGYGGGGGFGSGGYGGGGGYSPAGPHHGGMD 404

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/85 (56%), Positives = 48/85 (56%), Gaps = 12/85 (14%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGG------GGGYGGG--RGGGGYGG----SGGGYG 216
           GG   G  RG G  G  G  G GGYGG      GGGYGGG   GGGGYGG     GGGYG
Sbjct: 263 GGFNSGPMRGPGRGGFRGGMGRGGYGGHGSPYGGGGYGGGGYGGGGGYGGGGGYGGGGYG 322

Query: 215 GGGRGGGRGGGGGGGGSCYSCGESG 141
           GGG GGG GG GGGG   Y  G  G
Sbjct: 323 GGGYGGGNGGYGGGGNGGYGGGGYG 347

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 38/73 (52%), Positives = 42/73 (57%), Gaps = 2/73 (2%)
 Frame = -3

Query: 353 GGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGG--RGGGG 180
           G GG++   G Y GG + G     G GG+ GG G GGYGG G  YGGGG GGG   GGGG
Sbjct: 253 GRGGFD---GFYHGGFNSGPMRGPGRGGFRGGMGRGGYGGHGSPYGGGGYGGGGYGGGGG 309

Query: 179 GGGGSCYSCGESG 141
            GGG  Y  G  G
Sbjct: 310 YGGGGGYGGGGYG 322

[58][TOP]
>UniRef100_B6KME4 RRM domain-containing protein n=1 Tax=Toxoplasma gondii ME49
           RepID=B6KME4_TOXGO
          Length = 513

 Score =  115 bits (289), Expect = 1e-24
 Identities = 57/87 (65%), Positives = 59/87 (67%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G+  GGGG GG   GGGGYGGGG YGGGGYGGGG YGGG GG G GG  GGY
Sbjct: 286 GRGGYGGHGSPYGGGGYGGGGYGGGGYGGGGGYGGGGYGGGG-YGGGNGGYG-GGGNGGY 343

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESGH 138
           GGGG GGG GG GGGGG  Y  G  G+
Sbjct: 344 GGGGYGGGNGGYGGGGGGGYGGGGGGY 370

 Score =  115 bits (288), Expect = 2e-24
 Identities = 56/81 (69%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR-GGGGYGGSGGGYGGGGRGG 198
           G  RGG GG G   GGGGYGGGG YGGGGYGGGGGYGGG  GGGGYGG  GGYGGGG GG
Sbjct: 284 GMGRGGYGGHGSPYGGGGYGGGG-YGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGG 342

Query: 197 GRGGGGGGGGSCYSCGESGHF 135
             GGG GGG   Y  G  G +
Sbjct: 343 YGGGGYGGGNGGYGGGGGGGY 363

 Score =  112 bits (281), Expect = 1e-23
 Identities = 59/88 (67%), Positives = 61/88 (69%), Gaps = 9/88 (10%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGS--YGGGGYGGG-GGYGGGRGGGGYGGSGGGYGGGGRGGGR 192
           GG GGGGY  G GGYGGGG+  YGGGGYGGG GGYGGG GGGGYGG GGGYGG G GGG 
Sbjct: 321 GGYGGGGYGGGNGGYGGGGNGGYGGGGYGGGNGGYGGG-GGGGYGGGGGGYGGYGGGGGY 379

Query: 191 GGGGG------GGGSCYSCGESGHFARD 126
           GGGGG      GGG  YS     H + D
Sbjct: 380 GGGGGFGSGGYGGGGGYSPAGPHHGSMD 407

 Score =  107 bits (266), Expect = 5e-22
 Identities = 60/93 (64%), Positives = 61/93 (65%), Gaps = 10/93 (10%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGG-GGGYERGGGGYGGGGSYGGGGYGGG-GGYG----GGRGGGGYG 237
           G  G+   G   GGGG GGG   GGGGYGGGG YGGGGYGGG GGYG    GG GGGGYG
Sbjct: 291 GGHGSPYGGGGYGGGGYGGGGYGGGGGYGGGG-YGGGGYGGGNGGYGGGGNGGYGGGGYG 349

Query: 236 GSGGGYGGGGRGGGRGGGGG----GGGSCYSCG 150
           G  GGYGGGG GG  GGGGG    GGG  Y  G
Sbjct: 350 GGNGGYGGGGGGGYGGGGGGYGGYGGGGGYGGG 382

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/69 (63%), Positives = 45/69 (65%), Gaps = 2/69 (2%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGG--SYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRG 201
           G   GG GGGGY  G GGYGGGG   YG    GGGGGYGG  GGGGYGG GGG+G GG G
Sbjct: 337 GGGNGGYGGGGYGGGNGGYGGGGGGGYG----GGGGGYGGYGGGGGYGG-GGGFGSGGYG 391

Query: 200 GGRGGGGGG 174
           GG G    G
Sbjct: 392 GGGGYSPAG 400

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 46/88 (52%), Positives = 50/88 (56%), Gaps = 12/88 (13%)
 Frame = -3

Query: 362 GGGGGGGYERGG------GGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSG---GGYGGG 210
           G GG  G+  GG       G G GG  GG G GG GG+G   GGGGYGG G   GGYGGG
Sbjct: 256 GRGGFDGFYHGGFNSGPMRGPGRGGFRGGMGRGGYGGHGSPYGGGGYGGGGYGGGGYGGG 315

Query: 209 G--RGGGRGGGG-GGGGSCYSCGESGHF 135
           G   GGG GGGG GGG   Y  G +G +
Sbjct: 316 GGYGGGGYGGGGYGGGNGGYGGGGNGGY 343

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 29/44 (65%), Positives = 30/44 (68%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGY 267
           G  G    G   GGGG GGY  GGGGYGGGG +G GGYGGGGGY
Sbjct: 354 GYGGGGGGGYGGGGGGYGGYG-GGGGYGGGGGFGSGGYGGGGGY 396

[59][TOP]
>UniRef100_UPI00019852F3 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019852F3
          Length = 228

 Score =  115 bits (288), Expect = 2e-24
 Identities = 62/107 (57%), Positives = 69/107 (64%), Gaps = 5/107 (4%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGG-GYGGGGGYGGGRG 252
           DGR+KAV VT      V+G+   GGGGG       G+ GG S GG  G  GGGGYGGG G
Sbjct: 62  DGRTKAVEVTA-----VRGSYSSGGGGGR------GFSGGRSRGGSYGRYGGGGYGGGGG 110

Query: 251 GGGYGGSGGGYGGGGRGGGRGG----GGGGGGSCYSCGESGHFARDC 123
           GGG GG GGGYG G RGG R G    G GGGG+CY+CG +GH ARDC
Sbjct: 111 GGGGGGGGGGYGRGVRGGRRSGRTDDGYGGGGACYNCGRTGHLARDC 157

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 54/127 (42%), Positives = 59/127 (46%), Gaps = 30/127 (23%)
 Frame = -3

Query: 398 GPDGANVQGTRRGG------GGGGG--------------YERGGGG---YGGGGSY---- 300
           G  G  V+G RR G      GGGG               Y+  GGG   YGGGG Y    
Sbjct: 119 GGYGRGVRGGRRSGRTDDGYGGGGACYNCGRTGHLARDCYQGSGGGRRGYGGGGGYSAGA 178

Query: 299 GGGGYG---GGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGHFAR 129
           GGGGY    GGGGY  G GGGGY                   G GGG+CY+CGE GHFAR
Sbjct: 179 GGGGYSAGAGGGGYSAGAGGGGY-----------------SFGAGGGACYNCGEEGHFAR 221

Query: 128 DCPTSAR 108
           DCP   +
Sbjct: 222 DCPNGQK 228

[60][TOP]
>UniRef100_Q2VCI6 Putative glycine-rich RNA binding protein-like n=1 Tax=Solanum
           tuberosum RepID=Q2VCI6_SOLTU
          Length = 178

 Score =  115 bits (288), Expect = 2e-24
 Identities = 64/100 (64%), Positives = 66/100 (66%), Gaps = 7/100 (7%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGG-YGGGGGYGGG 258
           D DGR+  VN         +   RGGGGGGG  RGGGGYGGG   GGGG YGGGGGYGGG
Sbjct: 71  DLDGRNITVN---------EAQSRGGGGGGG-GRGGGGYGGGRREGGGGGYGGGGGYGGG 120

Query: 257 R----GGGGYGGSGGGYGGGGRGGGRGGGGG--GGGSCYS 156
           R    GGGGY G GGGYGGG R GG GGGGG  GGG  YS
Sbjct: 121 RREGGGGGGYSGGGGGYGGGRREGGYGGGGGGYGGGDRYS 160

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 42/62 (67%), Positives = 42/62 (67%)
 Frame = -3

Query: 335 RGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYS 156
           RGGGG  GGG  GGGGYGGG   GGG   GGYGG GGGYGGG R GG GGG  GGG  Y 
Sbjct: 85  RGGGG--GGGGRGGGGYGGGRREGGG---GGYGG-GGGYGGGRREGGGGGGYSGGGGGYG 138

Query: 155 CG 150
            G
Sbjct: 139 GG 140

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 40/75 (53%), Positives = 40/75 (53%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G RR GGGGGGY  GGGGYGGG     GGYGGGG               GGYGGG
Sbjct: 114 GGGYGGGRREGGGGGGYSGGGGGYGGGRR--EGGYGGGG---------------GGYGGG 156

Query: 209 GRGGGRGGGGGGGGS 165
            R   R   GGGGGS
Sbjct: 157 DRYSDRSSRGGGGGS 171

[61][TOP]
>UniRef100_B7QN34 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7QN34_IXOSC
          Length = 364

 Score =  115 bits (288), Expect = 2e-24
 Identities = 56/82 (68%), Positives = 56/82 (68%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 8   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 67

Query: 218 GGGGRGGGRGGGGGGGGSCYSC 153
           GGGG GGG GGGGGGGG   SC
Sbjct: 68  GGGGGGGGGGGGGGGGGGGVSC 89

 Score =  114 bits (286), Expect = 3e-24
 Identities = 55/80 (68%), Positives = 56/80 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 11  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70

Query: 218 GGGGRGGGRGGGGGGGGSCY 159
           GGGG GGG GGGGGGG SC+
Sbjct: 71  GGGGGGGGGGGGGGGGVSCF 90

 Score =  112 bits (281), Expect = 1e-23
 Identities = 57/92 (61%), Positives = 57/92 (61%)
 Frame = -3

Query: 416 KAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYG 237
           K  N     G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG G
Sbjct: 248 KRANDRSAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 307

Query: 236 GSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 308 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 339

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 61  GGGGGGGGGGGGGGGGGGGGGGGGGG 86

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 256 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 315

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 316 GGGGGGGGGGGGGGGGGGGGGGGGGG 341

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 257 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 316

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 317 GGGGGGGGGGGGGGGGGGGGGGGGGG 342

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 258 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 317

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 318 GGGGGGGGGGGGGGGGGGGGGGGGGG 343

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 259 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 318

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 319 GGGGGGGGGGGGGGGGGGGGGGGGGG 344

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 260 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 319

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 320 GGGGGGGGGGGGGGGGGGGGGGGGGG 345

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 261 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 320

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 321 GGGGGGGGGGGGGGGGGGGGGGGGGG 346

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 262 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 321

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 322 GGGGGGGGGGGGGGGGGGGGGGGGGG 347

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 263 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 322

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 323 GGGGGGGGGGGGGGGGGGGGGGGGGG 348

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 264 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 323

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 324 GGGGGGGGGGGGGGGGGGGGGGGGGG 349

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 265 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 324

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 325 GGGGGGGGGGGGGGGGGGGGGGGGGG 350

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 266 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 325

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 326 GGGGGGGGGGGGGGGGGGGGGGGGGG 351

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 267 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 326

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 327 GGGGGGGGGGGGGGGGGGGGGGGGGG 352

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 268 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 327

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 328 GGGGGGGGGGGGGGGGGGGGGGGGGG 353

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 269 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 328

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 329 GGGGGGGGGGGGGGGGGGGGGGGGGG 354

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 270 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 329

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 330 GGGGGGGGGGGGGGGGGGGGGGGGGG 355

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 271 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 330

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 331 GGGGGGGGGGGGGGGGGGGGGGGGGG 356

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 272 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 331

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 332 GGGGGGGGGGGGGGGGGGGGGGGGGG 357

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 273 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 332

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 333 GGGGGGGGGGGGGGGGGGGGGGGGGG 358

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 274 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 333

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 334 GGGGGGGGGGGGGGGGGGGGGGGGGG 359

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 275 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 334

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 335 GGGGGGGGGGGGGGGGGGGGGGGGGG 360

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 276 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 335

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 336 GGGGGGGGGGGGGGGGGGGGGGGGGG 361

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 277 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 336

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 337 GGGGGGGGGGGGGGGGGGGGGGGGGG 362

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 278 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 337

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 338 GGGGGGGGGGGGGGGGGGGGGGGGGG 363

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 279 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 338

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 339 GGGGGGGGGGGGGGGGGGGGGGGGGG 364

 Score =  111 bits (278), Expect = 2e-23
 Identities = 56/89 (62%), Positives = 56/89 (62%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 209 GRGGGRGGGGGGGGSCYSCGESGHFARDC 123
           G GGG GGGGGGGG     G  G     C
Sbjct: 61  GGGGGGGGGGGGGGGGGGGGGGGGGGVSC 89

[62][TOP]
>UniRef100_B7PDJ6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PDJ6_IXOSC
          Length = 275

 Score =  115 bits (288), Expect = 2e-24
 Identities = 57/88 (64%), Positives = 57/88 (64%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 19  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESGHF 135
           GGGG GGG GGGGGGGG     G   HF
Sbjct: 79  GGGGGGGGGGGGGGGGGGGGGGGGGSHF 106

 Score =  114 bits (285), Expect = 3e-24
 Identities = 56/84 (66%), Positives = 58/84 (69%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 27  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGE 147
           GGGG GGG GGGGGGGGS ++  E
Sbjct: 87  GGGGGGGGGGGGGGGGGSHFNFPE 110

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 61  GGGGGGGGGGGGGGGGGGGGGGGGGG 86

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 2   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 62  GGGGGGGGGGGGGGGGGGGGGGGGGG 87

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 3   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 62

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 63  GGGGGGGGGGGGGGGGGGGGGGGGGG 88

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 4   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 63

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 64  GGGGGGGGGGGGGGGGGGGGGGGGGG 89

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 5   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 65  GGGGGGGGGGGGGGGGGGGGGGGGGG 90

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 6   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 66  GGGGGGGGGGGGGGGGGGGGGGGGGG 91

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 7   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 67  GGGGGGGGGGGGGGGGGGGGGGGGGG 92

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 8   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 67

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 68  GGGGGGGGGGGGGGGGGGGGGGGGGG 93

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 9   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 68

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 69  GGGGGGGGGGGGGGGGGGGGGGGGGG 94

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 10  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 69

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 70  GGGGGGGGGGGGGGGGGGGGGGGGGG 95

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 11  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 71  GGGGGGGGGGGGGGGGGGGGGGGGGG 96

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 12  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 71

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 72  GGGGGGGGGGGGGGGGGGGGGGGGGG 97

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 13  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 73  GGGGGGGGGGGGGGGGGGGGGGGGGG 98

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 14  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 74  GGGGGGGGGGGGGGGGGGGGGGGGGG 99

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 15  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 74

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 75  GGGGGGGGGGGGGGGGGGGGGGGGGG 100

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 16  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 76  GGGGGGGGGGGGGGGGGGGGGGGGGG 101

[63][TOP]
>UniRef100_B7PAQ3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PAQ3_IXOSC
          Length = 235

 Score =  115 bits (288), Expect = 2e-24
 Identities = 53/70 (75%), Positives = 55/70 (78%)
 Frame = -3

Query: 377 QGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGG 198
           +G+ RGGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GG
Sbjct: 163 KGSERGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 222

Query: 197 GRGGGGGGGG 168
           G GGGGGGGG
Sbjct: 223 GGGGGGGGGG 232

 Score =  111 bits (278), Expect = 2e-23
 Identities = 52/67 (77%), Positives = 52/67 (77%)
 Frame = -3

Query: 368 RRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRG 189
           R GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG G
Sbjct: 167 RGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 226

Query: 188 GGGGGGG 168
           GGGGGGG
Sbjct: 227 GGGGGGG 233

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 170 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 229

Query: 182 GGGGG 168
           GGGGG
Sbjct: 230 GGGGG 234

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 171 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 230

Query: 182 GGGGG 168
           GGGGG
Sbjct: 231 GGGGG 235

 Score =  108 bits (270), Expect = 2e-22
 Identities = 51/69 (73%), Positives = 52/69 (75%)
 Frame = -3

Query: 377 QGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGG 198
           +G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GG
Sbjct: 167 RGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 226

Query: 197 GRGGGGGGG 171
           G GGGGGGG
Sbjct: 227 GGGGGGGGG 235

 Score =  106 bits (265), Expect = 7e-22
 Identities = 51/72 (70%), Positives = 52/72 (72%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G+   G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 164 GSERGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 223

Query: 209 GRGGGRGGGGGG 174
           G GGG GGGGGG
Sbjct: 224 GGGGGGGGGGGG 235

 Score =  102 bits (255), Expect = 1e-20
 Identities = 49/68 (72%), Positives = 49/68 (72%)
 Frame = -3

Query: 344 GYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGS 165
           G ERGGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG 
Sbjct: 164 GSERGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 223

Query: 164 CYSCGESG 141
               G  G
Sbjct: 224 GGGGGGGG 231

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 46/68 (67%), Positives = 46/68 (67%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 168 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 227

Query: 218 GGGGRGGG 195
           GGGG GGG
Sbjct: 228 GGGGGGGG 235

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 44/66 (66%), Positives = 45/66 (68%)
 Frame = -3

Query: 338 ERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCY 159
           +R G   GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG   
Sbjct: 161 KRKGSERGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 220

Query: 158 SCGESG 141
             G  G
Sbjct: 221 GGGGGG 226

[64][TOP]
>UniRef100_B7PFE5 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PFE5_IXOSC
          Length = 202

 Score =  115 bits (287), Expect = 2e-24
 Identities = 58/96 (60%), Positives = 60/96 (62%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG 249
           +G S  +   G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GG
Sbjct: 100 EGISHRLEALGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 159

Query: 248 GGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 160 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 195

 Score =  114 bits (284), Expect = 4e-24
 Identities = 58/94 (61%), Positives = 60/94 (63%)
 Frame = -3

Query: 422 RSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGG 243
           R +A+   G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG
Sbjct: 105 RLEALGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164

Query: 242 YGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 165 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 198

 Score =  113 bits (282), Expect = 8e-24
 Identities = 58/96 (60%), Positives = 63/96 (65%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG 249
           +GRS+      P+G + +    GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GG
Sbjct: 90  NGRSR--RSYSPEGISHRLEALGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 147

Query: 248 GGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 148 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 183

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 173

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 174 GGGGGGGGGGGGGGGGGGGGGGGGGG 199

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 174

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 175 GGGGGGGGGGGGGGGGGGGGGGGGGG 200

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 175

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 176 GGGGGGGGGGGGGGGGGGGGGGGGGG 201

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 117 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 176

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 177 GGGGGGGGGGGGGGGGGGGGGGGGGG 202

[65][TOP]
>UniRef100_B5X0E7 Vasa (Fragment) n=1 Tax=Capitella sp. I Grassle & Grassle, 1976
           RepID=B5X0E7_9ANNE
          Length = 516

 Score =  115 bits (287), Expect = 2e-24
 Identities = 61/106 (57%), Positives = 67/106 (63%), Gaps = 11/106 (10%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGG----GGGYGGGRGGGG-YGG 234
           G  G    G+  GGGG GG   GGGG+GG  S GGGG+GG    GGG+GG  GGGG +GG
Sbjct: 39  GGRGGGFGGSSGGGGGFGGSSGGGGGFGGS-SGGGGGFGGSSGRGGGFGGSSGGGGGFGG 97

Query: 233 SGGGYGG-GGRGGGRGG-----GGGGGGSCYSCGESGHFARDCPTS 114
           S GG GG GG  GG GG     GGGGG  C  CGE GHFAR+CP S
Sbjct: 98  SSGGGGGFGGSSGGGGGFGGSSGGGGGSGCRKCGEEGHFARECPNS 143

 Score =  105 bits (261), Expect = 2e-21
 Identities = 60/128 (46%), Positives = 67/128 (52%), Gaps = 27/128 (21%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGG---GYGGGGGYGGGR 255
           GR      +   G    G+  GGGG GG   GGGG+GG    GGG     GGGGG+GG  
Sbjct: 40  GRGGGFGGSSGGGGGFGGSSGGGGGFGGSSGGGGGFGGSSGRGGGFGGSSGGGGGFGGSS 99

Query: 254 GGGG-YGGSGGGYGG-GGRGGGRGG--------------------GGGGGGS--CYSCGE 147
           GGGG +GGS GG GG GG  GG GG                    GGGGGGS  C+ CGE
Sbjct: 100 GGGGGFGGSSGGGGGFGGSSGGGGGSGCRKCGEEGHFARECPNSEGGGGGGSGNCHKCGE 159

Query: 146 SGHFARDC 123
            GHFAR+C
Sbjct: 160 PGHFAREC 167

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 40/84 (47%), Positives = 42/84 (50%), Gaps = 6/84 (7%)
 Frame = -3

Query: 368 RRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRG 189
           + GGGGGGG  RG    G  G +       GGG   GRGGG  G SGGG G GG  GG  
Sbjct: 9   KAGGGGGGG--RGCHKCGEEGHFARECPSAGGG---GRGGGFGGSSGGGGGFGGSSGG-- 61

Query: 188 GG------GGGGGSCYSCGESGHF 135
           GG      GGGGG   S G  G F
Sbjct: 62  GGGFGGSSGGGGGFGGSSGRGGGF 85

[66][TOP]
>UniRef100_A0NCZ0 AGAP001055-PA (Fragment) n=1 Tax=Anopheles gambiae
           RepID=A0NCZ0_ANOGA
          Length = 208

 Score =  115 bits (287), Expect = 2e-24
 Identities = 58/90 (64%), Positives = 59/90 (65%)
 Frame = -3

Query: 410 VNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGS 231
           V V G  G +  G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG 
Sbjct: 13  VRVVGGGGNSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72

Query: 230 GGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 73  GGGGGGGGGGGGGGGGGGGGGGGGGPGGGG 102

 Score =  112 bits (281), Expect = 1e-23
 Identities = 55/83 (66%), Positives = 56/83 (67%)
 Frame = -3

Query: 416 KAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYG 237
           + V   G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG G
Sbjct: 14  RVVGGGGNSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73

Query: 236 GSGGGYGGGGRGGGRGGGGGGGG 168
           G GGG GGGG GGG GGGGGGGG
Sbjct: 74  GGGGGGGGGGGGGGGGGGGGGGG 96

 Score =  107 bits (267), Expect = 4e-22
 Identities = 54/86 (62%), Positives = 54/86 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 28  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG G GGGG G     G  G
Sbjct: 88  GGGGGGGGGGPGGGGWGGWRGRGAGG 113

 Score =  107 bits (267), Expect = 4e-22
 Identities = 54/86 (62%), Positives = 54/86 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 30  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGG GG      G  G
Sbjct: 90  GGGGGGGGPGGGGWGGWRGRGAGGGG 115

 Score =  107 bits (267), Expect = 4e-22
 Identities = 56/88 (63%), Positives = 56/88 (63%), Gaps = 2/88 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 39  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGP 98

Query: 218 GGGGRGG--GRGGGGGGGGSCYSCGESG 141
           GGGG GG  GRG GGGGGG     G  G
Sbjct: 99  GGGGWGGWRGRGAGGGGGGGGGGGGGGG 126

 Score =  107 bits (266), Expect = 5e-22
 Identities = 54/90 (60%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG---SG 228
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG+GG    G
Sbjct: 51  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGPGGGGWGGWRGRG 110

Query: 227 GGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
            G GGGG GGG GGGGGGGG   +   + H
Sbjct: 111 AGGGGGGGGGGGGGGGGGGGQIRTYSNNKH 140

 Score =  103 bits (258), Expect = 5e-21
 Identities = 56/97 (57%), Positives = 56/97 (57%), Gaps = 11/97 (11%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 32  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91

Query: 218 GGGG-----------RGGGRGGGGGGGGSCYSCGESG 141
           GGGG           RG G GGGGGGGG     G  G
Sbjct: 92  GGGGGGPGGGGWGGWRGRGAGGGGGGGGGGGGGGGGG 128

[67][TOP]
>UniRef100_B7PQ78 H/ACA ribonucleoprotein complex protein, putative n=1 Tax=Ixodes
           scapularis RepID=B7PQ78_IXOSC
          Length = 126

 Score =  114 bits (286), Expect = 3e-24
 Identities = 52/71 (73%), Positives = 55/71 (77%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGG 195
           G++ GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG
Sbjct: 56  GSKDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115

Query: 194 RGGGGGGGGSC 162
            GGGGGGG +C
Sbjct: 116 GGGGGGGGATC 126

 Score =  108 bits (269), Expect = 2e-22
 Identities = 51/73 (69%), Positives = 52/73 (71%)
 Frame = -3

Query: 386 ANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGG 207
           A + G R G   GGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG
Sbjct: 48  AGISGRRLGSKDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107

Query: 206 RGGGRGGGGGGGG 168
            GGG GGGGGGGG
Sbjct: 108 GGGGGGGGGGGGG 120

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/65 (69%), Positives = 45/65 (69%)
 Frame = -3

Query: 392 DGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGG 213
           DG    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GG
Sbjct: 59  DGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118

Query: 212 GGRGG 198
           GG GG
Sbjct: 119 GGGGG 123

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 44/65 (67%), Positives = 44/65 (67%)
 Frame = -3

Query: 335 RGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYS 156
           R G   GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG    
Sbjct: 54  RLGSKDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113

Query: 155 CGESG 141
            G  G
Sbjct: 114 GGGGG 118

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/64 (67%), Positives = 43/64 (67%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 60  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119

Query: 218 GGGG 207
           GGGG
Sbjct: 120 GGGG 123

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 44/72 (61%), Positives = 44/72 (61%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           GR       G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGG
Sbjct: 52  GRRLGSKDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111

Query: 245 GYGGSGGGYGGG 210
           G GG GGG GGG
Sbjct: 112 GGGGGGGGGGGG 123

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 37/59 (62%), Positives = 37/59 (62%)
 Frame = -3

Query: 317 GGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G  G   G   GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 49  GISGRRLGSKDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 36/57 (63%), Positives = 36/57 (63%)
 Frame = -3

Query: 311 GGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G   G    GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 52  GRRLGSKDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 36/56 (64%), Positives = 37/56 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGS 231
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG+
Sbjct: 69  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGA 124

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 35/56 (62%), Positives = 36/56 (64%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGS 231
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG G +
Sbjct: 70  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAT 125

[68][TOP]
>UniRef100_C1EFP7 Receptor-like cell wall protein n=1 Tax=Micromonas sp. RCC299
            RepID=C1EFP7_9CHLO
          Length = 1985

 Score =  114 bits (285), Expect = 3e-24
 Identities = 52/79 (65%), Positives = 54/79 (68%), Gaps = 3/79 (3%)
 Frame = +1

Query: 172  PPPPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS* 342
            PPPPPPP PPP PPPP PPP    PP PPPP PPP  PPPP PPPP  PPPP PPPP   
Sbjct: 1459 PPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP-SPPPPSPPPPLPP 1517

Query: 343  PPPPPPPRLVP*TLAPSGP 399
            PP PPPP   P  ++PS P
Sbjct: 1518 PPSPPPPSSPP-PMSPSPP 1535

 Score =  111 bits (278), Expect = 2e-23
 Identities = 55/91 (60%), Positives = 55/91 (60%), Gaps = 8/91 (8%)
 Frame = +1

Query: 127  SLAK*PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPP 297
            SL   P  P     PP PPPP  PPP PPPP PPP    PP PPPP PPP  PPPP PPP
Sbjct: 1454 SLVANPPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 1513

Query: 298  P*LPPPP*PPPPRS*P-----PPPPPPRLVP 375
            P LPPPP PPPP S P     PPPPPP   P
Sbjct: 1514 P-LPPPPSPPPPSSPPPMSPSPPPPPPPFPP 1543

[69][TOP]
>UniRef100_A2BTV1 RNA-binding region RNP-1 (RNA recognition motif) n=1
           Tax=Prochlorococcus marinus str. MIT 9515
           RepID=A2BTV1_PROM5
          Length = 222

 Score =  114 bits (285), Expect = 3e-24
 Identities = 61/93 (65%), Positives = 64/93 (68%), Gaps = 7/93 (7%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGG--GGYERGG--GGYGGGGSYGG-GGYGGGGGYGG 261
           GR   +N   P G    G RRGGGGG  GGY  GG  GGYGGGG+ GG GG G GGGYGG
Sbjct: 69  GRPLRINKAEPRGGG--GQRRGGGGGRGGGYGGGGNGGGYGGGGNGGGYGGGGNGGGYGG 126

Query: 260 GRGGGGYGG--SGGGYGGGGRGGGRGGGGGGGG 168
           G  GGGYGG  +GGGYGGGG GGG GGGG GGG
Sbjct: 127 GGNGGGYGGGGNGGGYGGGGNGGGYGGGGNGGG 159

 Score =  100 bits (249), Expect = 5e-20
 Identities = 51/73 (69%), Positives = 53/73 (72%), Gaps = 2/73 (2%)
 Frame = -3

Query: 353 GGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGY--GGSGGGYGGGGRGGGRGGGG 180
           GGGG  RGGGG G GG YGGGG   GGGYGGG  GGGY  GG+GGGYGGGG GGG GGGG
Sbjct: 81  GGGGQRRGGGG-GRGGGYGGGG--NGGGYGGGGNGGGYGGGGNGGGYGGGGNGGGYGGGG 137

Query: 179 GGGGSCYSCGESG 141
            GGG  Y  G +G
Sbjct: 138 NGGG--YGGGGNG 148

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/79 (65%), Positives = 54/79 (68%), Gaps = 2/79 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGG--GGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           G  G    G   GGG GGGY  GG  GGYGGGG+  GGGYGGGG  GGG GG   GG+GG
Sbjct: 96  GYGGGGNGGGYGGGGNGGGYGGGGNGGGYGGGGN--GGGYGGGGN-GGGYGG---GGNGG 149

Query: 224 GYGGGGRGGGRGGGGGGGG 168
           GYGGGG GGG GGGG GGG
Sbjct: 150 GYGGGGNGGGYGGGGYGGG 168

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 46/73 (63%), Positives = 48/73 (65%), Gaps = 2/73 (2%)
 Frame = -3

Query: 407 NVTGPDGANVQGTRRGGGGGGGYERGG--GGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG 234
           N  G  G    G   GGG GGGY  GG  GGYGGGG+  GGGYGGGG  GGG GG   GG
Sbjct: 102 NGGGYGGGGNGGGYGGGGNGGGYGGGGNGGGYGGGGN--GGGYGGGGN-GGGYGG---GG 155

Query: 233 SGGGYGGGGRGGG 195
           +GGGYGGGG GGG
Sbjct: 156 NGGGYGGGGYGGG 168

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 38/72 (52%), Positives = 39/72 (54%), Gaps = 3/72 (4%)
 Frame = -3

Query: 407 NVTGPDGANVQGTRRGGGGGGGYERGG--GGYGGGGSYGG-GGYGGGGGYGGGRGGGGYG 237
           N  G  G    G   GGG GGGY  GG  GGYGGGG+ GG GG G GGGYGGG  GGGY 
Sbjct: 111 NGGGYGGGGNGGGYGGGGNGGGYGGGGNGGGYGGGGNGGGYGGGGNGGGYGGGGYGGGYS 170

Query: 236 GSGGGYGGGGRG 201
                Y     G
Sbjct: 171 EPASNYANKSSG 182

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 26/44 (59%), Positives = 28/44 (63%)
 Frame = -3

Query: 266 GGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGHF 135
           GGG+  GG GG GGGYGGGG GGG GG GG GG     G  G +
Sbjct: 82  GGGQRRGGGGGRGGGYGGGGNGGGYGG-GGNGGGYGGGGNGGGY 124

[70][TOP]
>UniRef100_B4FNK1 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4FNK1_MAIZE
          Length = 395

 Score =  114 bits (285), Expect = 3e-24
 Identities = 59/106 (55%), Positives = 66/106 (62%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRG 252
           +DGR+KAV+VTGPDG+ V    RGGGGGGG                    GGGGYG  RG
Sbjct: 61  DDGRTKAVDVTGPDGSFV----RGGGGGGG--------------------GGGGYGS-RG 95

Query: 251 GGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGHFARDCPTS 114
           GGG GG G  YGG   GG R GGGGG G+CY CGE GH ARDCP++
Sbjct: 96  GGGSGGGGRSYGGSWGGGRRSGGGGGPGACYKCGEPGHMARDCPSA 141

[71][TOP]
>UniRef100_B7P9A9 HyFMR1 protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7P9A9_IXOSC
          Length = 506

 Score =  114 bits (285), Expect = 3e-24
 Identities = 55/81 (67%), Positives = 56/81 (69%)
 Frame = -3

Query: 410 VNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGS 231
           +  TG  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG 
Sbjct: 421 LGATGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 480

Query: 230 GGGYGGGGRGGGRGGGGGGGG 168
           GGG GGGG GGG GGGGGGGG
Sbjct: 481 GGGGGGGGGGGGGGGGGGGGG 501

 Score =  112 bits (281), Expect = 1e-23
 Identities = 56/83 (67%), Positives = 56/83 (67%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           GA   G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 422 GATGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 481

Query: 209 GRGGGRGGGGGGGGSCYSCGESG 141
           G GGG GGGGGGGG     G  G
Sbjct: 482 GGGGGGGGGGGGGGGGGGGGGGG 504

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 426 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 485

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GGGGGGGG
Sbjct: 486 GGGGGGGGGGGGGGGGG 502

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 427 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 486

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GGGGGGGG
Sbjct: 487 GGGGGGGGGGGGGGGGG 503

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 428 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 487

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GGGGGGGG
Sbjct: 488 GGGGGGGGGGGGGGGGG 504

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 429 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 488

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GGGGGGGG
Sbjct: 489 GGGGGGGGGGGGGGGGG 505

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 430 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 489

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GGGGGGGG
Sbjct: 490 GGGGGGGGGGGGGGGGG 506

 Score =  110 bits (276), Expect = 4e-23
 Identities = 53/74 (71%), Positives = 53/74 (71%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 432 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 491

Query: 182 GGGGGSCYSCGESG 141
           GGGGG     G  G
Sbjct: 492 GGGGGGGGGGGGGG 505

 Score =  110 bits (276), Expect = 4e-23
 Identities = 53/74 (71%), Positives = 53/74 (71%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 433 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 492

Query: 182 GGGGGSCYSCGESG 141
           GGGGG     G  G
Sbjct: 493 GGGGGGGGGGGGGG 506

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 50/78 (64%), Positives = 52/78 (66%), Gaps = 2/78 (2%)
 Frame = -3

Query: 368 RRGGGGGGG--YERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGG 195
           RRGGGG     ++ G  G GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG
Sbjct: 408 RRGGGGNQLILWKLGATGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 467

Query: 194 RGGGGGGGGSCYSCGESG 141
            GGGGGGGG     G  G
Sbjct: 468 GGGGGGGGGGGGGGGGGG 485

[72][TOP]
>UniRef100_B7QAD8 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7QAD8_IXOSC
          Length = 164

 Score =  114 bits (284), Expect = 4e-24
 Identities = 58/94 (61%), Positives = 59/94 (62%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 209 GRGGGRGGGGGGGGSCYSCGESGHFARDCPTSAR 108
           G GGG GGGGGGGG     G  G   +  P S R
Sbjct: 61  GGGGGGGGGGGGGGGGGGGGGGGTGPQRSPKSTR 94

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/78 (69%), Positives = 55/78 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 7   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66

Query: 218 GGGGRGGGRGGGGGGGGS 165
           GGGG GGG GGGGGGGG+
Sbjct: 67  GGGGGGGGGGGGGGGGGT 84

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GGGGGGGG
Sbjct: 61  GGGGGGGGGGGGGGGGG 77

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 4   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 63

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GGGGGGGG
Sbjct: 64  GGGGGGGGGGGGGGGGG 80

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 5   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GGGGGGGG
Sbjct: 65  GGGGGGGGGGGGGGGGG 81

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 6   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GGGGGGGG
Sbjct: 66  GGGGGGGGGGGGGGGGG 82

 Score =  108 bits (271), Expect = 1e-22
 Identities = 53/77 (68%), Positives = 53/77 (68%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 9   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 68

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GGGGGG G
Sbjct: 69  GGGGGGGGGGGGGGGTG 85

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 45/69 (65%), Positives = 45/69 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 20  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79

Query: 218 GGGGRGGGR 192
           GGGG G  R
Sbjct: 80  GGGGTGPQR 88

[73][TOP]
>UniRef100_B7P671 Cement protein, putative n=1 Tax=Ixodes scapularis
           RepID=B7P671_IXOSC
          Length = 324

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/93 (61%), Positives = 60/93 (64%)
 Frame = -3

Query: 419 SKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGY 240
           S+ ++  G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG 
Sbjct: 27  SELLSYKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86

Query: 239 GGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 87  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119

 Score =  113 bits (283), Expect = 6e-24
 Identities = 55/93 (59%), Positives = 62/93 (66%)
 Frame = -3

Query: 419 SKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGY 240
           SK +++   + + +   + GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG 
Sbjct: 16  SKILSILAHNPSELLSYKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75

Query: 239 GGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 76  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 35  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 95  GGGGGGGGGGGGGGGGGGGGGGGGGG 120

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 36  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 96  GGGGGGGGGGGGGGGGGGGGGGGGGG 121

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 37  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 97  GGGGGGGGGGGGGGGGGGGGGGGGGG 122

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 38  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 98  GGGGGGGGGGGGGGGGGGGGGGGGGG 123

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 39  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 99  GGGGGGGGGGGGGGGGGGGGGGGGGG 124

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 40  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGGGGGG 125

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 41  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 101 GGGGGGGGGGGGGGGGGGGGGGGGGG 126

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 42  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGG 127

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 43  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 103 GGGGGGGGGGGGGGGGGGGGGGGGGG 128

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 44  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGGGGGG 129

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 45  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 105 GGGGGGGGGGGGGGGGGGGGGGGGGG 130

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 46  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 105

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 106 GGGGGGGGGGGGGGGGGGGGGGGGGG 131

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 47  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 106

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 107 GGGGGGGGGGGGGGGGGGGGGGGGGG 132

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 48  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 108 GGGGGGGGGGGGGGGGGGGGGGGGGG 133

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 49  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGGGG 134

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 50  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 110 GGGGGGGGGGGGGGGGGGGGGGGGGG 135

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 51  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGG 136

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 52  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGG 137

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 53  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGG 138

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 54  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGG 139

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 55  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGG 140

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 56  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGG 141

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 57  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 117 GGGGGGGGGGGGGGGGGGGGGGGGGG 142

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 58  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 118 GGGGGGGGGGGGGGGGGGGGGGGGGG 143

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 59  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 119 GGGGGGGGGGGGGGGGGGGGGGGGGG 144

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 60  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 120 GGGGGGGGGGGGGGGGGGGGGGGGGG 145

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 61  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 121 GGGGGGGGGGGGGGGGGGGGGGGGGG 146

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 62  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 121

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 122 GGGGGGGGGGGGGGGGGGGGGGGGGG 147

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 63  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 122

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGGGGGG 148

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 64  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 123

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 124 GGGGGGGGGGGGGGGGGGGGGGGGGG 149

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 65  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 124

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 125 GGGGGGGGGGGGGGGGGGGGGGGGGG 150

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 66  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 125

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGGGGGG 151

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 67  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 126

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 127 GGGGGGGGGGGGGGGGGGGGGGGGGG 152

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 68  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 127

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 128 GGGGGGGGGGGGGGGGGGGGGGGGGG 153

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 69  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 128

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 129 GGGGGGGGGGGGGGGGGGGGGGGGGG 154

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 70  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 129

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 130 GGGGGGGGGGGGGGGGGGGGGGGGGG 155

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 71  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 130

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 131 GGGGGGGGGGGGGGGGGGGGGGGGGG 156

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 72  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 131

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGG 157

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 73  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 132

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGG 158

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 74  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 133

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGG 159

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 75  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 134

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGG 160

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 76  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 135

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGG 161

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 77  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 136

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGG 162

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 78  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 137

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGG 163

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 79  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 138

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGG 164

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 80  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 139

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGG 165

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 81  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 140

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGGG 166

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 82  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 141

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGGGG 167

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 83  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 142

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGGGGGG 168

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 84  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 143

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 144 GGGGGGGGGGGGGGGGGGGGGGGGGG 169

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 85  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 144

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 145 GGGGGGGGGGGGGGGGGGGGGGGGGG 170

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 86  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 145

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 146 GGGGGGGGGGGGGGGGGGGGGGGGGG 171

[74][TOP]
>UniRef100_A7SMB3 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SMB3_NEMVE
          Length = 218

 Score =  114 bits (284), Expect = 4e-24
 Identities = 62/100 (62%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGG----GGGYE---RGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGY 240
           G  G    G  RGGGG    GGGY    RGGGGYGGGG YGGGGYGGGG  GGG GGGGY
Sbjct: 107 GGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGG-YGGGGYGGGGHGGGGYGGGGY 165

Query: 239 GGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGHFARDCP 120
           GG GGGYGG G GGG G GGGG    Y  G SG    + P
Sbjct: 166 GGGGGGYGGSGYGGGGGYGGGG----YGGGRSGGGGYEVP 201

 Score =  105 bits (261), Expect = 2e-21
 Identities = 62/103 (60%), Positives = 64/103 (62%), Gaps = 6/103 (5%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSY-GGGGY-GGGGGYGG-G 258
           +GR   V     D     G RRGGG GGG   GGGGY  GG Y GGGGY GGGGGY G G
Sbjct: 78  EGRRLKVAEASKDSGG--GGRRGGGYGGG-RGGGGGYRSGGGYRGGGGYRGGGGGYRGRG 134

Query: 257 RGGGGYGGSG---GGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           RGGGGYGG G   GGYGGGG GGG  GGGG GG     G SG+
Sbjct: 135 RGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGY 177

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 43/70 (61%), Positives = 44/70 (62%), Gaps = 1/70 (1%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGY-GGGGSYGGGGYGGGGGYGGGRGG 249
           GR +     G  G    G   GG GGGGY  GGGGY GGGG YGG GYGGGGGYGGG  G
Sbjct: 132 GRGRGGGGYGGGGYGGGGYGGGGHGGGGY--GGGGYGGGGGGYGGSGYGGGGGYGGGGYG 189

Query: 248 GGYGGSGGGY 219
           GG  G GGGY
Sbjct: 190 GGRSG-GGGY 198

[75][TOP]
>UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata
           RepID=UPI0001926FBD
          Length = 268

 Score =  113 bits (283), Expect = 6e-24
 Identities = 55/92 (59%), Positives = 55/92 (59%), Gaps = 6/92 (6%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPP---PPPRPPPRPPPP*PPPLPPYPPPPRPPP---*PPPPPYPPPP* 303
           P  P     PPPPP   PPP PPP PPPP PPP PP PPPP PPP    PPPPP PPPP 
Sbjct: 121 PPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPA 180

Query: 304 LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             PPP PPPP   PPPPPPP   P    P  P
Sbjct: 181 PCPPPPPPPPMCLPPPPPPPPPPPPCPLPPPP 212

 Score =  111 bits (277), Expect = 3e-23
 Identities = 53/82 (64%), Positives = 54/82 (65%), Gaps = 5/82 (6%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPP--PP*PPPLPPYPPPPRPPP*PPPPPYPPPP*L---PPPP*PPPP 333
           PPPPPPPP  PP PP   P PPP PP PPPP PPP PPPPP PPPP +   PPPP PPPP
Sbjct: 120 PPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPP 179

Query: 334 RS*PPPPPPPRLVP*TLAPSGP 399
              PPPPPPP   P  L P  P
Sbjct: 180 APCPPPPPPP---PMCLPPPPP 198

 Score =  108 bits (269), Expect = 2e-22
 Identities = 54/96 (56%), Positives = 55/96 (57%), Gaps = 10/96 (10%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPP----------PPRPPP*PPPPPYP 291
           P  P +   PPPPPPPP PPP PPPP PPP PP PP          PP P P PPPPP P
Sbjct: 130 PPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPP-P 188

Query: 292 PPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP  LPPPP PPPP    P PPPP   P   AP  P
Sbjct: 189 PPMCLPPPPPPPPPPPPCPLPPPPPPCPPPPAPCPP 224

 Score =  107 bits (268), Expect = 3e-22
 Identities = 50/76 (65%), Positives = 50/76 (65%), Gaps = 11/76 (14%)
 Frame = +1

Query: 169 PPPPPPPPRPPP----RPPPP*PPPLPPYPPPPRPPP*---PPPPPYPPPP*L----PPP 315
           PPPPPPPP PPP     PPPP PPP  P PPPP PPP    PPPPP PPPP      PPP
Sbjct: 154 PPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPPPPP 213

Query: 316 P*PPPPRS*PPPPPPP 363
           P PPPP   PPPPPPP
Sbjct: 214 PCPPPPAPCPPPPPPP 229

 Score =  102 bits (255), Expect = 1e-20
 Identities = 57/108 (52%), Positives = 59/108 (54%), Gaps = 10/108 (9%)
 Frame = +1

Query: 133 AK*PDSPQL*QLPPPP---PPPPRPPPR---PPPP*PPPLPPYPPP----PRPPP*PPPP 282
           +K P  PQ    PPPP   PPPP PPP    PPPP PPP+ P PPP    P PPP PPPP
Sbjct: 89  SKPPPPPQPACPPPPPGCGPPPPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPP 148

Query: 283 PYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRP 426
           P PPPP  PPPP PPPP    PPPPP    P    P  P     L  P
Sbjct: 149 PPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPP 196

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 46/84 (54%), Positives = 47/84 (55%), Gaps = 6/84 (7%)
 Frame = +1

Query: 166 LPP-----PPPPPPRPPPRPPPP*PPPLPPYPPPPRP-PP*PPPPPYPPPP*LPPPP*PP 327
           LPP      PPPPP+P   PPPP   P PP PPPP P PP PPPPP  PPP   PP   P
Sbjct: 82  LPPVTDGSKPPPPPQPACPPPPPGCGPPPPCPPPPAPCPPPPPPPPVCPPP---PPMCAP 138

Query: 328 PPRS*PPPPPPPRLVP*TLAPSGP 399
           PP   PPPPPPP   P    P  P
Sbjct: 139 PP---PPPPPPPPPPPPPPPPPPP 159

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 44/88 (50%), Positives = 45/88 (51%), Gaps = 5/88 (5%)
 Frame = +1

Query: 151 PQL*QLP---PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP- 318
           P   QLP    P  PP     +PPPP  P  PP PP   PPP  PPPP P PP  PPPP 
Sbjct: 69  PMANQLPCTLAPLLPPVTDGSKPPPPPQPACPPPPPGCGPPPPCPPPPAPCPPPPPPPPV 128

Query: 319 -*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             PPPP   PPPPPPP   P    P  P
Sbjct: 129 CPPPPPMCAPPPPPPPPPPPPPPPPPPP 156

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 37/76 (48%), Positives = 39/76 (51%), Gaps = 7/76 (9%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRP-----PPP*PPPLPPYPPPPRPPP*PPPPPYPPPP--*LPPPP*PP 327
           PP  P  P P   P     P    P LPP     +PPP PP P  PPPP    PPPP PP
Sbjct: 56  PPVQPAAPAPLAYPMANQLPCTLAPLLPPVTDGSKPPP-PPQPACPPPPPGCGPPPPCPP 114

Query: 328 PPRS*PPPPPPPRLVP 375
           PP   PPPPPPP + P
Sbjct: 115 PPAPCPPPPPPPPVCP 130

[76][TOP]
>UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2B5_EHV86
          Length = 2332

 Score =  113 bits (283), Expect = 6e-24
 Identities = 55/85 (64%), Positives = 55/85 (64%), Gaps = 2/85 (2%)
 Frame = +1

Query: 142  PDSPQL*QLPPPP-PPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
            P  P    LPPPP PPPP PPP  PPP PPP PP  PPP PPP  PPPP PPPP  PPPP
Sbjct: 941  PPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPP-NPPPP 999

Query: 319  *PPPPRS*PPPP-PPPRLVP*TLAP 390
             PPPP   PPPP PPP L P  L P
Sbjct: 1000 SPPPPLPLPPPPSPPPPLPPPPLPP 1024

 Score =  113 bits (283), Expect = 6e-24
 Identities = 53/77 (68%), Positives = 53/77 (68%), Gaps = 3/77 (3%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PP---PLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS 339
            PPPP PPP PPP PPPP PP   P PP PPPP PPP  PPPP PPPP LPPPP PPPP  
Sbjct: 1150 PPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPP-LPPPPLPPPPV- 1207

Query: 340  *PPPPPPPRLVP*TLAP 390
             PPPP PP L P  L P
Sbjct: 1208 -PPPPSPPPLPPPPLPP 1223

 Score =  113 bits (282), Expect = 7e-24
 Identities = 54/87 (62%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
            P SP     PP PPPP  PPP PPPP PPP  P PPPP PPP  PPPP PPPP LPPPP 
Sbjct: 796  PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPP-LPPPPS 854

Query: 322  PPP-PRS*PPPPPPPRLVP*TLAPSGP 399
            PPP P   PPP PPP   P T  P  P
Sbjct: 855  PPPSPPPSPPPSPPPSPPPPTPPPPAP 881

 Score =  113 bits (282), Expect = 7e-24
 Identities = 57/93 (61%), Positives = 60/93 (64%), Gaps = 4/93 (4%)
 Frame = +1

Query: 166  LPPPP-PPPPRPPPRPPPP*PPP-LPPYP-PPPRPPP*PPP-PPYPPPP*LPPPP*PPPP 333
            LPPPP PPPP PPP PPPP PPP LPP P PPP PPP PPP PP  PPP  PPPP PPPP
Sbjct: 935  LPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPP 994

Query: 334  RS*PPPPPPPRLVP*TLAPSGPVTLTALDRPSL 432
               PP PPPP  +P   +P  P+    L  P L
Sbjct: 995  NPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPL 1027

 Score =  113 bits (282), Expect = 7e-24
 Identities = 54/87 (62%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
            P SP     PP PPPP  PPP PPPP PPP  P PPPP PPP  PPPP PPPP LPPPP 
Sbjct: 974  PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPP-LPPPPS 1032

Query: 322  PPP-PRS*PPPPPPPRLVP*TLAPSGP 399
            PPP P   PPP PPP   P T  P  P
Sbjct: 1033 PPPSPPPSPPPSPPPSPPPPTPPPPAP 1059

 Score =  113 bits (282), Expect = 7e-24
 Identities = 54/87 (62%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
            P SP     PP PPPP  PPP PPPP PPP  P PPPP PPP  PPPP PPPP LPPPP 
Sbjct: 1065 PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPP-LPPPPS 1123

Query: 322  PPP-PRS*PPPPPPPRLVP*TLAPSGP 399
            PPP P   PPP PPP   P T  P  P
Sbjct: 1124 PPPSPPPSPPPSPPPSPPPPTPPPPAP 1150

 Score =  112 bits (281), Expect = 1e-23
 Identities = 54/89 (60%), Positives = 55/89 (61%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP*LPP 312
           P SP     PPP PPPP PPP PPPP PPP    PP PPPP PPP PPP P P PP  PP
Sbjct: 687 PPSPS----PPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPP 742

Query: 313 PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP PPPP   PPPP PP   P +  PS P
Sbjct: 743 PPTPPPPA--PPPPAPPPAPPPSPPPSPP 769

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/97 (55%), Positives = 57/97 (58%), Gaps = 8/97 (8%)
 Frame = +1

Query: 166  LPPPP-PPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPP-------P*LPPPP* 321
            LPPPP PPPP PPP PPP  PP  PP PPPP PPP  PPPP PPP       P  PPPP 
Sbjct: 1022 LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPA 1081

Query: 322  PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRPSL 432
            PPPP   PP PPPP  +P   +P  P+    L  P L
Sbjct: 1082 PPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPL 1118

 Score =  111 bits (278), Expect = 2e-23
 Identities = 53/85 (62%), Positives = 54/85 (63%), Gaps = 7/85 (8%)
 Frame = +1

Query: 166  LPPPP-PPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP------*LPPPP*P 324
            LPPPP PPPP PPP PPP  PP  PP PPPP PPP  PPPP PPPP       LPPPP P
Sbjct: 954  LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSP 1013

Query: 325  PPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPP   PP PPPP   P +  PS P
Sbjct: 1014 PPPLPPPPLPPPPLPPPPSPPPSPP 1038

 Score =  111 bits (277), Expect = 3e-23
 Identities = 55/94 (58%), Positives = 56/94 (59%), Gaps = 8/94 (8%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPP--YPPPPRPPP*PPPPPYP------PP 297
            P SP     PPP PPPP PPP PPP  PPP PP   PPPP PPP  PPPP P      PP
Sbjct: 777  PPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPP 836

Query: 298  P*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            P LPPPP PPPP   PPPP PP   P +  PS P
Sbjct: 837  PPLPPPPLPPPPL--PPPPSPPPSPPPSPPPSPP 868

 Score =  111 bits (277), Expect = 3e-23
 Identities = 53/95 (55%), Positives = 56/95 (58%), Gaps = 8/95 (8%)
 Frame = +1

Query: 166  LPPPP-PPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPP-------P*LPPPP* 321
            LPPPP PPPP PPP PPP  PP  PP PPPP PPP  PPPP PPP       P  PPPP 
Sbjct: 844  LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPA 903

Query: 322  PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRP 426
            PPPP   PP PPPP  +P   +P  P+    L  P
Sbjct: 904  PPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPP 938

 Score =  111 bits (277), Expect = 3e-23
 Identities = 55/94 (58%), Positives = 56/94 (59%), Gaps = 8/94 (8%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPP--YPPPPRPPP*PPPPPYP------PP 297
            P SP     PPP PPPP PPP PPP  PPP PP   PPPP PPP  PPPP P      PP
Sbjct: 1046 PPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPP 1105

Query: 298  P*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            P LPPPP PPPP   PPPP PP   P +  PS P
Sbjct: 1106 PPLPPPPLPPPPL--PPPPSPPPSPPPSPPPSPP 1137

 Score =  110 bits (276), Expect = 4e-23
 Identities = 56/98 (57%), Positives = 56/98 (57%), Gaps = 2/98 (2%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LP--PP 315
            P SP     PPP PPPP PPP  PPP PPP PP  PPP PPP  PPPP PPPP  P  PP
Sbjct: 832  PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPP 891

Query: 316  P*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRPS 429
            P PPPP   PP PPPP   P    PS P  L     PS
Sbjct: 892  PSPPPPTPPPPAPPPPNPPP----PSPPPPLPLPPPPS 925

 Score =  110 bits (276), Expect = 4e-23
 Identities = 56/98 (57%), Positives = 56/98 (57%), Gaps = 2/98 (2%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LP--PP 315
            P SP     PPP PPPP PPP  PPP PPP PP  PPP PPP  PPPP PPPP  P  PP
Sbjct: 1010 PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPP 1069

Query: 316  P*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRPS 429
            P PPPP   PP PPPP   P    PS P  L     PS
Sbjct: 1070 PSPPPPTPPPPAPPPPNPPP----PSPPPPLPLPPPPS 1103

 Score =  110 bits (276), Expect = 4e-23
 Identities = 54/90 (60%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPL-PPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
            P SP     PP PPPP  PPP PPPP PPP  PP PPPP PPP  PPPP PPPP  PPPP
Sbjct: 1133 PPSP-----PPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP-SPPPP 1186

Query: 319  *PPPPRS*PPPPPPPRLVP*TLAPSGPVTL 408
             PPPP   PP PPPP   P    P  P  L
Sbjct: 1187 LPPPPSPPPPLPPPPLPPPPVPPPPSPPPL 1216

 Score =  110 bits (276), Expect = 4e-23
 Identities = 55/91 (60%), Positives = 56/91 (61%), Gaps = 2/91 (2%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPP--YPPPPRPPP*PPPPPYPPPP*LPPP 315
            P SP     PPP PPPP PPP  PPP PPP PP   PPPP PPP  PPPP PPPP LPPP
Sbjct: 1137 PPSP-----PPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPP-LPPP 1190

Query: 316  P*PPPPRS*PPPPPPPRLVP*TLAPSGPVTL 408
            P PPPP   PP PPPP   P +  P  P  L
Sbjct: 1191 PSPPPPLPPPPLPPPPVPPPPSPPPLPPPPL 1221

 Score =  110 bits (276), Expect = 4e-23
 Identities = 52/77 (67%), Positives = 52/77 (67%), Gaps = 3/77 (3%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PP---PLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS 339
            PPP PPP  PPP PPPP PP   P PP PPPP PPP  PPPP PPPP LPPPP PPPP  
Sbjct: 1155 PPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPP-LPPPPVPPPPS- 1212

Query: 340  *PPPPPPPRLVP*TLAP 390
             PPP PPP L P  L P
Sbjct: 1213 -PPPLPPPPLPPPPLPP 1228

 Score =  110 bits (275), Expect = 5e-23
 Identities = 57/101 (56%), Positives = 57/101 (56%), Gaps = 5/101 (4%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRP---PPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LP- 309
            P SP     PPP PPPP PPP P   PPP PPP PP  PPP PPP  PPPP PPPP  P 
Sbjct: 738  PPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPP 797

Query: 310  -PPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRPS 429
             PPP PPPP   PP PPPP   P    PS P  L     PS
Sbjct: 798  SPPPSPPPPTPPPPAPPPPNPPP----PSPPPPLPLPPPPS 834

 Score =  110 bits (275), Expect = 5e-23
 Identities = 50/87 (57%), Positives = 53/87 (60%)
 Frame = +1

Query: 172  PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPP 351
            PPP PPP PPP PPP  PPP PP P PP P P P PPP PPPP  PPPP PPPP   PP 
Sbjct: 764  PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPP-TPPPPAPPPPNPPPPS 822

Query: 352  PPPPRLVP*TLAPSGPVTLTALDRPSL 432
            PPPP  +P   +P  P+    L  P L
Sbjct: 823  PPPPLPLPPPPSPPPPLPPPPLPPPPL 849

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/93 (59%), Positives = 56/93 (60%), Gaps = 7/93 (7%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPP-YPPPPRPPP*PPPPPYPPPP------ 300
            P SP     PP PPPP  PPP PPPP PPP PP  PPPP PPP  PPPP PPPP      
Sbjct: 773  PPSP-----PPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPL 827

Query: 301  *LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             LPPPP PPPP   PP PPPP   P +  PS P
Sbjct: 828  PLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPP 860

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/93 (59%), Positives = 56/93 (60%), Gaps = 7/93 (7%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPP-YPPPPRPPP*PPPPPYPPPP------ 300
            P SP     PP PPPP  PPP PPPP PPP PP  PPPP PPP  PPPP PPPP      
Sbjct: 1042 PPSP-----PPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPL 1096

Query: 301  *LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             LPPPP PPPP   PP PPPP   P +  PS P
Sbjct: 1097 PLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPP 1129

 Score =  110 bits (274), Expect = 6e-23
 Identities = 52/87 (59%), Positives = 52/87 (59%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPP-RPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
            P SP     PPP PPPP PPP  PPPP P P PP PPPP PPP  PPPP PPPP  PP P
Sbjct: 800  PPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSP 859

Query: 319  *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             P PP S PP PPPP   P    P  P
Sbjct: 860  PPSPPPSPPPSPPPPTPPPPAPPPPAP 886

 Score =  110 bits (274), Expect = 6e-23
 Identities = 54/94 (57%), Positives = 55/94 (58%), Gaps = 8/94 (8%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPP--------P 297
            P SP     PP PPPP  PPP PPPP PPP  P PPPP PPP  PPPP PP        P
Sbjct: 887  PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSP 946

Query: 298  P*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            P LPPPP PPPP   PPPP PP   P +  PS P
Sbjct: 947  PPLPPPPLPPPPL--PPPPSPPPSPPPSPPPSPP 978

 Score =  110 bits (274), Expect = 6e-23
 Identities = 52/87 (59%), Positives = 52/87 (59%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPP-RPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
            P SP     PPP PPPP PPP  PPPP P P PP PPPP PPP  PPPP PPPP  PP P
Sbjct: 978  PPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSP 1037

Query: 319  *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             P PP S PP PPPP   P    P  P
Sbjct: 1038 PPSPPPSPPPSPPPPTPPPPAPPPPAP 1064

 Score =  110 bits (274), Expect = 6e-23
 Identities = 52/87 (59%), Positives = 52/87 (59%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPP-RPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
            P SP     PPP PPPP PPP  PPPP P P PP PPPP PPP  PPPP PPPP  PP P
Sbjct: 1069 PPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSP 1128

Query: 319  *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             P PP S PP PPPP   P    P  P
Sbjct: 1129 PPSPPPSPPPSPPPPTPPPPAPPPPAP 1155

 Score =  110 bits (274), Expect = 6e-23
 Identities = 51/81 (62%), Positives = 51/81 (62%), Gaps = 3/81 (3%)
 Frame = +1

Query: 166  LPPPP-PPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPP--PP*LPPPP*PPPPR 336
            LPPPP PPPP PPP PPP  PP  PP PPPP PPP  PPPP PP  PP  PPPP PPPP 
Sbjct: 1113 LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPA 1172

Query: 337  S*PPPPPPPRLVP*TLAPSGP 399
              PP PPPP   P    P  P
Sbjct: 1173 PPPPNPPPPSPPPPLPPPPSP 1193

 Score =  109 bits (273), Expect = 8e-23
 Identities = 52/88 (59%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LP--PP 315
            P SP     PPP PPPP PPP  PPP PPP PP  PPP PPP  PPPP PPPP  P  PP
Sbjct: 1101 PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPP 1160

Query: 316  P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            P PPPP   PP PPPP   P +  P  P
Sbjct: 1161 PSPPPPTPPPPAPPPPNPPPPSPPPPLP 1188

 Score =  109 bits (273), Expect = 8e-23
 Identities = 55/92 (59%), Positives = 56/92 (60%), Gaps = 6/92 (6%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PP---PLPPYPPPPRPPP*PPPPPYPP---PP* 303
            P SP     PP PPPP  PPP PPPP PP   P PP PPPP PPP  PPPP PP   PP 
Sbjct: 1156 PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPP 1215

Query: 304  LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            LPPPP PPPP   PPPP PP   P +  PS P
Sbjct: 1216 LPPPPLPPPPL--PPPPSPPPSPPPSPPPSPP 1245

 Score =  109 bits (272), Expect = 1e-22
 Identities = 55/92 (59%), Positives = 56/92 (60%), Gaps = 3/92 (3%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPP--YPPPPRPPP*PPPPPYPPPP-*LPP 312
            P SP     PPP PPPP PPP  PPP PPP PP   PPPP PPP  PPPP PPPP  LPP
Sbjct: 868  PPSP-----PPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPP 922

Query: 313  PP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTL 408
            PP PPPP   PP PPPP   P +  P  P  L
Sbjct: 923  PPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPL 954

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/101 (57%), Positives = 59/101 (58%), Gaps = 15/101 (14%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PP------PLPPYPPPPRPPP*PPPPPYP-PPP 300
            P SP    LPPPP PPP PPP PPPP PP      P PP P PP PPP PPP P P PPP
Sbjct: 2130 PPSPP--PLPPPPTPPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPP 2187

Query: 301  *LPPPP*PPP--------PRS*PPPPPPPRLVP*TLAPSGP 399
             +PPPP PPP        P S PPPPPPP L P    PS P
Sbjct: 2188 PIPPPPSPPPHPPPQSPLPPSPPPPPPPPPLPP---PPSPP 2225

 Score =  108 bits (271), Expect = 1e-22
 Identities = 54/85 (63%), Positives = 55/85 (64%), Gaps = 2/85 (2%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPP-YPPPPRPPP*PPPPPYPPPP*LPPPP 318
            P SP     PP PPPP  PPP PPPP PPP PP  PPPP PPP  PPPP PPPP  PPPP
Sbjct: 864  PPSP-----PPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP-SPPPP 917

Query: 319  *P-PPPRS*PPPPPPPRLVP*TLAP 390
             P PPP S PPP PPP L P  + P
Sbjct: 918  LPLPPPPSPPPPLPPPPLPPPPVPP 942

 Score =  108 bits (270), Expect = 2e-22
 Identities = 50/79 (63%), Positives = 51/79 (64%), Gaps = 1/79 (1%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP-*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P 345
            PPP PPP  PPP PPPP  PPP PP  PPP PPP  PPPP PPPP  PPPP PPPP   P
Sbjct: 863  PPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPP-NPPPPSPPPPLPLP 921

Query: 346  PPPPPPRLVP*TLAPSGPV 402
            PPP PP  +P    P  PV
Sbjct: 922  PPPSPPPPLPPPPLPPPPV 940

 Score =  108 bits (269), Expect = 2e-22
 Identities = 53/87 (60%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPP-PPYPPPP*LPPPP 318
           P SP     P PPPP P PPP PPPP PPP PP  PPP PPP PPP PP  PPP  PPPP
Sbjct: 730 PPSPPPSPPPSPPPPTP-PPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPP 788

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPPP   PPP PPP   P T  P  P
Sbjct: 789 APPPPT--PPPSPPPSPPPPTPPPPAP 813

 Score =  108 bits (269), Expect = 2e-22
 Identities = 51/76 (67%), Positives = 51/76 (67%), Gaps = 2/76 (2%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP-*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P 345
           PPP PPP  PPP PPPP  PPP PP  PPP PPP  PPPP PPPP  PPPP PPPP   P
Sbjct: 772 PPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPP-NPPPPSPPPPLPLP 830

Query: 346 PPP-PPPRLVP*TLAP 390
           PPP PPP L P  L P
Sbjct: 831 PPPSPPPPLPPPPLPP 846

 Score =  108 bits (269), Expect = 2e-22
 Identities = 53/84 (63%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPR-PPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
            P  P     PPP PPPP  PPP PPPP PPP  P PP P PPP  PPPP PPPP LPPPP
Sbjct: 881  PPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPP-LPPPP 939

Query: 319  *PPPPRS*PPPPPPPRLVP*TLAP 390
             PPPP   PPP PPP L P  L P
Sbjct: 940  VPPPPS--PPPLPPPPLPPPPLPP 961

 Score =  107 bits (268), Expect = 3e-22
 Identities = 59/110 (53%), Positives = 60/110 (54%), Gaps = 12/110 (10%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYP-----------PPPRPPP*PPPPPY 288
            P SP     PP PPPP  PPP PPPP PPPLPP P           PPP PPP PPP P 
Sbjct: 1190 PPSPP----PPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPP 1245

Query: 289  PPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVT-LTALDRPSLS 435
            P PP  PPPP PPPP   PPP PPP   P T  P  P+   T  DR S S
Sbjct: 1246 PSPPPSPPPPTPPPPAP-PPPTPPPSPPPPTPPPPPPLAPFTCEDRASRS 1294

 Score =  107 bits (268), Expect = 3e-22
 Identities = 49/79 (62%), Positives = 49/79 (62%)
 Frame = +1

Query: 172  PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPP 351
            PPP PPP PPP PPPP P P PP PPPP PPP  PPPP PPP  LPPPP PPPP   P P
Sbjct: 1589 PPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPP--LPPPPLPPPPSPPPSP 1646

Query: 352  PPPPRLVP*TLAPSGPVTL 408
            PP P   P    P  P  L
Sbjct: 1647 PPSPPPSPPPSPPPSPSPL 1665

 Score =  107 bits (267), Expect = 4e-22
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP PPP PP  PPP PPP  PPPP PPPP  PP P 
Sbjct: 702 PPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPP 761

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P PP S PPP PPP   P    P+ P
Sbjct: 762 PSPPPS-PPPSPPPSPPPSPPPPTPP 786

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/100 (56%), Positives = 56/100 (56%), Gaps = 14/100 (14%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PP-----------PLPPYPPPPRPPP*PP--PP 282
            P SP     PPP PPPP PPP PPPP PP           PLPP  PPP PPP PP  PP
Sbjct: 1543 PPSPS----PPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPSPP 1598

Query: 283  PYPPPP-*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            P PPPP  LPPPP PPPP   PP PPPP   P    P  P
Sbjct: 1599 PSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPP 1638

 Score =  106 bits (265), Expect = 7e-22
 Identities = 50/81 (61%), Positives = 51/81 (62%), Gaps = 3/81 (3%)
 Frame = +1

Query: 166  LPPPPPPPPRPPPRPPPP*PP-PLPPYPPPPRPPP--*PPPPPYPPPP*LPPPP*PPPPR 336
            LPPPP PPP PPP PPP  PP P PP PPPP PPP   PP PP  PPP  PPPP PPPP 
Sbjct: 1118 LPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPN 1177

Query: 337  S*PPPPPPPRLVP*TLAPSGP 399
              PP PPPP   P +  P  P
Sbjct: 1178 PPPPSPPPPLPPPPSPPPPLP 1198

 Score =  105 bits (263), Expect = 1e-21
 Identities = 53/82 (64%), Positives = 54/82 (65%), Gaps = 6/82 (7%)
 Frame = +1

Query: 172  PPPPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*P---PPPPYPPPP*LPPPP*PPPP 333
            PPP PPP PPP PPPP PPP    PP PPPP PPP P   PPPP PPPP LPPPP PPPP
Sbjct: 969  PPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPP-PLPLPPPPSPPPP-LPPPPLPPPP 1026

Query: 334  RS*PPPPPPPRLVP*TLAPSGP 399
               PPPP PP   P +  PS P
Sbjct: 1027 L--PPPPSPPPSPPPSPPPSPP 1046

 Score =  105 bits (262), Expect = 2e-21
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PP PPPP  PPP PPPP PPP PP  PPP PPP  PPPP PPPP  PPPP 
Sbjct: 698 PPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPP-SPPPPTPPPP-APPPPA 755

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPP     PPP PP   P +  PS P
Sbjct: 756 PPPAPPPSPPPSPPPSPPPSPPPSPP 781

 Score =  105 bits (262), Expect = 2e-21
 Identities = 52/92 (56%), Positives = 54/92 (58%), Gaps = 6/92 (6%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRP---PPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP* 303
            P +P     PPP PPPP P   PP PPPP PPP    PP PPPP PPP PPP P P PP 
Sbjct: 810  PPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPP 869

Query: 304  LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             PPPP PPPP   PPPP PP   P +  P  P
Sbjct: 870  SPPPPTPPPPA--PPPPAPPPSPPPSPPPPTP 899

 Score =  105 bits (262), Expect = 2e-21
 Identities = 52/92 (56%), Positives = 54/92 (58%), Gaps = 6/92 (6%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRP---PPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP* 303
            P +P     PPP PPPP P   PP PPPP PPP    PP PPPP PPP PPP P P PP 
Sbjct: 988  PPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPP 1047

Query: 304  LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             PPPP PPPP   PPPP PP   P +  P  P
Sbjct: 1048 SPPPPTPPPPA--PPPPAPPPSPPPSPPPPTP 1077

 Score =  105 bits (262), Expect = 2e-21
 Identities = 52/92 (56%), Positives = 54/92 (58%), Gaps = 6/92 (6%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRP---PPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP* 303
            P +P     PPP PPPP P   PP PPPP PPP    PP PPPP PPP PPP P P PP 
Sbjct: 1079 PPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPP 1138

Query: 304  LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             PPPP PPPP   PPPP PP   P +  P  P
Sbjct: 1139 SPPPPTPPPPA--PPPPAPPPSPPPSPPPPTP 1168

 Score =  105 bits (262), Expect = 2e-21
 Identities = 55/93 (59%), Positives = 55/93 (59%), Gaps = 7/93 (7%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPR--PPPRPPPP*PPPL--PPYPPPPRPPP*PPPPPYPPPP*LP 309
            P  P    LPPPP PPP   PPP PPPP PPPL  PP PPPP PPP PPP P P PP  P
Sbjct: 1599 PSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 1658

Query: 310  PP---P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PP   P PPPP   PPPP PP   P   AP  P
Sbjct: 1659 PPSPSPLPPPPT--PPPPSPPLPSPPLPAPPPP 1689

 Score =  105 bits (262), Expect = 2e-21
 Identities = 55/108 (50%), Positives = 58/108 (53%), Gaps = 13/108 (12%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPP-------------RPPPP*PPPLPPYPPPPRPPP*PPPP 282
            P SP L   P P PPPP PPP              PPPP PPP  P PPPP PPP  PPP
Sbjct: 1673 PPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPP--PLPPPPNPPPPLPPP 1730

Query: 283  PYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRP 426
            P PP P  P PP P PP S PP PPPP   P +L+PS P   T+   P
Sbjct: 1731 PSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPP 1778

 Score =  105 bits (261), Expect = 2e-21
 Identities = 63/118 (53%), Positives = 67/118 (56%), Gaps = 19/118 (16%)
 Frame = +1

Query: 127 SLAK*PDSPQL*QLPPPP-----PPPPRPPPRPPPP*----PPPL--PPYPPPPRPPP*P 273
           SL+  P  P L   PPPP     PPPP   P PPPP     PPP   PP PPPP PPP  
Sbjct: 327 SLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPSPPPPL 386

Query: 274 PPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*T--------LAPSGPVTLTALDR 423
           PPPP PPPP LPPPP PPPP S PPPPPPP L P T        LAP G  +++   R
Sbjct: 387 PPPPSPPPP-LPPPPIPPPP-SPPPPPPPP-LAPFTCEDLASRSLAPHGCTSVSPFTR 441

 Score =  105 bits (261), Expect = 2e-21
 Identities = 55/93 (59%), Positives = 56/93 (60%), Gaps = 7/93 (7%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRP---PPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP* 303
            P +P     PPP PPPP P   PP PPPP PPP    PP PPPP PPP  PPPP PPPP 
Sbjct: 901  PPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPP-LPPPPLPPPP- 958

Query: 304  LPPPP*PPP-PRS*PPPPPPPRLVP*TLAPSGP 399
            LPPPP PPP P   PPP PPP   P T  P  P
Sbjct: 959  LPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAP 991

 Score =  104 bits (260), Expect = 3e-21
 Identities = 55/91 (60%), Positives = 57/91 (62%), Gaps = 5/91 (5%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPR--PPPP*PPPL--PPYPPPPRPPP*PPPPPYPPPP*LP 309
            P +P     PPP PPPP PPP   PPP  PPPL  PP PPPP PPP P PPP PPPP LP
Sbjct: 1165 PPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPP-PSPPPLPPPP-LP 1222

Query: 310  PPP*PPPPRS*P-PPPPPPRLVP*TLAPSGP 399
            PPP PPPP   P PPP PP   P +  PS P
Sbjct: 1223 PPPLPPPPSPPPSPPPSPPPSPPPSPPPSPP 1253

 Score =  104 bits (259), Expect = 3e-21
 Identities = 55/92 (59%), Positives = 56/92 (60%), Gaps = 6/92 (6%)
 Frame = +1

Query: 142  PDSPQL*QLPPP---PPPPPRPPPRPPPP*PPP-LPPYP-PPPRPPP*PPP-PPYPPPP* 303
            P +P     PPP   PPPP  PPP PPPP PPP LPP P PPP PPP PPP PP  PPP 
Sbjct: 815  PPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPP 874

Query: 304  LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             PPPP PPPP   PPP PPP   P T  P  P
Sbjct: 875  TPPPPAPPPPA--PPPSPPPSPPPPTPPPPAP 904

 Score =  104 bits (259), Expect = 3e-21
 Identities = 55/92 (59%), Positives = 56/92 (60%), Gaps = 6/92 (6%)
 Frame = +1

Query: 142  PDSPQL*QLPPP---PPPPPRPPPRPPPP*PPP-LPPYP-PPPRPPP*PPP-PPYPPPP* 303
            P +P     PPP   PPPP  PPP PPPP PPP LPP P PPP PPP PPP PP  PPP 
Sbjct: 993  PPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPP 1052

Query: 304  LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             PPPP PPPP   PPP PPP   P T  P  P
Sbjct: 1053 TPPPPAPPPPA--PPPSPPPSPPPPTPPPPAP 1082

 Score =  104 bits (259), Expect = 3e-21
 Identities = 55/92 (59%), Positives = 56/92 (60%), Gaps = 6/92 (6%)
 Frame = +1

Query: 142  PDSPQL*QLPPP---PPPPPRPPPRPPPP*PPP-LPPYP-PPPRPPP*PPP-PPYPPPP* 303
            P +P     PPP   PPPP  PPP PPPP PPP LPP P PPP PPP PPP PP  PPP 
Sbjct: 1084 PPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPP 1143

Query: 304  LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             PPPP PPPP   PPP PPP   P T  P  P
Sbjct: 1144 TPPPPAPPPPA--PPPSPPPSPPPPTPPPPAP 1173

 Score =  104 bits (259), Expect = 3e-21
 Identities = 51/88 (57%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPP--P*LPPP 315
            P SP L   PPP PPPP PPP  PPP PPPLPP P PP  PP  PPPP PPP  P LP P
Sbjct: 2106 PPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPPLPPPPTPPPQSPPLPSP 2165

Query: 316  P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            P P PP   P PPP P  +P    P  P
Sbjct: 2166 PPPSPPTPPPLPPPSPSPLPPPPIPPPP 2193

 Score =  103 bits (258), Expect = 5e-21
 Identities = 47/77 (61%), Positives = 47/77 (61%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPP PPPP P P P PP PP  PP PPPP PPP  PPPP PPPP  PP P P PP S PP
Sbjct: 681 PPPSPPPPSPSPPPSPP-PPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPP 739

Query: 349 PPPPPRLVP*TLAPSGP 399
            PPPP   P    P  P
Sbjct: 740 SPPPPTPPPPAPPPPAP 756

 Score =  103 bits (258), Expect = 5e-21
 Identities = 50/84 (59%), Positives = 50/84 (59%), Gaps = 6/84 (7%)
 Frame = +1

Query: 166 LPPPPPPPPRPPPRPP------PP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PP 327
           LPPPP PPP PPP PP      PP P P PP PPPP PPP PPP P P PP  P PP  P
Sbjct: 719 LPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPP--PSPPPSP 776

Query: 328 PPRS*PPPPPPPRLVP*TLAPSGP 399
           PP   PP PPPP   P T  PS P
Sbjct: 777 PPSPPPPTPPPPAPPPPTPPPSPP 800

 Score =  103 bits (258), Expect = 5e-21
 Identities = 53/89 (59%), Positives = 54/89 (60%), Gaps = 6/89 (6%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYP------PPP* 303
            P +P     PPP PP P PPP PPPP PP  PP PPPP PPP  PPPP P      PPP 
Sbjct: 873  PPTPPPPAPPPPAPP-PSPPPSPPPPTPP--PPAPPPPNPPPPSPPPPLPLPPPPSPPPP 929

Query: 304  LPPPP*PPPPRS*PPPPPPPRLVP*TLAP 390
            LPPPP PPPP   PPPP PP L P  L P
Sbjct: 930  LPPPPLPPPPV--PPPPSPPPLPPPPLPP 956

 Score =  103 bits (258), Expect = 5e-21
 Identities = 54/94 (57%), Positives = 55/94 (58%), Gaps = 8/94 (8%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*--PPPLPP--YPPPPRPPP*P----PPPPYPPP 297
            P +P     PPP PPPP PPP  PPP   PPPLPP   PPPP PPP P    PPPP PPP
Sbjct: 1170 PPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPP 1229

Query: 298  P*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            P  PP P P PP S PPP PPP   P T  P  P
Sbjct: 1230 PSPPPSPPPSPPPS-PPPSPPPSPPPPTPPPPAP 1262

 Score =  103 bits (256), Expect = 8e-21
 Identities = 58/103 (56%), Positives = 62/103 (60%), Gaps = 16/103 (15%)
 Frame = +1

Query: 166  LPPPP--PPPPRPPPRPPPP*PP-PLPPYPPPPRPPP*P---PPPPYPPPP*L---PPP- 315
            LPPPP  PPP  PPP PPPP PP P PP PPPP PPP P   PPPP PPPP L   PPP 
Sbjct: 1712 LPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPP 1771

Query: 316  ---P*PPPPRS*PPPPPP---PRLVP*TLAPSGPVTLTALDRP 426
               P PPPP + P PPPP   P   P +L+PS P   T+   P
Sbjct: 1772 STSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPP 1814

 Score =  102 bits (255), Expect = 1e-20
 Identities = 54/89 (60%), Positives = 54/89 (60%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*P---PPPPYPPPP*LPP 312
            P SP     PPP PP P PPP PPP  PPP PP  PPP PPP P   PPPP PPPP LPP
Sbjct: 1563 PPSPPPPLPPPPVPPSPLPPPSPPPS-PPPSPPPSPPPSPPP-PLPLPPPPSPPPP-LPP 1619

Query: 313  PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PP PPPP   PPP PPP L P    P  P
Sbjct: 1620 PPVPPPPS--PPPLPPPPLPPPPSPPPSP 1646

 Score =  102 bits (254), Expect = 1e-20
 Identities = 47/79 (59%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYP-PPP*LPPPP*PPPPRS*P 345
            P PPPP P PPP PPPP PPP PP P PP P P PP PP P PPP  PP P P PP S P
Sbjct: 1539 PSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPSPP 1598

Query: 346  PPPPPPRLVP*TLAPSGPV 402
            P PPPP  +P   +P  P+
Sbjct: 1599 PSPPPPLPLPPPPSPPPPL 1617

 Score =  102 bits (253), Expect = 2e-20
 Identities = 46/69 (66%), Positives = 46/69 (66%), Gaps = 4/69 (5%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYP-PPP*LPPPP*PP---PPR 336
            PPP PPP  PPP PPPP PPP PP  PPP PPP PPP P P PPP  PPPP PP   PP 
Sbjct: 1624 PPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPL 1683

Query: 337  S*PPPPPPP 363
              PPPP PP
Sbjct: 1684 PAPPPPSPP 1692

 Score =  102 bits (253), Expect = 2e-20
 Identities = 54/92 (58%), Positives = 56/92 (60%), Gaps = 6/92 (6%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPR--PPPRPPPP*PPP-LPPYPPPPRPPP*PPPPPYPPPP*LPP 312
            P S    Q PPPP PPP   PPP PPPP PPP  PP PPPP PPP P PPP PPP   PP
Sbjct: 1699 PSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPP-PSPPPSPPPS--PP 1755

Query: 313  PP*PPPPRS*PPPPPP---PRLVP*TLAPSGP 399
            PP PPPP   P PPPP   P   P + +PS P
Sbjct: 1756 PPSPPPPSLSPSPPPPSTSPSPPPPSASPSPP 1787

 Score =  101 bits (252), Expect = 2e-20
 Identities = 51/87 (58%), Positives = 51/87 (58%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPP-YPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P SP     PPP PPPP PPP PPP  PPP PP  PPPP PPP  PPPP PPP   PPP 
Sbjct: 707 PPSPPPPLPPPPLPPPPLPPPSPPPS-PPPSPPPSPPPPTPPPPAPPPPAPPP--APPPS 763

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PP P   PPP PPP   P T  P  P
Sbjct: 764 PPPSPPPSPPPSPPPSPPPPTPPPPAP 790

 Score =  101 bits (252), Expect = 2e-20
 Identities = 49/82 (59%), Positives = 52/82 (63%), Gaps = 4/82 (4%)
 Frame = +1

Query: 166  LPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRP--PP*PPPPPYPPPP*LPPPP*PP--PP 333
            +PP P PPP PPP PPP  PP  PP PPPP P  PP  PPPP PPPP +PPPP PP  PP
Sbjct: 1575 VPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPP-VPPPPSPPPLPP 1633

Query: 334  RS*PPPPPPPRLVP*TLAPSGP 399
               PPPP PP   P +  PS P
Sbjct: 1634 PPLPPPPSPPPSPPPSPPPSPP 1655

 Score =  101 bits (251), Expect = 3e-20
 Identities = 54/100 (54%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP*LPP 312
            P SP     P PPP PP P P PPPP PPP    PP PPPP PPP  PPPP PPPP  PP
Sbjct: 1586 PPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPP-LPPPPLPPPPSPPP 1644

Query: 313  PP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRPSL 432
             P P PP S PPP PPP   P    P+ P     L  P L
Sbjct: 1645 SPPPSPPPS-PPPSPPPSPSPLPPPPTPPPPSPPLPSPPL 1683

 Score =  100 bits (249), Expect = 5e-20
 Identities = 50/79 (63%), Positives = 50/79 (63%), Gaps = 2/79 (2%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYP-PPPRPPP*PPPPPYPPPP*LPPPP*PPP-PRS* 342
           P P PPPP PPP  P P PPP PP P PPP PPP  PPPP PPPP LPPPP PPP P   
Sbjct: 676 PSPSPPPPSPPP--PSPSPPPSPPPPSPPPSPPPPSPPPPLPPPP-LPPPPLPPPSPPPS 732

Query: 343 PPPPPPPRLVP*TLAPSGP 399
           PPP PPP   P T  P  P
Sbjct: 733 PPPSPPPSPPPPTPPPPAP 751

 Score =  100 bits (249), Expect = 5e-20
 Identities = 53/99 (53%), Positives = 57/99 (57%), Gaps = 4/99 (4%)
 Frame = +1

Query: 142  PDSPQL*QLPPPP-PPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPP-PYPPPP*LPPP 315
            P  P    LPPPP PPPP PPP PPP  PPP PP  PPP P P PPPP P PP P LP P
Sbjct: 1623 PPPPSPPPLPPPPLPPPPSPPPSPPPS-PPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSP 1681

Query: 316  P*PPPPRS*PPPP--PPPRLVP*TLAPSGPVTLTALDRP 426
            P P PP   PPPP  P P  +P + +P  P+    L  P
Sbjct: 1682 PLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPP 1720

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 56/109 (51%), Positives = 57/109 (52%), Gaps = 11/109 (10%)
 Frame = +1

Query: 142 PDSPQL*QLPPPP-----PPPPRPPPRPPPP*------PPPLPPYPPPPRPPP*PPPPPY 288
           P  P L   PPPP     PPPP   P PPPP       PP L P PPP  PPP  PPPP 
Sbjct: 323 PPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPP-SPPPPS 381

Query: 289 PPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRPSLS 435
           PPPP LPPPP PPPP   PP PPPP   P    P  P T   L   SL+
Sbjct: 382 PPPP-LPPPPSPPPPLPPPPIPPPPSPPPPPPPPLAPFTCEDLASRSLA 429

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 57/104 (54%), Positives = 58/104 (55%), Gaps = 19/104 (18%)
 Frame = +1

Query: 154  QL*QLPPPPPPPPR--------PPPRPP-PP*PPPLPPYP------PPPRPPP*PPPPPY 288
            QL  +PPPP PPP         PPP PP PP PPPLPP P      PPP PPP PPPP  
Sbjct: 2083 QLMSVPPPPSPPPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTP 2142

Query: 289  PP-PP*LPPPP*PP---PPRS*PPPPPPPRLVP*TLAPSGPVTL 408
            PP PP LPPPP PP   PP   PPPP PP   P  L P  P  L
Sbjct: 2143 PPSPPPLPPPPTPPPQSPPLPSPPPPSPP--TPPPLPPPSPSPL 2184

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 53/93 (56%), Positives = 56/93 (60%), Gaps = 12/93 (12%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPR-------PPPRP--PPP*PPPLP-PYPPPPRPPP*PPPPPYP 291
            P SP    LPPPP PPP+       PPP P  PPP PPP P P PPPP PPP P PPP+P
Sbjct: 2143 PPSPP--PLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPP-PSPPPHP 2199

Query: 292  PP--P*LPPPP*PPPPRS*PPPPPPPRLVP*TL 384
            PP  P  P PP PPPP   PPPP PP   P +L
Sbjct: 2200 PPQSPLPPSPPPPPPPPPLPPPPSPPPSQPPSL 2232

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 51/92 (55%), Positives = 54/92 (58%), Gaps = 15/92 (16%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPP--LPPYPPPPRPPP*PPPP---PYPPPP*L---PPP--- 315
            PPPP PPP PPP PPPP PPP  L P PPPP   P PPPP   P PPPP     PPP   
Sbjct: 1741 PPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSL 1800

Query: 316  -P*PPPPRS*PPPPPPPRL---VP*TLAPSGP 399
             P PPPP + P PPPPP      P + +PS P
Sbjct: 1801 SPSPPPPSTSPSPPPPPASPSPPPPSASPSPP 1832

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 49/96 (51%), Positives = 49/96 (51%), Gaps = 30/96 (31%)
 Frame = +1

Query: 166  LPPPPPPPPRPPPRPPPP*PP---------PLPPYPPPPRPP------P*PPPPPYP--- 291
            LPPPP PPP PPP PPP  PP         P PP PPPP PP      P PPPP  P   
Sbjct: 1636 LPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPN 1695

Query: 292  ------------PPP*LPPPP*PPPPRS*PPPPPPP 363
                        PPP LPPPP PPPP   PP PPPP
Sbjct: 1696 APSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPP 1731

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 53/106 (50%), Positives = 54/106 (50%), Gaps = 20/106 (18%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPP----LP----PYPPPPRPPP---------- 267
            P  P      PPP PPP P P PPPP PPP    LP    P PPPP PPP          
Sbjct: 1644 PSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMP 1703

Query: 268  --*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
                PPPP PPPP LPPPP PPPP   PPPP PP   P +  P  P
Sbjct: 1704 PSQSPPPPLPPPP-LPPPPNPPPPL--PPPPSPPSPPPPSPPPPSP 1746

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 49/84 (58%), Positives = 50/84 (59%), Gaps = 1/84 (1%)
 Frame = +1

Query: 181  PPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P-PPPP 357
            P P  PPP PPPP P P PP PPPP PPP  PPPP PPPP LPPPP PP P   P PPP 
Sbjct: 1532 PSPSPPPPSPPPPSPSP-PPSPPPPSPPP-SPPPPSPPPP-LPPPPVPPSPLPPPSPPPS 1588

Query: 358  PPRLVP*TLAPSGPVTLTALDRPS 429
            PP   P +  PS P  L     PS
Sbjct: 1589 PPPSPPPSPPPSPPPPLPLPPPPS 1612

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 50/97 (51%), Positives = 53/97 (54%), Gaps = 6/97 (6%)
 Frame = +1

Query: 127 SLAK*PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPP---PYPPP 297
           SL+  P  P L   PPPP   P PPP PPPP   P PP  PPP   P PPPP   P PPP
Sbjct: 275 SLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPP 334

Query: 298 P*LPPPP*PPPPRS*PPPPPP---PRLVP*TLAPSGP 399
           P L P   PPPP   P PPPP   P   P +L+PS P
Sbjct: 335 PSLSPS--PPPPSLSPSPPPPSFSPSPPPPSLSPSPP 369

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/103 (50%), Positives = 54/103 (52%), Gaps = 17/103 (16%)
 Frame = +1

Query: 142  PDSPQL*QLPPPP-----PPPPRPPPRPPPP*------PPPLPPYPPPPRPPP*PPPPPY 288
            P  P L   PPPP     PPPP   P PPPP       PP L P PPPP   P PPPPP 
Sbjct: 1759 PPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPA 1818

Query: 289  PPPP*LPPP---P*PPPPRS*PPPPPP---PRLVP*TLAPSGP 399
             P P  PPP   P PPPP S P PPPP   P   P +L+PS P
Sbjct: 1819 SPSP--PPPSASPSPPPPSSSPSPPPPSSSPSPPPPSLSPSPP 1859

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/79 (55%), Positives = 44/79 (55%), Gaps = 5/79 (6%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRP--PPP*PPPLPPYPPPPRPPP*PPPP---PYPPPP*L 306
            P  P L   PPPP   P PPP P  P P PP   P PPPP   P PPPP   P PPPP L
Sbjct: 1795 PPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPPPPSL 1854

Query: 307  PPPP*PPPPRS*PPPPPPP 363
             P P P PP S PPPP PP
Sbjct: 1855 SPSPPPSPPPSSPPPPSPP 1873

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 55/121 (45%), Positives = 58/121 (47%), Gaps = 18/121 (14%)
 Frame = +1

Query: 127 SLAK*PDSPQL*QLPPPP-----PPPPRPPPRPPPP*------PPPLPPYPPPPRPPP*P 273
           SL+  P  P L   PPPP     PPPP   P PPPP       PP L P PPPP   P P
Sbjct: 230 SLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSP 289

Query: 274 PPP-------PYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRPSL 432
           PPP       P PPPP   P P P PP S  P PPPP L P   +P  P    +   PSL
Sbjct: 290 PPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSP---SPPPPSLSPSPPPPSL 346

Query: 433 S 435
           S
Sbjct: 347 S 347

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 54/113 (47%), Positives = 58/113 (51%), Gaps = 22/113 (19%)
 Frame = +1

Query: 127 SLAK*PDSPQL*QLPPPP-----PPPPRPPPRPPPP*------PPPLPPYPPPPR----P 261
           SL+  P  P +   PPPP     PPPP   P PPPP       PP L P PPPP     P
Sbjct: 239 SLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSP 298

Query: 262 PP*PPPP-PYPPPP*LPPP---P*PPPPRS*PPPPPP---PRLVP*TLAPSGP 399
           PP PPPP   P PP  PPP   P PPPP   P PPPP   P   P +L+PS P
Sbjct: 299 PPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPP 351

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 51/111 (45%), Positives = 51/111 (45%), Gaps = 14/111 (12%)
 Frame = +1

Query: 142  PDSPQL*QLPPPP-----PPPPRPPPRPPP------P*PPPLPPYPPPPRPPP*PPPP-- 282
            P  P     PPPP     PPPP   P PPP      P PPP  P PPPP   P PPPP  
Sbjct: 1777 PPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSS 1836

Query: 283  -PYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRPSL 432
             P PPPP   P P PP     PPP PPP   P    P  P T  A  RP L
Sbjct: 1837 SPSPPPPSSSPSPPPPSLSPSPPPSPPPSSPP----PPSPPTPPAPPRPFL 1883

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 42/82 (51%), Positives = 43/82 (52%), Gaps = 2/82 (2%)
 Frame = +1

Query: 127  SLAK*PDSPQL*QLPPPPP--PPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP 300
            SL+  P  P     PPPPP  P P PP   P P PP   P PPPP   P PPPP   P P
Sbjct: 1799 SLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPPPPSLSPSP 1858

Query: 301  *LPPPP*PPPPRS*PPPPPPPR 366
               PPP  PPP S P PP PPR
Sbjct: 1859 PPSPPPSSPPPPSPPTPPAPPR 1880

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 49/94 (52%), Positives = 51/94 (54%), Gaps = 14/94 (14%)
 Frame = +1

Query: 196  PPPRPP----------PP*PPPLPPYPPPPRPPP*PPPP-PYPPPP*LPPPP*PP--PPR 336
            PPP PP          PP  PPLPP PPP  PPP PPPP P P PP LPPPP PP  PP 
Sbjct: 2089 PPPSPPPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPP 2148

Query: 337  S*PPPPPPPRLVP-*TLAPSGPVTLTALDRPSLS 435
              PPP PPP+  P  +  P  P T   L  PS S
Sbjct: 2149 LPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPS 2182

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 50/112 (44%), Positives = 53/112 (47%), Gaps = 14/112 (12%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPP-----PRPPPRPPPP*PPPLPPYPPPPRPPP*PPPP---PYPPP 297
            P SP     PP PPPP     P PP   P P PP   P PPPP   P PPPP   P PPP
Sbjct: 1747 PPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPP 1806

Query: 298  P*LPPPP*PPPPRS*PPP------PPPPRLVP*TLAPSGPVTLTALDRPSLS 435
            P   P P PPP    PPP      PPPP   P   +P  P +  +   PSLS
Sbjct: 1807 PSTSPSPPPPPASPSPPPPSASPSPPPPSSSP---SPPPPSSSPSPPPPSLS 1855

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/95 (51%), Positives = 51/95 (53%), Gaps = 18/95 (18%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPP-----P*PPPLPPYPPPPRPPP*PPPP---PYPPPP*L---PPP 315
           PP PP  P PP  PPP     P PP L P PPPP   P PPPP   P PPPP L   PPP
Sbjct: 205 PPYPPSLPSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPP 264

Query: 316 ----P*PPPPRS*PPPPPP---PRLVP*TLAPSGP 399
               P PPPP   P PPPP   P   P +L+PS P
Sbjct: 265 PSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPP 299

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 49/105 (46%), Positives = 52/105 (49%), Gaps = 10/105 (9%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPR-PPPP*PPPLPPYPPPPRPPP*PPPP---PYPPPP*LP 309
           P  P    LPPP   P  PPP   P P PP L P PPPP   P PPPP   P PPPP + 
Sbjct: 209 PSLPSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVS 268

Query: 310 PPP*P------PPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRP 426
           P P P      PPP S  P PPPP L P +  PS P   T+   P
Sbjct: 269 PSPPPPSLSPSPPPPSLSPSPPPPSLSP-SPPPSPPPPSTSPSPP 312

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 47/103 (45%), Positives = 50/103 (48%), Gaps = 12/103 (11%)
 Frame = +1

Query: 127 SLAK*PDSPQL*QLPPPPPP----PPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPP---P 285
           SL   P  P     P PPPP     P PP   P P PP + P PPPP   P PPPP   P
Sbjct: 210 SLPSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVSP 269

Query: 286 YPPPP*LPPPP*PPPPRS*PPPP-----PPPRLVP*TLAPSGP 399
            PPPP L P P PP     PPPP     PPP   P + +PS P
Sbjct: 270 SPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPP 312

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 45/96 (46%), Positives = 48/96 (50%), Gaps = 11/96 (11%)
 Frame = +1

Query: 181 PPPPRPPPRPPPP*--PPPLPPYPPPPRPPP*PPPP---PYPPPP*LPPPP*P------P 327
           P PP PP  P PP   PP   P PPPP   P PPPP   P PPPP + P P P      P
Sbjct: 203 PSPPYPPSLPSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSP 262

Query: 328 PPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRPSLS 435
           PP S  P PPPP L P   +P  P    +   PSLS
Sbjct: 263 PPPSVSPSPPPPSLSP---SPPPPSLSPSPPPPSLS 295

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 28/52 (53%), Positives = 30/52 (57%)
 Frame = +1

Query: 247 PPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPV 402
           P P PPP  PPPP P PP  PPPP PPP    PPPP PP  +P    P  P+
Sbjct: 676 PSPSPPPPSPPPPSPSPPPSPPPPSPPPS---PPPPSPPPPLPPPPLPPPPL 724

[77][TOP]
>UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK2_CHLRE
          Length = 541

 Score =  113 bits (283), Expect = 6e-24
 Identities = 51/79 (64%), Positives = 51/79 (64%), Gaps = 1/79 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP-P 318
           P  P     PPP PPPP PPP  PPP PPP PP PPPP PPP  PPPP PPPP  PPP P
Sbjct: 178 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 237

Query: 319 *PPPPRS*PPPPPPPRLVP 375
            PPPP S PPP PPP   P
Sbjct: 238 PPPPPPSPPPPSPPPPSPP 256

 Score =  110 bits (275), Expect = 5e-23
 Identities = 52/83 (62%), Positives = 53/83 (63%), Gaps = 7/83 (8%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYP-PPPRPPP*PPPPPYP------PPP*LPPPP*PPP 330
           PPPPPPP PPP PPP  PPP PP P PPP PPP PPPPP P      PPP  PPPP PPP
Sbjct: 175 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 234

Query: 331 PRS*PPPPPPPRLVP*TLAPSGP 399
           P   PPPPPPP   P +  P  P
Sbjct: 235 PS--PPPPPPPSPPPPSPPPPSP 255

 Score =  109 bits (273), Expect = 8e-23
 Identities = 51/77 (66%), Positives = 51/77 (66%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPP  PPP PPPP PPP PP  PPP PPP PPPP  PPP   PPPP PPPP S PP
Sbjct: 183 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS--PPPPSPPPP-SPPP 239

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPP    P    PS P
Sbjct: 240 PPPPSPPPPSPPPPSPP 256

 Score =  109 bits (272), Expect = 1e-22
 Identities = 48/74 (64%), Positives = 48/74 (64%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PP  PPPP P P PP PPPP PPP  PPPP PPP   PPPP 
Sbjct: 188 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PPPPS 244

Query: 322 PPPPRS*PPPPPPP 363
           PPPP   PP PPPP
Sbjct: 245 PPPPSPPPPSPPPP 258

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/75 (56%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +1

Query: 184 PPPRPPPRPPPP*P---PPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPP 354
           P  R    PPPP P   PP PP PPPP PPP  PPPP PP P  PPPP PPPP   PP P
Sbjct: 168 PVTRGASPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 227

Query: 355 PPPRLVP*TLAPSGP 399
           PPP   P +  P  P
Sbjct: 228 PPPSPPPPSPPPPPP 242

[78][TOP]
>UniRef100_A8IZS5 Glycine-rich RNA-binding protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=A8IZS5_CHLRE
          Length = 165

 Score =  113 bits (283), Expect = 6e-24
 Identities = 62/95 (65%), Positives = 63/95 (66%), Gaps = 3/95 (3%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERG-GGGYGGG-GSYGGGGYGGGGGYGGGRG 252
           GR+  VN   P G    G R GG G GG  RG GG YGGG G YGGGGY GGGGYGGGRG
Sbjct: 70  GRTIRVNEATPLGERPPGGRGGGRGYGGGGRGRGGDYGGGRGGYGGGGY-GGGGYGGGRG 128

Query: 251 GGGYGGSG-GGYGGGGRGGGRGGGGGGGGSCYSCG 150
           GGGYGG G GGYGGGG GG  GGG G GG  Y  G
Sbjct: 129 GGGYGGGGSGGYGGGGYGGNGGGGYGAGGGGYGGG 163

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/67 (65%), Positives = 45/67 (67%)
 Frame = -3

Query: 338 ERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCY 159
           ER  GG GGG  YGGGG G GG YGGGRGG G    GGGYGGGG GGGRGGGG GGG   
Sbjct: 83  ERPPGGRGGGRGYGGGGRGRGGDYGGGRGGYG----GGGYGGGGYGGGRGGGGYGGGGSG 138

Query: 158 SCGESGH 138
             G  G+
Sbjct: 139 GYGGGGY 145

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 47/65 (72%), Positives = 48/65 (73%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGG 195
           G  RGG GGGGY  GGGGYGGG   GGGGYGGGG   GG GGGGYGG+GGG G G  GGG
Sbjct: 107 GGGRGGYGGGGY--GGGGYGGGR--GGGGYGGGG--SGGYGGGGYGGNGGG-GYGAGGGG 159

Query: 194 RGGGG 180
            GGGG
Sbjct: 160 YGGGG 164

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 45/73 (61%), Positives = 47/73 (64%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           GR +  +  G  G    G   GGG GGG  RGGGGYGGGGS   GGYGGGG   GG GGG
Sbjct: 99  GRGRGGDYGGGRGGYGGGGYGGGGYGGG--RGGGGYGGGGS---GGYGGGG--YGGNGGG 151

Query: 245 GYGGSGGGYGGGG 207
           GYG  GGGYGGGG
Sbjct: 152 GYGAGGGGYGGGG 164

[79][TOP]
>UniRef100_B7PFE7 Cement protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PFE7_IXOSC
          Length = 254

 Score =  113 bits (283), Expect = 6e-24
 Identities = 57/88 (64%), Positives = 57/88 (64%)
 Frame = -3

Query: 404 VTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           V G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GG
Sbjct: 17  VLGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGGG GGG GGGGGGGG     G  G
Sbjct: 77  GGGGGGGGGGGGGGGGGGGGGGGGGGGG 104

 Score =  113 bits (283), Expect = 6e-24
 Identities = 60/106 (56%), Positives = 63/106 (59%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 60  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESGHFARDCPTSAR*ISLCFTFM 81
           GGGG GGG GGGGGGGG     G  G    +   +   +SL F  M
Sbjct: 120 GGGGGGGGGGGGGGGGGGGGGGGGGGAIVSNPELTLTFVSLNFRRM 165

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 20  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 80  GGGGGGGGGGGGGGGGGGGGGGGGGG 105

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 21  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 81  GGGGGGGGGGGGGGGGGGGGGGGGGG 106

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 22  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 82  GGGGGGGGGGGGGGGGGGGGGGGGGG 107

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 23  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 83  GGGGGGGGGGGGGGGGGGGGGGGGGG 108

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 24  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 84  GGGGGGGGGGGGGGGGGGGGGGGGGG 109

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 25  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 85  GGGGGGGGGGGGGGGGGGGGGGGGGG 110

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 26  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 86  GGGGGGGGGGGGGGGGGGGGGGGGGG 111

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 27  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 87  GGGGGGGGGGGGGGGGGGGGGGGGGG 112

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 28  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 88  GGGGGGGGGGGGGGGGGGGGGGGGGG 113

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 29  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 89  GGGGGGGGGGGGGGGGGGGGGGGGGG 114

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 30  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 90  GGGGGGGGGGGGGGGGGGGGGGGGGG 115

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 31  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 91  GGGGGGGGGGGGGGGGGGGGGGGGGG 116

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 32  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 92  GGGGGGGGGGGGGGGGGGGGGGGGGG 117

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 33  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 93  GGGGGGGGGGGGGGGGGGGGGGGGGG 118

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 34  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 94  GGGGGGGGGGGGGGGGGGGGGGGGGG 119

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 35  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 95  GGGGGGGGGGGGGGGGGGGGGGGGGG 120

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 36  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 96  GGGGGGGGGGGGGGGGGGGGGGGGGG 121

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 37  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 97  GGGGGGGGGGGGGGGGGGGGGGGGGG 122

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 38  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 98  GGGGGGGGGGGGGGGGGGGGGGGGGG 123

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 39  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 99  GGGGGGGGGGGGGGGGGGGGGGGGGG 124

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 40  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGGGGGG 125

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 41  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 101 GGGGGGGGGGGGGGGGGGGGGGGGGG 126

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 42  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGG 127

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 43  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 103 GGGGGGGGGGGGGGGGGGGGGGGGGG 128

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 44  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGGGGGG 129

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 45  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 105 GGGGGGGGGGGGGGGGGGGGGGGGGG 130

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 46  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 105

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 106 GGGGGGGGGGGGGGGGGGGGGGGGGG 131

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 47  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 106

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 107 GGGGGGGGGGGGGGGGGGGGGGGGGG 132

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 48  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 108 GGGGGGGGGGGGGGGGGGGGGGGGGG 133

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 49  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGGGG 134

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 50  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 110 GGGGGGGGGGGGGGGGGGGGGGGGGG 135

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 51  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGG 136

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 52  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGG 137

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 53  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGG 138

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 54  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGG 139

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 55  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGG 140

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 56  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGG 141

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 57  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 117 GGGGGGGGGGGGGGGGGGGGGGGGGG 142

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 58  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 118 GGGGGGGGGGGGGGGGGGGGGGGGGG 143

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 59  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 119 GGGGGGGGGGGGGGGGGGGGGGGGGG 144

[80][TOP]
>UniRef100_B7PDJ8 SGRP-1, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PDJ8_IXOSC
          Length = 166

 Score =  113 bits (283), Expect = 6e-24
 Identities = 53/68 (77%), Positives = 53/68 (77%)
 Frame = -3

Query: 371 TRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGR 192
           TR GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG 
Sbjct: 98  TRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 157

Query: 191 GGGGGGGG 168
           GGGGGGGG
Sbjct: 158 GGGGGGGG 165

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 161

Query: 182 GGGGG 168
           GGGGG
Sbjct: 162 GGGGG 166

 Score =  107 bits (266), Expect = 5e-22
 Identities = 51/71 (71%), Positives = 52/71 (73%)
 Frame = -3

Query: 386 ANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGG 207
           A  +G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG
Sbjct: 96  AMTRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 155

Query: 206 RGGGRGGGGGG 174
            GGG GGGGGG
Sbjct: 156 GGGGGGGGGGG 166

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 47/65 (72%), Positives = 47/65 (72%)
 Frame = -3

Query: 335 RGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYS 156
           RGGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG    
Sbjct: 99  RGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 158

Query: 155 CGESG 141
            G  G
Sbjct: 159 GGGGG 163

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 46/64 (71%), Positives = 46/64 (71%)
 Frame = -3

Query: 332 GGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSC 153
           GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     
Sbjct: 101 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 160

Query: 152 GESG 141
           G  G
Sbjct: 161 GGGG 164

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 46/67 (68%), Positives = 46/67 (68%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 159

Query: 209 GRGGGRG 189
           G GGG G
Sbjct: 160 GGGGGGG 166

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 46/70 (65%), Positives = 47/70 (67%)
 Frame = -3

Query: 404 VTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           +T   G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GG
Sbjct: 97  MTRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 156

Query: 224 GYGGGGRGGG 195
           G GGGG GGG
Sbjct: 157 GGGGGGGGGG 166

[81][TOP]
>UniRef100_B7P0W1 Cement protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7P0W1_IXOSC
          Length = 144

 Score =  113 bits (283), Expect = 6e-24
 Identities = 54/76 (71%), Positives = 55/76 (72%)
 Frame = -3

Query: 368 RRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRG 189
           +RGGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG G
Sbjct: 66  KRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 125

Query: 188 GGGGGGGSCYSCGESG 141
           GGGGGGG     G  G
Sbjct: 126 GGGGGGGGGGGGGGGG 141

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/76 (71%), Positives = 54/76 (71%)
 Frame = -3

Query: 368 RRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRG 189
           R GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG G
Sbjct: 67  RGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 126

Query: 188 GGGGGGGSCYSCGESG 141
           GGGGGGG     G  G
Sbjct: 127 GGGGGGGGGGGGGGGG 142

 Score =  112 bits (279), Expect = 2e-23
 Identities = 54/77 (70%), Positives = 54/77 (70%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 68  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 127

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GGGGGGGG
Sbjct: 128 GGGGGGGGGGGGGGGGG 144

 Score =  110 bits (276), Expect = 4e-23
 Identities = 52/70 (74%), Positives = 53/70 (75%)
 Frame = -3

Query: 377 QGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGG 198
           +G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GG
Sbjct: 67  RGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 126

Query: 197 GRGGGGGGGG 168
           G GGGGGGGG
Sbjct: 127 GGGGGGGGGG 136

 Score =  110 bits (276), Expect = 4e-23
 Identities = 53/74 (71%), Positives = 53/74 (71%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 70  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 129

Query: 182 GGGGGSCYSCGESG 141
           GGGGG     G  G
Sbjct: 130 GGGGGGGGGGGGGG 143

 Score =  110 bits (276), Expect = 4e-23
 Identities = 53/74 (71%), Positives = 53/74 (71%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 71  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 130

Query: 182 GGGGGSCYSCGESG 141
           GGGGG     G  G
Sbjct: 131 GGGGGGGGGGGGGG 144

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/67 (67%), Positives = 48/67 (71%)
 Frame = -3

Query: 341 YERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSC 162
           +++ GGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG  
Sbjct: 64  FQKRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 123

Query: 161 YSCGESG 141
              G  G
Sbjct: 124 GGGGGGG 130

[82][TOP]
>UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E1896
          Length = 695

 Score =  113 bits (282), Expect = 7e-24
 Identities = 49/77 (63%), Positives = 50/77 (64%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           P P PP P PPP PPPP PPP PP PPPP  PP PPPP  PPPP  PPPP P PP + PP
Sbjct: 611 PAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPPPAPPP 670

Query: 349 PPPPPRLVP*TLAPSGP 399
           PPPPP   P   AP  P
Sbjct: 671 PPPPPPAPPPPPAPPPP 687

 Score =  112 bits (279), Expect = 2e-23
 Identities = 50/75 (66%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRP-PPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P  P     PPPPPPPP PPP P PPP PPP PP PP P PPP P PPP PPPP  PPPP
Sbjct: 618 PAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPPPAPPPP-PPPPP 676

Query: 319 *PPPPRS*PPPPPPP 363
            PPPP + PPPP PP
Sbjct: 677 APPPPPAPPPPPAPP 691

 Score =  111 bits (277), Expect = 3e-23
 Identities = 50/78 (64%), Positives = 51/78 (65%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P +P     PPPPPPPP PPP PPPP P P PP PP P PPP PPPPP P PP  PPPP 
Sbjct: 615 PPAPAPPPAPPPPPPPP-PPPAPPPP-PAPPPPPPPAPPPPPAPPPPPAPAPPPAPPPPP 672

Query: 322 PPPPRS*PPPPPPPRLVP 375
           PPPP   PPP PPP   P
Sbjct: 673 PPPPAPPPPPAPPPPPAP 690

 Score =  110 bits (274), Expect = 6e-23
 Identities = 52/78 (66%), Positives = 52/78 (66%), Gaps = 1/78 (1%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LP-PPP*PPPPRS*P 345
           P PPP PP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  P PPP PPPP   P
Sbjct: 618 PAPPPAPPPPPPPPPPPAPPP-PPAPPPP-PPPAPPPPPAPPPPPAPAPPPAPPPPPPPP 675

Query: 346 PPPPPPRLVP*TLAPSGP 399
           P PPPP   P   AP  P
Sbjct: 676 PAPPPPPAPPPPPAPPPP 693

 Score =  107 bits (268), Expect = 3e-22
 Identities = 48/66 (72%), Positives = 48/66 (72%), Gaps = 1/66 (1%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPP-P*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P 345
           PP PPPPP PPP PPP P PPP PP PP P PPP PPPPP PPPP  PPPP PPPP   P
Sbjct: 633 PPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPPPAPPPPP-PPPPAPPPPPAPPPP---P 688

Query: 346 PPPPPP 363
            PPPPP
Sbjct: 689 APPPPP 694

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 43/78 (55%), Positives = 45/78 (57%)
 Frame = +1

Query: 166 LPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P 345
           +P  P PPP P P PPP       P PP P PPP PPPPP PPPP  PPPP P PP   P
Sbjct: 595 MPQSPGPPPPPAPAPPPA------PAPPAPAPPPAPPPPPPPPPPPAPPPP-PAPPPPPP 647

Query: 346 PPPPPPRLVP*TLAPSGP 399
           P PPPP   P   AP+ P
Sbjct: 648 PAPPPPPAPPPPPAPAPP 665

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 38/59 (64%), Positives = 38/59 (64%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P  P     PPPP PPP PP  PPPP P P P  PPPP PPP PPPPP PPPP  PPPP
Sbjct: 636 PPPPPAPPPPPPPAPPP-PPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPPPP 693

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 30/48 (62%), Positives = 31/48 (64%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPP 285
           P +P     PPPPP P  PP  PPPP PPP PP PP P PPP PPPPP
Sbjct: 647 PPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPPPPP 694

[83][TOP]
>UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2U1_EHV86
          Length = 2873

 Score =  113 bits (282), Expect = 7e-24
 Identities = 57/88 (64%), Positives = 57/88 (64%), Gaps = 2/88 (2%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPL--PPYPPPPRPPP*PPPPPYPPPP*LPPP 315
            P SP     PP PPPP  PPP PPPP PPP   PP PPPP PPP  PPPP PPPP  PPP
Sbjct: 2686 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPP-SPPP 2744

Query: 316  P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            P PPPP S PPP PPP L P   APS P
Sbjct: 2745 PSPPPP-SPPPPSPPPPLPP---APSPP 2768

 Score =  112 bits (281), Expect = 1e-23
 Identities = 53/93 (56%), Positives = 55/93 (59%)
 Frame = +1

Query: 121  GQSLAK*PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP 300
            GQ+  K P SP     PPP PPPP PPP PPP  PPP PP P PP P P PP PP  PPP
Sbjct: 2661 GQTCIK-PPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP 2719

Query: 301  *LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
              PPPP PPPP   PP PPPP   P +  P  P
Sbjct: 2720 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2752

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/93 (60%), Positives = 56/93 (60%), Gaps = 7/93 (7%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PP---PLPPYPPPPRPPP*PPPPPYPPPP*LPP 312
            P SP     PPP PPPP PPP PPPP PP   P PP PPPP PPP  PPPP PPPP  PP
Sbjct: 2695 PPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP-SPP 2753

Query: 313  PP*PPPP----RS*PPPPPPPRLVP*TLAPSGP 399
            PP PPPP     S PP PPPP   P    PS P
Sbjct: 2754 PPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPP 2786

 Score =  111 bits (278), Expect = 2e-23
 Identities = 53/89 (59%), Positives = 54/89 (60%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP*LPP 312
            P  P     PPPP PPP PPP PPPP PPP    PP PPPP PPP  PPPP PPPP  PP
Sbjct: 2671 PPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP-SPPPPSPPPP-SPP 2728

Query: 313  PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PP PPPP   PP PPPP   P +  P  P
Sbjct: 2729 PPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2757

 Score =  106 bits (264), Expect = 9e-22
 Identities = 54/96 (56%), Positives = 54/96 (56%), Gaps = 1/96 (1%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYP-PPPRPPP*PPPPPYPPPP*LPPPP 318
            P SP     PP PPP P PP  PPP  PPP PP P PPP PPP  PPPP PPPP  PPPP
Sbjct: 2677 PPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPP-SPPPP 2735

Query: 319  *PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRP 426
             PPPP   PP PPPP   P    PS P  L     P
Sbjct: 2736 SPPPPSPPPPSPPPPSPPP----PSPPPPLPPAPSP 2767

 Score =  105 bits (263), Expect = 1e-21
 Identities = 48/70 (68%), Positives = 48/70 (68%), Gaps = 1/70 (1%)
 Frame = +1

Query: 169  PPPPPPPPRP-PPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P 345
            PPP PPPP P PP PPPP PPP  P PPPP PPP PPPPP  PPP  PPPP PPPP   P
Sbjct: 2253 PPPSPPPPSPHPPSPPPPSPPP--PSPPPPTPPPSPPPPPPTPPP-SPPPPSPPPPSPPP 2309

Query: 346  PPPPPPRLVP 375
            P PPPP   P
Sbjct: 2310 PSPPPPSQPP 2319

 Score =  105 bits (262), Expect = 2e-21
 Identities = 53/89 (59%), Positives = 53/89 (59%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142  PDSPQL*QLPPP-PPPPPRPPPRPPPP*PPPL--PPYPPPPRPPP*PPPPPYPPPP*LPP 312
            P SP     PPP PPPP  PPP PPP  PPP   PP PPPP PPP  PPPP PPPP  PP
Sbjct: 2690 PPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP-SPP 2748

Query: 313  PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PP PPPP   PP PP P   P    PS P
Sbjct: 2749 PPSPPPPSPPPPLPPAPSPPPSPPPPSPP 2777

 Score =  104 bits (260), Expect = 3e-21
 Identities = 48/68 (70%), Positives = 48/68 (70%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPP 351
           P PPPPP PPP PPPP PPP PP PPPP PP  PPPPP PPPP  PPPP PP P   PPP
Sbjct: 203 PSPPPPPPPPPLPPPP-PPPPPPSPPPPSPP--PPPPPSPPPP-SPPPPPPPSP---PPP 255

Query: 352 PPPPRLVP 375
           PPPP   P
Sbjct: 256 PPPPLPTP 263

 Score =  103 bits (257), Expect = 6e-21
 Identities = 52/88 (59%), Positives = 53/88 (60%), Gaps = 3/88 (3%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LP---P 312
            P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  P   P
Sbjct: 2714 PPSP-----PPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSP 2767

Query: 313  PP*PPPPRS*PPPPPPPRLVP*TLAPSG 396
            PP PPPP   PPP PPP   P   + SG
Sbjct: 2768 PPSPPPPS--PPPSPPPPSPPDRTSTSG 2793

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 45/64 (70%), Positives = 45/64 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPPP PPP PPP PPPP PP  PP PPPP PPP P PPP PPPP   PPP PPPP   PP
Sbjct: 2532 PPPPSPPPSPPPSPPPPLPP--PPSPPPPSPPP-PSPPPSPPPP--SPPPSPPPPS--PP 2584

Query: 349  PPPP 360
            P PP
Sbjct: 2585 PYPP 2588

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 46/74 (62%), Positives = 46/74 (62%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
            P SP     PPP P PP PPP  PPP P P PP PPP  PPP P PPP PPPP  PPPP 
Sbjct: 2254 PPSP-----PPPSPHPPSPPPPSPPP-PSPPPPTPPPSPPPPPPTPPPSPPPP-SPPPPS 2306

Query: 322  PPPPRS*PPPPPPP 363
            PPPP   PP  PPP
Sbjct: 2307 PPPPSPPPPSQPPP 2320

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 43/70 (61%), Positives = 44/70 (62%)
 Frame = +1

Query: 181  PPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPP 360
            PPP  PPP P PP PPP  P PPPP PPP P PPP PPPP   PPP PPPP   PP PPP
Sbjct: 2253 PPPSPPPPSPHPPSPPP--PSPPPPSPPP-PTPPPSPPPPPPTPPPSPPPPSPPPPSPPP 2309

Query: 361  PRLVP*TLAP 390
            P   P +  P
Sbjct: 2310 PSPPPPSQPP 2319

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 42/63 (66%), Positives = 42/63 (66%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P    LPPPPPPPP P P PP P PPP PP PPPP PP  PPPPP PPPP  PPPP 
Sbjct: 206 PPPPPPPPLPPPPPPPPPPSPPPPSP-PPPPPPSPPPPSPP--PPPPPSPPPP--PPPPL 260

Query: 322 PPP 330
           P P
Sbjct: 261 PTP 263

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 40/68 (58%), Positives = 40/68 (58%)
 Frame = +1

Query: 172  PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPP 351
            PP PPPP PPP PPP         PPPP PPP  PPPP PPPP  PP P PP P   PPP
Sbjct: 2529 PPSPPPPSPPPSPPPS--------PPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPP 2580

Query: 352  PPPPRLVP 375
            P PP   P
Sbjct: 2581 PSPPPYPP 2588

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 42/64 (65%), Positives = 42/64 (65%), Gaps = 2/64 (3%)
 Frame = +1

Query: 178  PPPPPRPPPRPPPP*PPPL--PPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPP 351
            P  PP PPP  PPP PPP   PP PPPP PPP  PPPP PPP   PPPP PPP  S PPP
Sbjct: 2526 PCSPPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPS--PPPPSPPP--SPPPP 2581

Query: 352  PPPP 363
             PPP
Sbjct: 2582 SPPP 2585

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 39/55 (70%), Positives = 39/55 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPP 333
           PPPP PPP PPP PP P PPP PP PPPP PPP  PPPP PP P  PPPP PP P
Sbjct: 210 PPPPLPPPPPPPPPPSP-PPPSPPPPPPPSPPPPSPPPPPPPSP--PPPPPPPLP 261

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 42/68 (61%), Positives = 42/68 (61%)
 Frame = +1

Query: 196  PPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP 375
            PPP PPPP   P PP PPPP PPP  PPPP PPP   PPPP P PP S PPP PPP   P
Sbjct: 2253 PPPSPPPP--SPHPPSPPPPSPPPPSPPPPTPPPS--PPPPPPTPPPSPPPPSPPPPSPP 2308

Query: 376  *TLAPSGP 399
                PS P
Sbjct: 2309 ---PPSPP 2313

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 33/51 (64%), Positives = 33/51 (64%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPP 294
            P SP     PP PPPP  PPP PPPP PPP PP P PP  PP P PPPYPP
Sbjct: 2538 PPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYPP 2588

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 32/47 (68%), Positives = 33/47 (70%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LP 309
            PP PPPPP PPP  PPP P P PP PPPP PPP P PPP PP P +P
Sbjct: 1172 PPSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPP-PSPPPPPPLPLIP 1217

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 35/50 (70%), Positives = 36/50 (72%)
 Frame = +1

Query: 226  PPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP 375
            PP PP PPP  PPP PPPPP PPPP  PPPP PPPP   PPPPPP  L+P
Sbjct: 1172 PPSPP-PPPSPPPPSPPPPPSPPPP-SPPPPLPPPPS--PPPPPPLPLIP 1217

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 38/68 (55%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +1

Query: 235 PPYPPPPRPPP*PPPPPYPPPP*LPPP-P*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLT 411
           P  PPPP PPP PPPPP PPPP  PPP P PPPP S PPP PPP   P    P  P   T
Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPT 262

Query: 412 ALDRPSLS 435
              R   S
Sbjct: 263 PTGRSCFS 270

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 33/46 (71%), Positives = 33/46 (71%)
 Frame = +1

Query: 181  PPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
            PP P PPP PPPP PPP PP PPPP PPP  PPPP PPPP  PP P
Sbjct: 1172 PPSPPPPPSPPPPSPPP-PPSPPPPSPPPPLPPPPSPPPP--PPLP 1214

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 38/61 (62%), Positives = 38/61 (62%), Gaps = 3/61 (4%)
 Frame = +1

Query: 226  PPLPPYPPPPRPPP*P---PPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSG 396
            P  PP PPPP PPP P   PPPP PPPP  PPPP PPPP S PP PPPP   P    PS 
Sbjct: 2526 PCSPPSPPPPSPPPSPPPSPPPPLPPPP-SPPPPSPPPP-SPPPSPPPPSPPPSPPPPSP 2583

Query: 397  P 399
            P
Sbjct: 2584 P 2584

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 31/50 (62%), Positives = 32/50 (64%)
 Frame = +1

Query: 247  PPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSG 396
            PP  PPP  PPPP PPPP  PPPP PPPP   PP PPPP  +P  L P G
Sbjct: 1172 PPSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLP--LIPGG 1219

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 33/55 (60%), Positives = 34/55 (61%), Gaps = 2/55 (3%)
 Frame = +1

Query: 241 YPPPPRPPP*P--PPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           +P PP PPP P  PPPP PPPP  PPPP PPPP   PPP PPP   P    PS P
Sbjct: 202 FPSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPP---PPPSPPPPSPPPPPPPSPP 253

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 32/60 (53%), Positives = 36/60 (60%), Gaps = 1/60 (1%)
 Frame = +1

Query: 115  LVGQSLAK*PDSPQL*QLPPPP-PPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYP 291
            ++G+  +  P SP     PPPP PP   PPP PPPP PP  PP PPPP PPP PP P  P
Sbjct: 1163 VMGKYFSCNPPSPPPPPSPPPPSPP---PPPSPPPPSPP--PPLPPPPSPPPPPPLPLIP 1217

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 25/40 (62%), Positives = 25/40 (62%)
 Frame = +1

Query: 280  PPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PP PPPP  PPPP PPPP S PPP PPP L P    P  P
Sbjct: 1172 PPSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPP 1211

[84][TOP]
>UniRef100_Q3MC83 Putative uncharacterized protein n=1 Tax=Anabaena variabilis ATCC
           29413 RepID=Q3MC83_ANAVT
          Length = 387

 Score =  113 bits (282), Expect = 7e-24
 Identities = 50/75 (66%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRP-PPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           PD+P     PP PPPPP P PP PPPP PPP PP  PPP PPP PPPPP P PP  PPP 
Sbjct: 313 PDNPDPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPD 372

Query: 319 *PPPPRS*PPPPPPP 363
            PPPP   PPPPPPP
Sbjct: 373 PPPPPPPDPPPPPPP 387

 Score =  111 bits (278), Expect = 2e-23
 Identities = 51/74 (68%), Positives = 51/74 (68%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           PD P L   P PPPPPP PPP PPPP PPP PP  PPP PPP PPPPP P PP  PPP  
Sbjct: 308 PDPP-LPDNPDPPPPPPDPPP-PPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDP 365

Query: 322 PPPPRS*PPPPPPP 363
           PPPP   PPPPPPP
Sbjct: 366 PPPPPPDPPPPPPP 379

 Score =  102 bits (254), Expect = 1e-20
 Identities = 43/66 (65%), Positives = 44/66 (66%)
 Frame = +1

Query: 166 LPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P 345
           + P PP P  P P PPPP PPP PP  PPP PPP PPPPP P PP  PPP  PPPP   P
Sbjct: 306 IQPDPPLPDNPDPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDP 365

Query: 346 PPPPPP 363
           PPPPPP
Sbjct: 366 PPPPPP 371

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 46/78 (58%), Positives = 46/78 (58%), Gaps = 1/78 (1%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPL-PPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P 345
           PP P  P  PPP P PP PPP  PP PPPP PPP PPP P PPPP  PPPP PP P   P
Sbjct: 310 PPLPDNPDPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPP 369

Query: 346 PPPPPPRLVP*TLAPSGP 399
           PP PPP   P    P  P
Sbjct: 370 PPDPPPPPPPDPPPPPPP 387

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 36/65 (55%), Positives = 37/65 (56%)
 Frame = +1

Query: 205 RPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TL 384
           +P PP P    P PPPP PPP PPP P PPPP  PPPP PP P   PPP PPP   P   
Sbjct: 307 QPDPPLPDNPDPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPP 366

Query: 385 APSGP 399
            P  P
Sbjct: 367 PPPPP 371

[85][TOP]
>UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7P5E7_IXOSC
          Length = 129

 Score =  113 bits (282), Expect = 7e-24
 Identities = 48/62 (77%), Positives = 48/62 (77%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--PPPPPPPPP---PP 55

Query: 349 PP 354
           PP
Sbjct: 56  PP 57

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 40/67 (59%), Positives = 42/67 (62%)
 Frame = +1

Query: 226 PPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVT 405
           PP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PPPPPPP   P    P  P  
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPP--PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPH 58

Query: 406 LTALDRP 426
           +T +  P
Sbjct: 59  ITKISLP 65

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 32/40 (80%), Positives = 33/40 (82%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPY 288
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP+
Sbjct: 19  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPH 58

[86][TOP]
>UniRef100_B7PCR0 Cement protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PCR0_IXOSC
          Length = 229

 Score =  113 bits (282), Expect = 8e-24
 Identities = 56/88 (63%), Positives = 58/88 (65%)
 Frame = -3

Query: 404 VTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           ++G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GG
Sbjct: 125 MSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 184

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGGG GGG GGGGGGGG     G  G
Sbjct: 185 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 212

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 128 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 187

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGGGGGG 213

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 129 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 188

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 189 GGGGGGGGGGGGGGGGGGGGGGGGGG 214

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 130 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 189

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 190 GGGGGGGGGGGGGGGGGGGGGGGGGG 215

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 131 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 190

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 191 GGGGGGGGGGGGGGGGGGGGGGGGGG 216

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 191

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 192 GGGGGGGGGGGGGGGGGGGGGGGGGG 217

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 192

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 193 GGGGGGGGGGGGGGGGGGGGGGGGGG 218

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 193

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 194 GGGGGGGGGGGGGGGGGGGGGGGGGG 219

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 194

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 195 GGGGGGGGGGGGGGGGGGGGGGGGGG 220

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 195

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 196 GGGGGGGGGGGGGGGGGGGGGGGGGG 221

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 196

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 197 GGGGGGGGGGGGGGGGGGGGGGGGGG 222

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 197

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 198 GGGGGGGGGGGGGGGGGGGGGGGGGG 223

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 198

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 199 GGGGGGGGGGGGGGGGGGGGGGGGGG 224

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 200 GGGGGGGGGGGGGGGGGGGGGGGGGG 225

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 201 GGGGGGGGGGGGGGGGGGGGGGGGGG 226

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 201

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 202 GGGGGGGGGGGGGGGGGGGGGGGGGG 227

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 202

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 203 GGGGGGGGGGGGGGGGGGGGGGGGGG 228

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/86 (65%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 144 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 203

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 204 GGGGGGGGGGGGGGGGGGGGGGGGGG 229

 Score =  111 bits (278), Expect = 2e-23
 Identities = 56/90 (62%), Positives = 58/90 (64%)
 Frame = -3

Query: 410 VNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGS 231
           V+ +   G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG 
Sbjct: 120 VHTSCMSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 179

Query: 230 GGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 209

[87][TOP]
>UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera
           RepID=UPI0000DB6CCB
          Length = 394

 Score =  112 bits (281), Expect = 1e-23
 Identities = 50/69 (72%), Positives = 52/69 (75%)
 Frame = +1

Query: 151 PQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPP 330
           PQ+  +PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPP
Sbjct: 228 PQVQVVPPPPPPPPPPPPPPPPP-PPPPPPPPPPPPPPPPPPPPPLPPPP-PPPPPLPPP 285

Query: 331 PRS*PPPPP 357
           P S P P P
Sbjct: 286 PPSLPLPLP 294

 Score =  108 bits (269), Expect = 2e-22
 Identities = 52/83 (62%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = +1

Query: 166 LPPP-----PPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPP 330
           +PPP     PPPPP PPP PPPP PPP    PPPP PPP PPPPP PPPP LPPPP PPP
Sbjct: 225 VPPPQVQVVPPPPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280

Query: 331 PRS*PPPPPPPRLVP*TLAPSGP 399
           P   PPPP  P  +P T A   P
Sbjct: 281 PLP-PPPPSLPLPLPTTSATVAP 302

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 43/63 (68%), Positives = 43/63 (68%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  P  P P P  S   
Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP--PSLPLPLPTTSATV 300

Query: 349 PPP 357
            PP
Sbjct: 301 APP 303

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 49/85 (57%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +1

Query: 184 PPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPP 363
           PPP+    PPPP PPP PP PPPP PPP PPPPP PPP   PPPP PPPP   PPPPPPP
Sbjct: 226 PPPQVQVVPPPP-PPPPPPPPPPPPPPPPPPPPPPPPP---PPPPPPPPPLPPPPPPPPP 281

Query: 364 RLVP*TLAPSG-PVTLTALDRPSLS 435
              P    P   P T   +  PS S
Sbjct: 282 LPPPPPSLPLPLPTTSATVAPPSTS 306

[88][TOP]
>UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7QC44_IXOSC
          Length = 116

 Score =  112 bits (281), Expect = 1e-23
 Identities = 47/63 (74%), Positives = 48/63 (76%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP+  P 
Sbjct: 46  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--PPPPPPPPPQWEPA 103

Query: 349 PPP 357
            PP
Sbjct: 104 DPP 106

 Score =  105 bits (263), Expect = 1e-21
 Identities = 45/66 (68%), Positives = 46/66 (69%)
 Frame = +1

Query: 178 PPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPP 357
           PPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP        PPPPP
Sbjct: 45  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--------PPPPP 96

Query: 358 PPRLVP 375
           PP+  P
Sbjct: 97  PPQWEP 102

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 40/61 (65%), Positives = 41/61 (67%)
 Frame = +1

Query: 217 P*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSG 396
           P PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PPPPPPP   P    P+ 
Sbjct: 45  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEPAD 104

Query: 397 P 399
           P
Sbjct: 105 P 105

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 36/52 (69%), Positives = 36/52 (69%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*P 324
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP    P  PP   P
Sbjct: 59  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEPADPPSKWP 110

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 37/62 (59%), Positives = 37/62 (59%)
 Frame = +1

Query: 244 PPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDR 423
           PPPP PPP PPPPP PPPP  PPPP PPPP   PPPPPPP   P    P  P      D 
Sbjct: 46  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEPADP 105

Query: 424 PS 429
           PS
Sbjct: 106 PS 107

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 33/53 (62%), Positives = 34/53 (64%)
 Frame = +1

Query: 241 YPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           + PPP PPP PPPPP PPPP  PPPP PPPP   PPPPPPP   P    P  P
Sbjct: 43  HSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95

[89][TOP]
>UniRef100_Q7VEJ9 RNA-binding protein, RRM domain n=1 Tax=Prochlorococcus marinus
           RepID=Q7VEJ9_PROMA
          Length = 252

 Score =  112 bits (281), Expect = 1e-23
 Identities = 62/106 (58%), Positives = 67/106 (63%), Gaps = 9/106 (8%)
 Frame = -3

Query: 425 GRSKAVNVTGP--DGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYG--GG 258
           GR   +N   P   G   +G   GGGG GGY  GGGGYGGGG YGGGGYGGGGG G  GG
Sbjct: 69  GRPLRINKAEPRGGGGGGRGGGYGGGGRGGYG-GGGGYGGGGGYGGGGYGGGGGQGGYGG 127

Query: 257 RGGGGYGGSG-GGYGGGGR----GGGRGGGGGGGGSCYSCGESGHF 135
            G GGYGG G GGYGGGG+    GGG+GG GGGG   Y  G  G +
Sbjct: 128 GGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGY 173

 Score =  101 bits (252), Expect = 2e-20
 Identities = 56/93 (60%), Positives = 59/93 (63%), Gaps = 5/93 (5%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSG-GG 222
           G  G    G   G GGGGGY  GGGGYGGGG  GG G GG GGYGGG G GGYGG G GG
Sbjct: 92  GGGGRGGYGGGGGYGGGGGY--GGGGYGGGGGQGGYGGGGQGGYGGG-GQGGYGGGGQGG 148

Query: 221 YGGGGR----GGGRGGGGGGGGSCYSCGESGHF 135
           YGGGG+    GGG+GG GGGG   Y  G  G +
Sbjct: 149 YGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGY 181

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 56/100 (56%), Positives = 57/100 (57%), Gaps = 15/100 (15%)
 Frame = -3

Query: 362 GGGGGGGYERGG-GGYGGGGS--YGGGGYGG--GGGYG--GGRGGGGYGGSG-GGYGGGG 207
           GGGG GGY  GG GGYGGGG   YGGGG GG  GGG G  GG G GGYGG G GGYGGGG
Sbjct: 134 GGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGG 193

Query: 206 RGGGRGG-------GGGGGGSCYSCGESGHFARDCPTSAR 108
           +GG  GG        G  G    S G S    RD   S R
Sbjct: 194 QGGYGGGQDTEQRASGAQGWEDRSYGSSDSSERDDTRSKR 233

[90][TOP]
>UniRef100_Q69XV3 Os06g0622400 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q69XV3_ORYSJ
          Length = 321

 Score =  112 bits (281), Expect = 1e-23
 Identities = 53/74 (71%), Positives = 54/74 (72%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGGRGGGG GG GGG GGGG GGG GGG
Sbjct: 86  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145

Query: 182 GGGGGSCYSCGESG 141
           GG GG     G+ G
Sbjct: 146 GGNGGDDGDNGDDG 159

 Score =  110 bits (276), Expect = 4e-23
 Identities = 53/79 (67%), Positives = 56/79 (70%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GG G GG GGG GGGG GGG GGG
Sbjct: 83  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142

Query: 182 GGGGGSCYSCGESGHFARD 126
           GGGGG+    G++G    D
Sbjct: 143 GGGGGNGGDDGDNGDDGED 161

 Score =  108 bits (270), Expect = 2e-22
 Identities = 50/64 (78%), Positives = 50/64 (78%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG 180
           GGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGG
Sbjct: 82  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141

Query: 179 GGGG 168
           GGGG
Sbjct: 142 GGGG 145

 Score =  108 bits (269), Expect = 2e-22
 Identities = 51/69 (73%), Positives = 51/69 (73%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGG 195
           G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGG  GG GGG GGGG GGG
Sbjct: 78  GVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137

Query: 194 RGGGGGGGG 168
            GGGGGGGG
Sbjct: 138 GGGGGGGGG 146

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 48/74 (64%), Positives = 48/74 (64%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGG G GGG GGGG GG GGG GGG
Sbjct: 83  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142

Query: 209 GRGGGRGGGGGGGG 168
           G GGG GG  G  G
Sbjct: 143 GGGGGNGGDDGDNG 156

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 48/76 (63%), Positives = 48/76 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 84  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143

Query: 218 GGGGRGGGRGGGGGGG 171
           GGGG GG  G  G  G
Sbjct: 144 GGGGNGGDDGDNGDDG 159

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 47/71 (66%), Positives = 48/71 (67%)
 Frame = -3

Query: 353 GGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGG 174
           G G +  GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG  GGG GGG GGGGGG
Sbjct: 76  GWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 135

Query: 173 GGSCYSCGESG 141
           GG     G  G
Sbjct: 136 GGGGGGGGGGG 146

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 51/83 (61%), Positives = 51/83 (61%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGG  GGG GGGG GG GG  GGG
Sbjct: 82  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG--GGG 139

Query: 209 GRGGGRGGGGGGGGSCYSCGESG 141
           G GGG GG GG  G     GE G
Sbjct: 140 GGGGGGGGNGGDDGDNGDDGEDG 162

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 45/65 (69%), Positives = 46/65 (70%)
 Frame = -3

Query: 335 RGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYS 156
           RG G + GGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGGRGGGGGGGG    
Sbjct: 75  RGWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG-GGGGGGGGRGGGGGGGGGGGG 133

Query: 155 CGESG 141
            G  G
Sbjct: 134 GGGGG 138

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 47/86 (54%), Positives = 48/86 (55%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GG G GGGGG GGG GGGG GG GGG 
Sbjct: 86  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG G   G  G  G  G   + G  G
Sbjct: 146 GGNGGDDGDNGDDGEDGDGDAGGRGG 171

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 50/90 (55%), Positives = 50/90 (55%), Gaps = 13/90 (14%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 89  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG-GGGGGGG 147

Query: 218 GGG-------------GRGGGRGGGGGGGG 168
            GG             G  GGRGG G G G
Sbjct: 148 NGGDDGDNGDDGEDGDGDAGGRGGKGRGRG 177

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 45/78 (57%), Positives = 45/78 (57%), Gaps = 2/78 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSG--G 225
           G  G    G R GGGGGGG   GGGG GGGG  GGGG GG GG  G  G  G  G G  G
Sbjct: 111 GGGGGGGGGGRGGGGGGGG---GGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAG 167

Query: 224 GYGGGGRGGGRGGGGGGG 171
           G GG GRG GRG G G G
Sbjct: 168 GRGGKGRGRGRGRGMGSG 185

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 35/55 (63%), Positives = 35/55 (63%)
 Frame = -3

Query: 305 SYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           S  G G   GGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 73  SLRGWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 127

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 39/76 (51%), Positives = 40/76 (52%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G   +G   GGGGGGG   GGGG GGGG  G GG  G  G  G  G G  GG GG  
Sbjct: 114 GGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGGKG 173

Query: 218 GGGGRGGGRGGGGGGG 171
            G GRG G G G G G
Sbjct: 174 RGRGRGRGMGSGIGRG 189

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 41/100 (41%), Positives = 44/100 (44%), Gaps = 23/100 (23%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYG-----------------------GGGSYGGGG 288
           G  G   +G  RG G G G  RG G  G                       GGG+ GGGG
Sbjct: 167 GGRGGKGRGRGRGRGMGSGIGRGNGQNGDRGINSGGRGKIKGSNGGSRNVIGGGNKGGGG 226

Query: 287 YGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGG 168
            GG      G GGGG+  SGGG G G   G  GGGGGGGG
Sbjct: 227 DGGSDNAQSGDGGGGWESSGGGGGRGDVSGAGGGGGGGGG 266

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 55/150 (36%), Positives = 55/150 (36%), Gaps = 73/150 (48%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGG------------- 258
           G  G    G   GGGGGGG  RGGGG GGGG  GGGG GGGGG GGG             
Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDG 159

Query: 257 ---------RGG------------------------------------GGYGGS-----G 228
                    RGG                                    G  GGS     G
Sbjct: 160 EDGDGDAGGRGGKGRGRGRGRGMGSGIGRGNGQNGDRGINSGGRGKIKGSNGGSRNVIGG 219

Query: 227 GGYGGGGRGG------GRGGGG----GGGG 168
           G  GGGG GG      G GGGG    GGGG
Sbjct: 220 GNKGGGGDGGSDNAQSGDGGGGWESSGGGG 249

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 44/92 (47%), Positives = 46/92 (50%), Gaps = 6/92 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGG--GGGYGGGRGGGGYG-GSG 228
           G  G    G   GGGGGGG   GGGG G GG  G  G  G  G G  GGRGG G G G G
Sbjct: 120 GRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGGKGRGRGRG 179

Query: 227 GGYGGG-GRGGGRGGGGG--GGGSCYSCGESG 141
            G G G GRG G+ G  G   GG     G +G
Sbjct: 180 RGMGSGIGRGNGQNGDRGINSGGRGKIKGSNG 211

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 44/120 (36%), Positives = 46/120 (38%), Gaps = 25/120 (20%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           GR       G  G    G   GGGGGGG     G  G  G  G G  GG GG G GRG G
Sbjct: 120 GRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGGKGRGRGRG 179

Query: 245 GYGGSGGGYG----------GGGR---------------GGGRGGGGGGGGSCYSCGESG 141
              GSG G G           GGR               GG +GGGG GG      G+ G
Sbjct: 180 RGMGSGIGRGNGQNGDRGINSGGRGKIKGSNGGSRNVIGGGNKGGGGDGGSDNAQSGDGG 239

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 42/122 (34%), Positives = 50/122 (40%), Gaps = 26/122 (21%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGG---SYGGGGYGGGGGYG 264
           ++ GR K     G     + G  +GGGG GG +    G GGGG   S GGGG G   G G
Sbjct: 199 NSGGRGKIKGSNGGSRNVIGGGNKGGGGDGGSDNAQSGDGGGGWESSGGGGGRGDVSGAG 258

Query: 263 GGRGGGGYGGSGG-----------------GYGGGGRGGGR------GGGGGGGGSCYSC 153
           GG GGGG   + G                  +GG G G G+      GG  G  G     
Sbjct: 259 GGGGGGGGDDANGVRQFIVPGPSICSSHRCKHGGDGTGNGQRKITTTGGNHGSSGVTKPK 318

Query: 152 GE 147
           GE
Sbjct: 319 GE 320

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 33/85 (38%), Positives = 36/85 (42%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           GR    N      +  +G  +G  GG     GGG  GGGG  G      G G GG    G
Sbjct: 187 GRGNGQNGDRGINSGGRGKIKGSNGGSRNVIGGGNKGGGGDGGSDNAQSGDGGGGWESSG 246

Query: 245 GYGGSGGGYGGGGRGGGRGGGGGGG 171
           G GG G   G GG GGG GG    G
Sbjct: 247 GGGGRGDVSGAGGGGGGGGGDDANG 271

[91][TOP]
>UniRef100_Q2QQ97 Os12g0502200 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q2QQ97_ORYSJ
          Length = 258

 Score =  112 bits (281), Expect = 1e-23
 Identities = 59/92 (64%), Positives = 60/92 (65%), Gaps = 3/92 (3%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGG--GGGYERGGGGYGGGGSYGGGGYGGGGGYGG 261
           D DGR+  VN          G R GGGG  GGGY  GGGGYGGGG  GGGGYGGGG  GG
Sbjct: 96  DLDGRNIRVNTANE---RTGGFRSGGGGYGGGGYGGGGGGYGGGGYSGGGGYGGGGYSGG 152

Query: 260 GRGGGGYGGSGGGYGGGGRG-GGRGGGGGGGG 168
           G GGGGY G GGGYGG   G G RGGGGGG G
Sbjct: 153 GGGGGGYQGGGGGYGGNNGGYGNRGGGGGGYG 184

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 50/91 (54%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = -3

Query: 404 VTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGG-YGGG--RGGGGYGG 234
           +T  DG ++ G  R        ER GG   GGG YGGGGYGGGGG YGGG   GGGGYGG
Sbjct: 89  ITALDGKDLDG--RNIRVNTANERTGGFRSGGGGYGGGGYGGGGGGYGGGGYSGGGGYGG 146

Query: 233 SGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            G   GGGG GG +GGGGG GG+    G  G
Sbjct: 147 GGYSGGGGGGGGYQGGGGGYGGNNGGYGNRG 177

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/106 (43%), Positives = 51/106 (48%), Gaps = 14/106 (13%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGG-GGSYGGGGYGGGGGYGGGRGG-------- 249
           +G  G    G   GGGGGGGY+ GGGGYGG  G YG  G GGGGGYG   G         
Sbjct: 139 SGGGGYGGGGYSGGGGGGGGYQGGGGGYGGNNGGYGNRG-GGGGGYGVAEGSADAFSGIN 197

Query: 248 -GGYGGSGGGYGG--GGRGGGRGGG--GGGGGSCYSCGESGHFARD 126
            GG G  GG   G  G  GG  GGG   G GG  +   ++     D
Sbjct: 198 LGGDGSFGGNPAGSFGDAGGSTGGGDFSGAGGDSFGSRKNDELMDD 243

[92][TOP]
>UniRef100_UPI0000DA36CE PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA36CE
          Length = 136

 Score =  112 bits (280), Expect = 1e-23
 Identities = 52/70 (74%), Positives = 52/70 (74%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 14  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73

Query: 182 GGGGGSCYSC 153
           GGGGG    C
Sbjct: 74  GGGGGGGIQC 83

 Score =  110 bits (276), Expect = 4e-23
 Identities = 54/81 (66%), Positives = 55/81 (67%)
 Frame = -3

Query: 404 VTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           + G D     G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GG
Sbjct: 3   IKGGDWCCGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 62

Query: 224 GYGGGGRGGGRGGGGGGGGSC 162
           G GGGG GGG GGGGGGG  C
Sbjct: 63  GGGGGGGGGGGGGGGGGGIQC 83

 Score =  105 bits (263), Expect = 1e-21
 Identities = 52/73 (71%), Positives = 52/73 (71%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG 180
           GGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGG
Sbjct: 11  GGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 67

Query: 179 GGGGSCYSCGESG 141
           GGGG     G  G
Sbjct: 68  GGGGGGGGGGGGG 80

 Score =  100 bits (248), Expect = 7e-20
 Identities = 52/78 (66%), Positives = 52/78 (66%)
 Frame = -3

Query: 356 GGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGG 177
           GGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGG
Sbjct: 11  GGGGG---GGGGGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65

Query: 176 GGGSCYSCGESGHFARDC 123
           GGG     G  G     C
Sbjct: 66  GGGGGGGGGGGGGGGIQC 83

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 48/70 (68%), Positives = 49/70 (70%)
 Frame = -3

Query: 350 GGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGG 171
           GG +  GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGG
Sbjct: 5   GGDWCCGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64

Query: 170 GSCYSCGESG 141
           G     G  G
Sbjct: 65  GGGGGGGGGG 74

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 48/71 (67%), Positives = 48/71 (67%)
 Frame = -3

Query: 353 GGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGG 174
           GG     GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGG
Sbjct: 5   GGDWCCGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64

Query: 173 GGSCYSCGESG 141
           GG     G  G
Sbjct: 65  GGGGGGGGGGG 75

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 43/65 (66%), Positives = 44/65 (67%)
 Frame = -3

Query: 335 RGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYS 156
           +GG    GGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG    
Sbjct: 4   KGGDWCCGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 63

Query: 155 CGESG 141
            G  G
Sbjct: 64  GGGGG 68

[93][TOP]
>UniRef100_C5XP48 Putative uncharacterized protein Sb03g005056 (Fragment) n=1
           Tax=Sorghum bicolor RepID=C5XP48_SORBI
          Length = 109

 Score =  112 bits (280), Expect = 1e-23
 Identities = 55/78 (70%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYG-GGRGGGGYGGSGGG 222
           G  G+   G R GGGGGGG  RGGGG G GG  GGGGYGGGGG G GG GGGG GG GGG
Sbjct: 17  GGYGSGGYGGRGGGGGGGGRGRGGGGGGYGGGGGGGGYGGGGGGGYGGGGGGGRGGGGGG 76

Query: 221 YGGGGRGGGRGGGGGGGG 168
           +GGGGRGG  GGGG GGG
Sbjct: 77  FGGGGRGGVGGGGGRGGG 94

 Score =  108 bits (271), Expect = 1e-22
 Identities = 53/70 (75%), Positives = 53/70 (75%), Gaps = 4/70 (5%)
 Frame = -3

Query: 365 RGGGGGGGYERGGGGYGGGGSYGGGGY----GGGGGYGGGRGGGGYGGSGGGYGGGGRGG 198
           RGGGGGGGY  G GGYGG G  GGGG     GGGGGYGGG GGGGYGG GGG  GGG GG
Sbjct: 11  RGGGGGGGY--GSGGYGGRGGGGGGGGRGRGGGGGGYGGGGGGGGYGGGGGGGYGGGGGG 68

Query: 197 GRGGGGGGGG 168
           GRGGGGGG G
Sbjct: 69  GRGGGGGGFG 78

 Score =  102 bits (253), Expect = 2e-20
 Identities = 53/77 (68%), Positives = 53/77 (68%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G R  GGGGGGY  GGGG GG G  GGGGYGGGG  GGGRGGGG G  GGG 
Sbjct: 26  GRGGGGGGGGRGRGGGGGGYGGGGGG-GGYGGGGGGGYGGGG--GGGRGGGGGGFGGGGR 82

Query: 218 GGGGRGGGRGGGGGGGG 168
           GG G GGGRGGGG GGG
Sbjct: 83  GGVGGGGGRGGGGRGGG 99

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 46/60 (76%), Positives = 47/60 (78%), Gaps = 1/60 (1%)
 Frame = -3

Query: 362 GGGGGGGYERGGGG-YGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGG 186
           GGGGGGGY  GGGG YGGGG  GGG  GGGGG+GGG G GG GG GGG GGGGRGGGR G
Sbjct: 47  GGGGGGGYGGGGGGGYGGGG--GGGRGGGGGGFGGG-GRGGVGG-GGGRGGGGRGGGREG 102

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 38/61 (62%), Positives = 39/61 (63%), Gaps = 2/61 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGY--GGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           G  G    G   GGGGGGGY  GGGG   GGGG +GGGG GG GG GGGRGGGG GG   
Sbjct: 43  GGYGGGGGGGGYGGGGGGGYGGGGGGGRGGGGGGFGGGGRGGVGG-GGGRGGGGRGGGRE 101

Query: 224 G 222
           G
Sbjct: 102 G 102

[94][TOP]
>UniRef100_B7Q2H8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q2H8_IXOSC
          Length = 220

 Score =  112 bits (280), Expect = 1e-23
 Identities = 52/66 (78%), Positives = 52/66 (78%)
 Frame = -3

Query: 365 RGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGG 186
           RGGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GG
Sbjct: 153 RGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 212

Query: 185 GGGGGG 168
           GGGGGG
Sbjct: 213 GGGGGG 218

 Score =  112 bits (279), Expect = 2e-23
 Identities = 52/68 (76%), Positives = 53/68 (77%)
 Frame = -3

Query: 371 TRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGR 192
           +R GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG 
Sbjct: 152 SRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 211

Query: 191 GGGGGGGG 168
           GGGGGGGG
Sbjct: 212 GGGGGGGG 219

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 156 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 215

Query: 182 GGGGG 168
           GGGGG
Sbjct: 216 GGGGG 220

 Score =  106 bits (264), Expect = 9e-22
 Identities = 50/68 (73%), Positives = 51/68 (75%)
 Frame = -3

Query: 377 QGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGG 198
           +G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GG
Sbjct: 153 RGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 212

Query: 197 GRGGGGGG 174
           G GGGGGG
Sbjct: 213 GGGGGGGG 220

 Score =  103 bits (258), Expect = 5e-21
 Identities = 51/75 (68%), Positives = 52/75 (69%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           T P   +  G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG
Sbjct: 146 TFPTPLSRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205

Query: 221 YGGGGRGGGRGGGGG 177
            GGGG GGG GGGGG
Sbjct: 206 GGGGGGGGGGGGGGG 220

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 47/65 (72%), Positives = 47/65 (72%)
 Frame = -3

Query: 335 RGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYS 156
           RGGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG    
Sbjct: 153 RGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 212

Query: 155 CGESG 141
            G  G
Sbjct: 213 GGGGG 217

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 46/64 (71%), Positives = 46/64 (71%)
 Frame = -3

Query: 332 GGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSC 153
           GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     
Sbjct: 155 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 214

Query: 152 GESG 141
           G  G
Sbjct: 215 GGGG 218

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 39/55 (70%), Positives = 39/55 (70%)
 Frame = -3

Query: 305 SYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           S GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 152 SRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 206

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 26/37 (70%), Positives = 27/37 (72%)
 Frame = -3

Query: 299 GGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRG 189
           GGGG GGGGG GGG GGGG GG GGG GGGG+    G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGKKSRNG 37

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 25/31 (80%), Positives = 25/31 (80%)
 Frame = -3

Query: 266 GGGRGGGGYGGSGGGYGGGGRGGGRGGGGGG 174
           GGG GGGG GG GGG GGGG GGG GGGGGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 31

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 25/31 (80%), Positives = 25/31 (80%)
 Frame = -3

Query: 263 GGRGGGGYGGSGGGYGGGGRGGGRGGGGGGG 171
           GG GGGG GG GGG GGGG GGG GGGGGGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 31

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 25/31 (80%), Positives = 25/31 (80%)
 Frame = -3

Query: 260 GRGGGGYGGSGGGYGGGGRGGGRGGGGGGGG 168
           G GGGG GG GGG GGGG GGG GGGGGGGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 31

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 26/37 (70%), Positives = 26/37 (70%)
 Frame = -3

Query: 296 GGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGG 186
           GGG GGGGG GGG GGGG GG GGG GGGG    R G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGKKSRNG 37

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 25/36 (69%), Positives = 26/36 (72%)
 Frame = -3

Query: 284 GGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGG 177
           GGGGG GGG GGGG GG GGG GGGG GGG+    G
Sbjct: 2   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGKKSRNG 37

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 27/40 (67%), Positives = 28/40 (70%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGG 243
           GGGGGGG   GGGG GGGG  GGGG GGGGG GG +   G
Sbjct: 1   GGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGKKSRNG 37

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 25/37 (67%), Positives = 26/37 (70%)
 Frame = -3

Query: 290 GYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG 180
           G GGGGG GGG GGGG GG GGG GGGG GG +   G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGKKSRNG 37

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 26/37 (70%), Positives = 26/37 (70%)
 Frame = -3

Query: 332 GGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           GGGG GGGG  GGGG GGGGG GGG GGGG   S  G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGKKSRNG 37

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 25/38 (65%), Positives = 26/38 (68%)
 Frame = -3

Query: 278 GGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGS 165
           GGG GGG GGGG GG GGG GGGG GGG GG     G+
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGKKSRNGT 38

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 27/39 (69%), Positives = 27/39 (69%)
 Frame = -3

Query: 314 GGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGG 198
           GGG  GGGG GGGGG GGG GGGG GG GGG G   R G
Sbjct: 1   GGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGKKSRNG 37

[95][TOP]
>UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0K5_ARATH
          Length = 760

 Score =  112 bits (279), Expect = 2e-23
 Identities = 58/100 (58%), Positives = 59/100 (59%), Gaps = 4/100 (4%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPP---PRPPPP*PPPLPPYPPPPRPPP*PPPPP-YPPPP*LP 309
           P SP      PPPPPPP PP   P PPPP PPP P Y PPP PPP PPPPP Y PPP  P
Sbjct: 428 PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487

Query: 310 PPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRPS 429
           PPP PPP  S PPPPPPP   P    P  PV  +    PS
Sbjct: 488 PPP-PPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPS 526

 Score =  104 bits (259), Expect = 3e-21
 Identities = 47/76 (61%), Positives = 47/76 (61%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPP 351
           PPPP PP P   PPPP PPP P Y PPP PPP PPPP Y PPP  PPPP PPP  S PPP
Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPP 485

Query: 352 PPPPRLVP*TLAPSGP 399
            PPP   P    P  P
Sbjct: 486 SPPPPPPPVYSPPPPP 501

 Score =  101 bits (252), Expect = 2e-20
 Identities = 51/89 (57%), Positives = 52/89 (58%), Gaps = 11/89 (12%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPP--RPPPP*PPPLPP--YPPPPRPPP*PPPPPY--PPPP* 303
           P  P +   PPPPPPPP PPP   PPPP PPP PP  Y PPP PPP PPPP Y  PPPP 
Sbjct: 458 PPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPV 517

Query: 304 LPPPP*PPPPRS*P-----PPPPPPRLVP 375
              PP PP P   P     PPPPPP   P
Sbjct: 518 YSSPPPPPSPAPTPVYCTRPPPPPPHSPP 546

 Score =  100 bits (249), Expect = 5e-20
 Identities = 51/95 (53%), Positives = 53/95 (55%), Gaps = 12/95 (12%)
 Frame = +1

Query: 151 PQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PP---PPPYPPPP*LPP--- 312
           P L   PPP PPPP   P PPPP PPP+   PPPP PPP PP   PPP PPPP  PP   
Sbjct: 421 PTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVY 480

Query: 313 ------PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
                 PP PPPP   PPPPPPP   P   +P  P
Sbjct: 481 SPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 50/94 (53%), Positives = 51/94 (54%), Gaps = 16/94 (17%)
 Frame = +1

Query: 166 LPPPPPPPP----------RPPPRPPPP*--PPPLPPYPPPPRPPP*PPPPPYPP----P 297
           LP PPPP P           PPP PPPP   PPP PP PPP   PP PPPPP PP    P
Sbjct: 407 LPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSP 466

Query: 298 P*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P  PPPP PPPP   PPPP PP   P   +P  P
Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPP 500

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 54/96 (56%), Positives = 56/96 (58%), Gaps = 10/96 (10%)
 Frame = +1

Query: 142 PDSPQL*QLPPPP---PPPPRP----PPR---PPPP*PPPLPPYPPPPRPPP*PPPPPYP 291
           P  P +  LPPP    PPPP P    PP    PPPP PPP P Y PPP PPP PPPP Y 
Sbjct: 394 PRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPP-PVYSPPP-PPP-PPPPVYS 450

Query: 292 PPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPP  PPPP PPP  S PPPPPPP   P   +P  P
Sbjct: 451 PPP-PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPP 485

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 58/129 (44%), Positives = 60/129 (46%), Gaps = 34/129 (26%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPP--RPPPP*PPPLPP--YPPPPRP----PP*PPPP----- 282
           P  P     PPPP PPP PPP   PPPP PPP PP  Y PPP P    PP PP P     
Sbjct: 473 PPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPV 532

Query: 283 ----PYPPPP*LPPPP-------------*PPPPRS*PPP--PPPPRLVP*TLAP--SGP 399
               P PPPP  PPPP              PPPP S PPP  PPPP   P  + P  S P
Sbjct: 533 YCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPP 592

Query: 400 VTLTALDRP 426
              T +  P
Sbjct: 593 PPPTPVSSP 601

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 50/104 (48%), Positives = 53/104 (50%), Gaps = 17/104 (16%)
 Frame = +1

Query: 142 PDSPQL*QLPP-------PPPPPPRPPPRPPPP---*PPPLPPY---PPPPRPPP*PPPP 282
           P  PQ    PP       PPPP   PPP  PPP    PPP+ PY   PPPP P   PPP 
Sbjct: 545 PPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPT 604

Query: 283 P-YPPPP*LPPP---P*PPPPRS*PPPPPPPRLVP*TLAPSGPV 402
           P Y PPP  PPP   P PPPP     PPPPP +V  +  P  PV
Sbjct: 605 PVYSPPP--PPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPV 646

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 50/112 (44%), Positives = 51/112 (45%), Gaps = 38/112 (33%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPP-----------PPPRPPPRPPPP*--PPPLPPY----PPPPR---- 258
           P  P +   PPPPP           PPP PP  PPPP   PPP  PY    PPPP     
Sbjct: 512 PPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPP 571

Query: 259 ----PPP*PPPPPY-----PPPP*LP---PPP-----*PPPPRS*PPPPPPP 363
               PPP  PPPP      PPPP  P   PPP      PPPP    PPPPPP
Sbjct: 572 PHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPP 623

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 51/113 (45%), Positives = 52/113 (46%), Gaps = 40/113 (35%)
 Frame = +1

Query: 142 PDSPQL*QLPPPP--------PPPPRPPP-------RPPPP-----*PPPLPPYPPPPRP 261
           P  P     PPPP        PPPP  PP        PPPP      PPP P Y PPP P
Sbjct: 554 PPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPP 613

Query: 262 P---P*PPPP-----PYPPPP*L----PPPP-----*PPPP---RS*PPPPPP 360
           P   P PPPP     P PPPP +    PPPP      PPPP    S PPPPPP
Sbjct: 614 PCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPP 666

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/76 (52%), Positives = 41/76 (53%), Gaps = 11/76 (14%)
 Frame = +1

Query: 169 PPPPPPP-PRPPPRP---PPP*PPPLPPYPPPP----RPPP*PPPPPY---PPPP*LPPP 315
           PPPPP P   PPP P   PPP PP + P PPPP     PPP PP   Y   PPPP     
Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSS 650

Query: 316 P*PPPPRS*PPPPPPP 363
           P PPP     PPPPPP
Sbjct: 651 PPPPPVYYSSPPPPPP 666

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 47/103 (45%), Positives = 48/103 (46%), Gaps = 25/103 (24%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPP-----PP*PPPLPPYPPPPRPP-----P*PPPPPYPPPP*LPPPP 318
           PPPPPP   PPP PP     PP PPP+  Y  PP PP     P PPP  Y  PP  PPPP
Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPP--PPPP 666

Query: 319 ----*PPPP----RS*PP-------PPPPPRLVP*TLAPSGPV 402
                PPPP     S PP       PPPPP        P  PV
Sbjct: 667 VHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPV 709

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 46/108 (42%), Positives = 51/108 (47%), Gaps = 11/108 (10%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*--PPPLPPYPPPPRPPP*PPPPP-----YPPPP 300
           P SP     PPPP  P   PP PP P   PPP P Y PPP PP   PPPP     Y PPP
Sbjct: 572 PHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPP 631

Query: 301 *LPPP----P*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRPSL 432
             PPP      PPPP      PPPP +   +  P  PV  ++   P +
Sbjct: 632 --PPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEV 677

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 37/80 (46%), Positives = 39/80 (48%), Gaps = 15/80 (18%)
 Frame = +1

Query: 205 RPPPP*PPPLPPYPPPPRPPP*P-------------PPPPYPPPP*L--PPPP*PPPPRS 339
           R   P PP + P PPP  P P P             PPPP PPPP    PPPP PPPP  
Sbjct: 390 RSVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVY 449

Query: 340 *PPPPPPPRLVP*TLAPSGP 399
            PPPPPPP   P   +P  P
Sbjct: 450 SPPPPPPPPPPPPVYSPPPP 469

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 46/107 (42%), Positives = 47/107 (43%), Gaps = 33/107 (30%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPP------PPRPP---PRPPPP-----*PPPLPPY----PPPPR--- 258
           P  P +   PPPPPP      PP PP     PPPP      PPP PP     PPPP    
Sbjct: 620 PPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHY 679

Query: 259 --PPP*P-----PPPPYPPPP*LPPPP*PPPPRS*PPP-----PPPP 363
             PPP P     PPPP   P    PPP P    S PPP     PPPP
Sbjct: 680 HSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPP 726

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 48/118 (40%), Positives = 51/118 (43%), Gaps = 44/118 (37%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPP-----PPRPPP----RPPPP*-----PPPLPPY----PPPPR--- 258
           P  P +    PPPPP     PP PPP     PPPP      PPP P +    PPPP    
Sbjct: 641 PPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPC 700

Query: 259 ---PPP*P-----PPPPY----PPPP*L---PPPP*PPPPRS*PP--------PPPPP 363
              PPP P     PPPP     PPPP +   PPPP P      PP        PPPPP
Sbjct: 701 EESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSPEYEGPLPPVIGVSYASPPPPP 758

[96][TOP]
>UniRef100_Q948Y7 VMP3 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q948Y7_VOLCA
          Length = 687

 Score =  112 bits (279), Expect = 2e-23
 Identities = 53/88 (60%), Positives = 53/88 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPP PPPP PPP  PPP P P PP PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 584 PPSPDPPSAPPPSPPPPSPPPPNPPP-PSPPPPNPPPPSPPPPSPPPPSPPPP-NPPPPS 641

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGPVT 405
           PPPP   PP PPPP   P    P  P T
Sbjct: 642 PPPPSPRPPTPPPPSPPPPRPPPRPPPT 669

 Score =  108 bits (270), Expect = 2e-22
 Identities = 52/86 (60%), Positives = 52/86 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PP P PP  PPP PPPP PPP  P PPPP PPP  PPPP PPPP  PPPP 
Sbjct: 579 PPSPD----PPSPDPPSAPPPSPPPPSPPP--PNPPPPSPPPPNPPPPSPPPP-SPPPPS 631

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPP   P T  P  P
Sbjct: 632 PPPPNPPPPSPPPPSPRPPTPPPPSP 657

 Score =  108 bits (270), Expect = 2e-22
 Identities = 55/100 (55%), Positives = 58/100 (58%), Gaps = 10/100 (10%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPP---RPPPRPPPP*PP---PLPPYPPPPRPPP*PPPPPYPPP-- 297
           PD P      PPPP PP    PPP PPPP PP   P PP PPPP PPP  PPPP PPP  
Sbjct: 587 PDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPS 646

Query: 298 --P*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLT 411
             P  PPPP PPPPR  P PPP  R  P T +P  PV ++
Sbjct: 647 PRPPTPPPPSPPPPRPPPRPPPTRRSPPPTSSPPPPVAVS 686

 Score =  100 bits (249), Expect = 5e-20
 Identities = 50/87 (57%), Positives = 51/87 (58%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRP-PPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P SP      PP P PP P PP  PPP PPP  P PPPP PPP  PPPP PPPP  PPPP
Sbjct: 569 PTSPDPPSPNPPSPDPPSPDPPSAPPPSPPP--PSPPPPNPPPPSPPPPNPPPP-SPPPP 625

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPPP   PP PPPP   P +  P  P
Sbjct: 626 SPPPPSPPPPNPPPPSPPPPSPRPPTP 652

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 48/89 (53%), Positives = 49/89 (55%), Gaps = 3/89 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPL---PPYPPPPRPPP*PPPPPYPPPP*LPP 312
           P  P    LP  P PP   PP P PP P P    PP PPPP PPP  PPPP PPPP  PP
Sbjct: 560 PPDPAWANLPTSPDPPSPNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPP-NPP 618

Query: 313 PP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP PPPP   PP PPPP   P +  P  P
Sbjct: 619 PPSPPPPSPPPPSPPPPNPPPPSPPPPSP 647

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 47/80 (58%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPP-PRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P 345
           PP PPPP  PPPRPPP  P P+PP PPP PRPPP P PP  PP P  P PP  PPPR   
Sbjct: 479 PPSPPPPSPPPPRPPP--PSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSS 536

Query: 346 PPPPPPRLVP*TLAPSGPVT 405
           P PPPP   P   +P  P T
Sbjct: 537 PRPPPPDPSPPPPSPPSPPT 556

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 45/74 (60%), Positives = 47/74 (63%), Gaps = 1/74 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYP-PPPRPPP*PPPPPYPPPP*LPPPP 318
           P SP    +PP PPP PRPPP P PP PPP PP P PPPRPPP P  P  PPP   PPPP
Sbjct: 494 PPSP----VPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPP 549

Query: 319 *PPPPRS*PPPPPP 360
            PP P + P PP P
Sbjct: 550 SPPSPPTSPSPPDP 563

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 52/119 (43%), Positives = 54/119 (45%), Gaps = 33/119 (27%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPP---PPPRPPPRPPPP*PPPLPPYPPPPRPPP*P------------- 273
           P SP+    PP PP   PPPRPPPRP  P PPP  P PPPP PP  P             
Sbjct: 509 PPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPPSPPSPPTSPSPPDPAWANL 568

Query: 274 -----PPPPYPP------------PP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
                PP P PP            PP  PPPP PPPP   PP PPPP   P +  P  P
Sbjct: 569 PTSPDPPSPNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSP 627

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 45/78 (57%), Positives = 46/78 (58%), Gaps = 4/78 (5%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP-- 315
           P +P     P PPPP P PPP P PP PPP P  PP PRPP  PP PP P PP  PPP  
Sbjct: 476 PSAPPSPPPPSPPPPRP-PPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRP 534

Query: 316 --P*PPPPRS*PPPPPPP 363
             P PPPP   PPPP PP
Sbjct: 535 SSPRPPPPDPSPPPPSPP 552

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 52/109 (47%), Positives = 54/109 (49%), Gaps = 23/109 (21%)
 Frame = +1

Query: 142 PDSPQL*QLPPPP---PPPPRPP-------------------PRPPPP*PP-PLPPYPPP 252
           P SP+    PPPP   PPPP PP                   P PP P PP P PP P P
Sbjct: 534 PSSPR----PPPPDPSPPPPSPPSPPTSPSPPDPAWANLPTSPDPPSPNPPSPDPPSPDP 589

Query: 253 PRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P  PP  PPPP PPPP  PPPP PPPP   PP PPPP   P +  P  P
Sbjct: 590 PSAPPPSPPPPSPPPP-NPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNP 637

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 38/60 (63%), Positives = 38/60 (63%), Gaps = 1/60 (1%)
 Frame = +1

Query: 190 PRPPPRPPPP*PPPLPPYPPPPRP-PP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPR 366
           P  PP PPPP PPP  P PPPP P PP PPP P PPP   PP P P PP   PPP PPPR
Sbjct: 476 PSAPPSPPPPSPPP--PRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPR 533

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/82 (45%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = +1

Query: 196 PPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LP-PPP*PPPPRS*PPPPPPPRLV 372
           P   PP      LP  PP P PP  PPP P PP P  P PPP P PP S  PP PPPR  
Sbjct: 463 PDECPPLSVLETLPSAPPSPPPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPR-P 521

Query: 373 P*TLAPSGPVTLTALDRPSLSD 438
           P    P  P    +  RP   D
Sbjct: 522 PSPRPPPRPPPRPSSPRPPPPD 543

[97][TOP]
>UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q948Y6_VOLCA
          Length = 1143

 Score =  112 bits (279), Expect = 2e-23
 Identities = 48/69 (69%), Positives = 48/69 (69%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PP PPPPP PPP P PP PPP PP PP P PPP PPPPP PPPP  PPPP  PPP   PP
Sbjct: 522 PPSPPPPPSPPPPPSPP-PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 580

Query: 349 PPPPPRLVP 375
           PPP PR  P
Sbjct: 581 PPPSPRHPP 589

 Score =  108 bits (270), Expect = 2e-22
 Identities = 54/99 (54%), Positives = 54/99 (54%), Gaps = 4/99 (4%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRP----PPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LP 309
           P SP L    PP P PPRP    PP PP P PPP PP PP P PPP PPPPP PPPP  P
Sbjct: 502 PPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 561

Query: 310 PPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRP 426
           PPP  PPP   PPPPP P   P    P  P       RP
Sbjct: 562 PPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRP 600

 Score =  105 bits (263), Expect = 1e-21
 Identities = 50/86 (58%), Positives = 50/86 (58%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPPPP PP PP  PPPP PPP P  PPPP PPP P PPP P PP  PPP  
Sbjct: 522 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP--PPPSP 579

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP    PP PPPR  P    P  P
Sbjct: 580 PPPPSPRHPPSPPPRPRPPRPQPPSP 605

 Score =  105 bits (261), Expect = 2e-21
 Identities = 50/87 (57%), Positives = 51/87 (58%), Gaps = 9/87 (10%)
 Frame = +1

Query: 166 LPPPP--------PPPPRPP-PRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           +PPPP        PP PRPP P PP P PPP PP PP P PPP PPPPP PPPP  PPPP
Sbjct: 499 VPPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 558

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             PPP   PPPPP P   P    P  P
Sbjct: 559 PSPPPPPSPPPPPSPPPPPSPPPPPSP 585

 Score =  103 bits (258), Expect = 5e-21
 Identities = 52/87 (59%), Positives = 52/87 (59%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRP-PPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P  P     PPPP PPP P PP PP P PPP PP PP P PPP PPPPP PPPP  P PP
Sbjct: 523 PSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP--PSPP 580

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PP PR  P PPP PR  P    PS P
Sbjct: 581 PPPSPRHPPSPPPRPR-PPRPQPPSPP 606

 Score =  102 bits (255), Expect = 1e-20
 Identities = 51/90 (56%), Positives = 53/90 (58%), Gaps = 2/90 (2%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRP--PPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP 315
           P SP     PPPPP PP P  PP PP P PPP PP PP P PPP PPPPP PPPP  P  
Sbjct: 528 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRH 587

Query: 316 P*PPPPRS*PPPPPPPRLVP*TLAPSGPVT 405
           P  PPPR  PP P PP   P + +P  P T
Sbjct: 588 PPSPPPRPRPPRPQPPS--PPSPSPPSPRT 615

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 47/84 (55%), Positives = 47/84 (55%), Gaps = 7/84 (8%)
 Frame = +1

Query: 169 PPPPPPPPRP------PPRPPPP*PPPLPPYPPP-PRPPP*PPPPPYPPPP*LPPPP*PP 327
           PP  PPPP P      PP P PP P P  P PPP P PPP PPPPP PPPP  PPPP  P
Sbjct: 496 PPFVPPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 555

Query: 328 PPRS*PPPPPPPRLVP*TLAPSGP 399
           PP   PPPPP P   P    P  P
Sbjct: 556 PPPPSPPPPPSPPPPPSPPPPPSP 579

[98][TOP]
>UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative
           (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC
          Length = 91

 Score =  112 bits (279), Expect = 2e-23
 Identities = 45/57 (78%), Positives = 46/57 (80%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS 339
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP+S
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQS 57

 Score =  107 bits (266), Expect = 5e-22
 Identities = 46/63 (73%), Positives = 47/63 (74%)
 Frame = +1

Query: 178 PPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPP 357
           PPPPP PPP PPPP PPP    PPPP PPP PPPPP PPPP  PPPP PPPP   PPPPP
Sbjct: 1   PPPPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP---PPPPP 53

Query: 358 PPR 366
           PP+
Sbjct: 54  PPQ 56

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 36/55 (65%), Positives = 36/55 (65%)
 Frame = +1

Query: 235 PPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP PPPP PPP PPPPP PPPP  PPPP PPPP   PPPPPPP   P    P  P
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 30/40 (75%), Positives = 31/40 (77%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPY 288
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPP  +
Sbjct: 19  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQSF 58

[99][TOP]
>UniRef100_Q7UA83 RNA-binding region RNP-1 (RNA recognition motif) n=1
           Tax=Synechococcus sp. WH 8102 RepID=Q7UA83_SYNPX
          Length = 214

 Score =  112 bits (279), Expect = 2e-23
 Identities = 63/108 (58%), Positives = 67/108 (62%), Gaps = 2/108 (1%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSY-GGGGYGGGGGYGGGRGG 249
           GR   +N   P G+  +G      GGGGY  GGGGYGGGG Y GGGG  GGGGYGG  GG
Sbjct: 69  GRPLRINKAEPRGSAPRG------GGGGYRGGGGGYGGGGGYGGGGGRDGGGGYGG--GG 120

Query: 248 GGYGGSGGGYGGGGRGGGRGGGG-GGGGSCYSCGESGHFARDCPTSAR 108
           GGY G GGGYGGGG GG  GGGG GGGG  Y     G  A D P+ AR
Sbjct: 121 GGYRGGGGGYGGGGGGGRDGGGGYGGGGGGY---RGGGDAGDRPSGAR 165

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 50/91 (54%), Positives = 51/91 (56%), Gaps = 5/91 (5%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   G  GGGGY  GGGGY G    GGGGYGGGGG GG  GGGGYGG GGGY
Sbjct: 97  GYGGGGGYGGGGGRDGGGGYGGGGGGYRG----GGGGYGGGGG-GGRDGGGGYGGGGGGY 151

Query: 218 GGGGRGGGRGGGGGGG-----GSCYSCGESG 141
            GGG  G R  G  G      G+  S GE G
Sbjct: 152 RGGGDAGDRPSGARGWEDRSYGARDSGGEGG 182

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 38/95 (40%), Positives = 38/95 (40%), Gaps = 46/95 (48%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYG---GGGYGGGGG----------------------YG--- 264
           GGGGGGY  GGGGYGGGG  G   GGGYGGGGG                      YG   
Sbjct: 117 GGGGGGYRGGGGGYGGGGGGGRDGGGGYGGGGGGYRGGGDAGDRPSGARGWEDRSYGARD 176

Query: 263 ------------------GGRGGGGYGGSGGGYGG 213
                             G  GGGG G    GYGG
Sbjct: 177 SGGEGGGGHDDGRSRRRRGSSGGGGGGDDYSGYGG 211

[100][TOP]
>UniRef100_A6G232 RNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1
           RepID=A6G232_9DELT
          Length = 136

 Score =  112 bits (279), Expect = 2e-23
 Identities = 63/100 (63%), Positives = 64/100 (64%), Gaps = 10/100 (10%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGG-----GGYERGGGGYGGGG---SYGGGGYGGGG 273
           DGR+  VN     G    G R GGGGG     GGY  GGGGYGGGG     GGGGYGGGG
Sbjct: 37  DGRAIRVNEANERGGGGGGGRGGGGGGRGGGGGGYGGGGGGYGGGGGGRGGGGGGYGGGG 96

Query: 272 GYG-GGRGGGGYGGSGG-GYGGGGRGGGRGGGGGGGGSCY 159
           G G GGRGGGG GG GG G GGGG GGG GGGGG GG  Y
Sbjct: 97  GGGRGGRGGGGGGGRGGRGGGGGGYGGGGGGGGGYGGGRY 136

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 48/74 (64%), Positives = 49/74 (66%), Gaps = 7/74 (9%)
 Frame = -3

Query: 338 ERGGGGYGGGGSYGGGGYGGGGGYGG-----GRGGGGYGGSGGGYGGGGRG--GGRGGGG 180
           ERGGGG GG G  GGG  GGGGGYGG     G GGGG GG GGGYGGGG G  GGRGGGG
Sbjct: 48  ERGGGGGGGRGGGGGGRGGGGGGYGGGGGGYGGGGGGRGGGGGGYGGGGGGGRGGRGGGG 107

Query: 179 GGGGSCYSCGESGH 138
           GGG      G  G+
Sbjct: 108 GGGRGGRGGGGGGY 121

[101][TOP]
>UniRef100_B9GUE2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GUE2_POPTR
          Length = 184

 Score =  112 bits (279), Expect = 2e-23
 Identities = 64/123 (52%), Positives = 69/123 (56%), Gaps = 15/123 (12%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTR-RGGGGGGGYERG---GGGYGGGGSYGGGGYGGGGG 270
           S  DGR+KA +V G   +       RGGGGG GY  G   GGGY  GG   G GYGGGG 
Sbjct: 59  SGEDGRAKAADVVGASRSRRPPRGGRGGGGGRGYYSGRGRGGGYERGGHSRGRGYGGGGS 118

Query: 269 YGG-----GRGGG------GYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGHFARDC 123
            GG     GR G         G  GG YGGGG     GGGGGGGG CY+CGE GHFARDC
Sbjct: 119 SGGACFNCGRYGHLARDCYEGGDDGGRYGGGGGRRYSGGGGGGGGGCYNCGEEGHFARDC 178

Query: 122 PTS 114
           P +
Sbjct: 179 PNA 181

[102][TOP]
>UniRef100_B7Q3T8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q3T8_IXOSC
          Length = 247

 Score =  112 bits (279), Expect = 2e-23
 Identities = 52/70 (74%), Positives = 54/70 (77%)
 Frame = -3

Query: 377 QGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGG 198
           +G+  GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GG
Sbjct: 175 KGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 234

Query: 197 GRGGGGGGGG 168
           G GGGGGGGG
Sbjct: 235 GGGGGGGGGG 244

 Score =  110 bits (276), Expect = 4e-23
 Identities = 54/76 (71%), Positives = 55/76 (72%)
 Frame = -3

Query: 395 PDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYG 216
           P G+   G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG G
Sbjct: 174 PKGSGGGGGGGGGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 230

Query: 215 GGGRGGGRGGGGGGGG 168
           GGG GGG GGGGGGGG
Sbjct: 231 GGGGGGGGGGGGGGGG 246

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 242

Query: 182 GGGGG 168
           GGGGG
Sbjct: 243 GGGGG 247

 Score =  106 bits (264), Expect = 9e-22
 Identities = 52/75 (69%), Positives = 53/75 (70%)
 Frame = -3

Query: 365 RGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGG 186
           +G GGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GG
Sbjct: 175 KGSGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 232

Query: 185 GGGGGGSCYSCGESG 141
           GGGGGG     G  G
Sbjct: 233 GGGGGGGGGGGGGGG 247

 Score =  102 bits (253), Expect = 2e-20
 Identities = 50/80 (62%), Positives = 53/80 (66%)
 Frame = -3

Query: 422 RSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGG 243
           ++K+    G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG
Sbjct: 168 KTKSHRPKGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 227

Query: 242 YGGSGGGYGGGGRGGGRGGG 183
            GG GGG GGGG GGG GGG
Sbjct: 228 GGGGGGGGGGGGGGGGGGGG 247

 Score =  101 bits (252), Expect = 2e-20
 Identities = 49/70 (70%), Positives = 49/70 (70%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 178 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 237

Query: 209 GRGGGRGGGG 180
           G GGG GGGG
Sbjct: 238 GGGGGGGGGG 247

[103][TOP]
>UniRef100_B7PVD9 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PVD9_IXOSC
          Length = 124

 Score =  112 bits (279), Expect = 2e-23
 Identities = 51/67 (76%), Positives = 53/67 (79%)
 Frame = -3

Query: 368 RRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRG 189
           ++GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG G
Sbjct: 57  KKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116

Query: 188 GGGGGGG 168
           GGGGGGG
Sbjct: 117 GGGGGGG 123

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 60  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119

Query: 182 GGGGG 168
           GGGGG
Sbjct: 120 GGGGG 124

 Score =  103 bits (258), Expect = 5e-21
 Identities = 49/67 (73%), Positives = 50/67 (74%)
 Frame = -3

Query: 377 QGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGG 198
           +G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GG
Sbjct: 58  KGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117

Query: 197 GRGGGGG 177
           G GGGGG
Sbjct: 118 GGGGGGG 124

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 46/67 (68%), Positives = 49/67 (73%)
 Frame = -3

Query: 341 YERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSC 162
           +++GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG  
Sbjct: 56  FKKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115

Query: 161 YSCGESG 141
              G  G
Sbjct: 116 GGGGGGG 122

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 46/64 (71%), Positives = 46/64 (71%)
 Frame = -3

Query: 332 GGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSC 153
           GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     
Sbjct: 60  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119

Query: 152 GESG 141
           G  G
Sbjct: 120 GGGG 123

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/65 (69%), Positives = 45/65 (69%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 59  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118

Query: 209 GRGGG 195
           G GGG
Sbjct: 119 GGGGG 123

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/65 (69%), Positives = 45/65 (69%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 60  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119

Query: 209 GRGGG 195
           G GGG
Sbjct: 120 GGGGG 124

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/66 (66%), Positives = 44/66 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 59  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118

Query: 218 GGGGRG 201
           GGGG G
Sbjct: 119 GGGGGG 124

[104][TOP]
>UniRef100_UPI0000DA3D7B PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA3D7B
          Length = 211

 Score =  111 bits (278), Expect = 2e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G DG    G   GGGGGGG   GGGG GGG   GGGG GGGGG GGG GGGG GG  GG 
Sbjct: 76  GGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGGGGGGGGGGGGDGGG 135

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGG 161

 Score =  110 bits (276), Expect = 4e-23
 Identities = 55/86 (63%), Positives = 57/86 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G + +G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 101 GGGGGDGRGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 160

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG G G GGGGGGGG     G  G
Sbjct: 161 GGGGGGRGDGGGGGGGGGRGGGGGDG 186

 Score =  110 bits (275), Expect = 5e-23
 Identities = 60/99 (60%), Positives = 61/99 (61%), Gaps = 1/99 (1%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYG-GG 258
           D  G   A    G  G +  G   GGGGGGG  RGGGG GGGG  GGGG GGGGG G GG
Sbjct: 78  DGGGGGGAAGGGGGGGGSGGG---GGGGGGGDGRGGGGGGGGGGGGGGGGGGGGGGGDGG 134

Query: 257 RGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGGG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGDGGGG 173

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGG G   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 89  GGGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGG 148

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 149 GGGGGGGGGGGGGGGGGGRGDGGGGG 174

 Score =  110 bits (275), Expect = 5e-23
 Identities = 53/77 (68%), Positives = 53/77 (68%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG   GGG GGGGG GGG GGGG GG GGG 
Sbjct: 99  GGGGGGGDGRGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGG 158

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGGRG GGGGGG
Sbjct: 159 GGGGGGGGRGDGGGGGG 175

 Score =  109 bits (273), Expect = 8e-23
 Identities = 54/86 (62%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG + GGGG GGGG  GGGG GGGGG GGG GGG  GG GG  
Sbjct: 27  GGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGDGGGGGGAA 86

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 87  GGGGGGGGSGGGGGGGGGGDGRGGGG 112

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/88 (63%), Positives = 56/88 (63%), Gaps = 2/88 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR--GGGGYGGSGG 225
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GG GG GGG   GGGG GGSGG
Sbjct: 38  GGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGG 97

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGGG G GRGGGGGGGG     G  G
Sbjct: 98  GGGGGGGGDGRGGGGGGGGGGGGGGGGG 125

 Score =  106 bits (264), Expect = 9e-22
 Identities = 53/78 (67%), Positives = 54/78 (69%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG + GGGG GGGG  GGGG GGGGG GGG GGGG GG G G 
Sbjct: 112 GGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGDG- 170

Query: 218 GGGGRGGGRGGGGGGGGS 165
           GGGG GGGRGGGGG G S
Sbjct: 171 GGGGGGGGRGGGGGDGAS 188

 Score =  105 bits (263), Expect = 1e-21
 Identities = 52/81 (64%), Positives = 52/81 (64%)
 Frame = -3

Query: 410 VNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGS 231
           V   G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG 
Sbjct: 17  VGGVGSGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGG 76

Query: 230 GGGYGGGGRGGGRGGGGGGGG 168
           G G GGGG  GG GGGGG GG
Sbjct: 77  GDGGGGGGAAGGGGGGGGSGG 97

 Score =  105 bits (262), Expect = 2e-21
 Identities = 55/90 (61%), Positives = 56/90 (62%)
 Frame = -3

Query: 410 VNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGS 231
           V V G  G+   G   GGGGGGG   GGGG GG G  GGGG GGGGG GG  GGGG GG 
Sbjct: 14  VVVVGGVGSGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGG 73

Query: 230 GGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGG  GGG GG  GGGGGGGGS    G  G
Sbjct: 74  GGGGDGGGGGGAAGGGGGGGGSGGGGGGGG 103

 Score =  105 bits (262), Expect = 2e-21
 Identities = 56/90 (62%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSY---GGGGYGGGGGYGGGRGGGGYGGSG 228
           G DG    G   GGGGGGG   GGGG GGGG     GGGG  GGGG GGG GGGG GG G
Sbjct: 45  GGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGG 104

Query: 227 G-GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G G GGGG GGG GGGGGGGG     G+ G
Sbjct: 105 GDGRGGGGGGGGGGGGGGGGGGGGGGGDGG 134

 Score =  105 bits (261), Expect = 2e-21
 Identities = 53/86 (61%), Positives = 54/86 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GG G GGGG+ GGGG GGG G GGG GGGG G  GGG 
Sbjct: 54  GGGGGGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGG 113

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 114 GGGGGGGGGGGGGGGGGGDGGGGGGG 139

 Score =  103 bits (258), Expect = 5e-21
 Identities = 57/92 (61%), Positives = 57/92 (61%), Gaps = 6/92 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGG--GGGYERGGGGYGGGGSYGGGGYGGGG----GYGGGRGGGGYG 237
           G DG    G   GGGG  GGG    GGG GGGGS GGGG GGGG    G GGG GGGG G
Sbjct: 62  GGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGG 121

Query: 236 GSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 122 GGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGG 153

 Score =  102 bits (255), Expect = 1e-20
 Identities = 52/86 (60%), Positives = 53/86 (61%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G +  G   GGGGGGG   GGGG  GGG  GGG  GGGGG GGG G GG GG GGG 
Sbjct: 59  GGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGGG 118

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGG GGG     G  G
Sbjct: 119 GGGGGGGGGGGGGDGGGGGGGGGGGG 144

 Score =  102 bits (255), Expect = 1e-20
 Identities = 52/86 (60%), Positives = 52/86 (60%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGG  G   GGGG GGGG  GGGG G GGG GGG GGGG GG GGG 
Sbjct: 69  GGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGGGGGGGGG 128

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGG  GGG GGGGGGGG     G  G
Sbjct: 129 GGGDGGGGGGGGGGGGGGGGGGGGGG 154

 Score =  102 bits (254), Expect = 1e-20
 Identities = 52/86 (60%), Positives = 52/86 (60%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGG  GGGG   GGG GGGG  GGG GGGG  G GGG 
Sbjct: 53  GGGGGGGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGG 112

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 113 GGGGGGGGGGGGGGGGGGGDGGGGGG 138

 Score =  102 bits (254), Expect = 1e-20
 Identities = 54/91 (59%), Positives = 55/91 (60%), Gaps = 5/91 (5%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGY-----GGGGSYGGGGYGGGGGYGGGRGGGGYGG 234
           G  G    G   GGGGGGG + GGGG      GGGG  GGGG GGGGG G G GGGG GG
Sbjct: 58  GGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGG 117

Query: 233 SGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGG GGGG GGG  GGGGGGG     G  G
Sbjct: 118 GGGGGGGGGGGGGGDGGGGGGGGGGGGGGGG 148

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 52/87 (59%), Positives = 52/87 (59%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG 249
           DGR       G  G    G   GGGG GG   GGGG GGGG  GGGG GGGGG GGG GG
Sbjct: 106 DGRGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG-GG 164

Query: 248 GGYGGSGGGYGGGGRGGGRGGGGGGGG 168
           GG G  GGG GGGGRGGG G G  G G
Sbjct: 165 GGRGDGGGGGGGGGRGGGGGDGASGSG 191

[105][TOP]
>UniRef100_UPI0000DA3CD5 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA3CD5
          Length = 311

 Score =  111 bits (278), Expect = 2e-23
 Identities = 56/82 (68%), Positives = 58/82 (70%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G +V+   RGGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 170 GCSVRVPGRGGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 226

Query: 209 GRGGGRGGGGGGGGSCYSCGES 144
           G GGGR GGGGG G   S  ES
Sbjct: 227 GGGGGRSGGGGGRGILLSSEES 248

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 47/65 (72%), Positives = 47/65 (72%)
 Frame = -3

Query: 335 RGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYS 156
           RGGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG    
Sbjct: 178 RGGGGGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGG 235

Query: 155 CGESG 141
            G  G
Sbjct: 236 GGGRG 240

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 45/74 (60%), Positives = 46/74 (62%)
 Frame = -3

Query: 422 RSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGG 243
           R K  +V  P      G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG
Sbjct: 167 RIKGCSVRVPGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 226

Query: 242 YGGSGGGYGGGGRG 201
            GG G   GGGGRG
Sbjct: 227 GGGGGRSGGGGGRG 240

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 39/66 (59%), Positives = 39/66 (59%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           GR       G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGGR GG
Sbjct: 177 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG-GGGRSGG 235

Query: 245 GYGGSG 228
           G GG G
Sbjct: 236 G-GGRG 240

[106][TOP]
>UniRef100_B9PW07 RNA recognition motif-containing protein, putative n=1
           Tax=Toxoplasma gondii GT1 RepID=B9PW07_TOXGO
          Length = 508

 Score =  111 bits (278), Expect = 2e-23
 Identities = 55/89 (61%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGY-GGGRGGGGYGGSGG 225
           +GP     +G  RGG G GGY   G  YGGGG  GGGGYGGGGGY GGG GGGGYGG  G
Sbjct: 270 SGPMRGPGRGGFRGGMGRGGYGGHGSPYGGGGYGGGGGYGGGGGYGGGGYGGGGYGGGNG 329

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           GYGGGG GG  GGG GGG   Y  G  G+
Sbjct: 330 GYGGGGNGGYGGGGYGGGNGGYGGGGGGY 358

 Score =  110 bits (274), Expect = 6e-23
 Identities = 56/83 (67%), Positives = 57/83 (68%), Gaps = 4/83 (4%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGG---GRGGGGYGGSG-GGYGGGG 207
           G  RGG GG G   GGGGYGGGG YGGGG  GGGGYGG   G G GGYGG G GGYGGGG
Sbjct: 284 GMGRGGYGGHGSPYGGGGYGGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGGNGGYGGGG 343

Query: 206 RGGGRGGGGGGGGSCYSCGESGH 138
            GGG GG GGGGG  Y  G  G+
Sbjct: 344 YGGGNGGYGGGGGG-YGGGGGGY 365

 Score =  105 bits (262), Expect = 2e-21
 Identities = 63/118 (53%), Positives = 64/118 (54%), Gaps = 27/118 (22%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGG--GGGYERGGGGYGGGGSYGGGGYG--------------GGGGY 267
           G  G    G+  GGGG  GGG   GGGGYGGGG YGGGGYG              GGGGY
Sbjct: 286 GRGGYGGHGSPYGGGGYGGGGGYGGGGGYGGGG-YGGGGYGGGNGGYGGGGNGGYGGGGY 344

Query: 266 GGGR-----GGGGYGGSGGGYGGGGRGGGRGGGGG------GGGSCYSCGESGHFARD 126
           GGG      GGGGYGG GGGYGG G GGG GGGGG      GGG  YS     H   D
Sbjct: 345 GGGNGGYGGGGGGYGGGGGGYGGYGGGGGYGGGGGFGSGGYGGGGGYSPAGPHHGGMD 402

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 46/80 (57%), Positives = 46/80 (57%), Gaps = 7/80 (8%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGG------GGGYGGGRG-GGGYGGSGGGYGGGGRG 201
           GG   G  RG G  G  G  G GGYGG      GGGYGGG G GGG G  GGGYGGGG G
Sbjct: 266 GGFNSGPMRGPGRGGFRGGMGRGGYGGHGSPYGGGGYGGGGGYGGGGGYGGGGYGGGGYG 325

Query: 200 GGRGGGGGGGGSCYSCGESG 141
           GG GG GGGG   Y  G  G
Sbjct: 326 GGNGGYGGGGNGGYGGGGYG 345

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 47/89 (52%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGS-YGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           G +   ++G  RGG  GG    G GGYGG GS YGGGGYGGGGGYGGG          GG
Sbjct: 267 GFNSGPMRGPGRGGFRGG---MGRGGYGGHGSPYGGGGYGGGGGYGGG----------GG 313

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESGHF 135
           YGGGG GGG   G GGG   Y  G +G +
Sbjct: 314 YGGGGYGGG---GYGGGNGGYGGGGNGGY 339

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 38/79 (48%), Positives = 43/79 (54%), Gaps = 7/79 (8%)
 Frame = -3

Query: 353 GGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRG----- 189
           G GG++   G Y GG + G     G GG+ GG G GGYGG G  YGGGG GGG G     
Sbjct: 256 GRGGFD---GFYHGGFNSGPMRGPGRGGFRGGMGRGGYGGHGSPYGGGGYGGGGGYGGGG 312

Query: 188 --GGGGGGGSCYSCGESGH 138
             GGGG GG  Y  G  G+
Sbjct: 313 GYGGGGYGGGGYGGGNGGY 331

[107][TOP]
>UniRef100_B7Q768 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7Q768_IXOSC
          Length = 230

 Score =  111 bits (278), Expect = 2e-23
 Identities = 52/68 (76%), Positives = 52/68 (76%)
 Frame = -3

Query: 371 TRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGR 192
           T  GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG 
Sbjct: 156 TNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 215

Query: 191 GGGGGGGG 168
           GGGGGGGG
Sbjct: 216 GGGGGGGG 223

 Score =  110 bits (276), Expect = 4e-23
 Identities = 53/76 (69%), Positives = 53/76 (69%)
 Frame = -3

Query: 395 PDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYG 216
           P      G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG G
Sbjct: 151 PVRPRTNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 210

Query: 215 GGGRGGGRGGGGGGGG 168
           GGG GGG GGGGGGGG
Sbjct: 211 GGGGGGGGGGGGGGGG 226

 Score =  110 bits (276), Expect = 4e-23
 Identities = 53/72 (73%), Positives = 53/72 (73%)
 Frame = -3

Query: 383 NVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGR 204
           N  G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG 
Sbjct: 157 NGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 216

Query: 203 GGGRGGGGGGGG 168
           GGG GGGGGGGG
Sbjct: 217 GGGGGGGGGGGG 228

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 165 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 224

Query: 182 GGGGG 168
           GGGGG
Sbjct: 225 GGGGG 229

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 166 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 225

Query: 182 GGGGG 168
           GGGGG
Sbjct: 226 GGGGG 230

 Score =  110 bits (274), Expect = 6e-23
 Identities = 53/76 (69%), Positives = 53/76 (69%)
 Frame = -3

Query: 368 RRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRG 189
           R  GGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG G
Sbjct: 155 RTNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 214

Query: 188 GGGGGGGSCYSCGESG 141
           GGGGGGG     G  G
Sbjct: 215 GGGGGGGGGGGGGGGG 230

 Score =  108 bits (271), Expect = 1e-22
 Identities = 52/74 (70%), Positives = 53/74 (71%)
 Frame = -3

Query: 392 DGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGG 213
           +G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GG
Sbjct: 157 NGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 216

Query: 212 GGRGGGRGGGGGGG 171
           GG GGG GGGGGGG
Sbjct: 217 GGGGGGGGGGGGGG 230

 Score =  104 bits (260), Expect = 3e-21
 Identities = 51/75 (68%), Positives = 51/75 (68%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           T   G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG
Sbjct: 156 TNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 215

Query: 221 YGGGGRGGGRGGGGG 177
            GGGG GGG GGGGG
Sbjct: 216 GGGGGGGGGGGGGGG 230

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 49/74 (66%), Positives = 49/74 (66%)
 Frame = -3

Query: 407 NVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSG 228
           N  G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG G
Sbjct: 157 NGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 216

Query: 227 GGYGGGGRGGGRGG 186
           GG GGGG GGG GG
Sbjct: 217 GGGGGGGGGGGGGG 230

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/64 (68%), Positives = 51/64 (79%), Gaps = 1/64 (1%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGS-GGGYGGGGRGGGRGGG 183
           G GGGG+  GGGG+GGGG +GGGG+GGG  +GGG GGGG+GG  GGG+GGG  GGG GGG
Sbjct: 1   GHGGGGF--GGGGFGGGG-FGGGGFGGG--HGGGYGGGGFGGGFGGGHGGGFGGGGYGGG 55

Query: 182 GGGG 171
           G GG
Sbjct: 56  GHGG 59

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/60 (68%), Positives = 44/60 (73%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGG GG   GGGG+GGGG   GGG+GGG G GGG GGG  GG GGG+GGGG GGG  GG
Sbjct: 3   GGGGFGGGGFGGGGFGGGGF--GGGHGGGYG-GGGFGGGFGGGHGGGFGGGGYGGGGHGG 59

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 40/62 (64%), Positives = 43/62 (69%)
 Frame = -3

Query: 323 GYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGES 144
           G+GGGG +GGGG+GGGG  GGG GGG  GG GGG  GGG GGG GGG GGGG     G  
Sbjct: 1   GHGGGG-FGGGGFGGGGFGGGGFGGGHGGGYGGGGFGGGFGGGHGGGFGGGG----YGGG 55

Query: 143 GH 138
           GH
Sbjct: 56  GH 57

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 38/57 (66%), Positives = 41/57 (71%), Gaps = 3/57 (5%)
 Frame = -3

Query: 302 YGGGGYGGGGGYGGGRGGGGYGGS-GGGYGGGGRGGGRGGG--GGGGGSCYSCGESG 141
           +GGGG+GGGG  GGG GGGG+GG  GGGYGGGG GGG GGG  GG GG  Y  G  G
Sbjct: 2   HGGGGFGGGGFGGGGFGGGGFGGGHGGGYGGGGFGGGFGGGHGGGFGGGGYGGGGHG 58

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 38/64 (59%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGG--GGGYGGGRGGGGYGGSGG 225
           G  G    G   GG GGGG+    GG+GGG  YGGGG+GG  GGG+GGG GGGGYG  GG
Sbjct: 3   GGGGFGGGGFGGGGFGGGGFG---GGHGGG--YGGGGFGGGFGGGHGGGFGGGGYG--GG 55

Query: 224 GYGG 213
           G+GG
Sbjct: 56  GHGG 59

[108][TOP]
>UniRef100_B7PYQ7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PYQ7_IXOSC
          Length = 209

 Score =  111 bits (278), Expect = 2e-23
 Identities = 53/79 (67%), Positives = 54/79 (68%)
 Frame = -3

Query: 404 VTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           + G       G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GG
Sbjct: 128 ILGSSRGKAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 187

Query: 224 GYGGGGRGGGRGGGGGGGG 168
           G GGGG GGG GGGGGGGG
Sbjct: 188 GGGGGGGGGGGGGGGGGGG 206

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/82 (67%), Positives = 57/82 (69%), Gaps = 2/82 (2%)
 Frame = -3

Query: 380 VQGTRRG--GGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGG 207
           + G+ RG  GGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG
Sbjct: 128 ILGSSRGKAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 187

Query: 206 RGGGRGGGGGGGGSCYSCGESG 141
            GGG GGGGGGGG     G  G
Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGG 209

 Score =  109 bits (273), Expect = 8e-23
 Identities = 53/76 (69%), Positives = 53/76 (69%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 134 GKAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 193

Query: 218 GGGGRGGGRGGGGGGG 171
           GGGG GGG GGGGGGG
Sbjct: 194 GGGGGGGGGGGGGGGG 209

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 50/80 (62%), Positives = 51/80 (63%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           G S+     G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGG
Sbjct: 130 GSSRGKAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 189

Query: 245 GYGGSGGGYGGGGRGGGRGG 186
           G GG GGG GGGG GGG GG
Sbjct: 190 GGGGGGGGGGGGGGGGGGGG 209

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 32/39 (82%), Positives = 32/39 (82%)
 Frame = -3

Query: 284 GGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGG 168
           GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 39

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 32/39 (82%), Positives = 32/39 (82%)
 Frame = -3

Query: 284 GGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGG 168
           GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG
Sbjct: 2   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 32/40 (80%), Positives = 32/40 (80%)
 Frame = -3

Query: 299 GGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG 180
           GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 32/40 (80%), Positives = 32/40 (80%)
 Frame = -3

Query: 296 GGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGG 177
           GGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 32/40 (80%), Positives = 32/40 (80%)
 Frame = -3

Query: 293 GGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGG 174
           GG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 32/40 (80%), Positives = 32/40 (80%)
 Frame = -3

Query: 290 GYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGG 171
           G GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 34/43 (79%), Positives = 34/43 (79%)
 Frame = -3

Query: 332 GGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGR 204
           GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGGR
Sbjct: 1   GGGGGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 41

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 32/41 (78%), Positives = 32/41 (78%)
 Frame = -3

Query: 314 GGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGR 192
           GGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGGR
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 41

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 33/43 (76%), Positives = 33/43 (76%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG 234
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG
Sbjct: 1   GGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 30/51 (58%), Positives = 32/51 (62%)
 Frame = -3

Query: 260 GRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGHFARDCPTSAR 108
           G GGGG GG GGG GGGG GGG GGGGGGGG     G  G   R  P S++
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGREIRPWPMSSK 51

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 28/36 (77%), Positives = 28/36 (77%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR 255
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGGR
Sbjct: 6   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 41

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 26/40 (65%), Positives = 26/40 (65%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGG 270
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40

[109][TOP]
>UniRef100_B7PW62 Cellular nucleic acid binding protein, putative (Fragment) n=1
           Tax=Ixodes scapularis RepID=B7PW62_IXOSC
          Length = 189

 Score =  111 bits (278), Expect = 2e-23
 Identities = 60/128 (46%), Positives = 70/128 (54%), Gaps = 14/128 (10%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGS-YGGGGYGGGGGYGGG 258
           + D RS +      DG    G   GGGGGG    GGG YGGGG+ YGGGGYGGGG +G  
Sbjct: 49  EGDQRSSSYGNRSRDGGYGGGGAYGGGGGGYGGGGGGSYGGGGAGYGGGGYGGGGSFGSS 108

Query: 257 RGGGGYGGSGGGYGGGGRGGGRGGGGGGGG-------------SCYSCGESGHFARDCPT 117
              GGY GS GG GGGG  GG GG  GG               SCY+CG++GH AR+CP 
Sbjct: 109 YRSGGY-GSRGGRGGGGSPGGPGGMRGGSTRMGDSRSFSSGPMSCYNCGKTGHIARECPD 167

Query: 116 SAR*ISLC 93
             +   +C
Sbjct: 168 DGKTCYVC 175

[110][TOP]
>UniRef100_UPI000186773D hypothetical protein BRAFLDRAFT_237208 n=1 Tax=Branchiostoma
           floridae RepID=UPI000186773D
          Length = 378

 Score =  111 bits (277), Expect = 3e-23
 Identities = 59/97 (60%), Positives = 62/97 (63%), Gaps = 10/97 (10%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGG---GGYGGGGSYGGGGYG--GGGGYGG----GRGGG 246
           G  G   +G   GGGGG G +RGG   G YGGGG YGGGGYG  GGGGYGG    G GGG
Sbjct: 217 GYGGGGGRGGGYGGGGGYGGDRGGYNNGNYGGGGGYGGGGYGGSGGGGYGGGGGYGGGGG 276

Query: 245 GYGGSGGGYGGGGRG-GGRGGGGGGGGSCYSCGESGH 138
           GY G GGGYGGGG   GG GG  GGGG  Y  G SG+
Sbjct: 277 GYSGGGGGYGGGGGSYGGGGGSYGGGGGSYGGGSSGY 313

 Score =  100 bits (250), Expect = 4e-20
 Identities = 57/93 (61%), Positives = 60/93 (64%), Gaps = 9/93 (9%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG---GGYGGSGGGY 219
           G   +G R+GG GG G    GGGYGGGG  GGG YGGGGGYGG RGG   G YGG GGGY
Sbjct: 198 GGGGRGQRQGGFGGRGR---GGGYGGGGGRGGG-YGGGGGYGGDRGGYNNGNYGG-GGGY 252

Query: 218 GGGGRGG------GRGGGGGGGGSCYSCGESGH 138
           GGGG GG      G GGG GGGG  YS G  G+
Sbjct: 253 GGGGYGGSGGGGYGGGGGYGGGGGGYSGGGGGY 285

 Score =  100 bits (248), Expect = 7e-20
 Identities = 57/95 (60%), Positives = 58/95 (61%), Gaps = 8/95 (8%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGG--GGGYE-RGGGGYGGGGSYGGGG---YGGGGGYGGGRGGGGYG 237
           G  G    G   GGGG  GGGY   GGGGYGGGG YGGGG    GGGGGYGG  GGG YG
Sbjct: 236 GDRGGYNNGNYGGGGGYGGGGYGGSGGGGYGGGGGYGGGGGGYSGGGGGYGG--GGGSYG 293

Query: 236 GSGGGYGGGG--RGGGRGGGGGGGGSCYSCGESGH 138
           G GG YGGGG   GGG  G GG  G  YS   SG+
Sbjct: 294 GGGGSYGGGGGSYGGGSSGYGGSSGGGYSDFGSGY 328

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 56/93 (60%), Positives = 56/93 (60%), Gaps = 7/93 (7%)
 Frame = -3

Query: 398 GPDGANVQGTRRGG------GGGGGYERGG-GGYGGGGSYGGGGYGGGGGYGGGRGGGGY 240
           G  G    G  RGG      GGGGGY  GG GG GGGG  GGGGYGGGGG G   GGGGY
Sbjct: 227 GYGGGGGYGGDRGGYNNGNYGGGGGYGGGGYGGSGGGGYGGGGGYGGGGG-GYSGGGGGY 285

Query: 239 GGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG GG YGGGG   G GGG  GGGS    G SG
Sbjct: 286 GGGGGSYGGGGGSYGGGGGSYGGGSSGYGGSSG 318

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 62/117 (52%), Positives = 63/117 (53%), Gaps = 33/117 (28%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGG-SYGGGG--YGGGGG-YG------GGRGG 249
           G  G    G    GGGGGGY  GGGGYGGGG SYGGGG  YGGGGG YG      GG  G
Sbjct: 259 GSGGGGYGGGGGYGGGGGGYSGGGGGYGGGGGSYGGGGGSYGGGGGSYGGGSSGYGGSSG 318

Query: 248 GGY------------------GGSGGGYGGGGR--GGGRGGG---GGGGGSCYSCGE 147
           GGY                  GG GGGYGGGGR  GG  GGG   GGGGG  Y  G+
Sbjct: 319 GGYSDFGSGYGSQQSNYGPMKGGGGGGYGGGGRQGGGPYGGGYSSGGGGGGGYGGGQ 375

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 53/89 (59%), Positives = 55/89 (61%), Gaps = 5/89 (5%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGG---SYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G    G   GG GGGGY  GGGGYGGGG   S GGGGYGGGGG  GG GGG YGG GG Y
Sbjct: 249 GGGYGGGGYGGSGGGGYG-GGGGYGGGGGGYSGGGGGYGGGGGSYGG-GGGSYGGGGGSY 306

Query: 218 GGG--GRGGGRGGGGGGGGSCYSCGESGH 138
           GGG  G GG  GGG    GS Y   +S +
Sbjct: 307 GGGSSGYGGSSGGGYSDFGSGYGSQQSNY 335

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 49/96 (51%), Positives = 50/96 (52%), Gaps = 18/96 (18%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGS-YGGGGYGG----GGGYGG-------- 261
           +G  G    G    GGGGG Y  GGG YGGG S YGG   GG    G GYG         
Sbjct: 279 SGGGGGYGGGGGSYGGGGGSYGGGGGSYGGGSSGYGGSSGGGYSDFGSGYGSQQSNYGPM 338

Query: 260 -GRGGGGYGG----SGGGYGGGGRGGGRGGGGGGGG 168
            G GGGGYGG     GG YGGG   GG GGGG GGG
Sbjct: 339 KGGGGGGYGGGGRQGGGPYGGGYSSGGGGGGGYGGG 374

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 43/90 (47%), Positives = 44/90 (48%), Gaps = 25/90 (27%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGG--GGSY--------------------GGGGY 285
           G  G+   G    GGGGG Y  G  GYGG  GG Y                    GGGGY
Sbjct: 287 GGGGSYGGGGGSYGGGGGSYGGGSSGYGGSSGGGYSDFGSGYGSQQSNYGPMKGGGGGGY 346

Query: 284 GGGGGYGGGRGGGGY---GGSGGGYGGGGR 204
           GGGG  GGG  GGGY   GG GGGYGGG R
Sbjct: 347 GGGGRQGGGPYGGGYSSGGGGGGGYGGGQR 376

[111][TOP]
>UniRef100_UPI0000DA1BD4 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA1BD4
          Length = 250

 Score =  111 bits (277), Expect = 3e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 114 GGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGG 173

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGG GGG GGGGGGGG     G  G
Sbjct: 174 DGGGGGGGDGGGGGGGGGGGGDGSGG 199

 Score =  110 bits (276), Expect = 4e-23
 Identities = 55/86 (63%), Positives = 56/86 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G DG    G   GGGGGGG   GGGG GGGG  GGGG GGGG  GGG GGGG GG GGG 
Sbjct: 78  GGDGGGGGGGGVGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGG 137

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GG  GGGGGGGG     G+ G
Sbjct: 138 GGGGGGGDGGGGGGGGGGGGGGGDGG 163

 Score =  109 bits (273), Expect = 8e-23
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G  V G   GG GGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 83  GGGGGGVGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGG 142

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG G GGG GGGGGGGG     G  G
Sbjct: 143 GGDGGGGGGGGGGGGGGGDGGGGVGG 168

 Score =  108 bits (269), Expect = 2e-22
 Identities = 54/86 (62%), Positives = 54/86 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG G G 
Sbjct: 88  GVGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGG 147

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGG GGG     G  G
Sbjct: 148 GGGGGGGGGGGGGDGGGGVGGGGGGG 173

 Score =  107 bits (268), Expect = 3e-22
 Identities = 54/86 (62%), Positives = 54/86 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G DG    G R GGGG GG   GG G G GG  GGGG GGGGG G G GGGG GG GGG 
Sbjct: 52  GGDGGGDGGGRGGGGGDGGGGGGGDGGGDGGGGGGGGVGGGGGGGDGGGGGGGGGGGGGG 111

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 112 GGGGGGGGDGGGGGGGGGGGGGGGGG 137

 Score =  107 bits (267), Expect = 4e-22
 Identities = 56/98 (57%), Positives = 56/98 (57%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR 255
           D  GR       G  G    G   GGGGGGG   GGGG  GGG  GGGG GGGGG GGG 
Sbjct: 58  DGGGRGGGGGDGGGGGGGDGGGDGGGGGGGGVGGGGGGGDGGGGGGGGGGGGGGGGGGGG 117

Query: 254 GGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG G GG GGG GGGG GGG GGGGGG G     G  G
Sbjct: 118 GGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGG 155

 Score =  106 bits (265), Expect = 7e-22
 Identities = 54/86 (62%), Positives = 54/86 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGG    GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 102 GGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGD 161

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGG GGGG     G  G
Sbjct: 162 GGGGVGGGGGGGDGGGGGGGDGGGGG 187

 Score =  105 bits (263), Expect = 1e-21
 Identities = 53/86 (61%), Positives = 53/86 (61%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG 249
           DG        G  G    G   GGGGGGG   GGGG GGG   GGGG GGGGG GGG GG
Sbjct: 80  DGGGGGGGGVGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGG 139

Query: 248 GGYGGSGGGYGGGGRGGGRGGGGGGG 171
           GG GG GGG GGGG GGG GG GGGG
Sbjct: 140 GGGGGDGGGGGGGGGGGGGGGDGGGG 165

 Score =  105 bits (263), Expect = 1e-21
 Identities = 55/86 (63%), Positives = 55/86 (63%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G DG    G   GGGGGGG   GGGG  GGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 95  GGDGGGGGGGGGGGGGGGG--GGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGG 152

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGG GGG     G  G
Sbjct: 153 GGGGGGGGDGGGGVGGGGGGGDGGGG 178

 Score =  105 bits (262), Expect = 2e-21
 Identities = 53/86 (61%), Positives = 53/86 (61%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   G GG GGGG  GGGG GG GG GGG GGGG GG GGG 
Sbjct: 57  GDGGGRGGGGGDGGGGGGGDGGGDGGGGGGGGVGGGGGGGDGGGGGGGGGGGGGGGGGGG 116

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGG  GGG GGGGGGGG     G  G
Sbjct: 117 GGGDGGGGGGGGGGGGGGGGGGGGGG 142

 Score =  105 bits (261), Expect = 2e-21
 Identities = 53/86 (61%), Positives = 54/86 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G DG    G    GGGGGG + GG G GGGG   GGG GGG G GGG GGGG GG GGG 
Sbjct: 56  GGDGGGRGGGGGDGGGGGGGDGGGDGGGGGGGGVGGGGGGGDGGGGGGGGGGGGGGGGGG 115

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGGGGGGG     G  G
Sbjct: 116 GGGGDGGGGGGGGGGGGGGGGGGGGG 141

 Score =  103 bits (256), Expect = 8e-21
 Identities = 51/80 (63%), Positives = 52/80 (65%)
 Frame = -3

Query: 380 VQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRG 201
           V G   GGGGG G   GGG  GGGG  GGGG G GGG GGG GGGG GG GGG  GGG G
Sbjct: 43  VAGGGGGGGGGDGGGDGGGRGGGGGDGGGGGGGDGGGDGGGGGGGGVGGGGGGGDGGGGG 102

Query: 200 GGRGGGGGGGGSCYSCGESG 141
           GG GGGGGGGG     G+ G
Sbjct: 103 GGGGGGGGGGGGGGGGGDGG 122

 Score =  103 bits (256), Expect = 8e-21
 Identities = 53/88 (60%), Positives = 54/88 (61%)
 Frame = -3

Query: 404 VTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           V G  G    G   GGGGGGG   GGGG GG G  GGGG GGGGG GGG GGGG G  GG
Sbjct: 89  VGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGG 148

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGGG GGG G GGGG G     G+ G
Sbjct: 149 GGGGGGGGGGGGDGGGGVGGGGGGGDGG 176

 Score =  102 bits (254), Expect = 1e-20
 Identities = 52/86 (60%), Positives = 53/86 (61%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GG  GGGG GG GGG 
Sbjct: 99  GGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGG 158

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG G GG  GGGGGG G     G+ G
Sbjct: 159 GGDGGGGVGGGGGGGDGGGGGGGDGG 184

 Score =  101 bits (252), Expect = 2e-20
 Identities = 52/80 (65%), Positives = 52/80 (65%), Gaps = 3/80 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGG---GYGGGRGGGGYGGSG 228
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGG   G GGG GGGG GG G
Sbjct: 124 GGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGGDG 183

Query: 227 GGYGGGGRGGGRGGGGGGGG 168
           GG GGGG GGG G GGG GG
Sbjct: 184 GGGGGGGGGGGDGSGGGDGG 203

 Score =  100 bits (250), Expect = 4e-20
 Identities = 52/86 (60%), Positives = 52/86 (60%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGG  GGGGG GGG GGGG GG G G 
Sbjct: 109 GGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGGGVGG 168

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG  GG GGGG GGG     G  G
Sbjct: 169 GGGGGDGGGGGGGDGGGGGGGGGGGG 194

 Score =  100 bits (249), Expect = 5e-20
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G +  G   GGGGGGG   GGGG GGGG  G GG GGGG  GGG GGGG GG G G 
Sbjct: 140 GGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGGDGGGGGGGGGGGGDGSGG 199

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GG GGG GGG GGGG     G  G
Sbjct: 200 GDGGVGGGSGGGDGGGGGGGGGGGGG 225

 Score =  100 bits (248), Expect = 7e-20
 Identities = 56/91 (61%), Positives = 56/91 (61%), Gaps = 5/91 (5%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGG  GGG GGGG GG GGG 
Sbjct: 119 GDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGG 178

Query: 218 GGG--GRGGGRGGGGG---GGGSCYSCGESG 141
           GGG  G GGG GGGGG   GGG     G SG
Sbjct: 179 GGGDGGGGGGGGGGGGDGSGGGDGGVGGGSG 209

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GG GGGG + GGGG G GG  GGGG GGG G GGG G GG GG GGG 
Sbjct: 48  GGGGGGDGGGDGGGRGGGGGDGGGGGGGDGGGDGGGGGGGGVGGGGGGGDGGGGGGGGGG 107

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGG GGGG     G  G
Sbjct: 108 GGGGGGGGGGGGDGGGGGGGGGGGGG 133

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 54/103 (52%), Positives = 56/103 (54%), Gaps = 12/103 (11%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG-- 225
           G  G    G   GGGGGGG   GGGG GGGG  GGGG G GGG GGG GGGG GG GG  
Sbjct: 135 GGGGGGGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGGDGGGGGGGGGGGG 194

Query: 224 ----------GYGGGGRGGGRGGGGGGGGSCYSCGESGHFARD 126
                     G G GG  GG GGGGGGGG     G+ G   R+
Sbjct: 195 DGSGGGDGGVGGGSGGGDGGGGGGGGGGGGGVGGGDGGDHIRE 237

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 52/90 (57%), Positives = 52/90 (57%)
 Frame = -3

Query: 410 VNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGS 231
           V V G  G    G   G GGG G   G GG GGGG  GG G GGGGG  GG GGGG GG 
Sbjct: 41  VVVAGGGGGGGGGDGGGDGGGRGGGGGDGGGGGGGDGGGDGGGGGGGGVGGGGGGGDGGG 100

Query: 230 GGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGG GGGG GGG GGGGGG G     G  G
Sbjct: 101 GGGGGGGGGGGGGGGGGGGDGGGGGGGGGG 130

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 51/87 (58%), Positives = 51/87 (58%), Gaps = 10/87 (11%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG  GGG  GGGG GG GG GGG  GGG GG GGG 
Sbjct: 134 GGGGGGGGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGGDGGGGGGGGGGG 193

Query: 218 G----------GGGRGGGRGGGGGGGG 168
           G          GGG GGG GGGGGGGG
Sbjct: 194 GDGSGGGDGGVGGGSGGGDGGGGGGGG 220

[112][TOP]
>UniRef100_B9RJ51 Cold shock protein, putative n=1 Tax=Ricinus communis
           RepID=B9RJ51_RICCO
          Length = 184

 Score =  111 bits (277), Expect = 3e-23
 Identities = 64/124 (51%), Positives = 70/124 (56%), Gaps = 22/124 (17%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYE-RGGGGYGGGGSYGGGGYGGGGGY----- 267
           DGR+KAV+V       +  +RRGG GG G    GG G GGGG Y GGG G GG Y     
Sbjct: 62  DGRTKAVDV-------IPRSRRGGRGGFGRGFYGGRGRGGGGGYSGGGRGDGGVYVRRGR 114

Query: 266 GGGRGGGGYGGSG----------------GGYGGGGRGGGRGGGGGGGGSCYSCGESGHF 135
           GG  GGGG GGS                 GG GGGG G  R GGGGG G+CY+CGE GHF
Sbjct: 115 GGRSGGGGAGGSACYNCGRYGHLARDCYQGGGGGGGGGSRRFGGGGGSGACYNCGEEGHF 174

Query: 134 ARDC 123
           ARDC
Sbjct: 175 ARDC 178

[113][TOP]
>UniRef100_B7Q8C0 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7Q8C0_IXOSC
          Length = 92

 Score =  111 bits (277), Expect = 3e-23
 Identities = 52/68 (76%), Positives = 52/68 (76%)
 Frame = -3

Query: 371 TRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGR 192
           T  GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG 
Sbjct: 18  TMGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77

Query: 191 GGGGGGGG 168
           GGGGGGGG
Sbjct: 78  GGGGGGGG 85

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 22  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81

Query: 182 GGGGG 168
           GGGGG
Sbjct: 82  GGGGG 86

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 23  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82

Query: 182 GGGGG 168
           GGGGG
Sbjct: 83  GGGGG 87

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 24  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83

Query: 182 GGGGG 168
           GGGGG
Sbjct: 84  GGGGG 88

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 25  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84

Query: 182 GGGGG 168
           GGGGG
Sbjct: 85  GGGGG 89

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 26  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85

Query: 182 GGGGG 168
           GGGGG
Sbjct: 86  GGGGG 90

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 27  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86

Query: 182 GGGGG 168
           GGGGG
Sbjct: 87  GGGGG 91

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 28  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87

Query: 182 GGGGG 168
           GGGGG
Sbjct: 88  GGGGG 92

 Score =  108 bits (270), Expect = 2e-22
 Identities = 52/73 (71%), Positives = 52/73 (71%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 20  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79

Query: 209 GRGGGRGGGGGGG 171
           G GGG GGGGGGG
Sbjct: 80  GGGGGGGGGGGGG 92

 Score =  108 bits (270), Expect = 2e-22
 Identities = 52/73 (71%), Positives = 52/73 (71%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG 180
           GGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGG
Sbjct: 20  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79

Query: 179 GGGGSCYSCGESG 141
           GGGG     G  G
Sbjct: 80  GGGGGGGGGGGGG 92

 Score =  102 bits (255), Expect = 1e-20
 Identities = 50/73 (68%), Positives = 50/73 (68%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 20  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79

Query: 218 GGGGRGGGRGGGG 180
           GGGG GGG GGGG
Sbjct: 80  GGGGGGGGGGGGG 92

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 46/67 (68%), Positives = 47/67 (70%)
 Frame = -3

Query: 341 YERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSC 162
           +  GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG  
Sbjct: 17  FTMGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76

Query: 161 YSCGESG 141
              G  G
Sbjct: 77  GGGGGGG 83

[114][TOP]
>UniRef100_B7PVB4 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PVB4_IXOSC
          Length = 226

 Score =  111 bits (277), Expect = 3e-23
 Identities = 51/66 (77%), Positives = 52/66 (78%)
 Frame = -3

Query: 365 RGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGG 186
           +GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GG
Sbjct: 159 KGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 218

Query: 185 GGGGGG 168
           GGGGGG
Sbjct: 219 GGGGGG 224

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 161 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 220

Query: 182 GGGGG 168
           GGGGG
Sbjct: 221 GGGGG 225

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 162 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 221

Query: 182 GGGGG 168
           GGGGG
Sbjct: 222 GGGGG 226

 Score =  110 bits (274), Expect = 6e-23
 Identities = 52/68 (76%), Positives = 52/68 (76%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 1   GGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 57

Query: 182 GGGGGSCY 159
           GGGGG  Y
Sbjct: 58  GGGGGGVY 65

 Score =  106 bits (264), Expect = 9e-22
 Identities = 50/68 (73%), Positives = 51/68 (75%)
 Frame = -3

Query: 377 QGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGG 198
           +G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GG
Sbjct: 159 KGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 218

Query: 197 GRGGGGGG 174
           G GGGGGG
Sbjct: 219 GGGGGGGG 226

 Score =  104 bits (259), Expect = 3e-21
 Identities = 50/69 (72%), Positives = 50/69 (72%)
 Frame = -3

Query: 383 NVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGR 204
           N  G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG 
Sbjct: 158 NKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 217

Query: 203 GGGRGGGGG 177
           GGG GGGGG
Sbjct: 218 GGGGGGGGG 226

 Score =  100 bits (250), Expect = 4e-20
 Identities = 47/67 (70%), Positives = 48/67 (71%)
 Frame = -3

Query: 341 YERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSC 162
           Y +GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG  
Sbjct: 157 YNKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 216

Query: 161 YSCGESG 141
              G  G
Sbjct: 217 GGGGGGG 223

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 51/72 (70%), Positives = 51/72 (70%)
 Frame = -3

Query: 356 GGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGG 177
           GGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGG
Sbjct: 160 GGGGG---GGGGGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 214

Query: 176 GGGSCYSCGESG 141
           GGG     G  G
Sbjct: 215 GGGGGGGGGGGG 226

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 51/82 (62%), Positives = 53/82 (64%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR 255
           ++D   KA N  G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG 
Sbjct: 149 ESDHFYKAYNKGGGGG----GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 204

Query: 254 GGGGYGGSGGGYGGGGRGGGRG 189
           GGGG GG GGG GGGG GGG G
Sbjct: 205 GGGGGGGGGGGGGGGGGGGGGG 226

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 45/63 (71%), Positives = 45/63 (71%)
 Frame = -3

Query: 329 GGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCG 150
           GGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 149 ESG 141
             G
Sbjct: 61  GGG 63

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/63 (68%), Positives = 43/63 (68%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 209 GRG 201
           G G
Sbjct: 61  GGG 63

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 42/63 (66%), Positives = 42/63 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 218 GGG 210
           GGG
Sbjct: 61  GGG 63

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 39/60 (65%), Positives = 39/60 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GG Y
Sbjct: 6   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVY 65

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 37/55 (67%), Positives = 38/55 (69%)
 Frame = -3

Query: 305 SYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           +Y  GG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 156 AYNKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 210

[115][TOP]
>UniRef100_B7Q972 Secreted salivary gland peptide, putative (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q972_IXOSC
          Length = 117

 Score =  110 bits (276), Expect = 4e-23
 Identities = 52/68 (76%), Positives = 52/68 (76%)
 Frame = -3

Query: 371 TRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGR 192
           T  GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG 
Sbjct: 48  TGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107

Query: 191 GGGGGGGG 168
           GGGGGGGG
Sbjct: 108 GGGGGGGG 115

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 52  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111

Query: 182 GGGGG 168
           GGGGG
Sbjct: 112 GGGGG 116

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 53  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112

Query: 182 GGGGG 168
           GGGGG
Sbjct: 113 GGGGG 117

 Score =  104 bits (259), Expect = 3e-21
 Identities = 53/74 (71%), Positives = 53/74 (71%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 49  GGGGGGG---GGGGGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 182 GGGGGSCYSCGESG 141
           GGGGG     G  G
Sbjct: 104 GGGGGGGGGGGGGG 117

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 50/73 (68%), Positives = 50/73 (68%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           TG  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG
Sbjct: 48  TGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104

Query: 221 YGGGGRGGGRGGG 183
            GGGG GGG GGG
Sbjct: 105 GGGGGGGGGGGGG 117

[116][TOP]
>UniRef100_B7P0X5 Collagen-like repeats containing protein, putative (Fragment) n=1
           Tax=Ixodes scapularis RepID=B7P0X5_IXOSC
          Length = 117

 Score =  110 bits (276), Expect = 4e-23
 Identities = 51/67 (76%), Positives = 52/67 (77%)
 Frame = -3

Query: 368 RRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRG 189
           + GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG G
Sbjct: 48  KTGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107

Query: 188 GGGGGGG 168
           GGGGGGG
Sbjct: 108 GGGGGGG 114

 Score =  110 bits (276), Expect = 4e-23
 Identities = 52/68 (76%), Positives = 52/68 (76%)
 Frame = -3

Query: 371 TRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGR 192
           T  GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG 
Sbjct: 49  TGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108

Query: 191 GGGGGGGG 168
           GGGGGGGG
Sbjct: 109 GGGGGGGG 116

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 53  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112

Query: 182 GGGGG 168
           GGGGG
Sbjct: 113 GGGGG 117

 Score =  103 bits (258), Expect = 5e-21
 Identities = 51/83 (61%), Positives = 53/83 (63%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG 249
           +G     + T P      G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GG
Sbjct: 35  EGCCSVSSTTAPPKTGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94

Query: 248 GGYGGSGGGYGGGGRGGGRGGGG 180
           GG GG GGG GGGG GGG GGGG
Sbjct: 95  GGGGGGGGGGGGGGGGGGGGGGG 117

 Score =  102 bits (253), Expect = 2e-20
 Identities = 52/73 (71%), Positives = 52/73 (71%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG 180
           GGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGG
Sbjct: 50  GGGGGG---GGGGGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104

Query: 179 GGGGSCYSCGESG 141
           GGGG     G  G
Sbjct: 105 GGGGGGGGGGGGG 117

[117][TOP]
>UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus
           purpuratus RepID=UPI0000E498A8
          Length = 58

 Score =  110 bits (275), Expect = 5e-23
 Identities = 46/57 (80%), Positives = 46/57 (80%)
 Frame = +1

Query: 166 LPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPR 336
           LPPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPPR
Sbjct: 2   LPPPPPPPPPPPPPPPPP-PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 57

 Score =  107 bits (266), Expect = 5e-22
 Identities = 46/60 (76%), Positives = 46/60 (76%)
 Frame = +1

Query: 187 PPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPR 366
           PP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PPPPPPPR
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--PPPPPPPPP---PPPPPPPR 57

 Score =  104 bits (259), Expect = 3e-21
 Identities = 43/55 (78%), Positives = 43/55 (78%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPP 333
           PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PP P
Sbjct: 6   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--PPPPPPPRP 58

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 39/58 (67%), Positives = 39/58 (67%)
 Frame = +1

Query: 127 SLAK*PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP 300
           SL   P  P     PPPPPPPP PPP PPPP PPP PP PPPP PPP PPPPP PP P
Sbjct: 1   SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 34/44 (77%), Positives = 34/44 (77%)
 Frame = +1

Query: 232 LPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPP 363
           LPP PPPP PPP PPPPP PPPP  PPPP PPPP   PPPPPPP
Sbjct: 2   LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 36/55 (65%), Positives = 36/55 (65%)
 Frame = +1

Query: 235 PPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP PPPP PPP PPPPP PPPP  PPPP PPPP   PPPPPPP   P    P  P
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 34/52 (65%), Positives = 34/52 (65%)
 Frame = +1

Query: 244 PPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP PPP PPPPP PPPP  PPPP PPPP   PPPPPPP   P    P  P
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54

[118][TOP]
>UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO
          Length = 1765

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/86 (59%), Positives = 55/86 (63%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
            PD+P     PPPP PPP PPP PPPP P P+PP PPP  PPP PPPPP PPPP   PPP 
Sbjct: 1143 PDAPPPSPPPPPPSPPPSPPPSPPPP-PSPMPP-PPPSPPPPRPPPPPSPPPPVHEPPPS 1200

Query: 322  PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPPP +  PPPP P   P +  P  P
Sbjct: 1201 PPPPPNPSPPPPSPMPPPPSPMPPPP 1226

 Score =  107 bits (268), Expect = 3e-22
 Identities = 51/91 (56%), Positives = 53/91 (58%), Gaps = 10/91 (10%)
 Frame = +1

Query: 151  PQL*QLPPPPPPPPRPPPR----------PPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP 300
            P + + PP PPPPP PPP           PPPP PPP PP  PPP P P PPPPP PPPP
Sbjct: 1123 PPVHEPPPSPPPPPSPPPPTPDAPPPSPPPPPPSPPPSPPPSPPPPPSPMPPPPPSPPPP 1182

Query: 301  *LPPPP*PPPPRS*PPPPPPPRLVP*TLAPS 393
              PPPP PPPP   PPP PPP   P    PS
Sbjct: 1183 RPPPPPSPPPPVHEPPPSPPPPPNPSPPPPS 1213

 Score =  107 bits (266), Expect = 5e-22
 Identities = 54/85 (63%), Positives = 54/85 (63%), Gaps = 7/85 (8%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPP---PPRPPPRPPPP*PPPLPPYPPPP--RPPP*PPPPPYPPPP*L 306
            P SP     PPPPPP   PP PPP PPPP PPP PP PPPP   PPP PPPPP PPPP  
Sbjct: 1085 PPSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPP-PPSPPPPVHEPPPSPPPPPSPPPP-T 1142

Query: 307  P--PPP*PPPPRS*PPPPPPPRLVP 375
            P  PPP PPPP   PPP PPP   P
Sbjct: 1143 PDAPPPSPPPPPPSPPPSPPPSPPP 1167

 Score =  106 bits (265), Expect = 7e-22
 Identities = 50/86 (58%), Positives = 51/86 (59%), Gaps = 9/86 (10%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
            PPP PP P  PP PPPP PP  PP PPP  PPP PPPPP PPPP   PPP PPPP S PP
Sbjct: 1081 PPPSPPSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPP 1140

Query: 349  ---------PPPPPRLVP*TLAPSGP 399
                     PPPPP   P +  PS P
Sbjct: 1141 PTPDAPPPSPPPPPPSPPPSPPPSPP 1166

 Score =  105 bits (261), Expect = 2e-21
 Identities = 50/90 (55%), Positives = 54/90 (60%), Gaps = 3/90 (3%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*P---PPPPYPPPP*LPP 312
            P SP     P PPPPP  PPPRPPPP  PP P + PPP PPP P   PPPP P PP  PP
Sbjct: 1162 PPSPPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPP--PP 1219

Query: 313  PP*PPPPRS*PPPPPPPRLVP*TLAPSGPV 402
             P PPPP   PP PPPP  +P   +P  P+
Sbjct: 1220 SPMPPPPSPPPPSPPPPSPMPPPPSPPPPI 1249

 Score =  103 bits (258), Expect = 5e-21
 Identities = 48/75 (64%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPP-P*LPPPP 318
            P  P     PPP PPPP  PP P P  PPP PP PPPP PPP PPP P PPP P  PPPP
Sbjct: 1119 PSPPPPVHEPPPSPPPPPSPPPPTPDAPPPSPP-PPPPSPPPSPPPSPPPPPSPMPPPPP 1177

Query: 319  *PPPPRS*PPPPPPP 363
             PPPPR  PPP PPP
Sbjct: 1178 SPPPPRPPPPPSPPP 1192

 Score =  103 bits (258), Expect = 5e-21
 Identities = 51/87 (58%), Positives = 52/87 (59%), Gaps = 10/87 (11%)
 Frame = +1

Query: 169  PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPP--PYPPPP*LPPPP*PPPPRS* 342
            PPPPP PP P P  PPP PPP PP  PPP PPP PPPP  P PPPP  PPPP PPPP S 
Sbjct: 1132 PPPPPSPPPPTPDAPPPSPPPPPP-SPPPSPPPSPPPPPSPMPPPPPSPPPPRPPPPPSP 1190

Query: 343  PP--------PPPPPRLVP*TLAPSGP 399
            PP        PPPPP   P   +P  P
Sbjct: 1191 PPPVHEPPPSPPPPPNPSPPPPSPMPP 1217

 Score =  103 bits (257), Expect = 6e-21
 Identities = 59/113 (52%), Positives = 62/113 (54%), Gaps = 20/113 (17%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPP---RPPPRPPP---P*PPPLPPYPPPPR---PPP*PPPPPYPP 294
            P SP   + PPPP PPP    PPP PPP   P PPP  P PPPP    PPP PPPP  PP
Sbjct: 1176 PPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPSPMPPPPSPPPPSPPP 1235

Query: 295  PP*LPPPP*PPPPRS*PPPPPP-PRLVP*TLAP----------SGPVTLTALD 420
            P  +PPPP PPPP   PPPPPP PR  P    P          S PVT  A+D
Sbjct: 1236 PSPMPPPPSPPPPIPSPPPPPPTPRSPPPAPPPLPGDVDPTPASPPVTGRAVD 1288

 Score =  102 bits (253), Expect = 2e-20
 Identities = 50/83 (60%), Positives = 52/83 (62%), Gaps = 5/83 (6%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPP--RPPPRPPPP*PPPLPPYPPPPRPPP*P-PPPPYP--PPP*L 306
            P SP     P PPPPPP   PPPRPPPP  PP P + PPP PPP P PPPP P  PPP  
Sbjct: 1091 PPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPDAPPPSP 1150

Query: 307  PPPP*PPPPRS*PPPPPPPRLVP 375
            PPPP  PPP   P PPPPP  +P
Sbjct: 1151 PPPPPSPPPSPPPSPPPPPSPMP 1173

 Score =  100 bits (248), Expect = 7e-20
 Identities = 52/97 (53%), Positives = 53/97 (54%), Gaps = 11/97 (11%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPP---------PRPPPRPPPP*PPPLPPYPPPP--RPPP*PPPPPY 288
            P  P     PPP PPP         P PPP PPPP PPP PP PPPP   PPP PPPPP 
Sbjct: 1148 PSPPPPPPSPPPSPPPSPPPPPSPMPPPPPSPPPPRPPP-PPSPPPPVHEPPPSPPPPPN 1206

Query: 289  PPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            P PP  PP P PPPP   PPPP PP   P   +P  P
Sbjct: 1207 PSPP--PPSPMPPPPSPMPPPPSPPPPSPPPPSPMPP 1241

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 51/91 (56%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*P-PPPPYPPPP*LPPPP 318
            P SP       PPP PP PPP PPP  PPP PP PP P PPP P PPPP PPPP  PPPP
Sbjct: 1135 PPSPPPPTPDAPPPSPPPPPPSPPPS-PPPSPPPPPSPMPPPPPSPPPPRPPPPPSPPPP 1193

Query: 319  *PPPPRS*PPP----PPPPRLVP*TLAPSGP 399
               PP S PPP    PPPP  +P   +P  P
Sbjct: 1194 VHEPPPSPPPPPNPSPPPPSPMPPPPSPMPP 1224

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 50/87 (57%), Positives = 51/87 (58%), Gaps = 9/87 (10%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPP---PRPPPRPPPP--*PPPLPPYPPPPRPPP----*PPPPPYPP 294
            P  P     PPPP PP   P PPP PPPP   PPP PP PP P PPP     PPP P PP
Sbjct: 1165 PPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPSPMPP 1224

Query: 295  PP*LPPPP*PPPPRS*PPPPPPPRLVP 375
            PP  PPPP PPPP   PPPP PP  +P
Sbjct: 1225 PP-SPPPPSPPPPSPMPPPPSPPPPIP 1250

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 47/86 (54%), Positives = 49/86 (56%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
            P +  +   P   PPPP PP  P PP PPP PP P PP PPP  PPPP PPPP  PPPP 
Sbjct: 1067 PPAAAMDNRPCEKPPPPSPPSPPSPPSPPPPPP-PSPPPPPPPSPPPPRPPPPPSPPPPV 1125

Query: 322  PPPPRS*PPPPPPPRLVP*TLAPSGP 399
              PP S PPPP PP   P    PS P
Sbjct: 1126 HEPPPSPPPPPSPPPPTPDAPPPSPP 1151

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 31/58 (53%), Positives = 31/58 (53%)
 Frame = +1

Query: 202  PRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP 375
            P PP       P   PPP  PP PP PP PPPP  P PP PPPP   PP PPPP   P
Sbjct: 1065 PAPPAAAMDNRPCEKPPPPSPPSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPP 1122

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 32/66 (48%), Positives = 34/66 (51%)
 Frame = +1

Query: 205  RPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TL 384
            R P P    +   P    PPP PP PP PP P  PPPP PPPP   PPP PPP   P   
Sbjct: 1063 RFPAPPAAAMDNRPCEKPPPPSPPSPPSPPSPPPPPPPSPPPP---PPPSPPPPRPPPPP 1119

Query: 385  APSGPV 402
            +P  PV
Sbjct: 1120 SPPPPV 1125

[119][TOP]
>UniRef100_B7QMH8 H/ACA ribonucleoprotein complex protein, putative (Fragment) n=1
           Tax=Ixodes scapularis RepID=B7QMH8_IXOSC
          Length = 121

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 50  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109

Query: 182 GGGGG 168
           GGGGG
Sbjct: 110 GGGGG 114

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 51  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110

Query: 182 GGGGG 168
           GGGGG
Sbjct: 111 GGGGG 115

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 52  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111

Query: 182 GGGGG 168
           GGGGG
Sbjct: 112 GGGGG 116

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 53  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112

Query: 182 GGGGG 168
           GGGGG
Sbjct: 113 GGGGG 117

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 54  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113

Query: 182 GGGGG 168
           GGGGG
Sbjct: 114 GGGGG 118

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 55  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114

Query: 182 GGGGG 168
           GGGGG
Sbjct: 115 GGGGG 119

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 56  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115

Query: 182 GGGGG 168
           GGGGG
Sbjct: 116 GGGGG 120

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 57  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116

Query: 182 GGGGG 168
           GGGGG
Sbjct: 117 GGGGG 121

 Score =  106 bits (265), Expect = 7e-22
 Identities = 52/77 (67%), Positives = 53/77 (68%)
 Frame = -3

Query: 404 VTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           +T   G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GG
Sbjct: 45  LTPMPGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104

Query: 224 GYGGGGRGGGRGGGGGG 174
           G GGGG GGG GGGGGG
Sbjct: 105 GGGGGGGGGGGGGGGGG 121

 Score =  105 bits (263), Expect = 1e-21
 Identities = 52/73 (71%), Positives = 52/73 (71%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG 180
           GGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGG
Sbjct: 50  GGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 106

Query: 179 GGGGSCYSCGESG 141
           GGGG     G  G
Sbjct: 107 GGGGGGGGGGGGG 119

[120][TOP]
>UniRef100_B7PJU5 GGY domain-containing protein, putative (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PJU5_IXOSC
          Length = 200

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 182 GGGGG 168
           GGGGG
Sbjct: 61  GGGGG 65

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 2   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61

Query: 182 GGGGG 168
           GGGGG
Sbjct: 62  GGGGG 66

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 3   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 62

Query: 182 GGGGG 168
           GGGGG
Sbjct: 63  GGGGG 67

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 51/72 (70%), Positives = 51/72 (70%)
 Frame = -3

Query: 356 GGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGG 177
           GGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGG
Sbjct: 1   GGGGG---GGGGGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 55

Query: 176 GGGSCYSCGESG 141
           GGG     G  G
Sbjct: 56  GGGGGGGGGGGG 67

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 49/68 (72%), Positives = 49/68 (72%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 8   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 67

Query: 182 GGGGGSCY 159
               GS Y
Sbjct: 68  IRVIGSFY 75

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 46/67 (68%), Positives = 46/67 (68%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 209 GRGGGRG 189
           G GGG G
Sbjct: 61  GGGGGGG 67

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 46/69 (66%), Positives = 46/69 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 218 GGGGRGGGR 192
           GGGG GG R
Sbjct: 61  GGGGGGGIR 69

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 40/74 (54%), Positives = 40/74 (54%), Gaps = 5/74 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG    G  Y
Sbjct: 16  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGIRVIGSFY 75

Query: 218 -----GGGGRGGGR 192
                G     GGR
Sbjct: 76  CDFYLGETSTNGGR 89

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 31/46 (67%), Positives = 31/46 (67%)
 Frame = -3

Query: 371 TRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG 234
           T  G G G  Y  GGGG GGGG  GGGG GGGGG GGG GGGG GG
Sbjct: 155 TPHGSGAGAAYCEGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 31/43 (72%), Positives = 31/43 (72%), Gaps = 2/43 (4%)
 Frame = -3

Query: 290 GYGGGGGY--GGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGG 168
           G G G  Y  GGG GGGG GG GGG GGGG GGG GGGGGGGG
Sbjct: 158 GSGAGAAYCEGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 30/43 (69%), Positives = 31/43 (72%)
 Frame = -3

Query: 323 GYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGG 195
           G G G +Y  GG GGGGG GGG GGGG GG GGG GGGG GGG
Sbjct: 158 GSGAGAAYCEGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 30/43 (69%), Positives = 30/43 (69%)
 Frame = -3

Query: 308 GSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG 180
           GS  G  Y  GGG GGG GGGG GG GGG GGGG GGG GGGG
Sbjct: 158 GSGAGAAYCEGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 27/40 (67%), Positives = 28/40 (70%)
 Frame = -3

Query: 287 YGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGG 168
           +G G G     GGGG GG GGG GGGG GGG GGGGGGGG
Sbjct: 157 HGSGAGAAYCEGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 196

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 31/50 (62%), Positives = 32/50 (64%)
 Frame = -3

Query: 395 PDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           P G+        GGGGGG   GGGG GGGG  GGGG GGGGG GGG GGG
Sbjct: 156 PHGSGAGAAYCEGGGGGG---GGGGGGGGG--GGGGGGGGGGGGGGGGGG 200

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 28/51 (54%), Positives = 32/51 (62%)
 Frame = -3

Query: 422 RSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGG 270
           R +  + +G   A  +G   GGGGGGG   GGGG GGGG  GGGG GGGGG
Sbjct: 152 RPRTPHGSGAGAAYCEGGGGGGGGGGGGGGGGGGGGGGG--GGGGGGGGGG 200

[121][TOP]
>UniRef100_A4H3P3 Putative uncharacterized protein n=1 Tax=Leishmania braziliensis
            RepID=A4H3P3_LEIBR
          Length = 1295

 Score =  110 bits (275), Expect = 5e-23
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362  GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
            GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 1200 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1259

Query: 182  GGGGG 168
            GGGGG
Sbjct: 1260 GGGGG 1264

 Score =  106 bits (265), Expect = 7e-22
 Identities = 51/73 (69%), Positives = 52/73 (71%)
 Frame = -3

Query: 392  DGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGG 213
            D  N   +  GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GG
Sbjct: 1192 DWDNNSSSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1251

Query: 212  GGRGGGRGGGGGG 174
            GG GGG GGGGGG
Sbjct: 1252 GGGGGGGGGGGGG 1264

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 49/78 (62%), Positives = 49/78 (62%)
 Frame = -3

Query: 401  TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
            TG D   V    R          GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG
Sbjct: 1179 TGGDRGPVCSAIRDWDNNSSSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1238

Query: 221  YGGGGRGGGRGGGGGGGG 168
             GGGG GGG GGGGGGGG
Sbjct: 1239 GGGGGGGGGGGGGGGGGG 1256

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 46/66 (69%), Positives = 47/66 (71%)
 Frame = -3

Query: 332  GGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSC 153
            GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     
Sbjct: 1201 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1260

Query: 152  GESGHF 135
            G  G +
Sbjct: 1261 GGGGRW 1266

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 46/64 (71%), Positives = 46/64 (71%)
 Frame = -3

Query: 332  GGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSC 153
            GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     
Sbjct: 1200 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1259

Query: 152  GESG 141
            G  G
Sbjct: 1260 GGGG 1263

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 46/66 (69%), Positives = 46/66 (69%)
 Frame = -3

Query: 389  GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
            G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 1200 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1259

Query: 209  GRGGGR 192
            G GGGR
Sbjct: 1260 GGGGGR 1265

 Score = 76.3 bits (186), Expect(2) = 9e-18
 Identities = 25/38 (65%), Positives = 25/38 (65%)
 Frame = -2

Query: 315  RWRKLWWRWIWWWRRLWWWTWWRRIWW*RRRLWWWWTW 202
            RWR  WWRW WWW   WWW WW   WW RRR WWWW W
Sbjct: 1265 RWR--WWRWRWWW--WWWWRWW---WWWRRRWWWWWRW 1295

 Score = 37.4 bits (85), Expect(2) = 9e-18
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = -3

Query: 398  GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSY 300
            G  G    G   GGGGGGG   GGGG GGGG +
Sbjct: 1234 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRW 1266

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 50/96 (52%), Positives = 52/96 (54%), Gaps = 6/96 (6%)
 Frame = -3

Query: 410  VNVTGPDGANVQGTRRGGGGGG------GYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG 249
            VN T P        R GG  G        ++      GGGG  GGGG GGGGG GGG GG
Sbjct: 1170 VNFTRPSA------RTGGDRGPVCSAIRDWDNNSSSGGGGGGGGGGGGGGGGGGGGGGGG 1223

Query: 248  GGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 1224 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1259

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 44/65 (67%), Positives = 44/65 (67%)
 Frame = -3

Query: 398  GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
            G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 1201 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1260

Query: 218  GGGGR 204
            GGGGR
Sbjct: 1261 GGGGR 1265

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/65 (66%), Positives = 44/65 (67%)
 Frame = -3

Query: 401  TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
            +G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG
Sbjct: 1199 SGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1258

Query: 221  YGGGG 207
             GGGG
Sbjct: 1259 GGGGG 1263

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 43/73 (58%), Positives = 44/73 (60%)
 Frame = -3

Query: 434  DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR 255
            D D  S +    G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG 
Sbjct: 1192 DWDNNSSSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1251

Query: 254  GGGGYGGSGGGYG 216
            GGGG GG GGG G
Sbjct: 1252 GGGGGGGGGGGGG 1264

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 23/39 (58%), Positives = 23/39 (58%)
 Frame = -2

Query: 363  RWWRRRRL*AWWRWLWRWRKLWWRWIWWWRRLWWWTWWR 247
            RWWR       WRW W W   WWRW WWWRR  WW WWR
Sbjct: 1267 RWWR-------WRWWWWW---WWRWWWWWRR-RWWWWWR 1294

[122][TOP]
>UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas
           reinhardtii RepID=A8J1N3_CHLRE
          Length = 527

 Score =  110 bits (274), Expect = 6e-23
 Identities = 48/76 (63%), Positives = 49/76 (64%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPP 351
           PP PPPP PPP PPPP PPP PP+PPPP PPP  P PP P PP  PPPP PPPP   PP 
Sbjct: 420 PPSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPS 479

Query: 352 PPPPRLVP*TLAPSGP 399
           P PP      L PS P
Sbjct: 480 PAPP------LPPSPP 489

 Score =  107 bits (266), Expect = 5e-22
 Identities = 57/111 (51%), Positives = 60/111 (54%), Gaps = 24/111 (21%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRP---------PPRPPPP*P------PPLPPYPPPPRPPP*PP 276
           P SPQ    PP PPPPP P         PP PPPP P      PP PP PPPP PPP PP
Sbjct: 378 PPSPQ----PPLPPPPPSPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPP 433

Query: 277 PPPYPPPP*LPPPP*PPPPR---------S*PPPPPPPRLVP*TLAPSGPV 402
           PPP PP P  PPPP PPPP          S PPPPPPP   P   +P+ P+
Sbjct: 434 PPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPPL 484

 Score =  104 bits (260), Expect = 3e-21
 Identities = 54/94 (57%), Positives = 55/94 (58%), Gaps = 8/94 (8%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRP--PPRPPPP*PPPLPPYPP------PPRPPP*PPPPPYPPP 297
           P SP     PPPPPPPP P  PP PPPP PPP  P PP      PP PPP PPP PYPP 
Sbjct: 420 PPSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPS 479

Query: 298 P*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P  P PP PPPP   PP P PP  VP + AP  P
Sbjct: 480 PAPPLPPSPPPPSPYPPSPAPP--VPPSPAPPSP 511

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 46/74 (62%), Positives = 46/74 (62%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP    LPP P PP   PP PPPP P P PP P PP PP  PPP PYPP P  P PP 
Sbjct: 368 PPSP----LPPSPAPPSPQPPLPPPP-PSPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPS 422

Query: 322 PPPPRS*PPPPPPP 363
           PPPP   PPPPPPP
Sbjct: 423 PPPPPPPPPPPPPP 436

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 47/87 (54%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP      PP P PP PPP P PP P P PP P PP PPP  P PP PP P  P PP 
Sbjct: 196 PPSPLPPSPRPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTPPG 255

Query: 322 PPPPRS*PP-PPPPPRLVP*TLAPSGP 399
           PPPP   PP PPPPP   P +  P  P
Sbjct: 256 PPPPSPAPPNPPPPPSPAPPSPKPPSP 282

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 51/93 (54%), Positives = 52/93 (55%), Gaps = 7/93 (7%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPP-------PRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP 300
           P SP     P PPPP P PP       P PPPP PPP PP PPPP  PP PPPP  PPP 
Sbjct: 394 PPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPPS 453

Query: 301 *LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
             PP P PP P   PPPPPPP   P + AP  P
Sbjct: 454 PGPPSPAPPSPPP-PPPPPPPSPYPPSPAPPLP 485

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 44/78 (56%), Positives = 44/78 (56%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP      PP P PP PPP PPPP P P PP P PP PP  PPP PYPP P  P PP 
Sbjct: 446 PPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPPLPPSPPPPSPYPPSPAPPVPPS 505

Query: 322 PPPPRS*PPPPPPPRLVP 375
           P PP   PP P PP   P
Sbjct: 506 PAPPSPEPPSPAPPSPPP 523

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 51/94 (54%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = +1

Query: 136 K*PDSPQL*QLPPPPPPPPRP-PPRPPPP*P-PPLPPYPPPPRPPP*PPP---PPYPPPP 300
           K P  P     PPP P PP P PP PPPP P PP+PP P PP PP  PPP   PP PPPP
Sbjct: 210 KPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTPPGPPPPSPAPPNPPPP 269

Query: 301 *LPPPP*PPPPRS*PP-PPPPPRLVP*TLAPSGP 399
             P PP P PP   PP PPPPP   P +  P  P
Sbjct: 270 PSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPSP 303

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 47/92 (51%), Positives = 48/92 (52%), Gaps = 6/92 (6%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPP------PPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP* 303
           P SP     PPPP P      PP P P  PPP P P PP P PP P P  P PP PPPP 
Sbjct: 258 PPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPPP 317

Query: 304 LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            P PP P PP   PP PPPP   P + AP  P
Sbjct: 318 SPYPPSPSPPSPPPPSPPPPSPAPPSPAPPSP 349

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 48/100 (48%), Positives = 49/100 (49%), Gaps = 14/100 (14%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPP-------------- 279
           P SP     P PPPP P PP  PPPP P P  P PP P PP  PPP              
Sbjct: 245 PPSPAPPTPPGPPPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPSPE 304

Query: 280 PPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP P PP  PPPP P PP   PP PPPP   P + AP  P
Sbjct: 305 PPSPQPPLPPPPPSPYPPSPSPPSPPPPSPPPPSPAPPSP 344

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 42/65 (64%), Positives = 42/65 (64%), Gaps = 1/65 (1%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*P-PPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P 345
           P PPPPPP PPP P PP P PPLPP PPPP P P  P PP PP P  PP P PP P    
Sbjct: 462 PSPPPPPPPPPPSPYPPSPAPPLPPSPPPPSPYPPSPAPPVPPSP-APPSPEPPSPAPPS 520

Query: 346 PPPPP 360
           PPPPP
Sbjct: 521 PPPPP 525

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 46/89 (51%), Positives = 49/89 (55%), Gaps = 2/89 (2%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PP-PLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*P 345
           P PP PPP P P PP P PP P PP PPPP P P  PP P PP P  PPPP P PP   P
Sbjct: 209 PKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTPPGPPPPSPAPPNPPP 268

Query: 346 PP-PPPPRLVP*TLAPSGPVTLTALDRPS 429
           PP P PP   P +  P  P    + + PS
Sbjct: 269 PPSPAPPSPKPPSPEPPSPPPPPSPEPPS 297

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 43/75 (57%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PP-PLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P SP+    PPPPP P  P P+PP P PP P PP PPPP  P  P P P  PPP  PPPP
Sbjct: 279 PPSPEP-PSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPPPSPYPPSPSPPSPPPPSPPPP 337

Query: 319 *PPPPRS*PPPPPPP 363
            P PP   PP PPPP
Sbjct: 338 SPAPPSPAPPSPPPP 352

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 48/96 (50%), Positives = 50/96 (52%), Gaps = 10/96 (10%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*P----PPLPPYPPPPRPPP*PPPPPYPPPP*LP 309
           P SPQ    P PP P P  PP PPPP P    PP PP P PP P P  P PP PPPP  P
Sbjct: 237 PPSPQP---PVPPSPAPPTPPGPPPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPPPSP 293

Query: 310 PPP*PPPPRS*PP------PPPPPRLVP*TLAPSGP 399
            PP P PP   PP      PPPPP   P + +P  P
Sbjct: 294 EPPSPKPPSPEPPSPQPPLPPPPPSPYPPSPSPPSP 329

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 55/122 (45%), Positives = 55/122 (45%), Gaps = 36/122 (29%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRP------PPRPPPP*---------------PPPLPPYPPPPR 258
           P SP     PPP PPPP P      PP PPPP                P PLPP P PP 
Sbjct: 321 PPSPSPPSPPPPSPPPPSPAPPSPAPPSPPPPCECLAGERELTCAFLPPSPLPPSPAPPS 380

Query: 259 P-PP*PPPPP--YPPPP*LPPPP*PPPPR------------S*PPPPPPPRLVP*TLAPS 393
           P PP PPPPP  YPP P  P PP PPPP             S PPPPPPP   P    P 
Sbjct: 381 PQPPLPPPPPSPYPPSPAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPF 440

Query: 394 GP 399
            P
Sbjct: 441 PP 442

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 41/74 (55%), Positives = 41/74 (55%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP      PP PPPP PPP P P  P P PP PP P PP   PP P PP P  P PP 
Sbjct: 451 PPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPPLPPSPPPPSPYPPSPAPPVPPSPAPPS 510

Query: 322 PPPPRS*PPPPPPP 363
           P PP   PP PPPP
Sbjct: 511 PEPPSPAPPSPPPP 524

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 48/95 (50%), Positives = 50/95 (52%), Gaps = 1/95 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRP-PP*PPPPPYPPPP*LPPPP 318
           P SP      PP P PP PPP P P  P P PP P PP P PP PPPPP P PP  P PP
Sbjct: 269 PPSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPPPPSPYPP-SPSPP 327

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDR 423
            PPPP   PPPP P    P   +P  P    A +R
Sbjct: 328 SPPPP--SPPPPSPAPPSPAPPSPPPPCECLAGER 360

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 45/80 (56%), Positives = 46/80 (57%), Gaps = 3/80 (3%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*P-PPLPPYPPPPRP-PP*PPPPPYPPPP*LPPPP*PPPPRS* 342
           P PP PPP  P  P PP P PP PP PPPP P PP PPPPP P PP  P PP P PP   
Sbjct: 230 PSPPSPPPPSPQPPVPPSPAPPTPPGPPPPSPAPPNPPPPPSPAPP-SPKPPSPEPPSPP 288

Query: 343 PPP-PPPPRLVP*TLAPSGP 399
           PPP P PP   P +  P  P
Sbjct: 289 PPPSPEPPSPKPPSPEPPSP 308

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/103 (49%), Positives = 53/103 (51%), Gaps = 16/103 (15%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRP-PPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*----- 303
           P SPQ    PP PPPPP P PP P PP PPP  P PPPP P P  P PP PPPP      
Sbjct: 305 PPSPQ----PPLPPPPPSPYPPSPSPPSPPP--PSPPPPSPAPPSPAPPSPPPPCECLAG 358

Query: 304 --------LPPPP*PPPPR--S*PPPPPPPRLVP*TLAPSGPV 402
                   LPP P PP P   S  PP PPP   P   +P+ PV
Sbjct: 359 ERELTCAFLPPSPLPPSPAPPSPQPPLPPPPPSPYPPSPAPPV 401

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 38/73 (52%), Positives = 38/73 (52%), Gaps = 9/73 (12%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRP---------PPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPP 294
           P SP     PPPPPPPP P         PP PPP  P P PP P PP PP   PP P PP
Sbjct: 461 PPSPP----PPPPPPPPSPYPPSPAPPLPPSPPP--PSPYPPSPAPPVPPSPAPPSPEPP 514

Query: 295 PP*LPPPP*PPPP 333
            P  P PP PP P
Sbjct: 515 SPAPPSPPPPPSP 527

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 38/73 (52%), Positives = 39/73 (53%), Gaps = 7/73 (9%)
 Frame = +1

Query: 202 PRPPPP*PP-PLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP------PPPP 360
           P PP P PP P PP P PP PPP P PPP  P P  P PP PPPP   PP      PP P
Sbjct: 194 PSPPSPLPPSPRPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQPPVPPSPAPPTP 253

Query: 361 PRLVP*TLAPSGP 399
           P   P + AP  P
Sbjct: 254 PGPPPPSPAPPNP 266

[123][TOP]
>UniRef100_Q6FT22 Strain CBS138 chromosome G complete sequence n=1 Tax=Candida
           glabrata RepID=Q6FT22_CANGA
          Length = 419

 Score =  110 bits (274), Expect = 6e-23
 Identities = 60/115 (52%), Positives = 66/115 (57%), Gaps = 8/115 (6%)
 Frame = -3

Query: 407 NVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSG 228
           N T P      GT  GGG  GG  +GGGG  GGGS GG G G GGG GGG GGG  GGSG
Sbjct: 33  NTTIPHNNGTNGTGGGGGQEGGGGQGGGGGSGGGSGGGSGGGSGGGSGGGSGGGSGGGSG 92

Query: 227 GGYG---GGGRGGGRGGGGGGG-----GSCYSCGESGHFARDCPTSAR*ISLCFT 87
           GG G   GGG GGG GGG GGG     GS Y    +GH+  D  T+ R I + +T
Sbjct: 93  GGSGGGSGGGSGGGSGGGSGGGLITSPGSSYCYPSNGHYPGDTITTGRKIGIFYT 147

[124][TOP]
>UniRef100_UPI0000DA1F29 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA1F29
          Length = 170

 Score =  109 bits (273), Expect = 8e-23
 Identities = 52/66 (78%), Positives = 52/66 (78%)
 Frame = -3

Query: 365 RGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGG 186
           RGGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GG
Sbjct: 36  RGGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92

Query: 185 GGGGGG 168
           GGGGGG
Sbjct: 93  GGGGGG 98

 Score =  104 bits (260), Expect = 3e-21
 Identities = 49/64 (76%), Positives = 49/64 (76%)
 Frame = -3

Query: 368 RRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRG 189
           R GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG G
Sbjct: 36  RGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95

Query: 188 GGGG 177
           GGGG
Sbjct: 96  GGGG 99

 Score =  101 bits (252), Expect = 2e-20
 Identities = 48/65 (73%), Positives = 48/65 (73%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGG 195
           G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG
Sbjct: 35  GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94

Query: 194 RGGGG 180
            GGGG
Sbjct: 95  GGGGG 99

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 46/64 (71%), Positives = 47/64 (73%)
 Frame = -3

Query: 377 QGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGG 198
           +G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GG
Sbjct: 36  RGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95

Query: 197 GRGG 186
           G GG
Sbjct: 96  GGGG 99

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 46/66 (69%), Positives = 46/66 (69%)
 Frame = -3

Query: 338 ERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCY 159
           E G GG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG   
Sbjct: 33  ESGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92

Query: 158 SCGESG 141
             G  G
Sbjct: 93  GGGGGG 98

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 47/65 (72%), Positives = 47/65 (72%)
 Frame = -3

Query: 335 RGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYS 156
           RGGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG    
Sbjct: 36  RGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG-GGGGGGGGGGGGGGGGGGGGG 94

Query: 155 CGESG 141
            G  G
Sbjct: 95  GGGGG 99

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 44/57 (77%), Positives = 44/57 (77%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGR 192
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGGR
Sbjct: 44  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 100

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 45/67 (67%), Positives = 46/67 (68%)
 Frame = -3

Query: 395 PDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYG 216
           P+     G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG G
Sbjct: 32  PESGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91

Query: 215 GGGRGGG 195
           GGG GGG
Sbjct: 92  GGGGGGG 98

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 43/57 (75%), Positives = 43/57 (75%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGR 192
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GG R
Sbjct: 45  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRR 101

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 43/62 (69%), Positives = 43/62 (69%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 39  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98

Query: 209 GR 204
           GR
Sbjct: 99  GR 100

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/65 (66%), Positives = 44/65 (67%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           +G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG
Sbjct: 34  SGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93

Query: 221 YGGGG 207
            GGGG
Sbjct: 94  GGGGG 98

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/65 (66%), Positives = 43/65 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 37  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96

Query: 218 GGGGR 204
           GGG R
Sbjct: 97  GGGRR 101

[125][TOP]
>UniRef100_Q40052 Glycine rich protein, RNA binding protein n=1 Tax=Hordeum vulgare
           RepID=Q40052_HORVU
          Length = 173

 Score =  109 bits (273), Expect = 8e-23
 Identities = 62/103 (60%), Positives = 64/103 (62%), Gaps = 7/103 (6%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGY---ERGGGGYGGGGSYG--GGGYGGGGGYG 264
           DGR   VN         Q  R  GGGGGGY     GGGGYGGGG YG  GGGYGG GG G
Sbjct: 73  DGRQVTVN-------EAQSRRSAGGGGGGYGGQRGGGGGYGGGGGYGGQGGGYGGQGGGG 125

Query: 263 -GGRGGGGYGGSGGGYGG-GGRGGGRGGGGGGGGSCYSCGESG 141
            GG+GGGGYGG  GG GG GG GGG GGGGGG G     G+SG
Sbjct: 126 YGGQGGGGYGGQRGGGGGYGGGGGGYGGGGGGYGGQRGGGDSG 168

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 41/70 (58%), Positives = 43/70 (61%), Gaps = 5/70 (7%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYE-RGGGGYGG----GGSYGGGGYGGGGGYGGGRGGGGYGG 234
           G  G   QG   GG GGGGY  +GGGGYGG    GG YG    GGGGGYGG  GGGGYGG
Sbjct: 107 GGGGYGGQGGGYGGQGGGGYGGQGGGGYGGQRGGGGGYG----GGGGGYGG--GGGGYGG 160

Query: 233 SGGGYGGGGR 204
             GG   GG+
Sbjct: 161 QRGGGDSGGQ 170

[126][TOP]
>UniRef100_A3BDN5 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A3BDN5_ORYSJ
          Length = 321

 Score =  109 bits (273), Expect = 8e-23
 Identities = 52/74 (70%), Positives = 53/74 (71%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GG RGGGG GG GGG GGGG GGG GGG
Sbjct: 86  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGGGGGG 145

Query: 182 GGGGGSCYSCGESG 141
           GG GG     G+ G
Sbjct: 146 GGNGGDDGDNGDDG 159

 Score =  107 bits (268), Expect = 3e-22
 Identities = 53/78 (67%), Positives = 55/78 (70%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGG 195
           G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG  G GGG GGGG GGG
Sbjct: 78  GVWSGGGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGG 135

Query: 194 RGGGGGGGGSCYSCGESG 141
            GGGGGGGG   + G+ G
Sbjct: 136 GGGGGGGGGGGGNGGDDG 153

 Score =  107 bits (268), Expect = 3e-22
 Identities = 52/79 (65%), Positives = 55/79 (69%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG G  G GG GGG GGGG GGG GGG
Sbjct: 83  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGGG 142

Query: 182 GGGGGSCYSCGESGHFARD 126
           GGGGG+    G++G    D
Sbjct: 143 GGGGGNGGDDGDNGDDGED 161

 Score =  103 bits (256), Expect = 8e-21
 Identities = 50/74 (67%), Positives = 50/74 (67%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG  GG GGGG GG GGG GGGG GGG GG 
Sbjct: 89  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGGGGGGGGN 148

Query: 182 GGGGGSCYSCGESG 141
           GG  G     GE G
Sbjct: 149 GGDDGDNGDDGEDG 162

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 47/71 (66%), Positives = 48/71 (67%)
 Frame = -3

Query: 353 GGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGG 174
           G G +  GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG  GGG GGG GGGGGG
Sbjct: 76  GWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGG 135

Query: 173 GGSCYSCGESG 141
           GG     G  G
Sbjct: 136 GGGGGGGGGGG 146

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 47/76 (61%), Positives = 47/76 (61%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGG  GGGGG GGG GGGG GG GGG 
Sbjct: 84  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGGGG 143

Query: 218 GGGGRGGGRGGGGGGG 171
           GGGG GG  G  G  G
Sbjct: 144 GGGGNGGDDGDNGDDG 159

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 47/77 (61%), Positives = 47/77 (61%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG  GGGG GGG GGGG GG GGG 
Sbjct: 83  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGGG 142

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG  GG  G  G  G
Sbjct: 143 GGGGGNGGDDGDNGDDG 159

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 50/89 (56%), Positives = 50/89 (56%), Gaps = 12/89 (13%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 89  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGGGGGGGGN 148

Query: 218 G------------GGGRGGGRGGGGGGGG 168
           G            G G  GGRGG G G G
Sbjct: 149 GGDDGDNGDDGEDGDGDAGGRGGKGRGRG 177

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 45/68 (66%), Positives = 46/68 (67%), Gaps = 3/68 (4%)
 Frame = -3

Query: 335 RGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGG---RGGGRGGGGGGGGS 165
           RG G + GGG  GGGG GGGGG GGG GGGG GG GGG GGGG   RGGG GGGGGGGG 
Sbjct: 75  RGWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGG 134

Query: 164 CYSCGESG 141
               G  G
Sbjct: 135 GGGGGGGG 142

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 46/78 (58%), Positives = 46/78 (58%), Gaps = 2/78 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGG--GGYGGGGGYGGGRGGGGYGGSGG 225
           G  G    G   GGGGGGG   GGGG GGGG  GG  GG GGGGG GGG GGGG GG GG
Sbjct: 85  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGGGGG 144

Query: 224 GYGGGGRGGGRGGGGGGG 171
           G G GG  G  G  G  G
Sbjct: 145 GGGNGGDDGDNGDDGEDG 162

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 45/78 (57%), Positives = 45/78 (57%), Gaps = 2/78 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSG--G 225
           G  G    G R GGGGGGG   GGGG GGGG  GGGG GG GG  G  G  G  G G  G
Sbjct: 111 GGGGGGGGGERGGGGGGGG---GGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAG 167

Query: 224 GYGGGGRGGGRGGGGGGG 171
           G GG GRG GRG G G G
Sbjct: 168 GRGGKGRGRGRGRGMGSG 185

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 35/55 (63%), Positives = 35/55 (63%)
 Frame = -3

Query: 305 SYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           S  G G   GGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 73  SLRGWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGG 127

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 39/76 (51%), Positives = 40/76 (52%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G   +G   GGGGGGG   GGGG GGGG  G GG  G  G  G  G G  GG GG  
Sbjct: 114 GGGGGGERGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGGKG 173

Query: 218 GGGGRGGGRGGGGGGG 171
            G GRG G G G G G
Sbjct: 174 RGRGRGRGMGSGIGRG 189

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 56/150 (37%), Positives = 56/150 (37%), Gaps = 73/150 (48%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGG------------- 258
           G  G    G   GGGGGGG ERGGGG GGGG  GGGG GGGGG GGG             
Sbjct: 100 GGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDG 159

Query: 257 ---------RGG------------------------------------GGYGGS-----G 228
                    RGG                                    G  GGS     G
Sbjct: 160 EDGDGDAGGRGGKGRGRGRGRGMGSGIGRGNGQNGDRGINSGGRGKIKGSNGGSRNVIGG 219

Query: 227 GGYGGGGRGG------GRGGGG----GGGG 168
           G  GGGG GG      G GGGG    GGGG
Sbjct: 220 GNKGGGGDGGSDNAQSGDGGGGWESSGGGG 249

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 41/100 (41%), Positives = 44/100 (44%), Gaps = 23/100 (23%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYG-----------------------GGGSYGGGG 288
           G  G   +G  RG G G G  RG G  G                       GGG+ GGGG
Sbjct: 167 GGRGGKGRGRGRGRGMGSGIGRGNGQNGDRGINSGGRGKIKGSNGGSRNVIGGGNKGGGG 226

Query: 287 YGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGG 168
            GG      G GGGG+  SGGG G G   G  GGGGGGGG
Sbjct: 227 DGGSDNAQSGDGGGGWESSGGGGGRGDVSGAGGGGGGGGG 266

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 43/89 (48%), Positives = 45/89 (50%), Gaps = 6/89 (6%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGG--GGGYGGGRGGGGYG-GSGGGY 219
           G    G   GGGGGGG   GGGG G GG  G  G  G  G G  GGRGG G G G G G 
Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGGKGRGRGRGRGM 182

Query: 218 GGG-GRGGGRGGGGG--GGGSCYSCGESG 141
           G G GRG G+ G  G   GG     G +G
Sbjct: 183 GSGIGRGNGQNGDRGINSGGRGKIKGSNG 211

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 46/118 (38%), Positives = 48/118 (40%), Gaps = 32/118 (27%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGG-------GGSYGGGGYGGGGGYGGGRGGGGY 240
           G  G    G   GGGGGGG   GGGG GG        G  G G  GG GG G GRG G  
Sbjct: 122 GGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGGKGRGRGRGRG 181

Query: 239 GGSGGGYG----------GGGR---------------GGGRGGGGGGGGSCYSCGESG 141
            GSG G G           GGR               GG +GGGG GG      G+ G
Sbjct: 182 MGSGIGRGNGQNGDRGINSGGRGKIKGSNGGSRNVIGGGNKGGGGDGGSDNAQSGDGG 239

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 42/122 (34%), Positives = 50/122 (40%), Gaps = 26/122 (21%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGG---SYGGGGYGGGGGYG 264
           ++ GR K     G     + G  +GGGG GG +    G GGGG   S GGGG G   G G
Sbjct: 199 NSGGRGKIKGSNGGSRNVIGGGNKGGGGDGGSDNAQSGDGGGGWESSGGGGGRGDVSGAG 258

Query: 263 GGRGGGGYGGSGG-----------------GYGGGGRGGGR------GGGGGGGGSCYSC 153
           GG GGGG   + G                  +GG G G G+      GG  G  G     
Sbjct: 259 GGGGGGGGDDANGVRQFIVPGPSICSSHRCKHGGDGTGNGQRKITTTGGNHGSSGVTKPK 318

Query: 152 GE 147
           GE
Sbjct: 319 GE 320

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 33/85 (38%), Positives = 36/85 (42%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           GR    N      +  +G  +G  GG     GGG  GGGG  G      G G GG    G
Sbjct: 187 GRGNGQNGDRGINSGGRGKIKGSNGGSRNVIGGGNKGGGGDGGSDNAQSGDGGGGWESSG 246

Query: 245 GYGGSGGGYGGGGRGGGRGGGGGGG 171
           G GG G   G GG GGG GG    G
Sbjct: 247 GGGGRGDVSGAGGGGGGGGGDDANG 271

[127][TOP]
>UniRef100_B7Q9F8 E3 ubiquitin ligase, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7Q9F8_IXOSC
          Length = 112

 Score =  109 bits (273), Expect = 8e-23
 Identities = 57/86 (66%), Positives = 60/86 (69%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG 249
           +GRS A+   G    +V   R GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GG
Sbjct: 31  NGRS-ALESYGRHDKDVHVARLGGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGG 86

Query: 248 GGYGGSGGGYGGGGRGGGRGGGGGGG 171
           GG GG GGG GGGG GGG GGGGGGG
Sbjct: 87  GGGGGGGGGGGGGGGGGGGGGGGGGG 112

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 42/59 (71%), Positives = 42/59 (71%)
 Frame = -3

Query: 317 GGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 52  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 40/70 (57%), Positives = 41/70 (58%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR 255
           D D     +   G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG 
Sbjct: 43  DKDVHVARLGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102

Query: 254 GGGGYGGSGG 225
           GGGG GG GG
Sbjct: 103 GGGGGGGGGG 112

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 26/39 (66%), Positives = 26/39 (66%)
 Frame = -3

Query: 257 RGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           R GGG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 50  RLGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88

[128][TOP]
>UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum
           bicolor RepID=C5XPK9_SORBI
          Length = 613

 Score =  109 bits (272), Expect = 1e-22
 Identities = 51/84 (60%), Positives = 52/84 (61%)
 Frame = +1

Query: 148 SPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PP 327
           SP L    PPPP PP P P PPPP PPP  P PP P PPP  PPPP PPPP  PPPP PP
Sbjct: 406 SPPLPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPP-SPPPPSPP 464

Query: 328 PPRS*PPPPPPPRLVP*TLAPSGP 399
           PP   PPPP PP   P   +PS P
Sbjct: 465 PPSPSPPPPSPPPPSPPPPSPSPP 488

 Score =  108 bits (270), Expect = 2e-22
 Identities = 53/90 (58%), Positives = 54/90 (60%), Gaps = 4/90 (4%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRP---PPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPP 312
           P SP     PPP PPPP P   PP PPPP PPP  P PPPP PPP  PPPP PPPP  PP
Sbjct: 411 PPSP-----PPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPP 465

Query: 313 P-P*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P P PPPP   PP PPPP   P   +P  P
Sbjct: 466 PSPSPPPPSPPPPSPPPPSPSPPPPSPPPP 495

 Score =  107 bits (268), Expect = 3e-22
 Identities = 52/87 (59%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYP-PPP*LPPPP 318
           P SP      PPPP PP P P PPPP PP  PP PPPP PPP  PPPP P PPP  PPPP
Sbjct: 421 PPSPSPPPPSPPPPSPPPPSPSPPPPSPP--PPSPPPPSPPPPSPPPPSPSPPPPSPPPP 478

Query: 319 *PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPPP   PPPP PP   P   +PS P
Sbjct: 479 SPPPPSPSPPPPSPPPPSPPPPSPSPP 505

 Score =  103 bits (258), Expect = 5e-21
 Identities = 46/72 (63%), Positives = 46/72 (63%), Gaps = 1/72 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYP-PPP*LPPPP 318
           P  P     PP PPPP  PPP PPPP PPP  P PPPP PPP  PPPP P PPP  PPPP
Sbjct: 436 PPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPP 495

Query: 319 *PPPPRS*PPPP 354
            PPPP   PPPP
Sbjct: 496 SPPPPSPSPPPP 507

 Score =  102 bits (255), Expect = 1e-20
 Identities = 46/74 (62%), Positives = 47/74 (63%), Gaps = 1/74 (1%)
 Frame = +1

Query: 181 PPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYP-PPP*LPPPP*PPPPRS*PPPPP 357
           P PP PPP PPPP PPP  P PPPP PPP  PPPP P PPP  PPPP PPPP   PP PP
Sbjct: 405 PSPPLPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPP 464

Query: 358 PPRLVP*TLAPSGP 399
           PP   P   +P  P
Sbjct: 465 PPSPSPPPPSPPPP 478

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/100 (49%), Positives = 49/100 (49%), Gaps = 27/100 (27%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPR---PPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP---- 300
           P SP     PPP PPPP    PPP PPPP PPP  P PPPP PPP  PPPP P PP    
Sbjct: 450 PPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPYY 509

Query: 301 --------*LPPPP----*PPPP--------RS*PPPPPP 360
                     PPPP     PPPP        R   PPPPP
Sbjct: 510 EVSPEERYLSPPPPAYTEVPPPPYYEVSPEDRYLSPPPPP 549

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 46/127 (36%), Positives = 47/127 (37%), Gaps = 49/127 (38%)
 Frame = +1

Query: 142 PDSPQL*QLPPP---PPPPPRPPPRPPPP*PPPLPPY----------------------- 243
           P SP     PPP   PPPP  PPP PPPP P P PPY                       
Sbjct: 472 PPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPP 531

Query: 244 ---------------PPPPRPPP*PPPPPY----PPPP*LPPPP*PPPPRS*P----PPP 354
                          PPP      PPPPPY    P    L PP  PP P S P      P
Sbjct: 532 PYYEVSPEDRYLSPPPPPVHHD--PPPPPYYEVSPEDRYLSPP--PPSPASLPKYDYSSP 587

Query: 355 PPPRLVP 375
           PPPR +P
Sbjct: 588 PPPRALP 594

[129][TOP]
>UniRef100_UPI0001867639 hypothetical protein BRAFLDRAFT_237268 n=1 Tax=Branchiostoma
           floridae RepID=UPI0001867639
          Length = 360

 Score =  109 bits (272), Expect = 1e-22
 Identities = 60/99 (60%), Positives = 63/99 (63%), Gaps = 12/99 (12%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGG----GYGGGGSYGGGGYGG--GGGYGGGRG----G 249
           G  G   +G   GGGGG G +RGGG     YGGGG YGGGGYGG  GGGYGGG G    G
Sbjct: 212 GYGGGGGRGGGYGGGGGYGGDRGGGYNNGNYGGGGGYGGGGYGGSGGGGYGGGGGYGGGG 271

Query: 248 GGYGGSGGGYGGGG--RGGGRGGGGGGGGSCYSCGESGH 138
           GGY G GGGYGGGG   GGG GG GGG G  YS   SG+
Sbjct: 272 GGYSGGGGGYGGGGGSYGGGGGGYGGGSGGGYSDFGSGY 310

 Score =  104 bits (260), Expect = 3e-21
 Identities = 58/92 (63%), Positives = 59/92 (64%), Gaps = 13/92 (14%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGG--------GGYGGGGGYGGG----RGGGGYGGS 231
           G  RGGG GGG  RGGG YGGGG YGG        G YGGGGGYGGG     GGGGYGG 
Sbjct: 206 GRGRGGGYGGGGGRGGG-YGGGGGYGGDRGGGYNNGNYGGGGGYGGGGYGGSGGGGYGG- 263

Query: 230 GGGYGGGGRG-GGRGGGGGGGGSCYSCGESGH 138
           GGGYGGGG G  G GGG GGGG  Y  G  G+
Sbjct: 264 GGGYGGGGGGYSGGGGGYGGGGGSYGGGGGGY 295

 Score =  100 bits (250), Expect = 4e-20
 Identities = 56/93 (60%), Positives = 59/93 (63%), Gaps = 9/93 (9%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG---GYGGSGGGY 219
           G   +G R+GG GG G    GGGYGGGG  GGG YGGGGGYGG RGGG   G  G GGGY
Sbjct: 193 GGGGRGQRQGGFGGRGR---GGGYGGGGGRGGG-YGGGGGYGGDRGGGYNNGNYGGGGGY 248

Query: 218 GGGGRGG------GRGGGGGGGGSCYSCGESGH 138
           GGGG GG      G GGG GGGG  YS G  G+
Sbjct: 249 GGGGYGGSGGGGYGGGGGYGGGGGGYSGGGGGY 281

 Score =  100 bits (248), Expect = 7e-20
 Identities = 62/111 (55%), Positives = 64/111 (57%), Gaps = 27/111 (24%)
 Frame = -3

Query: 398 GPDGANVQGTRRGG-GGGGGYERGGGGY-GGGGSYGGGG---YGGGGGYGGGRGGG---- 246
           G  G    G+  GG GGGGGY  GGGGY GGGG YGGGG    GGGGGYGGG GGG    
Sbjct: 247 GYGGGGYGGSGGGGYGGGGGYGGGGGGYSGGGGGYGGGGGSYGGGGGGYGGGSGGGYSDF 306

Query: 245 --GY-----------GGSGGGYGGGGR--GGGRGGG---GGGGGSCYSCGE 147
             GY           GG GGGYGGGGR  GG  GGG   GGGGG  Y  G+
Sbjct: 307 GSGYGSQQSNYGPMKGGGGGGYGGGGRQGGGPYGGGYSSGGGGGGGYGGGQ 357

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 55/101 (54%), Positives = 55/101 (54%), Gaps = 28/101 (27%)
 Frame = -3

Query: 362 GGGGGGGYE-RGGGGYGGGGSYGGGG---YGGGGGYGGGRGGGGYGGSGGGYGG------ 213
           GG GGGGY   GGGGYGGGG YGGGG    GGGGGYGG  GGG YGG GGGYGG      
Sbjct: 246 GGYGGGGYGGSGGGGYGGGGGYGGGGGGYSGGGGGYGG--GGGSYGGGGGGYGGGSGGGY 303

Query: 212 ------------------GGRGGGRGGGGGGGGSCYSCGES 144
                             GG GGG GGGG  GG  Y  G S
Sbjct: 304 SDFGSGYGSQQSNYGPMKGGGGGGYGGGGRQGGGPYGGGYS 344

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 50/100 (50%), Positives = 56/100 (56%), Gaps = 2/100 (2%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR 255
           D +G    V    P    +Q  ++  GGGGG  +  GG+GG G   GGGYGGGGG GGG 
Sbjct: 167 DINGHKSEVKKAVPK-QELQRLQQQSGGGGGRGQRQGGFGGRGR--GGGYGGGGGRGGGY 223

Query: 254 GGGG-YGGS-GGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG YGG  GGGY  G  GGG G GGGG G     G  G
Sbjct: 224 GGGGGYGGDRGGGYNNGNYGGGGGYGGGGYGGSGGGGYGG 263

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 46/91 (50%), Positives = 46/91 (50%), Gaps = 26/91 (28%)
 Frame = -3

Query: 398 GPDGANVQGTRRG-GGGGGGYERGGGGYGGG--GSY--------------------GGGG 288
           G  G    G   G GGGGG Y  GGGGYGGG  G Y                    GGGG
Sbjct: 268 GGGGGGYSGGGGGYGGGGGSYGGGGGGYGGGSGGGYSDFGSGYGSQQSNYGPMKGGGGGG 327

Query: 287 YGGGGGYGGGRGGGGY---GGSGGGYGGGGR 204
           YGGGG  GGG  GGGY   GG GGGYGGG R
Sbjct: 328 YGGGGRQGGGPYGGGYSSGGGGGGGYGGGQR 358

[130][TOP]
>UniRef100_UPI0000DB6D2F PREDICTED: hypothetical protein n=1 Tax=Apis mellifera
           RepID=UPI0000DB6D2F
          Length = 143

 Score =  109 bits (272), Expect = 1e-22
 Identities = 55/86 (63%), Positives = 57/86 (66%), Gaps = 3/86 (3%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGG--GGYGGGRGGGG-YGGSGGGY 219
           G    G   GGGGGGG   GGGG GGGG  GGGG GGG  GG GGGRGGGG  GG GGG 
Sbjct: 2   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGI 61

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG GGG GGG GG G+ + CG  G
Sbjct: 62  GGGGTGGGAGGGSGGDGNVWRCGGGG 87

 Score =  100 bits (250), Expect = 4e-20
 Identities = 51/78 (65%), Positives = 53/78 (67%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGG  GG GGG G GG GGG GGG
Sbjct: 6   GGGGGGGGGGGGGGGGGGGGGGGGGVGGGGG-GGGIGGGDGGGRGGGGGSGGDGGGIGGG 64

Query: 182 GGGGGSCYSCGESGHFAR 129
           G GGG+    G  G+  R
Sbjct: 65  GTGGGAGGGSGGDGNVWR 82

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 31/59 (52%), Positives = 34/59 (57%), Gaps = 1/59 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERG-GGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           G  G  + G   GG GGGG   G GGG GGGG+ GG G G GG     R GGG GG+GG
Sbjct: 34  GGGGGGIGGGDGGGRGGGGGSGGDGGGIGGGGTGGGAGGGSGGDGNVWRCGGG-GGAGG 91

[131][TOP]
>UniRef100_C1E9S3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E9S3_9CHLO
          Length = 461

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/89 (65%), Positives = 59/89 (66%), Gaps = 8/89 (8%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGG--GSYGGGGYGG------GGGYGGGRGGGGYGGSGGGYGGGG 207
           GGGGGGGY   GGGYGGG  G  GGGGYGG      GGGY GG GGGGYGG GGGYGGGG
Sbjct: 375 GGGGGGGYGGRGGGYGGGRGGGRGGGGYGGRGGGGRGGGYRGGGGGGGYGGGGGGYGGGG 434

Query: 206 RGGGRGGGGGGGGSCYSCGESGHFARDCP 120
            GGG GGGG  GG  Y  G  G + R  P
Sbjct: 435 -GGGYGGGGDRGG--YRGGGGGGYDRHRP 460

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 55/80 (68%), Positives = 55/80 (68%), Gaps = 5/80 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGG-GGGGGYERGGGGYG--GGGSYGGGGYGGGGGYGGGRGGGGY-GGS 231
           G  G    G R GG GGG G  RGGGGYG  GGG  GGG  GGGGG G G GGGGY GG 
Sbjct: 375 GGGGGGGYGGRGGGYGGGRGGGRGGGGYGGRGGGGRGGGYRGGGGGGGYGGGGGGYGGGG 434

Query: 230 GGGYGGGG-RGGGRGGGGGG 174
           GGGYGGGG RGG RGGGGGG
Sbjct: 435 GGGYGGGGDRGGYRGGGGGG 454

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 51/90 (56%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = -3

Query: 392 DGANVQGTRRGGGGGGGYERG---GGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG-SGG 225
           DG  ++G++         ER    GGG GGGG YGG G G GGG GGGRGGGGYGG  GG
Sbjct: 349 DGFELKGSKLSVSIATSKERPEDEGGGGGGGGGYGGRGGGYGGGRGGGRGGGGYGGRGGG 408

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESGHF 135
           G GGG RGGG GGG GGGG  Y  G  G +
Sbjct: 409 GRGGGYRGGGGGGGYGGGGGGYGGGGGGGY 438

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 39/61 (63%), Positives = 39/61 (63%), Gaps = 1/61 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGY-GGSGGG 222
           G  G    G R GGG GGGY  GGGG G GG  GG G GGGGGYGGG   GGY GG GGG
Sbjct: 395 GGRGGGGYGGRGGGGRGGGYRGGGGGGGYGGGGGGYGGGGGGGYGGGGDRGGYRGGGGGG 454

Query: 221 Y 219
           Y
Sbjct: 455 Y 455

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 42/96 (43%), Positives = 45/96 (46%), Gaps = 9/96 (9%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGT---------RRGGGGGGGYERGGGGYGGGGSYGGGGYGGG 276
           D  + A  V    GA++ G          RRGGGGGGG   G G  G  G Y   G  GG
Sbjct: 54  DASAAAAAVQTMHGADIMGRACRIDFSEDRRGGGGGGG---GRGPPGPPGGYAPSG--GG 108

Query: 275 GGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGG 168
           GGY   R GG     GGGY  GGR    GGG  GGG
Sbjct: 109 GGYDRDRSGGYDRDRGGGYDRGGRDSRGGGGYDGGG 144

[132][TOP]
>UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra
           magnipapillata RepID=UPI0001924514
          Length = 490

 Score =  108 bits (271), Expect = 1e-22
 Identities = 48/75 (64%), Positives = 51/75 (68%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPP   P  P  PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PP
Sbjct: 346 PPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP---PP 402

Query: 349 PPPPPRLVP*TLAPS 393
           PPPPP   P + +P+
Sbjct: 403 PPPPPPPCPASCSPT 417

 Score =  105 bits (262), Expect = 2e-21
 Identities = 44/64 (68%), Positives = 44/64 (68%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P      P PPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPPP  PPPP 
Sbjct: 346 PPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 322 PPPP 333
           PPPP
Sbjct: 406 PPPP 409

 Score =  102 bits (255), Expect = 1e-20
 Identities = 46/69 (66%), Positives = 46/69 (66%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P S    Q  PPPPPPP PPP PPPP PPP  P PPPP PPP PPPPP PPPP  PPPP 
Sbjct: 348 PPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 322 PPPPRS*PP 348
           PP P S  P
Sbjct: 408 PPCPASCSP 416

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 44/73 (60%), Positives = 45/73 (61%)
 Frame = +1

Query: 187 PPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPR 366
           PP P   P  P PPP PP PPPP PPP PPPPP PPPP  PPPP PPPP   PPPPPPP 
Sbjct: 346 PPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 367 LVP*TLAPSGPVT 405
             P   A   P +
Sbjct: 406 PPPPCPASCSPTS 418

[133][TOP]
>UniRef100_UPI000186D45B RNA-binding protein cabeza, putative n=1 Tax=Pediculus humanus
           corporis RepID=UPI000186D45B
          Length = 424

 Score =  108 bits (270), Expect = 2e-22
 Identities = 59/88 (67%), Positives = 60/88 (68%), Gaps = 8/88 (9%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGG---GGYERGGGGYGGGGSY--GGGGYGGGGGYGGGRGG-GGYG 237
           GP GAN  G   GGG G   GG   GGGGYGG G Y  GGGGYGGGGG+GG  G  GGYG
Sbjct: 86  GPQGANNYGGGMGGGSGNSYGGGGGGGGGYGGAGGYPGGGGGYGGGGGFGGNTGNSGGYG 145

Query: 236 GSGG-GYGGGGRGGGRG-GGGGGGGSCY 159
           GSGG G GGGG GGG G GGGGGGG  Y
Sbjct: 146 GSGGYGGGGGGYGGGSGSGGGGGGGGGY 173

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 53/108 (49%), Positives = 56/108 (51%), Gaps = 43/108 (39%)
 Frame = -3

Query: 362 GGGGGGGYER---------------------------------------GGGGYGGGGSY 300
           GGGGGGGY++                                       GGGGYGG G Y
Sbjct: 62  GGGGGGGYDQSGGNYNSGGGRGNYGPQGANNYGGGMGGGSGNSYGGGGGGGGGYGGAGGY 121

Query: 299 --GGGGYGGGGGYGGGRG-GGGYGGSGG-GYGGGGRGGGRGGGGGGGG 168
             GGGGYGGGGG+GG  G  GGYGGSGG G GGGG GGG G GGGGGG
Sbjct: 122 PGGGGGYGGGGGFGGNTGNSGGYGGSGGYGGGGGGYGGGSGSGGGGGG 169

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 53/120 (44%), Positives = 55/120 (45%), Gaps = 32/120 (26%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYG---- 264
           N G  +     GP G    G   GGGGGGG   GGGG GGGG  GGGG GG GG+G    
Sbjct: 271 NFGSGRGRGRGGPMGGGGGG---GGGGGGGRGGGGGGGGGGGGGGGGGGGGKGGFGRDGD 327

Query: 263 ---------------------------GGRGGGGYGGSGGGYGGGGR-GGGRGGGGGGGG 168
                                       G GGGG GG GG  G GGR GGGRGG GGG G
Sbjct: 328 WKCTNISCSNTNFSWRQLCNRCGENKPNGPGGGGDGGPGGRGGFGGRPGGGRGGPGGGRG 387

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 57/138 (41%), Positives = 58/138 (42%), Gaps = 39/138 (28%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYG----------------- 297
           GR   +   G  G    G R GGGGGGG   GGGG GGGG  G                 
Sbjct: 279 GRGGPMGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGKGGFGRDGDWKCTNISCSNT 338

Query: 296 --------------------GGGYGGGGGYGG--GRGGGGYGGSGGGYGGGGRGGGRGGG 183
                               GGG GG GG GG  GR GGG GG GGG GGG R G RGGG
Sbjct: 339 NFSWRQLCNRCGENKPNGPGGGGDGGPGGRGGFGGRPGGGRGGPGGGRGGGDR-GFRGGG 397

Query: 182 GGGGGSCYSCGESGHFAR 129
           GGGG      G  G   R
Sbjct: 398 GGGGDRRGPPGRGGSSGR 415

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 46/96 (47%), Positives = 49/96 (51%), Gaps = 9/96 (9%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGG-----GYGGGGSYGGGGYG-GGGGYGGGRGGGGYG 237
           G   A   G  +G GGG G +  GG     GYG GG  GGGGY   GG Y  G G G YG
Sbjct: 27  GQPQAGQWGGNQGYGGGPGMQGAGGFGQQQGYGQGGGGGGGGYDQSGGNYNSGGGRGNYG 86

Query: 236 GSGGGYGGGGRGGGRG---GGGGGGGSCYSCGESGH 138
             G    GGG GGG G   GGGGGGG  Y  G  G+
Sbjct: 87  PQGANNYGGGMGGGSGNSYGGGGGGGGGYG-GAGGY 121

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 39/70 (55%), Positives = 41/70 (58%), Gaps = 2/70 (2%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGG- 198
           G  +  G GGG   G GG GG G +GG   GG GG GGGRGGG  G  GGG GGG R G 
Sbjct: 350 GENKPNGPGGG---GDGGPGGRGGFGGRPGGGRGGPGGGRGGGDRGFRGGGGGGGDRRGP 406

Query: 197 -GRGGGGGGG 171
            GRGG  G G
Sbjct: 407 PGRGGSSGRG 416

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 48/103 (46%), Positives = 51/103 (49%), Gaps = 30/103 (29%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYG---GGGYGGGGGYGGG---RGGGGYG-----GSGGGYGG 213
           G GGGG   GGGGYG    YG    G +GG  GYGGG   +G GG+G     G GGG GG
Sbjct: 10  GVGGGG---GGGGYGNAQGYGQPQAGQWGGNQGYGGGPGMQGAGGFGQQQGYGQGGGGGG 66

Query: 212 GG---------RGGGRG----------GGGGGGGSCYSCGESG 141
           GG          GGGRG          GGG GGGS  S G  G
Sbjct: 67  GGYDQSGGNYNSGGGRGNYGPQGANNYGGGMGGGSGNSYGGGG 109

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 33/52 (63%), Positives = 33/52 (63%)
 Frame = -3

Query: 296 GGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G G G GG  GGG GGGG GG G G GGGG GGG GGGGGGGG     G  G
Sbjct: 275 GRGRGRGGPMGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGKGGFGRDG 326

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 39/75 (52%), Positives = 43/75 (57%), Gaps = 9/75 (12%)
 Frame = -3

Query: 347 GGYERGGGGYGGGGSYGGGGYGGGGGYG---GGRGGG--GYGGSGGGYGGGG----RGGG 195
           G  + G  G GGGG  GGGGYG   GYG    G+ GG  GYGG  G  G GG    +G G
Sbjct: 2   GDSQYGYTGVGGGG--GGGGYGNAQGYGQPQAGQWGGNQGYGGGPGMQGAGGFGQQQGYG 59

Query: 194 RGGGGGGGGSCYSCG 150
           +GGGGGGGG   S G
Sbjct: 60  QGGGGGGGGYDQSGG 74

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/70 (51%), Positives = 36/70 (51%), Gaps = 8/70 (11%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGG--------GGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGG 243
           G  G    G   GGGGG        GGY  G GGYG          GGGGGYGGG G GG
Sbjct: 117 GAGGYPGGGGGYGGGGGFGGNTGNSGGYG-GSGGYG----------GGGGGYGGGSGSGG 165

Query: 242 YGGSGGGYGG 213
            GG GGGYGG
Sbjct: 166 GGGGGGGYGG 175

[134][TOP]
>UniRef100_A9B9L1 RNA-binding region RNP-1 (RNA recognition motif) n=1
           Tax=Prochlorococcus marinus str. MIT 9211
           RepID=A9B9L1_PROM4
          Length = 245

 Score =  108 bits (270), Expect = 2e-22
 Identities = 64/123 (52%), Positives = 67/123 (54%), Gaps = 27/123 (21%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERG---------GGGYGGGGSYGG------- 294
           GR   +N   P G    G RRGG GGGGY  G         GGGYGGGG  GG       
Sbjct: 69  GRPLRINKAEPRGGG-GGPRRGGYGGGGYGGGYGGGGQGGYGGGYGGGGGQGGYGGGGGQ 127

Query: 293 GGYGGGG--GYGGGRGGGGYGGSG---------GGYGGGGRGGGRGGGGGGGGSCYSCGE 147
           GGYGGGG  GYGGG G GGYGG G         GGYGGGG GGG GGGGG GG     G+
Sbjct: 128 GGYGGGGQGGYGGGGGQGGYGGGGQGGYGGGGQGGYGGGGYGGGYGGGGGQGGYGGGGGQ 187

Query: 146 SGH 138
            G+
Sbjct: 188 GGY 190

 Score =  101 bits (252), Expect = 2e-20
 Identities = 57/88 (64%), Positives = 60/88 (68%), Gaps = 11/88 (12%)
 Frame = -3

Query: 365 RGGGGG---GGYERGGGGYGGGGSYGGGGYGG-GGGYGGGRGGGGYGGSG--GGYGGGGR 204
           RGGGGG   GGY  GGGGYGGG  YGGGG GG GGGYGGG G GGYGG G  GGYGGGG+
Sbjct: 80  RGGGGGPRRGGY--GGGGYGGG--YGGGGQGGYGGGYGGGGGQGGYGGGGGQGGYGGGGQ 135

Query: 203 -----GGGRGGGGGGGGSCYSCGESGHF 135
                GGG+GG GGGG   Y  G  G +
Sbjct: 136 GGYGGGGGQGGYGGGGQGGYGGGGQGGY 163

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 47/78 (60%), Positives = 48/78 (61%), Gaps = 3/78 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGG-GGYGGGGS--YGGGGYGGGGGYGGGRGGGGYGGSG 228
           G  G   QG   GGGG GGY  GG GGYGGGG   YGGGGYGGG G GGG+GG G GG  
Sbjct: 128 GGYGGGGQGGYGGGGGQGGYGGGGQGGYGGGGQGGYGGGGYGGGYGGGGGQGGYGGGGGQ 187

Query: 227 GGYGGGGRGGGRGGGGGG 174
           GGYGG    G R  G  G
Sbjct: 188 GGYGGDQDPGQRSSGAKG 205

[135][TOP]
>UniRef100_B9HFC9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HFC9_POPTR
          Length = 241

 Score =  108 bits (270), Expect = 2e-22
 Identities = 59/105 (56%), Positives = 61/105 (58%), Gaps = 9/105 (8%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGG--------YGGGGSYGGGGYGGGGG 270
           GR    N  G  GA+  G   GGGGGGG   GGGG        +GGGG  GGGG GGGGG
Sbjct: 124 GRGSGGNGGGRGGASSGGGGGGGGGGGGGGGGGGGNGKGFGFGHGGGGGGGGGGGGGGGG 183

Query: 269 YGGGRGGGGYGGSGGGYGGG-GRGGGRGGGGGGGGSCYSCGESGH 138
            GGG  GGG GG GGG GGG G GGG GGGGG  G C   G  GH
Sbjct: 184 GGGGGSGGGGGGGGGGQGGGWGWGGGGGGGGGNQGDCLPWGCGGH 228

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 53/94 (56%), Positives = 57/94 (60%), Gaps = 1/94 (1%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYG-GGGGYGGGRGGGGYGGSGG 225
           +G +G    G   GGGGGGG   GGGG GGGG+  G G+G GGGG GGG GGGG GG GG
Sbjct: 127 SGGNGGGRGGASSGGGGGGGGGGGGGGGGGGGNGKGFGFGHGGGGGGGGGGGGGGGGGGG 186

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESGHFARDC 123
           G  GGG GGG GG GGG G     G  G    DC
Sbjct: 187 GGSGGGGGGGGGGQGGGWGWGGGGGGGGGNQGDC 220

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 51/96 (53%), Positives = 57/96 (59%), Gaps = 7/96 (7%)
 Frame = -3

Query: 434 DNDGRSKAVNVT-----GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGG 270
           D+ G  K +        G   +  +G+   GGG GG   GGGG GGGG  GGGG GGG G
Sbjct: 101 DHSGHGKEIGKPHQRKGGKPSSGGRGSGGNGGGRGGASSGGGGGGGGGGGGGGGGGGGNG 160

Query: 269 --YGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGG 168
             +G G GGGG GG GGG GGGG GGG  GGGGGGG
Sbjct: 161 KGFGFGHGGGGGGGGGGGGGGGGGGGGGSGGGGGGG 196

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 49/83 (59%), Positives = 50/83 (60%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G R  GG GGG  RGG   GGGG  GGGG GGGGG GGG  G G+G   GG GGG
Sbjct: 118 GKPSSGGRGSGGNGGG--RGGASSGGGG--GGGGGGGGGGGGGGGNGKGFGFGHGGGGGG 173

Query: 209 GRGGGRGGGGGGGGSCYSCGESG 141
           G GGG GGGGGGGG     G  G
Sbjct: 174 GGGGGGGGGGGGGGGSGGGGGGG 196

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 47/80 (58%), Positives = 50/80 (62%), Gaps = 4/80 (5%)
 Frame = -3

Query: 368 RRGGG-GGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYG---GGGRG 201
           R+GG    GG   GG G G GG+  GGG GGGGG GGG GGGG  G G G+G   GGG G
Sbjct: 115 RKGGKPSSGGRGSGGNGGGRGGASSGGGGGGGGGGGGGGGGGGGNGKGFGFGHGGGGGGG 174

Query: 200 GGRGGGGGGGGSCYSCGESG 141
           GG GGGGGGGG   S G  G
Sbjct: 175 GGGGGGGGGGGGGGSGGGGG 194

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 45/107 (42%), Positives = 53/107 (49%), Gaps = 17/107 (15%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDG-----ANVQGTRRGGGGGGGYERGGGGYGGGGSYGG-------- 294
           ++D R    N T  D      +++    RGGG G G   GG G G GG + G        
Sbjct: 53  EDDIREGRTNSTYTDALVEHNSDLNNGGRGGGNGNGGGGGGSGVGKGGDHSGHGKEIGKP 112

Query: 293 ----GGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGS 165
               GG    GG G G  GGG GG+  G GGGG GGG GGGGGGGG+
Sbjct: 113 HQRKGGKPSSGGRGSGGNGGGRGGASSGGGGGGGGGGGGGGGGGGGN 159

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 51/116 (43%), Positives = 53/116 (45%), Gaps = 26/116 (22%)
 Frame = -3

Query: 410 VNVTGPDGANVQGTRRGGGGGGGYERGG----------------GGYGGGGSYGGGGYGG 279
           +N  G  G N  G   GGGGG G  +GG                GG    G  G GG GG
Sbjct: 76  LNNGGRGGGNGNG---GGGGGSGVGKGGDHSGHGKEIGKPHQRKGGKPSSGGRGSGGNGG 132

Query: 278 G-GGYGGGRGGGGYGGSGGGYGGG---------GRGGGRGGGGGGGGSCYSCGESG 141
           G GG   G GGGG GG GGG GGG         G GGG GGGGGGGG     G  G
Sbjct: 133 GRGGASSGGGGGGGGGGGGGGGGGGGNGKGFGFGHGGGGGGGGGGGGGGGGGGGGG 188

[136][TOP]
>UniRef100_Q38M49 Putative glycine-rich RNA binding protein-like n=1 Tax=Solanum
           tuberosum RepID=Q38M49_SOLTU
          Length = 176

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/104 (58%), Positives = 61/104 (58%), Gaps = 14/104 (13%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYER-----GGGGYGGGGSYGGG------- 291
           D DGR   VN     G    G   GG GGGGY R     GGGGYGGGG YGGG       
Sbjct: 67  DLDGRKITVNEAQSRGGG-GGGGGGGRGGGGYVRWRREGGGGGYGGGGGYGGGRREGGGG 125

Query: 290 -GY-GGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGS 165
            GY GGGGGYGGGR  GGYGG GGGYGGG R   R   GGGGGS
Sbjct: 126 GGYSGGGGGYGGGRREGGYGGGGGGYGGGDRYSDRSSRGGGGGS 169

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/56 (64%), Positives = 37/56 (66%), Gaps = 7/56 (12%)
 Frame = -3

Query: 284 GGGGGYGGGRGGGGY-----GGSGGGYGGGGR--GGGRGGGGGGGGSCYSCGESGH 138
           GGGGG GGGRGGGGY      G GGGYGGGG   GG R GGGGGG   YS G  G+
Sbjct: 83  GGGGGGGGGRGGGGYVRWRREGGGGGYGGGGGYGGGRREGGGGGG---YSGGGGGY 135

[137][TOP]
>UniRef100_B7PE30 Collagen-like repeats containing protein, putative (Fragment) n=1
           Tax=Ixodes scapularis RepID=B7PE30_IXOSC
          Length = 107

 Score =  108 bits (269), Expect = 2e-22
 Identities = 50/64 (78%), Positives = 50/64 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 44  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 182 GGGG 171
           GGGG
Sbjct: 104 GGGG 107

 Score =  108 bits (269), Expect = 2e-22
 Identities = 50/64 (78%), Positives = 50/64 (78%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG 180
           GGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGG
Sbjct: 44  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 179 GGGG 168
           GGGG
Sbjct: 104 GGGG 107

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 46/64 (71%), Positives = 46/64 (71%)
 Frame = -3

Query: 332 GGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSC 153
           GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     
Sbjct: 44  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 152 GESG 141
           G  G
Sbjct: 104 GGGG 107

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 44/64 (68%), Positives = 44/64 (68%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 44  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 209 GRGG 198
           G GG
Sbjct: 104 GGGG 107

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/64 (67%), Positives = 43/64 (67%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 44  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103

Query: 218 GGGG 207
           GGGG
Sbjct: 104 GGGG 107

[138][TOP]
>UniRef100_C9J285 Putative uncharacterized protein ENSP00000392404 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J285_HUMAN
          Length = 446

 Score =  108 bits (269), Expect = 2e-22
 Identities = 58/89 (65%), Positives = 58/89 (65%), Gaps = 3/89 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGG---GGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSG 228
           G  GA   G  RGGGG   GGG   GGGG GGGG  GGG  GGGG  GGGRGGGG GG G
Sbjct: 137 GGRGAGGGGGGRGGGGDGGGGGSSGGGGGDGGGGGRGGGDGGGGGRGGGGRGGGG-GGRG 195

Query: 227 GGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG GGGGRGGG  GGGGGGG     GE G
Sbjct: 196 GGGGGGGRGGGGDGGGGGGGGDGGGGEGG 224

 Score =  107 bits (266), Expect = 5e-22
 Identities = 60/102 (58%), Positives = 60/102 (58%), Gaps = 13/102 (12%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGG-----GGYERGGGGYGGGGSY--------GG 294
           D DG      V   DG    G R GGGGG     GG  RGGGG GGGG          GG
Sbjct: 115 DGDG-----GVGDGDGGGGGGGRGGGGGGRGAGGGGGGRGGGGDGGGGGSSGGGGGDGGG 169

Query: 293 GGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGG 168
           GG GGG G GGGRGGGG GG GGG GGGG GGGRGGGG GGG
Sbjct: 170 GGRGGGDGGGGGRGGGGRGGGGGGRGGGGGGGGRGGGGDGGG 211

 Score =  102 bits (255), Expect = 1e-20
 Identities = 52/80 (65%), Positives = 52/80 (65%), Gaps = 11/80 (13%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYG-----------GGRGGGGYGGSG 228
           G  RGGGGGGG   GGGG GGGGS GGG  GGGGG G           GG GGGG GG G
Sbjct: 3   GGGRGGGGGGGGRGGGGGGGGGGSSGGGDGGGGGGDGDGDGGVGDGGGGGGGGGGGGGGG 62

Query: 227 GGYGGGGRGGGRGGGGGGGG 168
           GG G GG GGG GGGGGGGG
Sbjct: 63  GGRGSGGDGGGGGGGGGGGG 82

 Score =  100 bits (250), Expect = 4e-20
 Identities = 54/87 (62%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG-G 222
           G  G +  G  RGGGG GG   G GG GGGG  GGGG GGGGG GGG GGGG GG GG G
Sbjct: 171 GRGGGDGGGGGRGGGGRGGGGGGRGGGGGGGGRGGGGDGGGGG-GGGDGGGGEGGGGGDG 229

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGGG G G GGGGGGGG     G+ G
Sbjct: 230 DGGGGGGDGDGGGGGGGGDGGGGGDGG 256

 Score =  100 bits (248), Expect = 7e-20
 Identities = 51/86 (59%), Positives = 52/86 (60%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G DG     +  GGG GGG  RGGG  GGGG  GGG  GGGGG GGG GGGG GG G G 
Sbjct: 151 GGDGGGGGSSGGGGGDGGGGGRGGGDGGGGGRGGGGRGGGGGGRGGGGGGGGRGGGGDGG 210

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG G G GG GGGGG     G  G
Sbjct: 211 GGGGGGDGGGGEGGGGGDGDGGGGGG 236

 Score =  100 bits (248), Expect = 7e-20
 Identities = 52/87 (59%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGG-GGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           G  G++  G   GGGGG GG + GGGG GGGG  GGGG  GGGG GGGRGGGG GG GGG
Sbjct: 155 GGGGSSGGGGGDGGGGGRGGGDGGGGGRGGGGRGGGGGGRGGGGGGGGRGGGGDGGGGGG 214

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESG 141
            G GG G G GGG G GG     G+ G
Sbjct: 215 GGDGGGGEGGGGGDGDGGGGGGDGDGG 241

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 53/87 (60%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G DG    G   GGGGGGG   GGGG GGGG  G GG GGGGG GGG GGGG GG G G 
Sbjct: 36  GGDGDGDGGVGDGGGGGGG---GGGGGGGGGGRGSGGDGGGGGGGGGGGGGGGGGGGRGS 92

Query: 218 G-GGGRGGGRGGGGGGGGSCYSCGESG 141
           G  GG GGG GGG GGGG     G+ G
Sbjct: 93  GRDGGGGGGSGGGDGGGGGGDGDGDGG 119

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 54/88 (61%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGG--GYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           G  G    G  RGGGGGGG   GGG  G GGGG  GGGG GGGGG G G GGGG  G GG
Sbjct: 183 GGGGRGGGGGGRGGGGGGGGRGGGGDGGGGGGGGDGGGGEGGGGGDGDGGGGGG-DGDGG 241

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGGG GGG G GGGG G   S G  G
Sbjct: 242 GGGGGGDGGGGGDGGGGDGDEGSSGGGG 269

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 53/86 (61%), Positives = 53/86 (61%), Gaps = 9/86 (10%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGG-GGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           G  G    G   GGGGGGG   GG GG GGGG  GGGG GGGGG G GR GGG GGSGGG
Sbjct: 46  GDGGGGGGGGGGGGGGGGGRGSGGDGGGGGGGGGGGGGGGGGGGRGSGRDGGGGGGSGGG 105

Query: 221 YGGGGRGGGRG--------GGGGGGG 168
            GGGG G G G        GGGGGGG
Sbjct: 106 DGGGGGGDGDGDGGVGDGDGGGGGGG 131

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 52/91 (57%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGG-----GGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG 234
           G  G +  G   GGGGG     GG   GGGG GGGG  GGGG G G G  GG GGGG GG
Sbjct: 21  GGGGGSSGGGDGGGGGGDGDGDGGVGDGGGGGGGGGGGGGGGGGRGSGGDGGGGGGGGGG 80

Query: 233 SGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGG GGGGRG GR GGGGGG      G  G
Sbjct: 81  GGGGGGGGGRGSGRDGGGGGGSGGGDGGGGG 111

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 58/106 (54%), Positives = 58/106 (54%), Gaps = 20/106 (18%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSY-------------GGGGYGGGGGYGGG 258
           G  G    G R GGGGGGG    GGG GGGG               GGGG GGGGG GGG
Sbjct: 5   GRGGGGGGGGRGGGGGGGGGGSSGGGDGGGGGGDGDGDGGVGDGGGGGGGGGGGGGGGGG 64

Query: 257 RG----GGGYGGSGGGYGGGGRGGGRGG---GGGGGGSCYSCGESG 141
           RG    GGG GG GGG GGGG GGGRG    GGGGGGS    G  G
Sbjct: 65  RGSGGDGGGGGGGGGGGGGGGGGGGRGSGRDGGGGGGSGGGDGGGG 110

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 53/97 (54%), Positives = 53/97 (54%), Gaps = 11/97 (11%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGG-----------GRG 252
           G  G    G   GGGGGGG  RG G  GGGG   GGG GGGGG  G           G G
Sbjct: 69  GDGGGGGGGGGGGGGGGGGGGRGSGRDGGGGGGSGGGDGGGGGGDGDGDGGVGDGDGGGG 128

Query: 251 GGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGG GG GGG G GG GGGRGGGG GGG   S G  G
Sbjct: 129 GGGRGGGGGGRGAGGGGGGRGGGGDGGGGGSSGGGGG 165

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 53/98 (54%), Positives = 56/98 (57%), Gaps = 11/98 (11%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGG--------GGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           +G DG    G+  G GGGGG +  G        GG GGGG  GGGG  G GG GGGRGGG
Sbjct: 92  SGRDGGGGGGSGGGDGGGGGGDGDGDGGVGDGDGGGGGGGRGGGGGGRGAGGGGGGRGGG 151

Query: 245 GYGGSGGGYGGGGR---GGGRGGGGGGGGSCYSCGESG 141
           G GG GG  GGGG    GGGRGGG GGGG     G  G
Sbjct: 152 GDGGGGGSSGGGGGDGGGGGRGGGDGGGGGRGGGGRGG 189

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 51/87 (58%), Positives = 52/87 (59%), Gaps = 1/87 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYG-GGRGGGGYGGSGGG 222
           G  G    G R GGGGG G   GGGG GGGG  GGGG GG GG G GG GG G GG GGG
Sbjct: 177 GGGGGRGGGGRGGGGGGRGGGGGGGGRGGGGDGGGGGGGGDGGGGEGGGGGDGDGGGGGG 236

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESG 141
            G GG GGG G GGGGG      G+ G
Sbjct: 237 DGDGGGGGGGGDGGGGGDGGGGDGDEG 263

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 58/118 (49%), Positives = 59/118 (50%), Gaps = 32/118 (27%)
 Frame = -3

Query: 398 GPDGANVQGTRRG---GGGGGGYERGGGGYGGG---------------GSYGGGGYGGGG 273
           G DG   +G   G   GGGGGG   GGGG GGG               GS GGGG  GGG
Sbjct: 215 GGDGGGGEGGGGGDGDGGGGGGDGDGGGGGGGGDGGGGGDGGGGDGDEGSSGGGGDNGGG 274

Query: 272 GYGGGRGGGGY--------------GGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GG  GGGGY               G GGG GGGGRGGG GGGGGGGG   S G  G
Sbjct: 275 GIGGRVGGGGYSSGSSGSSDGGGDSSGGGGGGGGGGRGGGGGGGGGGGGGHSSGGGGG 332

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/104 (51%), Positives = 56/104 (53%), Gaps = 16/104 (15%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGG----------GGGYERGGGGYGGGGSYGGGGYGG 279
           DG   +    G +G    G R GGGG          GGG   GGGG GGGG  GGGG GG
Sbjct: 259 DGDEGSSGGGGDNGGGGIGGRVGGGGYSSGSSGSSDGGGDSSGGGGGGGGGGRGGGGGGG 318

Query: 278 GGGYGGGRGGGGYGG------SGGGYGGGGRGGGRGGGGGGGGS 165
           GGG GG   GGG GG      S GG GGG  GGG  GGGGGGGS
Sbjct: 319 GGGGGGHSSGGGGGGSDGGGHSSGGGGGGSDGGGHSGGGGGGGS 362

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 51/92 (55%), Positives = 53/92 (57%), Gaps = 6/92 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGG--GGYGGGRGGG----GYG 237
           G  G   +G+ R GGGGGG   G GG GGG   G GG G G  GG GGGRGGG    G G
Sbjct: 83  GGGGGGGRGSGRDGGGGGGSGGGDGGGGGGDGDGDGGVGDGDGGGGGGGRGGGGGGRGAG 142

Query: 236 GSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGG GGGG GGG G  GGGGG     G  G
Sbjct: 143 GGGGGRGGGGDGGGGGSSGGGGGDGGGGGRGG 174

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 53/99 (53%), Positives = 53/99 (53%), Gaps = 4/99 (4%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           GR       G  G    G   GGG GGG E GGGG G GG  GG G GGGGG GG  GGG
Sbjct: 193 GRGGGGGGGGRGGGGDGGGGGGGGDGGGGEGGGGGDGDGGGGGGDGDGGGGGGGGDGGGG 252

Query: 245 GYGGSG----GGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GG G    G  GGGG  GG G GG  GG  YS G SG
Sbjct: 253 GDGGGGDGDEGSSGGGGDNGGGGIGGRVGGGGYSSGSSG 291

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 50/86 (58%), Positives = 51/86 (59%), Gaps = 20/86 (23%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGG-------GRGGGGYGGSGGGYG---- 216
           GGGGGGG  RG GG GGGG  GGGG GGGGG GG       G GGG  GG GGG G    
Sbjct: 56  GGGGGGGGGRGSGGDGGGGGGGGGGGGGGGGGGGRGSGRDGGGGGGSGGGDGGGGGGDGD 115

Query: 215 ---------GGGRGGGRGGGGGGGGS 165
                    GGG GGGRGGGGGG G+
Sbjct: 116 GDGGVGDGDGGGGGGGRGGGGGGRGA 141

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/75 (66%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -3

Query: 356 GGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYG---GSGGGYGGGGRGGGRGG 186
           GGGGG  RGGGG GGGG  GGGG GGGG  GGG GGGG G   G GG   GGG GGG GG
Sbjct: 1   GGGGG--RGGGG-GGGGRGGGGGGGGGGSSGGGDGGGGGGDGDGDGGVGDGGGGGGGGGG 57

Query: 185 GGGGGGSCYSCGESG 141
           GGGGGG   S G+ G
Sbjct: 58  GGGGGGGRGSGGDGG 72

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 56/110 (50%), Positives = 59/110 (53%), Gaps = 12/110 (10%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGY---------GGGGSYGGGGYG 282
           D  G        G +G++  G   GGGG GG   GGGGY         GGG S GGGG G
Sbjct: 248 DGGGGGDGGGGDGDEGSSGGGGDNGGGGIGG-RVGGGGYSSGSSGSSDGGGDSSGGGGGG 306

Query: 281 GGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG---GGGGGSCYSCGESG 141
           GGGG GGG GGGG GG GG   GGG GG  GGG   GGGGG     G SG
Sbjct: 307 GGGGRGGGGGGGG-GGGGGHSSGGGGGGSDGGGHSSGGGGGGSDGGGHSG 355

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 47/75 (62%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG-GYGGSGGGYGGGGRGGGRGG 186
           GGGGGGG  RGGGG GGGG  GGGG+  GGG GG  GGG   GG GGG  GGG  GG GG
Sbjct: 302 GGGGGGGGGRGGGGGGGGG--GGGGHSSGGGGGGSDGGGHSSGGGGGGSDGGGHSGGGGG 359

Query: 185 GGGGGGSCYSCGESG 141
           GG  GG   S G  G
Sbjct: 360 GGSDGGGHSSGGGGG 374

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 45/65 (69%), Positives = 45/65 (69%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGG G   GGGG GGGG  GGGG  GGG  GGG GG G G  G G GGGG GGG GGG
Sbjct: 1   GGGGGRGGGGGGGGRGGGGGGGGGGSSGGGD-GGGGGGDGDGDGGVGDGGGGGGGGGGGG 59

Query: 182 GGGGG 168
           GGGGG
Sbjct: 60  GGGGG 64

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 52/95 (54%), Positives = 52/95 (54%), Gaps = 18/95 (18%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGY------GGGGGYGGGRGGGGYG 237
           G  G    G   GG GGGG   GGGG GGGG  GGGG       GGGGG GGG GGGG G
Sbjct: 56  GGGGGGGGGRGSGGDGGGG---GGGGGGGGGGGGGGGRGSGRDGGGGGGSGGGDGGGGGG 112

Query: 236 ------------GSGGGYGGGGRGGGRGGGGGGGG 168
                       G GGG G GG GGGRG GGGGGG
Sbjct: 113 DGDGDGGVGDGDGGGGGGGRGGGGGGRGAGGGGGG 147

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/110 (47%), Positives = 54/110 (49%), Gaps = 11/110 (10%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYG----------GGGSYGGGG 288
           SD  G S      G  G    G   GGGGGGG+  GGGG G          GGG   GGG
Sbjct: 293 SDGGGDSSGGGGGGGGGGRGGGGGGGGGGGGGHSSGGGGGGSDGGGHSSGGGGGGSDGGG 352

Query: 287 YGGGGGYGGGRGGG-GYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           + GGGG GG  GGG   GG GGG  GGG   G GGGG  GG   S G  G
Sbjct: 353 HSGGGGGGGSDGGGHSSGGGGGGRDGGGHSSGGGGGGRDGGGHSSGGGGG 402

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 54/101 (53%), Positives = 57/101 (56%), Gaps = 11/101 (10%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGG---GYGGGGSYGGG---GYGGG 276
           S + G S     +   G    G  RGGGGGGG   GGG   G GGGGS GGG   G GGG
Sbjct: 287 SGSSGSSDGGGDSSGGGGGGGGGGRGGGGGGGGGGGGGHSSGGGGGGSDGGGHSSGGGGG 346

Query: 275 GGYGGGR--GGGGYGGSGGGYGGGGRGGGRGGGG---GGGG 168
           G  GGG   GGGG G  GGG+  GG GGGR GGG   GGGG
Sbjct: 347 GSDGGGHSGGGGGGGSDGGGHSSGGGGGGRDGGGHSSGGGG 387

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 52/102 (50%), Positives = 55/102 (53%), Gaps = 3/102 (2%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGG-GGYGGGGSYGGGGYGGGGGYGG 261
           SD  G S      G DG    G   GGGGGGG + GG    GGGG   GGG+  GGG GG
Sbjct: 334 SDGGGHSSGGGGGGSDG----GGHSGGGGGGGSDGGGHSSGGGGGGRDGGGHSSGGG-GG 388

Query: 260 GRGGGGY--GGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GR GGG+  GG GGG  GGG   G GGGG  GG   S G  G
Sbjct: 389 GRDGGGHSSGGGGGGSDGGGHSSGGGGGGRDGGGHSSGGGGG 430

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 48/91 (52%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR--G 252
           G S   + +   G +  G   GGGGGG    GGGG GGGG +  GG GGGG  GGG   G
Sbjct: 284 GYSSGSSGSSDGGGDSSGGGGGGGGGGRGGGGGGGGGGGGGHSSGG-GGGGSDGGGHSSG 342

Query: 251 GGGYGGSGGGYGGGGRGGGRGGGG---GGGG 168
           GGG G  GGG+ GGG GGG  GGG   GGGG
Sbjct: 343 GGGGGSDGGGHSGGGGGGGSDGGGHSSGGGG 373

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 47/89 (52%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGG-GGYGGGGSYGGGGYGGGGGYGGGRGGGGY--GGSG 228
           G  G +  G    GGGGGG + GG  G GGGG   GGG+  GGG GGGR GGG+  GG G
Sbjct: 329 GGGGGSDGGGHSSGGGGGGSDGGGHSGGGGGGGSDGGGHSSGGG-GGGRDGGGHSSGGGG 387

Query: 227 GGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG  GGG   G GGGG  GG   S G  G
Sbjct: 388 GGRDGGGHSSGGGGGGSDGGGHSSGGGGG 416

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/100 (53%), Positives = 55/100 (55%), Gaps = 10/100 (10%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGG--GGYGGGGSYGGG---GYGGGG 273
           SD  G S      G DG    G    GGGGGG + GG   G GGGG  GGG   G GGGG
Sbjct: 348 SDGGGHSGGGGGGGSDG----GGHSSGGGGGGRDGGGHSSGGGGGGRDGGGHSSGGGGGG 403

Query: 272 GYGGGR--GGGGYGGSGGGYGGGGRGGGRGGGG---GGGG 168
             GGG   GGGG G  GGG+  GG GGGR GGG   GGGG
Sbjct: 404 SDGGGHSSGGGGGGRDGGGHSSGGGGGGRDGGGHSSGGGG 443

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 50/92 (54%), Positives = 52/92 (56%), Gaps = 2/92 (2%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGG--GGYGGGGSYGGGGYGGGGGYG 264
           SD  G S      G DG    G    GGGGGG + GG   G GGGGS GGG   GGGG  
Sbjct: 362 SDGGGHSSGGGGGGRDG----GGHSSGGGGGGRDGGGHSSGGGGGGSDGGGHSSGGGG-- 415

Query: 263 GGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGG 168
           GGR GGG+  S GG GGG  GGG   GGGGGG
Sbjct: 416 GGRDGGGH--SSGGGGGGRDGGGHSSGGGGGG 445

[139][TOP]
>UniRef100_P49311 Glycine-rich RNA-binding protein GRP2A n=1 Tax=Sinapis alba
           RepID=GRP2_SINAL
          Length = 169

 Score =  108 bits (269), Expect = 2e-22
 Identities = 59/96 (61%), Positives = 60/96 (62%), Gaps = 8/96 (8%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGG----GGYERGGGGYGGGGSYGGGGYGGGGGY 267
           D DGRS  VN     G+   G  RGGGGG    GGY  GGGGYGGG   GGG  GGGGGY
Sbjct: 73  DLDGRSITVNEAQSRGSGAGGGGRGGGGGYRGGGGYGGGGGGYGGGRREGGGYSGGGGGY 132

Query: 266 GG-GRGGGGYGGSG---GGYGGGGRGGGRGGGGGGG 171
              G GGGGYGG G   GG  GGG GGG GGGGGGG
Sbjct: 133 SSRGGGGGGYGGGGRRDGGGYGGGEGGGYGGGGGGG 168

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 47/76 (61%), Positives = 48/76 (63%), Gaps = 11/76 (14%)
 Frame = -3

Query: 329 GGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG---SGGGYGGGG-----RGGGRGGGGGG 174
           G G GGGG  GGGGY GGGGYGG  GGGGYGG    GGGY GGG     RGGG GG GGG
Sbjct: 88  GSGAGGGGRGGGGGYRGGGGYGG--GGGGYGGGRREGGGYSGGGGGYSSRGGGGGGYGGG 145

Query: 173 G---GSCYSCGESGHF 135
           G   G  Y  GE G +
Sbjct: 146 GRRDGGGYGGGEGGGY 161

[140][TOP]
>UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q3HTL0_VOLCA
          Length = 590

 Score =  107 bits (268), Expect = 3e-22
 Identities = 46/63 (73%), Positives = 46/63 (73%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP P P P PP PPP PP PPPP PPP PPPPP PPPP  PPPP  PPP S P 
Sbjct: 206 PPPPPPPPSPSPPPSPP-PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPL 264

Query: 349 PPP 357
           PPP
Sbjct: 265 PPP 267

 Score =  104 bits (259), Expect = 3e-21
 Identities = 48/74 (64%), Positives = 49/74 (66%)
 Frame = +1

Query: 178 PPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPP 357
           PPPPP PPP P PP  PP PP PPPP PPP PP PP PPPP  PPPP PPPP S PPP P
Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPP--PPPPSPPPPPSPPPPSP 262

Query: 358 PPRLVP*TLAPSGP 399
           P   +P    PS P
Sbjct: 263 P---LPPPSIPSPP 273

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 46/70 (65%), Positives = 46/70 (65%), Gaps = 8/70 (11%)
 Frame = +1

Query: 169 PPPPPPP-------PRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PP 327
           PPPPPPP       P PPP PPPP PPP PP PPPP P   PPPPP PPPP  PPPP PP
Sbjct: 207 PPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPP---PPPPPSPPPPPSPPPPSPP 263

Query: 328 -PPRS*PPPP 354
            PP S P PP
Sbjct: 264 LPPPSIPSPP 273

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 44/66 (66%), Positives = 44/66 (66%), Gaps = 2/66 (3%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPP--P*LPPP 315
           P  P     PP PPPPP PPP PPPP PPP PP PPPP PPP PPPPP PPP  P LPPP
Sbjct: 209 PPPPPSPSPPPSPPPPPSPPPPPPPP-PPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPP 267

Query: 316 P*PPPP 333
             P PP
Sbjct: 268 SIPSPP 273

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 45/74 (60%), Positives = 45/74 (60%), Gaps = 2/74 (2%)
 Frame = +1

Query: 184 PPPRPPPRPPPP*PPPLPPYPPP-PRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPP- 357
           P  R    PPPP PPP  P PPP P PPP PPPPP PPPP  PPPP PPPP   PPPPP 
Sbjct: 197 PTSRASKYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPS 256

Query: 358 PPRLVP*TLAPSGP 399
           PP   P    PS P
Sbjct: 257 PPPPSPPLPPPSIP 270

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 38/68 (55%), Positives = 41/68 (60%)
 Frame = +1

Query: 223 PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPV 402
           PPP PP PP P PPP PPPPP PPPP  PPPP  PPP   PPPPP P   P    PS P+
Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPL 264

Query: 403 TLTALDRP 426
              ++  P
Sbjct: 265 PPPSIPSP 272

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 27/40 (67%), Positives = 28/40 (70%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPY 288
           PPP PPPP PPP PP P PPP PP P PP PPP  P PP+
Sbjct: 235 PPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIPSPPF 274

[141][TOP]
>UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1
            Tax=Ostreococcus tauri RepID=Q010M7_OSTTA
          Length = 1449

 Score =  107 bits (268), Expect = 3e-22
 Identities = 52/96 (54%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = +1

Query: 115  LVGQSLAK*PDSPQL*QLPPPPPPP-PRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYP 291
            ++GQ+    P SP     P PPPPP P PPP PP P PPP PP PP P PPP PPPPP  
Sbjct: 779  VLGQARQSPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSS 838

Query: 292  PPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPP  P PP  PPP   PPPPP P   P    P  P
Sbjct: 839  PPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSP 874

 Score =  104 bits (260), Expect = 3e-21
 Identities = 56/103 (54%), Positives = 56/103 (54%), Gaps = 17/103 (16%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRP---------PPP*PPPLPPYPPPPRP--PP*PPPPPY 288
            P SP     PPPPPPPP PPP P         PPP PPP P  PPPP P  PP PPP P 
Sbjct: 796  PPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPS 855

Query: 289  PPPP*LPPP-P*PPPPRS*PP-----PPPPPRLVP*TLAPSGP 399
            PPPP  PPP P PPPP S PP     PPPPP   P    P  P
Sbjct: 856  PPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSP 898

 Score =  103 bits (257), Expect = 6e-21
 Identities = 46/78 (58%), Positives = 46/78 (58%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
            P SP     PPPPP  P PP   PPP PPP P  PPPP PPP P PPP P PP  PPP  
Sbjct: 823  PPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSP 882

Query: 322  PPPPRS*PPPPPPPRLVP 375
            PPPP   PPP PPP   P
Sbjct: 883  PPPPSPPPPPSPPPSPSP 900

 Score =  102 bits (255), Expect = 1e-20
 Identities = 57/114 (50%), Positives = 60/114 (52%), Gaps = 18/114 (15%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRP---------PPP*PPPLPPYPPPPRPPP*PPPPPYP- 291
            P  P     PP PPPPP PPP P         PPP PPP P  PPPP PPP P PPP P 
Sbjct: 814  PPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPS 873

Query: 292  ----PPP*LPPPP*PPPPRS*PP-PPPPPRLVP*TLAP---SGPVTLTALDRPS 429
                PPP  PPPP PPPP S PP P PPP   P   +P   S P  L++   PS
Sbjct: 874  PPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPS 927

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 60/115 (52%), Positives = 61/115 (53%), Gaps = 17/115 (14%)
 Frame = +1

Query: 142  PDSPQL*QLPPP---PPPPPRPPPRPPPP*PPPLPPYPPP-PRPPP*PPPPPYPPPP*LP 309
            P SP     PPP   PPPPP PPP P PP PP  PP PPP P PPP PPPPP PPP   P
Sbjct: 841  PPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSP 900

Query: 310  PP--------P*P---PPPRS*PPPP--PPPRLVP*TLAPSGPVTLTALDRPSLS 435
            PP        P P   PPP S PPPP  PPP   P  L PS P+       PS S
Sbjct: 901  PPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSPP--LPPSPPLPPNPPPPPSPS 953

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/119 (44%), Positives = 55/119 (46%), Gaps = 33/119 (27%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPP-PRPPP*---------------- 270
            P+ P     PPPP PPP PPP PPPP  PP PP PPP P PPP                 
Sbjct: 860  PNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPP 919

Query: 271  ---PPPPPYPPPP*--LPP----PP*PPPPRS*PPPPP-------PPRLVP*TLAPSGP 399
               PPPP  PPPP   LPP    PP PPPP   P P P       PPRL   +  P  P
Sbjct: 920  LSSPPPPSSPPPPSPPLPPSPPLPPNPPPP---PSPSPXXXXXXXPPRLPTPSPPPPSP 975

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 48/109 (44%), Positives = 48/109 (44%), Gaps = 35/109 (32%)
 Frame = +1

Query: 142  PDSPQL*QLPPPPPPPPRPPPRPPPP*--------------PPPL----PPYPPPPRPPP 267
            P  P     PP PPPPP PPP P PP               PPPL    PP  PPP  PP
Sbjct: 876  PSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSPP 935

Query: 268  *PPPPPYPPPP*LPPPP*P-----------------PPPRS*PPPPPPP 363
             PP PP PP P  PPPP P                 PPP S P PPPPP
Sbjct: 936  LPPSPPLPPNP--PPPPSPSPXXXXXXXPPRLPTPSPPPPSPPLPPPPP 982

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 33/63 (52%), Positives = 35/63 (55%)
 Frame = +1

Query: 247 PPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRP 426
           PPP PPP  P PP PPPP  P PP PPPP S PPPP PP        PS P   ++   P
Sbjct: 787 PPPSPPP--PLPPSPPPP--PSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPP 842

Query: 427 SLS 435
           S S
Sbjct: 843 SPS 845

[142][TOP]
>UniRef100_A3PA60 RNA-binding region RNP-1 (RNA recognition motif) n=1
           Tax=Prochlorococcus marinus str. MIT 9301
           RepID=A3PA60_PROM0
          Length = 217

 Score =  107 bits (268), Expect = 3e-22
 Identities = 62/103 (60%), Positives = 66/103 (64%), Gaps = 13/103 (12%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGG------GYERGGGGYGGG---GSYGGGGYGGG- 276
           GR   +N   P G+   G+RRGG GGG      G   GGGGYGGG   G YGGGGYGGG 
Sbjct: 69  GRPLRINKAEPRGSG--GSRRGGRGGGYGGGNSGGGYGGGGYGGGNSGGGYGGGGYGGGN 126

Query: 275 --GGYGGGR-GGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYS 156
             GGYGGG  GGGGYG  GGGYGGGG GGG  GGG GGG+  S
Sbjct: 127 SGGGYGGGGYGGGGYG--GGGYGGGGYGGGNSGGGYGGGNSES 167

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 43/89 (48%), Positives = 46/89 (51%), Gaps = 1/89 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGG-GGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           G  G    G   GGG  GGGY  GGGGYGGGG YGGGGY GGGGYGGG  GGGYGG    
Sbjct: 111 GNSGGGYGGGGYGGGNSGGGY--GGGGYGGGG-YGGGGY-GGGGYGGGNSGGGYGGGNSE 166

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESGHF 135
                     G  G    S  +  E+  +
Sbjct: 167 SNSSNINKSSGAEGWEDRSYGNSSENSEY 195

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 37/61 (60%), Positives = 38/61 (62%), Gaps = 1/61 (1%)
 Frame = -3

Query: 317 GGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGG-GGGGGGSCYSCGESG 141
           G GGS  GG    GGGYGGG  GGGYGG  GGYGGG  GGG GG G GGG S    G  G
Sbjct: 81  GSGGSRRGGR---GGGYGGGNSGGGYGG--GGYGGGNSGGGYGGGGYGGGNSGGGYGGGG 135

Query: 140 H 138
           +
Sbjct: 136 Y 136

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 43/89 (48%), Positives = 43/89 (48%), Gaps = 4/89 (4%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGG-GGGGYERGGGGYGGGGSYGGGGYGG---GGGYGGGRGGGGYGGS 231
           G  G    G   GGG GGGGY  GGGGYGGGG YGGGGYGG   GGGYGGG         
Sbjct: 116 GYGGGGYGGGNSGGGYGGGGY--GGGGYGGGG-YGGGGYGGGNSGGGYGGGNSESNSSNI 172

Query: 230 GGGYGGGGRGGGRGGGGGGGGSCYSCGES 144
               G  G    R  G     S Y  G S
Sbjct: 173 NKSSGAEG-WEDRSYGNSSENSEYESGRS 200

[143][TOP]
>UniRef100_Q41810 Glycine-rich protein n=1 Tax=Zea mays RepID=Q41810_MAIZE
          Length = 155

 Score =  107 bits (268), Expect = 3e-22
 Identities = 56/85 (65%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSY-GGGGYGGGGGYGGGRG 252
           DGR+  VN      A  +G R GGGGG G  RGGGGYGGGG   GGGGYGGGGGYGGG  
Sbjct: 75  DGRNITVNE-----AQSRGGRGGGGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYGGG-- 127

Query: 251 GGGYGGSGGGYGGGGRGGGRGGGGG 177
            GGYGG GGGYGGG RGGG G   G
Sbjct: 128 -GGYGGGGGGYGGGNRGGGYGNSDG 151

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 39/57 (68%), Positives = 39/57 (68%), Gaps = 5/57 (8%)
 Frame = -3

Query: 296 GGGYGGGGGYGGGRGGGGYGGSG-----GGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG  GGGGGYGGGRGGGGYGG G     GGYGGGG  GG GGG GGGG  Y  G  G
Sbjct: 88  GGRGGGGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYGG-GGGYGGGGGGYGGGNRG 143

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 35/52 (67%), Positives = 36/52 (69%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G RR GGGG G   GGGGYGGGG YG    GGGGGYGGG  GGGYG S G +
Sbjct: 109 GGRRDGGGGYG---GGGGYGGGGGYG----GGGGGYGGGNRGGGYGNSDGNW 153

[144][TOP]
>UniRef100_C0PNT1 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0PNT1_MAIZE
          Length = 94

 Score =  107 bits (268), Expect = 3e-22
 Identities = 56/85 (65%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSY-GGGGYGGGGGYGGGRG 252
           DGR+  VN      A  +G R GGGGG G  RGGGGYGGGG   GGGGYGGGGGYGGG  
Sbjct: 14  DGRNITVNE-----AQSRGGRGGGGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYGGG-- 66

Query: 251 GGGYGGSGGGYGGGGRGGGRGGGGG 177
            GGYGG GGGYGGG RGGG G   G
Sbjct: 67  -GGYGGGGGGYGGGNRGGGYGNSDG 90

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 50/86 (58%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = -3

Query: 392 DGANV---QGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           DG N+   +   RGG GGGG     GGYGGG   GGGGYGGGG   GG   GGYGG GGG
Sbjct: 14  DGRNITVNEAQSRGGRGGGG-----GGYGGGR--GGGGYGGGGRRDGG---GGYGG-GGG 62

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGES 144
           YGGGG  GG GGG GGG      G S
Sbjct: 63  YGGGGGYGGGGGGYGGGNRGGGYGNS 88

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 39/57 (68%), Positives = 39/57 (68%), Gaps = 5/57 (8%)
 Frame = -3

Query: 296 GGGYGGGGGYGGGRGGGGYGGSG-----GGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG  GGGGGYGGGRGGGGYGG G     GGYGGGG  GG GGG GGGG  Y  G  G
Sbjct: 27  GGRGGGGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYGG-GGGYGGGGGGYGGGNRG 82

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 35/52 (67%), Positives = 36/52 (69%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G RR GGGG G   GGGGYGGGG YG    GGGGGYGGG  GGGYG S G +
Sbjct: 48  GGRRDGGGGYG---GGGGYGGGGGYG----GGGGGYGGGNRGGGYGNSDGNW 92

[145][TOP]
>UniRef100_B6STA5 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays
           RepID=B6STA5_MAIZE
          Length = 155

 Score =  107 bits (268), Expect = 3e-22
 Identities = 56/85 (65%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSY-GGGGYGGGGGYGGGRG 252
           DGR+  VN      A  +G R GGGGG G  RGGGGYGGGG   GGGGYGGGGGYGGG  
Sbjct: 75  DGRNITVNE-----AQSRGGRGGGGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYGGG-- 127

Query: 251 GGGYGGSGGGYGGGGRGGGRGGGGG 177
            GGYGG GGGYGGG RGGG G   G
Sbjct: 128 -GGYGGGGGGYGGGNRGGGYGNSDG 151

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 50/86 (58%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = -3

Query: 392 DGANV---QGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           DG N+   +   RGG GGGG     GGYGGG   GGGGYGGGG   GG   GGYGG GGG
Sbjct: 75  DGRNITVNEAQSRGGRGGGG-----GGYGGGR--GGGGYGGGGRRDGG---GGYGG-GGG 123

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGES 144
           YGGGG  GG GGG GGG      G S
Sbjct: 124 YGGGGGYGGGGGGYGGGNRGGGYGNS 149

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 39/57 (68%), Positives = 39/57 (68%), Gaps = 5/57 (8%)
 Frame = -3

Query: 296 GGGYGGGGGYGGGRGGGGYGGSG-----GGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG  GGGGGYGGGRGGGGYGG G     GGYGGGG  GG GGG GGGG  Y  G  G
Sbjct: 88  GGRGGGGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYGG-GGGYGGGGGGYGGGNRG 143

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 35/52 (67%), Positives = 36/52 (69%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G RR GGGG G   GGGGYGGGG YG    GGGGGYGGG  GGGYG S G +
Sbjct: 109 GGRRDGGGGYG---GGGGYGGGGGYG----GGGGGYGGGNRGGGYGNSDGNW 153

[146][TOP]
>UniRef100_B7Q312 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q312_IXOSC
          Length = 161

 Score =  107 bits (268), Expect = 3e-22
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 1   GGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 57

Query: 182 GGGGG 168
           GGGGG
Sbjct: 58  GGGGG 62

 Score =  107 bits (268), Expect = 3e-22
 Identities = 51/65 (78%), Positives = 51/65 (78%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 2   GGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 58

Query: 182 GGGGG 168
           GGGGG
Sbjct: 59  GGGGG 63

 Score =  105 bits (263), Expect = 1e-21
 Identities = 49/63 (77%), Positives = 49/63 (77%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG 180
           GGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 179 GGG 171
           GGG
Sbjct: 61  GGG 63

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 45/63 (71%), Positives = 45/63 (71%)
 Frame = -3

Query: 329 GGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCG 150
           GGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 149 ESG 141
             G
Sbjct: 61  GGG 63

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 47/67 (70%), Positives = 47/67 (70%)
 Frame = -3

Query: 332 GGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSC 153
           GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     
Sbjct: 1   GGGGGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 58

Query: 152 GESGHFA 132
           G  G  A
Sbjct: 59  GGGGGIA 65

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/63 (68%), Positives = 43/63 (68%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 209 GRG 201
           G G
Sbjct: 61  GGG 63

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 42/63 (66%), Positives = 42/63 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 218 GGG 210
           GGG
Sbjct: 61  GGG 63

[147][TOP]
>UniRef100_Q41645 Extensin (Fragment) n=1 Tax=Volvox carteri RepID=Q41645_VOLCA
          Length = 464

 Score =  107 bits (267), Expect = 4e-22
 Identities = 56/101 (55%), Positives = 59/101 (58%), Gaps = 16/101 (15%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPP-------PP*PPPLPPYPPPPRPPP*PPPP---PYPPPP*LPPPP* 321
           PPPPPPPRP P PP       PP P P PP PPPPRP P PPPP   P PPPP + PP  
Sbjct: 310 PPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPP-- 367

Query: 322 PPPPRS*PP------PPPPPRLVP*TLAPSGPVTLTALDRP 426
           PPPPR+ PP      PPPPPR  P +  PS P   TA   P
Sbjct: 368 PPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANP 408

 Score =  105 bits (263), Expect = 1e-21
 Identities = 53/92 (57%), Positives = 55/92 (59%), Gaps = 6/92 (6%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPP---PYPPPP*LPP 312
           P SP      PPPPPPPR  P PPPP P   PP PPPPRP P PPPP   P PPPP  PP
Sbjct: 279 PPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPP-SPP 337

Query: 313 PP*PPPPRS*PPPPPP---PRLVP*TLAPSGP 399
           PP PPPPR  P PPPP   P   P  ++P  P
Sbjct: 338 PPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPP 369

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 48/90 (53%), Positives = 50/90 (55%), Gaps = 6/90 (6%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPP------P*PPPLPPYPPPPRPPP*PPPPPYPPPP* 303
           P SP     PPP PPPPRP P PPP      P PP + P PPPPR  P PPP   PPPP 
Sbjct: 333 PPSP-----PPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPP 387

Query: 304 LPPPP*PPPPRS*PPPPPPPRLVP*TLAPS 393
            PPPP PPP    PPPP      P + APS
Sbjct: 388 RPPPPSPPPS---PPPPATAAANPPSPAPS 414

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 58/138 (42%), Positives = 64/138 (46%), Gaps = 30/138 (21%)
 Frame = +1

Query: 112 ALVGQSLAK*PDSPQL*QLPPPPP-----PPPR---PPPR------------PP-----P 216
           A+V Q+    P  P++   PPPP      PPP    PPPR            PP     P
Sbjct: 213 AVVVQTTPSPPPPPRVSTSPPPPARVSSSPPPATRSPPPRRITSPSPVLTASPPLPKTSP 272

Query: 217 P*PPPLPPYPPPPRPPP*PPPPPY-----PPPP*LPPPP*PPPPRS*PPPPPPPRLVP*T 381
           P PP +PP PPPP   P PPPPP      PPP  +  PP PPPPR   P PPPPR  P  
Sbjct: 273 PPPPRVPPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRP-SPSPPPPRSSPSP 331

Query: 382 LAPSGPVTLTALDRPSLS 435
             PS P       RPS S
Sbjct: 332 PPPSPPPPSPPPPRPSPS 349

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 46/87 (52%), Positives = 47/87 (54%), Gaps = 14/87 (16%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPP---PPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*L-- 306
           P  P     P PPPP   PP PPPR  PP PPP    PPPPRPPP P PPP PPPP    
Sbjct: 348 PSPPPPRSSPSPPPPVVSPPPPPPRASPP-PPPASSPPPPPRPPP-PSPPPSPPPPATAA 405

Query: 307 --PPPP*P-------PPPRS*PPPPPP 360
             PP P P       PP  + PPPPPP
Sbjct: 406 ANPPSPAPSRSRAGGPPLGTRPPPPPP 432

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 46/98 (46%), Positives = 48/98 (48%), Gaps = 23/98 (23%)
 Frame = +1

Query: 142 PDSPQL*QLPPPP-----PPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPP-------P 285
           P  P+    PPPP     PPPPR  P PPP   PP PP PPPP PPP PPPP       P
Sbjct: 350 PPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANPP 409

Query: 286 YPPP-------P*LPPPP*PPPPRS*PPPP----PPPR 366
            P P       P L   P PPPP    PPP    PPP+
Sbjct: 410 SPAPSRSRAGGPPLGTRPPPPPPEDDAPPPDYYFPPPQ 447

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/88 (45%), Positives = 41/88 (46%), Gaps = 10/88 (11%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPP------PP* 303
           P  P     PPPP   P PPPRPPPP PPP    PPPP      PP P P       PP 
Sbjct: 367 PPPPPRASPPPPPASSPPPPPRPPPPSPPP---SPPPPATAAANPPSPAPSRSRAGGPPL 423

Query: 304 LPPPP*PPPPRS*PPP----PPPPRLVP 375
              PP PPP    PPP    PPP  + P
Sbjct: 424 GTRPPPPPPEDDAPPPDYYFPPPQDMSP 451

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 38/79 (48%), Positives = 39/79 (49%), Gaps = 7/79 (8%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPL-PPYPPPPR-----PPP*PPPPPYPPPP* 303
           P  P     PPP PPPP PPP PPPP      PP P P R     PP    PPP PP   
Sbjct: 376 PPPPASSPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPLGTRPPPPPPEDD 435

Query: 304 LPPPP*P-PPPRS*PPPPP 357
            PPP    PPP+   PPPP
Sbjct: 436 APPPDYYFPPPQDMSPPPP 454

[148][TOP]
>UniRef100_UPI0000E4714A PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus
           purpuratus RepID=UPI0000E4714A
          Length = 202

 Score =  107 bits (267), Expect = 4e-22
 Identities = 53/79 (67%), Positives = 55/79 (69%)
 Frame = -3

Query: 404 VTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           + G  G  + G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GG
Sbjct: 82  IGGGGGGAIGGGGGGGGGGGGI--GGGGGGGGGGIGGGGGGGGGGIGGGIGGGGGGGIGG 139

Query: 224 GYGGGGRGGGRGGGGGGGG 168
           G  GGG GGG GGGGGGGG
Sbjct: 140 GGIGGGGGGGIGGGGGGGG 158

 Score =  103 bits (258), Expect = 5e-21
 Identities = 55/102 (53%), Positives = 58/102 (56%), Gaps = 4/102 (3%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGG----YGGGGGY 267
           D    +  +  TG     + G   GGGGGGG   GGGG GGGG  G GG     GGGGG 
Sbjct: 19  DTVNTASRMQTTGLRNGGIGGGGGGGGGGGGGGGGGGGGGGGGVCGSGGEKNGIGGGGGG 78

Query: 266 GGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGG GGGG G  GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 79  GGGIGGGGGGAIGGGGGGGGGGGGIGGGGGGGGGGIGGGGGG 120

 Score =  100 bits (250), Expect = 4e-20
 Identities = 52/84 (61%), Positives = 52/84 (61%), Gaps = 7/84 (8%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGG-------Y 240
           G  G    G   GGGGGG    GGGG GGGG  GGGG GGGGG GGG GGGG        
Sbjct: 71  GIGGGGGGGGGIGGGGGGAIGGGGGGGGGGGGIGGGGGGGGGGIGGGGGGGGGGIGGGIG 130

Query: 239 GGSGGGYGGGGRGGGRGGGGGGGG 168
           GG GGG GGGG GGG GGG GGGG
Sbjct: 131 GGGGGGIGGGGIGGGGGGGIGGGG 154

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 56/109 (51%), Positives = 57/109 (52%), Gaps = 14/109 (12%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR-GG 249
           G   A+   G  G    G   GGGGGGG   GGGG GGGG  GG G GGGGG GGG  GG
Sbjct: 85  GGGGAIGGGGGGGGGGGGIGGGGGGGGGGIGGGGGGGGGGIGGGIGGGGGGGIGGGGIGG 144

Query: 248 GGYGGSGGGYGGGGR-------------GGGRGGGGGGGGSCYSCGESG 141
           GG GG GGG GGGGR             G GRG GGGGG     C   G
Sbjct: 145 GGGGGIGGGGGGGGRGVAPDGGSSDIGSGSGRGVGGGGGDLVSICDGVG 193

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/70 (68%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG-GYGGGGRGG 198
           G + G GGGGG   GGGG GGGG    GG GGGGG GGG GGGG GG GG G GGGG GG
Sbjct: 67  GEKNGIGGGGG---GGGGIGGGGGGAIGGGGGGGGGGGGIGGGGGGGGGGIGGGGGGGGG 123

Query: 197 GRGGGGGGGG 168
           G GGG GGGG
Sbjct: 124 GIGGGIGGGG 133

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 55/94 (58%), Positives = 56/94 (59%), Gaps = 17/94 (18%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGY-----ER---GGGGYGGGGSYGGGG--YGGGGGYGGGRG- 252
           G  G    G   GGGGGGG      E+   GGGG GGGG  GGGG   GGGGG GGG G 
Sbjct: 43  GGGGGGGGGGGGGGGGGGGVCGSGGEKNGIGGGGGGGGGIGGGGGGAIGGGGGGGGGGGG 102

Query: 251 -GGGYGGSGGGYGGGGRGGGRG-----GGGGGGG 168
            GGG GG GGG GGGG GGG G     GGGGGGG
Sbjct: 103 IGGGGGGGGGGIGGGGGGGGGGIGGGIGGGGGGG 136

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 41/87 (47%), Positives = 43/87 (49%), Gaps = 9/87 (10%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGG--GYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           G  G  + G   GGGGGG  G   GGGG         GG GGGGG GGGRG    GGS  
Sbjct: 119 GGGGGGIGGGIGGGGGGGIGGGGIGGGGG--------GGIGGGGG-GGGRGVAPDGGSSD 169

Query: 224 GYGGGGRGGGRGGG-------GGGGGS 165
              G GRG G GGG       G GGG+
Sbjct: 170 IGSGSGRGVGGGGGDLVSICDGVGGGA 196

[149][TOP]
>UniRef100_Q3KEU2 Putative glycine rich protein n=1 Tax=Pseudomonas fluorescens Pf0-1
           RepID=Q3KEU2_PSEPF
          Length = 220

 Score =  107 bits (267), Expect = 4e-22
 Identities = 57/106 (53%), Positives = 64/106 (60%), Gaps = 7/106 (6%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYG---GG 258
           D  S   +V   +G +  G   GGGGGGG   GGGG GGGGS GGGG  GGGG G   GG
Sbjct: 25  DNLSGVSSVQAKEGGSGGGGSGGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGG 84

Query: 257 RGGGGYGGSGGGYGGGGRGGGRGGGGGG----GGSCYSCGESGHFA 132
            GGGG GG+GGG+GG G GG  G GGGG     GS +  G SG+ A
Sbjct: 85  NGGGGSGGNGGGHGGSGSGGNSGSGGGGNSGHSGSDHGSGHSGNTA 130

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 50/85 (58%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = -3

Query: 377 QGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGG 198
           +G   GGG GGG   GG G GGGG+ GGG  GGGGG GGG  GGG GG+GGG G GG GG
Sbjct: 37  EGGSGGGGSGGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGG-GSGGNGG 95

Query: 197 GRGGGGGGGGS-CYSCGESGHFARD 126
           G GG G GG S     G SGH   D
Sbjct: 96  GHGGSGSGGNSGSGGGGNSGHSGSD 120

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 45/87 (51%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G +G    G   GG GGGG   GGGG GGGG  GG G GG GG GGG GG G GG+ G  
Sbjct: 52  GGNGGGGGGNGGGGSGGGGGGNGGGGSGGGG--GGNGGGGSGGNGGGHGGSGSGGNSGSG 109

Query: 218 GGGGRG-GGRGGGGGGGGSCYSCGESG 141
           GGG  G  G   G G  G+  S G SG
Sbjct: 110 GGGNSGHSGSDHGSGHSGNTASSGRSG 136

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 39/86 (45%), Positives = 42/86 (48%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G +G    G   GG GGGG   GGGG GGGGS G GG  GG G GG  G GG G S  G+
Sbjct: 59  GGNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGGHGGSGSGGNSGSGGGGNS--GH 116

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
            G   G G  G     G   +  E G
Sbjct: 117 SGSDHGSGHSGNTASSGRSGTHSEPG 142

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 40/97 (41%), Positives = 45/97 (46%), Gaps = 3/97 (3%)
 Frame = -3

Query: 407 NVTGPDGANVQGTRRGGGGGGGYERGGGGYGG-GGSYGGGGYGGGGGYGGGRGGGGYGGS 231
           N  G  G    G   GG GGGG   GGGG GG GG +GG G GG  G GGG G  G+ GS
Sbjct: 61  NGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGGHGGSGSGGNSGSGGG-GNSGHSGS 119

Query: 230 --GGGYGGGGRGGGRGGGGGGGGSCYSCGESGHFARD 126
             G G+ G     GR G     G  +    +G    D
Sbjct: 120 DHGSGHSGNTASSGRSGTHSEPGDDHGVHRAGEVGDD 156

[150][TOP]
>UniRef100_B1JXE0 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia
           MC0-3 RepID=B1JXE0_BURCC
          Length = 505

 Score =  107 bits (267), Expect = 4e-22
 Identities = 52/80 (65%), Positives = 53/80 (66%), Gaps = 5/80 (6%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGG-----GRGGGGYGGSGGGYGGGGRGG 198
           GGGGGGG   GGGG GGGG  GGGG GG GG GG     G GGGG GG GGG GGGG GG
Sbjct: 334 GGGGGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGGGGG 393

Query: 197 GRGGGGGGGGSCYSCGESGH 138
           G GG GGGGG  +  G  GH
Sbjct: 394 GNGGNGGGGGGGHGNGGGGH 413

 Score =  107 bits (266), Expect = 5e-22
 Identities = 52/83 (62%), Positives = 53/83 (63%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G N  G   G GGGGG   GGGG G GG  GGGG GGGGG GGG GG G  G GGG GGG
Sbjct: 318 GGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGG 377

Query: 209 GRGGGRGGGGGGGGSCYSCGESG 141
           G GGG GGGGGGGG   + G  G
Sbjct: 378 GGGGGGGGGGGGGGGGGNGGNGG 400

 Score =  106 bits (264), Expect = 9e-22
 Identities = 54/87 (62%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYG-GGRGGGGYGGSGGG 222
           G    N  G   GGGGGGG   GG G GGGG  GGGG GGGGG G GG GG G GG GGG
Sbjct: 317 GGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGG 376

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGGG GGG GGGGGGGG+  + G  G
Sbjct: 377 GGGGGGGGGGGGGGGGGGNGGNGGGGG 403

 Score =  106 bits (264), Expect = 9e-22
 Identities = 51/77 (66%), Positives = 51/77 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G N  G   GGGGGGG   GGGG GG G  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 336 GGGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGGGGGGN 395

Query: 218 GGGGRGGGRGGGGGGGG 168
           GG G GGG G G GGGG
Sbjct: 396 GGNGGGGGGGHGNGGGG 412

 Score =  101 bits (251), Expect = 3e-20
 Identities = 49/75 (65%), Positives = 52/75 (69%)
 Frame = -3

Query: 392 DGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGG 213
           +G    G   G G GGG   GGGG GGGG+  GGG GGGGG GGG GGGG GG+GG  GG
Sbjct: 315 NGGGGNGNGGGPGNGGG---GGGGGGGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGG 371

Query: 212 GGRGGGRGGGGGGGG 168
           GG GGG GGGGGGGG
Sbjct: 372 GGGGGGGGGGGGGGG 386

 Score =  100 bits (250), Expect = 4e-20
 Identities = 49/79 (62%), Positives = 50/79 (63%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGG 195
           G   G GGG G   GGGG GGGG  G GG GGGGG GGG GGGG  G  GG GGGG GGG
Sbjct: 317 GGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGG 376

Query: 194 RGGGGGGGGSCYSCGESGH 138
            GGGGGGGG     G  G+
Sbjct: 377 GGGGGGGGGGGGGGGGGGN 395

 Score =  100 bits (250), Expect = 4e-20
 Identities = 50/86 (58%), Positives = 51/86 (59%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   G GG GGGG  GGGG GGGGG GGG GGGG  G  GG 
Sbjct: 342 GNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGGGGGGNGGNGGG 401

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG G G GG G GGG+    G  G
Sbjct: 402 GGGGHGNGGGGHGNGGGNGNGNGSGG 427

 Score =  100 bits (248), Expect = 7e-20
 Identities = 49/84 (58%), Positives = 49/84 (58%)
 Frame = -3

Query: 392 DGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGG 213
           DG    G   G G GGG    GGG G GG  GGGG GGG G GGG GGGG GG GGG GG
Sbjct: 302 DGGGGHGNGGGHGNGGGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGGG 361

Query: 212 GGRGGGRGGGGGGGGSCYSCGESG 141
            G  GG GGGGGGGG     G  G
Sbjct: 362 AGGNGGNGGGGGGGGGGGGGGGGG 385

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 48/78 (61%), Positives = 48/78 (61%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGG 195
           G   GG G GG    GGG GGGG  GG G GGGGG GGG GGGG GG  GG GG G GGG
Sbjct: 314 GNGGGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGG 373

Query: 194 RGGGGGGGGSCYSCGESG 141
            GGGGGGGG     G  G
Sbjct: 374 GGGGGGGGGGGGGGGGGG 391

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 50/84 (59%), Positives = 52/84 (61%), Gaps = 1/84 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  GA   G   GGGGGGG   GGGG GGGG  GGGG GG GG GGG GGGG+G  GGG+
Sbjct: 358 GGGGAGGNGGNGGGGGGGG---GGGGGGGGGGGGGGGGGGNGGNGGG-GGGGHGNGGGGH 413

Query: 218 G-GGGRGGGRGGGGGGGGSCYSCG 150
           G GGG G G G GG G G     G
Sbjct: 414 GNGGGNGNGNGSGGAGNGGANGVG 437

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 44/74 (59%), Positives = 48/74 (64%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           G G GGG+  GGGG+G GG +G GG G G G G G GGGG GG GGG  G G GGG GGG
Sbjct: 293 GHGSGGGHGDGGGGHGNGGGHGNGGGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGG 352

Query: 182 GGGGGSCYSCGESG 141
           GGGGG     G +G
Sbjct: 353 GGGGGGGGGAGGNG 366

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 48/84 (57%), Positives = 52/84 (61%)
 Frame = -3

Query: 392 DGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGG 213
           DG    G+  G G GGG    GGG+G GG  GG G GGG G GGG GGGG GG  G  GG
Sbjct: 289 DGGGGHGSGGGHGDGGGGHGNGGGHGNGG--GGNGNGGGPGNGGGGGGGGGGGGNGNGGG 346

Query: 212 GGRGGGRGGGGGGGGSCYSCGESG 141
           GG GGG GGGGGGGG+  + G  G
Sbjct: 347 GGGGGGGGGGGGGGGAGGNGGNGG 370

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 48/82 (58%), Positives = 49/82 (59%), Gaps = 8/82 (9%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGG- 186
           G G GGG+  GGGG G GG  G GG GGGGG GGG G GG GG GGG GGGG GGG GG 
Sbjct: 306 GHGNGGGHGNGGGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGGGAGGN 365

Query: 185 -------GGGGGGSCYSCGESG 141
                  GGGGGG     G  G
Sbjct: 366 GGNGGGGGGGGGGGGGGGGGGG 387

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 46/78 (58%), Positives = 47/78 (60%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GG GG G   GGGG GGGG  GGGG GGGGG  GG GGGG GG G G 
Sbjct: 351 GGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGGGGGGNGGNGGGGGGGHGNGG 410

Query: 218 GGGGRGGGRGGGGGGGGS 165
           GG G GGG G G G GG+
Sbjct: 411 GGHGNGGGNGNGNGSGGA 428

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 49/90 (54%), Positives = 50/90 (55%), Gaps = 1/90 (1%)
 Frame = -3

Query: 407 NVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGY-GGS 231
           N  G  G    G   GGGG GG    GGG GGGG  GGGG GGGGG GGG G GG  GG 
Sbjct: 343 NGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGGGGGGNGGNGGGG 402

Query: 230 GGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGG+G GG G G GGG G G      G  G
Sbjct: 403 GGGHGNGGGGHGNGGGNGNGNGSGGAGNGG 432

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 46/79 (58%), Positives = 52/79 (65%), Gaps = 5/79 (6%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYG--GGGYGGGGGYGGGRGGGGYGG---SGGGYGGGGRGG 198
           G G GGG+  GGGG+G GG +G  GGG+G GGG+G G GG G GG   +GGG GGGG GG
Sbjct: 280 GHGSGGGHGDGGGGHGSGGGHGDGGGGHGNGGGHGNGGGGNGNGGGPGNGGGGGGGGGGG 339

Query: 197 GRGGGGGGGGSCYSCGESG 141
           G G GGGGGG     G  G
Sbjct: 340 GNGNGGGGGGGGGGGGGGG 358

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 50/95 (52%), Positives = 54/95 (56%), Gaps = 9/95 (9%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGY---GGGRGGGGYGGSG 228
           G +G N  G   GGGGGGG   GGGG GGGG  GG G GGGGG+   GGG G GG  G+G
Sbjct: 363 GGNGGNGGGGGGGGGGGGGGGGGGGGGGGGGGNGGNGGGGGGGHGNGGGGHGNGGGNGNG 422

Query: 227 GGYGGGGRGG------GRGGGGGGGGSCYSCGESG 141
            G GG G GG      GRG GG  G +  S G  G
Sbjct: 423 NGSGGAGNGGANGVGNGRGNGGNSGNAGGSNGNGG 457

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 46/84 (54%), Positives = 50/84 (59%), Gaps = 1/84 (1%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG-GGYGGSGGGYGG 213
           G    G   GGG  GG   GGGG+GGGG   GGG+G GGG+G G GG G  GG G G GG
Sbjct: 221 GGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGGHGDGSGGHGNGGGHGDGSGG 280

Query: 212 GGRGGGRGGGGGGGGSCYSCGESG 141
            G GGG G GGGG GS    G+ G
Sbjct: 281 HGSGGGHGDGGGGHGSGGGHGDGG 304

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 47/95 (49%), Positives = 57/95 (60%), Gaps = 7/95 (7%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSY--GGGGYGGGGGYGGGRG----GGGY 240
           T   G +  GT  GGG GGG +  GGG+G GG +  G GG+G GGG+G G G    GGG+
Sbjct: 228 TSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGGHGDGSGGHGNGGGHGDGSGGHGSGGGH 287

Query: 239 GGSGGGYG-GGGRGGGRGGGGGGGGSCYSCGESGH 138
           G  GGG+G GGG G G GG G GGG     G +G+
Sbjct: 288 GDGGGGHGSGGGHGDGGGGHGNGGGHGNGGGGNGN 322

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 45/83 (54%), Positives = 52/83 (62%), Gaps = 9/83 (10%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYG--GGGYGGGGGYGGGRG----GGGYGGSGGGYGGG--- 210
           G G GGG+  G GG+G GG +G  GGG+G GGG+G G G    GGG+G  GGG G G   
Sbjct: 267 GHGNGGGHGDGSGGHGSGGGHGDGGGGHGSGGGHGDGGGGHGNGGGHGNGGGGNGNGGGP 326

Query: 209 GRGGGRGGGGGGGGSCYSCGESG 141
           G GGG GGGGGGGG+    G  G
Sbjct: 327 GNGGGGGGGGGGGGNGNGGGGGG 349

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 47/90 (52%), Positives = 52/90 (57%), Gaps = 3/90 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGG-GYGGGRG-GGGYGGSGG 225
           G  G    G    GGG  G    GGG  GGG+ GGGG+GGGG G GGG G GGG+G   G
Sbjct: 207 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGGHGDGSG 266

Query: 224 GYG-GGGRGGGRGGGGGGGGSCYSCGESGH 138
           G+G GGG G G GG G GGG  +  G  GH
Sbjct: 267 GHGNGGGHGDGSGGHGSGGG--HGDGGGGH 294

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 50/111 (45%), Positives = 53/111 (47%), Gaps = 13/111 (11%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRG 252
           N G        G  G    G   GGGGGGG    GGG GGG   GGGG+G GGG G G G
Sbjct: 365 NGGNGGGGGGGGGGGGGGGGGGGGGGGGGGNGGNGGGGGGGHGNGGGGHGNGGGNGNGNG 424

Query: 251 GGGYG-----------GSGG--GYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
            GG G           G+GG  G  GG  G G GG G GGGS  + G  GH
Sbjct: 425 SGGAGNGGANGVGNGRGNGGNSGNAGGSNGNGGGGAGNGGGSGGANGTGGH 475

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/100 (49%), Positives = 53/100 (53%), Gaps = 2/100 (2%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRG-GGGGGGYERGGG-GYGGGGSYGGGGYGGGGGYGG 261
           D DG          DG+   G   G G G GG+  GGG G GGGG   GGG+G GGG  G
Sbjct: 249 DGDGGGHGNGGGHGDGSGGHGNGGGHGDGSGGHGSGGGHGDGGGGHGSGGGHGDGGGGHG 308

Query: 260 GRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
             GG G GG G G GGG   GG GGGGGGGG   + G  G
Sbjct: 309 NGGGHGNGGGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGG 348

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 43/87 (49%), Positives = 45/87 (51%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GGG GGGG G  GG  
Sbjct: 197 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHG 256

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESGH 138
            GGG G G GG G GGG  +  G  GH
Sbjct: 257 NGGGHGDGSGGHGNGGG--HGDGSGGH 281

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 44/90 (48%), Positives = 48/90 (53%), Gaps = 4/90 (4%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G    GGG  G    GGG  GGG+ GGG  GGGG  GGG G GG  G+GGG+
Sbjct: 202 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGGH 261

Query: 218 GGG----GRGGGRGGGGGGGGSCYSCGESG 141
           G G    G GGG G G GG GS    G+ G
Sbjct: 262 GDGSGGHGNGGGHGDGSGGHGSGGGHGDGG 291

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 44/92 (47%), Positives = 51/92 (55%), Gaps = 6/92 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYG--GGGYGGGGGYGGGRGG----GGYG 237
           G  G    G   G G GGG+  G GG+G GG +G   GG+G GGG+G G GG    GG+G
Sbjct: 242 GGHGGGGDGDGGGHGNGGGHGDGSGGHGNGGGHGDGSGGHGSGGGHGDGGGGHGSGGGHG 301

Query: 236 GSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
             GGG+G GG G G GGGG G G     G  G
Sbjct: 302 DGGGGHGNGG-GHGNGGGGNGNGGGPGNGGGG 332

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 47/92 (51%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYG---GGGGYGGGRGGGGYG-G 234
           T   G +  GT  GG  GGG   GGG   GGG   GGG+G   GG G GGG G G  G G
Sbjct: 223 TSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGGHGDGSGGHGNGGGHGDGSGGHG 282

Query: 233 SGGGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           SGGG+G GG G G GGG G GG  +  G  GH
Sbjct: 283 SGGGHGDGGGGHGSGGGHGDGGGGHGNG-GGH 313

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 47/94 (50%), Positives = 49/94 (52%), Gaps = 7/94 (7%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGG----GGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG 234
           TG    +  GT RGG     GG G    GGG  GGG+ GGG  GGG   GG  GGG  GG
Sbjct: 127 TGGTSGSTSGTGRGGNASGNGGSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTTGGGTSGG 186

Query: 233 --SGGGYGGGG-RGGGRGGGGGGGGSCYSCGESG 141
             SGGG  GGG  GGG  GGG  GG     G SG
Sbjct: 187 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 220

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 46/98 (46%), Positives = 48/98 (48%), Gaps = 3/98 (3%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           GR    +  G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GG  GGG
Sbjct: 138 GRGGNASGNGGSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTTGGGTSGGGTSGGGTSGGG 197

Query: 245 GYGG--SGGGYGGGG-RGGGRGGGGGGGGSCYSCGESG 141
             GG  SGGG  GGG  GGG  GGG  GG     G SG
Sbjct: 198 TSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 235

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 46/92 (50%), Positives = 48/92 (52%), Gaps = 5/92 (5%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGG---GGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG- 234
           T   G +  GT  GG  GGG   GG   GG  GGG+ GGG  GGG   GG  GGG  GG 
Sbjct: 168 TSGGGTSGGGTTGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGG 227

Query: 233 -SGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            SGGG  GGG  GG G GGGG G     G  G
Sbjct: 228 TSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGG 259

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 43/90 (47%), Positives = 46/90 (51%), Gaps = 3/90 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG---SG 228
           G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GG  GGG  GG    G
Sbjct: 182 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 241

Query: 227 GGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           GG+GGGG G G G G GGG   +  G  GH
Sbjct: 242 GGHGGGGDGDGGGHGNGGG---HGDGSGGH 268

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 48/98 (48%), Positives = 53/98 (54%), Gaps = 3/98 (3%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           G  +  N +G +G +  GT  GG  GGG    GGG  GGG+ GGG  GGG   GG  GGG
Sbjct: 136 GTGRGGNASG-NGGSGGGTSGGGTSGGG--TSGGGTSGGGTSGGGTTGGGTSGGGTSGGG 192

Query: 245 GYGG--SGGGYGGGGR-GGGRGGGGGGGGSCYSCGESG 141
             GG  SGGG  GGG  GGG  GGG  GG     G SG
Sbjct: 193 TSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 230

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 45/99 (45%), Positives = 47/99 (47%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGG 258
           S N G     +  G  G    G    GGG  G    GGG  GGG+  GGG  GGG  GGG
Sbjct: 144 SGNGGSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTTGGGTSGGGT-SGGGTSGGGTSGGG 202

Query: 257 RGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
             GGG  G GG  GGG  GGG  GGG  GG     G SG
Sbjct: 203 TSGGGTSG-GGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 240

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 43/89 (48%), Positives = 46/89 (51%), Gaps = 3/89 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYG--GGGYG-GGGGYGGGRGGGGYGGSG 228
           G  G N  G   GG G GG    G G G GG+ G  GG  G GGGG G G G GG  G+G
Sbjct: 414 GNGGGNGNGNGSGGAGNGGANGVGNGRGNGGNSGNAGGSNGNGGGGAGNGGGSGGANGTG 473

Query: 227 GGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G   GGG G G G G G GG   + G SG
Sbjct: 474 GHGNGGGNGNGHGTGNGNGGGHGNGGSSG 502

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 41/89 (46%), Positives = 46/89 (51%), Gaps = 1/89 (1%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG 249
           +G        G  GAN  G  RG GG  G   G  G GGGG+  GGG GG  G GG   G
Sbjct: 419 NGNGNGSGGAGNGGANGVGNGRGNGGNSGNAGGSNGNGGGGAGNGGGSGGANGTGGHGNG 478

Query: 248 GGYGGSGGGYG-GGGRGGGRGGGGGGGGS 165
              GG+G G+G G G GGG G GG  GG+
Sbjct: 479 ---GGNGNGHGTGNGNGGGHGNGGSSGGN 504

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 39/91 (42%), Positives = 41/91 (45%)
 Frame = -3

Query: 413 AVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG 234
           AV+V    G    G   GG G G     GGG GGG   G GG  G G  G    GG  GG
Sbjct: 70  AVHVYAGRGVGNGGAGAGGSGNGNGNGNGGGTGGGNGNGSGGNNGNGAVGPAGVGGATGG 129

Query: 233 SGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           + G   G GRGG   G GG GG     G SG
Sbjct: 130 TSGSTSGTGRGGNASGNGGSGGGTSGGGTSG 160

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 46/110 (41%), Positives = 48/110 (43%), Gaps = 15/110 (13%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGA-NVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGG--------- 276
           GR       G  G+ N  G   GGG GGG   G GG  G G+ G  G GG          
Sbjct: 76  GRGVGNGGAGAGGSGNGNGNGNGGGTGGGNGNGSGGNNGNGAVGPAGVGGATGGTSGSTS 135

Query: 275 ----GGYGGGRGGGGYGGSGGGYGGGGR-GGGRGGGGGGGGSCYSCGESG 141
               GG   G GG G G SGGG  GGG  GGG  GGG  GG     G SG
Sbjct: 136 GTGRGGNASGNGGSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTTGGGTSG 185

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 47/107 (43%), Positives = 48/107 (44%), Gaps = 10/107 (9%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGG----------GYERGGGGYGGGGSYGGGGYG 282
           N G +   N  G  G N  G     G GG          G  RGG   G GGS  GGG  
Sbjct: 97  NGGGTGGGNGNGSGGNNGNGAVGPAGVGGATGGTSGSTSGTGRGGNASGNGGS--GGGTS 154

Query: 281 GGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGG  GGG  GGG  G GG  GGG  GGG  GGG  GG     G SG
Sbjct: 155 GGGTSGGGTSGGGTSG-GGTSGGGTTGGGTSGGGTSGGGTSGGGTSG 200

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 44/100 (44%), Positives = 47/100 (47%), Gaps = 3/100 (3%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRG 252
           N+G   AV   G  GA    +    G G G    G G  GGG+ GGG  GGG   GG  G
Sbjct: 112 NNGNG-AVGPAGVGGATGGTSGSTSGTGRGGNASGNGGSGGGTSGGGTSGGGTSGGGTSG 170

Query: 251 GGGYGG---SGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG  GG    GG  GGG  GGG  GGG  GG     G SG
Sbjct: 171 GGTSGGGTTGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 210

[151][TOP]
>UniRef100_A2C5L0 RNA-binding region RNP-1 (RNA recognition motif) n=1
           Tax=Prochlorococcus marinus str. MIT 9303
           RepID=A2C5L0_PROM3
          Length = 202

 Score =  107 bits (267), Expect = 4e-22
 Identities = 60/98 (61%), Positives = 62/98 (63%), Gaps = 3/98 (3%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           GR   +N   P G+     RRGGGGG  Y  GGGGYGGGG    GGYGGGGG G G GGG
Sbjct: 69  GRPLRINKAEPRGS---APRRGGGGG--YGGGGGGYGGGG----GGYGGGGG-GYGGGGG 118

Query: 245 GYGGSGGGYGGGGRGGGRGG---GGGGGGSCYSCGESG 141
           GYGG GGGYGGGG GGG GG   GGGGGG     G  G
Sbjct: 119 GYGGGGGGYGGGGGGGGGGGYGGGGGGGGGDRGSGARG 156

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 40/61 (65%), Positives = 41/61 (67%)
 Frame = -3

Query: 317 GGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           GGGG YGGGG    GGYGGG  GGGYGG GGGYGGGG  GG GGGGGG G     G  G 
Sbjct: 87  GGGGGYGGGG----GGYGGG--GGGYGGGGGGYGGGG--GGYGGGGGGYGGGGGGGGGGG 138

Query: 137 F 135
           +
Sbjct: 139 Y 139

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/82 (53%), Positives = 44/82 (53%), Gaps = 14/82 (17%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGY--GGGGGYGGGRGGGGYGGSGGGYGGG-------- 210
           GGGGGGY  GGGGYGGGG  GGGG   GGGGG GG RG G  G     YGG         
Sbjct: 114 GGGGGGYGGGGGGYGGGGGGGGGGGYGGGGGGGGGDRGSGARGWEDRSYGGAAPETSSYD 173

Query: 209 -GRGGGRGGGG---GGGGSCYS 156
            GR   R GG    G GG  YS
Sbjct: 174 DGRTRRRRGGAAPEGEGGDSYS 195

[152][TOP]
>UniRef100_Q41518 Single-stranded nucleic acid binding protein n=1 Tax=Triticum
           aestivum RepID=Q41518_WHEAT
          Length = 167

 Score =  107 bits (267), Expect = 4e-22
 Identities = 57/92 (61%), Positives = 61/92 (66%), Gaps = 7/92 (7%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGY---ERGGGGYGGGGSYGGGGYG----GGGG 270
           DGR+  VN      A  + +  GGGGGGGY     GGGGYGGGG YGGGG G    GGGG
Sbjct: 73  DGRNITVNE-----AQSRRSGGGGGGGGGYGGQRGGGGGYGGGGGYGGGGGGYGGQGGGG 127

Query: 269 YGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGG 174
           YGG RGGGG  G GGGYGGGG  GG+ GGGGG
Sbjct: 128 YGGQRGGGGGYGGGGGYGGGGGYGGQRGGGGG 159

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 5/42 (11%)
 Frame = -3

Query: 365 RGGGGGGGYERGGGGYGGGGSYGGGG-----YGGGGGYGGGR 255
           +GGGG GG   GGGGYGGGG YGGGG      GGGGG  GG+
Sbjct: 123 QGGGGYGGQRGGGGGYGGGGGYGGGGGYGGQRGGGGGDSGGQ 164

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 28/46 (60%), Positives = 28/46 (60%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGG 261
           G  G    G R   GGGGGY  GGGGYGGGG YGG   GGGG  GG
Sbjct: 122 GQGGGGYGGQR---GGGGGY-GGGGGYGGGGGYGGQRGGGGGDSGG 163

[153][TOP]
>UniRef100_B7P029 Vasa n=1 Tax=Chlamys farreri RepID=B7P029_9BIVA
          Length = 801

 Score =  107 bits (267), Expect = 4e-22
 Identities = 53/101 (52%), Positives = 60/101 (59%), Gaps = 19/101 (18%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR-------GGGGYGGSGGGYG---- 216
           GGGG G   +GG G GGGG +G     GGGG+GGG        GGGG+G  GGG+G    
Sbjct: 85  GGGGFGSGGKGGFGSGGGGGFGSKPQNGGGGFGGGESDGMTNGGGGGFGRGGGGFGKGSG 144

Query: 215 -GGG-------RGGGRGGGGGGGGSCYSCGESGHFARDCPT 117
            GGG       RGGG GGGGG    C+ CGE GHFAR+CPT
Sbjct: 145 DGGGFGSDRPPRGGGFGGGGGSSSGCHKCGEDGHFARECPT 185

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/116 (50%), Positives = 67/116 (57%), Gaps = 34/116 (29%)
 Frame = -3

Query: 362 GGGGGGGY----ERGGGGYGGGGSYG-----GGGYG-GGGGYGGGRG-GGGYGGS----G 228
           G GGGGG+    + GGGG+GGG S G     GGG+G GGGG+G G G GGG+G      G
Sbjct: 98  GSGGGGGFGSKPQNGGGGFGGGESDGMTNGGGGGFGRGGGGFGKGSGDGGGFGSDRPPRG 157

Query: 227 GGYGGGGRG-------------------GGRGGGGGGGGSCYSCGESGHFARDCPT 117
           GG+GGGG                     GG G GGGGGG C+ CGE GHFAR+CPT
Sbjct: 158 GGFGGGGGSSSGCHKCGEDGHFARECPTGGGGRGGGGGGKCHKCGEEGHFARECPT 213

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 58/141 (41%), Positives = 66/141 (46%), Gaps = 60/141 (42%)
 Frame = -3

Query: 356 GGGGGYERGGGGYG----GGGSYG------GGGYGGGGGYGGG---------------RG 252
           GGGGG+ RGGGG+G     GG +G      GGG+GGGGG   G                G
Sbjct: 127 GGGGGFGRGGGGFGKGSGDGGGFGSDRPPRGGGFGGGGGSSSGCHKCGEDGHFARECPTG 186

Query: 251 GGGYGGSGGGY----------------GGGGRGGGR-----------------GGGGGGG 171
           GGG GG GGG                 GGGG GG R                 GGGGGGG
Sbjct: 187 GGGRGGGGGGKCHKCGEEGHFARECPTGGGGGGGDRSCFKCGEQGHMSRECPKGGGGGGG 246

Query: 170 G--SCYSCGESGHFARDCPTS 114
           G  SC+ CGE GH +R+CP+S
Sbjct: 247 GDRSCFKCGEQGHMSRECPSS 267

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 47/133 (35%), Positives = 58/133 (43%), Gaps = 27/133 (20%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQ------GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYG 264
           G S   +  G DG   +      G R GGGGG  ++ G  G+       GGG GGG    
Sbjct: 165 GSSSGCHKCGEDGHFARECPTGGGGRGGGGGGKCHKCGEEGHFARECPTGGGGGGGDRSC 224

Query: 263 GGRGGGGYGGSGGGYGGGGRGGG-------------------RGGGGGGGG--SCYSCGE 147
              G  G+       GGGG GGG                    GGGGGGGG   C+ CGE
Sbjct: 225 FKCGEQGHMSRECPKGGGGGGGGDRSCFKCGEQGHMSRECPSSGGGGGGGGDRGCFKCGE 284

Query: 146 SGHFARDCPTSAR 108
            GHF+R+CP + +
Sbjct: 285 QGHFSRECPNAEK 297

[154][TOP]
>UniRef100_B4NC76 GK25807 n=1 Tax=Drosophila willistoni RepID=B4NC76_DROWI
          Length = 234

 Score =  107 bits (267), Expect = 4e-22
 Identities = 59/117 (50%), Positives = 60/117 (51%), Gaps = 29/117 (24%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGY------- 240
           G  G    G   GG GGGGY  GGG +GGGG  GGGGYGGGGG  GG GGGGY       
Sbjct: 25  GGGGGGGYGGGGGGNGGGGYGGGGGSHGGGGGNGGGGYGGGGGSHGGGGGGGYGGGSKSL 84

Query: 239 --------------------GGSGGGYGGGGRGGGRGG--GGGGGGSCYSCGESGHF 135
                               GG GGGYGGGG GG  GG  GGGGGG  Y  G SG F
Sbjct: 85  AGNRGSSISWQGGGNGGKQGGGGGGGYGGGGSGGFGGGKHGGGGGGGGYGGGGSGGF 141

 Score =  105 bits (261), Expect = 2e-21
 Identities = 57/109 (52%), Positives = 61/109 (55%), Gaps = 21/109 (19%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGG--------------GGYGGGGSYGGGGYGGGGGYGG 261
           G  G    G   GGGGGGGY  GG              GGYGG G  GGGGYGG GG GG
Sbjct: 114 GGSGGFGGGKHGGGGGGGGYGGGGSGGFGGGKHGGGGGGGYGGNGGNGGGGYGGNGGGGG 173

Query: 260 GR----GGGGYGGSGGGYGG---GGRGGGRGGGGGGGGSCYSCGESGHF 135
           G+    GGGGYGG+GGG GG   GG GGG GG GGGGG  +  G  G +
Sbjct: 174 GKHGGNGGGGYGGNGGGGGGKHGGGGGGGYGGNGGGGGGKHGGGGGGGY 222

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/119 (48%), Positives = 68/119 (57%), Gaps = 24/119 (20%)
 Frame = -3

Query: 419 SKAVNVTGPDGANVQGTRRGGGGGGGYERGG---------GGYGGGGSYGGGGY------ 285
           ++  +++   G N  G ++GGGGGGGY  GG         GG GGGG YGGGG       
Sbjct: 87  NRGSSISWQGGGN--GGKQGGGGGGGYGGGGSGGFGGGKHGGGGGGGGYGGGGSGGFGGG 144

Query: 284 ----GGGGGYG--GGRGGGGYGGSGGGYG---GGGRGGGRGGGGGGGGSCYSCGESGHF 135
               GGGGGYG  GG GGGGYGG+GGG G   GG  GGG GG GGGGG  +  G  G +
Sbjct: 145 KHGGGGGGGYGGNGGNGGGGYGGNGGGGGGKHGGNGGGGYGGNGGGGGGKHGGGGGGGY 203

 Score =  101 bits (251), Expect = 3e-20
 Identities = 55/88 (62%), Positives = 58/88 (65%), Gaps = 10/88 (11%)
 Frame = -3

Query: 374 GTRRGGGGGGGYE----RGGGGYGGGGSYGGGGYGG--GGGYGGGRGGGGY---GGSGGG 222
           G + GGGGGGGY      GGGGYGG G  GGG +GG  GGGYGG  GGGG    GG GGG
Sbjct: 143 GGKHGGGGGGGYGGNGGNGGGGYGGNGGGGGGKHGGNGGGGYGGNGGGGGGKHGGGGGGG 202

Query: 221 YGG-GGRGGGRGGGGGGGGSCYSCGESG 141
           YGG GG GGG+ GGGGGGG  Y  G  G
Sbjct: 203 YGGNGGGGGGKHGGGGGGG--YGGGGGG 228

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 54/96 (56%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYG-GGGYGGGGGYGGGRGG 249
           G SK++        + QG   GG  GGG   GGGGYGGGGS G GGG  GGGG GGG GG
Sbjct: 79  GGSKSLAGNRGSSISWQGGGNGGKQGGG---GGGGYGGGGSGGFGGGKHGGGGGGGGYGG 135

Query: 248 GGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG GG GGG  GGG GGG GG GG GG  Y     G
Sbjct: 136 GGSGGFGGGKHGGGGGGGYGGNGGNGGGGYGGNGGG 171

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 49/81 (60%), Positives = 51/81 (62%), Gaps = 5/81 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGG---GGYGGGGSYGGG--GYGGGGGYGGGRGGGGYGG 234
           G +G N  G   G GGGGG + GG   GGYGG G  GGG  G GGGGGYGG  GGG  GG
Sbjct: 155 GGNGGNGGGGYGGNGGGGGGKHGGNGGGGYGGNGGGGGGKHGGGGGGGYGGNGGGG--GG 212

Query: 233 SGGGYGGGGRGGGRGGGGGGG 171
             GG GGGG GGG GG  GGG
Sbjct: 213 KHGGGGGGGYGGGGGGKHGGG 233

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/68 (64%), Positives = 44/68 (64%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGG 195
           G   GGGGGGGY       GGGG  GGGGYGGGGG  GG GG G    GGGYGGGG  G 
Sbjct: 21  GLLGGGGGGGGYG------GGGGGNGGGGYGGGGGSHGGGGGNG----GGGYGGGG--GS 68

Query: 194 RGGGGGGG 171
            GGGGGGG
Sbjct: 69  HGGGGGGG 76

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 36/61 (59%), Positives = 39/61 (63%), Gaps = 1/61 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGG-GGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           G  G N  G   G GGGGG + GGGG GG GG+ GGGG   GGG GGG GGGG G  GGG
Sbjct: 174 GKHGGNGGGGYGGNGGGGGGKHGGGGGGGYGGNGGGGGGKHGGGGGGGYGGGGGGKHGGG 233

Query: 221 Y 219
           +
Sbjct: 234 W 234

[155][TOP]
>UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri
           RepID=SSGP_VOLCA
          Length = 485

 Score =  107 bits (266), Expect = 5e-22
 Identities = 53/93 (56%), Positives = 53/93 (56%), Gaps = 2/93 (2%)
 Frame = +1

Query: 142 PDSPQ--L*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPP 315
           P SPQ      PP PPP PRPP  PPP   PP PP PPPP PPP PP PP PPPP  PPP
Sbjct: 230 PPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 289

Query: 316 P*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTA 414
           P PPPP   PP  PP    P    PS P  L A
Sbjct: 290 PPPPPPSPSPPRKPPSPSPPVPPPPSPPSVLPA 322

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/86 (56%), Positives = 50/86 (58%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     P PP P P    RPP P P P PP PPPP P P PPPPP PPPP  PPPP 
Sbjct: 219 PIGPAPNNSPLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPP-PPPPPS 277

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PPPP   PPPPPPP   P   +PS P
Sbjct: 278 PPPPPPPPPPPPPPPPPP---SPSPP 300

[156][TOP]
>UniRef100_Q4TB22 Chromosome 15 SCAF7210, whole genome shotgun sequence. (Fragment) n=1
            Tax=Tetraodon nigroviridis RepID=Q4TB22_TETNG
          Length = 1021

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/83 (67%), Positives = 56/83 (67%), Gaps = 9/83 (10%)
 Frame = -3

Query: 389  GANVQGTRRGGGGGGGYERGGGGYGGGGSY-GGGGYGGGGGY---GGGRGGGGYG----- 237
            G   QG   GG GGGG  RGGGGYGGGG Y GGGGYGG  GY   GG RGGGGYG     
Sbjct: 938  GGPFQGGGGGGYGGGGGYRGGGGYGGGGGYRGGGGYGGRRGYRGSGGYRGGGGYGGGRGN 997

Query: 236  GSGGGYGGGGRGGGRGGGGGGGG 168
            G GGGYGGGG  GG GG GGGGG
Sbjct: 998  GGGGGYGGGGGYGGGGGNGGGGG 1020

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 52/78 (66%), Positives = 54/78 (69%), Gaps = 4/78 (5%)
 Frame = -3

Query: 392  DGANVQGTRRGGGGGGGYERGGGGYGGGGSY-GGGGYGGGGGYGGGRGGG---GYGGSGG 225
            +G   +G  RGG   GG   GGGGYGGGG Y GGGGYGGGGGY GG G G   GY GSGG
Sbjct: 930  EGGGYRG--RGGPFQGG---GGGGYGGGGGYRGGGGYGGGGGYRGGGGYGGRRGYRGSGG 984

Query: 224  GYGGGGRGGGRGGGGGGG 171
              GGGG GGGRG GGGGG
Sbjct: 985  YRGGGGYGGGRGNGGGGG 1002

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/61 (67%), Positives = 42/61 (68%), Gaps = 1/61 (1%)
 Frame = -3

Query: 398  GPDGANVQGTRRGGGGGGGYERGGGGYGGG-GSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
            G  G    G RRG  G GGY RGGGGYGGG G+ GGGGYGGGGGYGGG G GG    GGG
Sbjct: 966  GYRGGGGYGGRRGYRGSGGY-RGGGGYGGGRGNGGGGGYGGGGGYGGGGGNGG----GGG 1020

Query: 221  Y 219
            Y
Sbjct: 1021 Y 1021

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 46/96 (47%), Positives = 49/96 (51%), Gaps = 15/96 (15%)
 Frame = -3

Query: 380  VQGTRRGGGGGGGYERG---GGGYGGGGSYGGGGYGGGGGY----GGGRGGGGYGGSGGG 222
            V  T R G G    + G   GGGY G G   G   GGGGG     GG RGGGGYGG GG 
Sbjct: 911  VTNTSRMGDGPRPPKMGRFEGGGYRGRG---GPFQGGGGGGYGGGGGYRGGGGYGGGGGY 967

Query: 221  YGGGGRGGGRG--------GGGGGGGSCYSCGESGH 138
             GGGG GG RG        GGGG GG   + G  G+
Sbjct: 968  RGGGGYGGRRGYRGSGGYRGGGGYGGGRGNGGGGGY 1003

[157][TOP]
>UniRef100_Q0BCI9 Putative uncharacterized protein n=1 Tax=Burkholderia ambifaria
           AMMD RepID=Q0BCI9_BURCM
          Length = 529

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/92 (60%), Positives = 56/92 (60%), Gaps = 5/92 (5%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G    N  G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GGSGGG 
Sbjct: 394 GNGNGNGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSGGGG 453

Query: 218 GGGGRG-----GGRGGGGGGGGSCYSCGESGH 138
           G GG G     GG GG G GGGS    G  GH
Sbjct: 454 GSGGSGGSGGAGGSGGQGNGGGSTGGHGIGGH 485

 Score =  106 bits (265), Expect = 7e-22
 Identities = 59/109 (54%), Positives = 62/109 (56%), Gaps = 12/109 (11%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRG-GGGGGGYERGGGGYG-----------GGGSYGGGG 288
           N G +   N  G  G N  G   G GGG GG+  G GG+G           GGG  GGGG
Sbjct: 355 NGGGNGGGNGGGNGGGNGGGNGGGHGGGSGGHGNGNGGHGNGNGNGNGGGGGGGGGGGGG 414

Query: 287 YGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGGGG GGG GGGG GG GGG GGGG GGG GG GGGGGS  S G  G
Sbjct: 415 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSGGGGGSGGSGGSGG 463

 Score =  104 bits (260), Expect = 3e-21
 Identities = 52/86 (60%), Positives = 53/86 (61%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G +  G    G G G    GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 381 GGSGGHGNGNGGHGNGNGNGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 440

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG  GG GGGGG GGS  S G  G
Sbjct: 441 GGGGGSGGSGGGGGSGGSGGSGGAGG 466

 Score =  102 bits (254), Expect = 1e-20
 Identities = 54/97 (55%), Positives = 55/97 (56%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRG 252
           N G +   N  G  G N  G   G GGG G   GG G G GG   G G G GGG GGG G
Sbjct: 351 NGGGNGGGNGGGNGGGNGGGNGGGNGGGHGGGSGGHGNGNGGHGNGNGNGNGGGGGGGGG 410

Query: 251 GGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGG GG GGG GGGG GGG GGGGGGGG     G SG
Sbjct: 411 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSG 447

 Score =  100 bits (248), Expect = 7e-20
 Identities = 50/84 (59%), Positives = 51/84 (60%)
 Frame = -3

Query: 392 DGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGG 213
           +G    G   G G GGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GG
Sbjct: 388 NGNGGHGNGNGNGNGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 444

Query: 212 GGRGGGRGGGGGGGGSCYSCGESG 141
           G  G G GGG GG G     G SG
Sbjct: 445 GSGGSGGGGGSGGSGGSGGAGGSG 468

 Score =  100 bits (248), Expect = 7e-20
 Identities = 50/84 (59%), Positives = 53/84 (63%)
 Frame = -3

Query: 392 DGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGG 213
           +G +  G   G GGGGG    GGG GGGG  GGGG GGGGG GGG GGGG GG GGG GG
Sbjct: 390 NGGHGNGNGNGNGGGGG----GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 445

Query: 212 GGRGGGRGGGGGGGGSCYSCGESG 141
            G  GG GG GG GGS  + G  G
Sbjct: 446 SGGSGGGGGSGGSGGSGGAGGSGG 469

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 52/97 (53%), Positives = 53/97 (54%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRG 252
           N G +   N  G  G N  G   G GGG G   GGG  G G   GG G G G G GGG G
Sbjct: 347 NGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGHGGGSGGHGNGNGGHGNGNGNGNGGGGG 406

Query: 251 GGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 407 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 443

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 48/87 (55%), Positives = 51/87 (58%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G N  G   GGG GGG   G GG  GGG  GG G G GGG+GGG GGG  GG+GGG 
Sbjct: 302 GHGGGN--GGGHGGGNGGGNGGGSGGGSGGGHGGGNGGGNGGGHGGGNGGGNGGGNGGGN 359

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESGH 138
           GGG  GG  GG GGG G  +  G  GH
Sbjct: 360 GGGNGGGNGGGNGGGNGGGHGGGSGGH 386

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 48/87 (55%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = -3

Query: 392 DGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYG- 216
           +G    G   GGGGGGG+  G GG  GGG+ GG G G GGG GGG GGG  GG+GGG+G 
Sbjct: 286 NGGGHGGGHGGGGGGGGHGGGNGGGHGGGNGGGNGGGSGGGSGGGHGGGNGGGNGGGHGG 345

Query: 215 --GGGRGGGRGGGGGGGGSCYSCGESG 141
             GGG GGG GGG GGG    + G +G
Sbjct: 346 GNGGGNGGGNGGGNGGGNGGGNGGGNG 372

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 46/83 (55%), Positives = 51/83 (61%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGG  GG   GGG  GG G +GGGG+G GGG GGG G G  GG GGG+GGG
Sbjct: 238 GGTSGGGTSGGGTSGGGTSGGGTSGGHGGHGGGGHGDGGGNGGGNGVGNGGGHGGGHGGG 297

Query: 209 GRGGGRGGGGGGGGSCYSCGESG 141
           G GGG GGG GGG    + G +G
Sbjct: 298 GGGGGHGGGNGGGHGGGNGGGNG 320

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 51/89 (57%), Positives = 54/89 (60%), Gaps = 3/89 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G N  G   G GGG G   GGGG GGGG  GG G G GGG GGG GGG  GGSGGG+
Sbjct: 273 GDGGGNGGGNGVGNGGGHGGGHGGGG-GGGGHGGGNGGGHGGGNGGGNGGGSGGGSGGGH 331

Query: 218 GGG---GRGGGRGGGGGGGGSCYSCGESG 141
           GGG   G GGG GGG GGG    + G +G
Sbjct: 332 GGGNGGGNGGGHGGGNGGGNGGGNGGGNG 360

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 50/92 (54%), Positives = 54/92 (58%), Gaps = 6/92 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGG---GYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSG 228
           G  G    G   G GGG G   GGG   G+GGGG  GG G G GGG+GGG GGG  GGSG
Sbjct: 265 GGHGGGGHGDGGGNGGGNGVGNGGGHGGGHGGGGGGGGHGGGNGGGHGGGNGGGNGGGSG 324

Query: 227 GGYG---GGGRGGGRGGGGGGGGSCYSCGESG 141
           GG G   GGG GGG GGG GGG    + G +G
Sbjct: 325 GGSGGGHGGGNGGGNGGGHGGGNGGGNGGGNG 356

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 50/97 (51%), Positives = 52/97 (53%), Gaps = 8/97 (8%)
 Frame = -3

Query: 407 NVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGG--------GGYGGGRG 252
           N  G  G N  G   G GGG G   GGG  GG G   GGG+GGG        GG+G G G
Sbjct: 339 NGGGHGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGHGGGSGGHGNGNGGHGNGNG 398

Query: 251 GGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            G  GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 399 NGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 435

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 50/98 (51%), Positives = 55/98 (56%), Gaps = 11/98 (11%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGG----------GGYGGGRG 252
           T   G +  GT  GG  GGG   G GG+GGGG   GGG GGG          GG+GGG G
Sbjct: 240 TSGGGTSGGGTSGGGTSGGGTSGGHGGHGGGGHGDGGGNGGGNGVGNGGGHGGGHGGGGG 299

Query: 251 GGGYGGSGGGYGGGGRGGGRGGG-GGGGGSCYSCGESG 141
           GGG+GG  GG  GGG GGG GGG GGG G  +  G  G
Sbjct: 300 GGGHGGGNGGGHGGGNGGGNGGGSGGGSGGGHGGGNGG 337

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 52/90 (57%), Positives = 52/90 (57%), Gaps = 1/90 (1%)
 Frame = -3

Query: 407 NVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSG 228
           N  G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GG  GGGG GGSG
Sbjct: 401 NGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG-GGGGGGGGGGSGGSGGGGGSGGSG 459

Query: 227 GGYGGGGRGG-GRGGGGGGGGSCYSCGESG 141
           G  G GG GG G GGG  GG      G  G
Sbjct: 460 GSGGAGGSGGQGNGGGSTGGHGIGGHGNGG 489

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 49/87 (56%), Positives = 53/87 (60%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G N  G+  GGG GGG+  G GG  GGG  GG G G GGG GGG GGG  GG+GGG 
Sbjct: 314 GNGGGNGGGS--GGGSGGGHGGGNGGGNGGGHGGGNGGGNGGGNGGGNGGGNGGGNGGG- 370

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESGH 138
            GGG GGG GGG GG G+    G  GH
Sbjct: 371 NGGGNGGGHGGGSGGHGN----GNGGH 393

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 56/118 (47%), Positives = 56/118 (47%), Gaps = 31/118 (26%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG-- 225
           G  G    G   GGGGGGG   GGGG GGGG  G GG GGGGG GG  G GG GGSGG  
Sbjct: 412 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSGGGGGSGGSGGSGGAGGSGGQG 471

Query: 224 ---------GYGGGGRGGGRG--------------------GGGGGGGSCYSCGESGH 138
                    G GG G GGG G                    GGGGGGGS  S G  GH
Sbjct: 472 NGGGSTGGHGIGGHGNGGGNGNGNGNGGAGSGGANGVGNGSGGGGGGGSGGSAGGHGH 529

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 48/87 (55%), Positives = 51/87 (58%), Gaps = 1/87 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERG-GGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           G  G    G   GGG GGG   G GGG+GGG   GGGG G GGG GGG GGG  GG+GGG
Sbjct: 263 GHGGHGGGGHGDGGGNGGGNGVGNGGGHGGGHGGGGGGGGHGGGNGGGHGGGNGGGNGGG 322

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGG  GG  GG GGG G  +  G  G
Sbjct: 323 SGGGSGGGHGGGNGGGNGGGHGGGNGG 349

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/92 (55%), Positives = 56/92 (60%), Gaps = 6/92 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGG--GSYGGGGYGG-GGGYGGGRGGGGYGGSG 228
           G  G N  G   G GGG G   GGGG+GGG  G +GGG  GG GGG GGG GGG  GG+G
Sbjct: 277 GNGGGNGVGNGGGHGGGHGGGGGGGGHGGGNGGGHGGGNGGGNGGGSGGGSGGGHGGGNG 336

Query: 227 GGYG---GGGRGGGRGGGGGGGGSCYSCGESG 141
           GG G   GGG GGG GGG GGG    + G +G
Sbjct: 337 GGNGGGHGGGNGGGNGGGNGGGNGGGNGGGNG 368

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 49/103 (47%), Positives = 52/103 (50%), Gaps = 16/103 (15%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           +G       G   GGG GGG+  G GG  GGG+ GG G G GGG GGG GGG  GG GGG
Sbjct: 323 SGGGSGGGHGGGNGGGNGGGHGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGHGGG 382

Query: 221 YGG----------------GGRGGGRGGGGGGGGSCYSCGESG 141
            GG                GG GGG GGGGGGGG     G  G
Sbjct: 383 SGGHGNGNGGHGNGNGNGNGGGGGGGGGGGGGGGGGGGGGGGG 425

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 52/105 (49%), Positives = 54/105 (51%), Gaps = 8/105 (7%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTR--RGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGG 258
           N G S   +  G  G N  G     GGG GGG   G GG  GGG+ GG G G GGG GGG
Sbjct: 319 NGGGSGGGSGGGHGGGNGGGNGGGHGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGG 378

Query: 257 RGGG------GYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGG      G GG G G G G  GGG GGGGGGGG     G  G
Sbjct: 379 HGGGSGGHGNGNGGHGNGNGNGNGGGGGGGGGGGGGGGGGGGGGG 423

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/113 (46%), Positives = 56/113 (49%), Gaps = 16/113 (14%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGG--GGGYGGG 258
           N G +   +  G  G +  G   G GGG G   GGG  GG G   GGG GG  GGG GGG
Sbjct: 315 NGGGNGGGSGGGSGGGHGGGNGGGNGGGHGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGG 374

Query: 257 RGGGGYGGSGG--------------GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGG  GGSGG              G GGGG GGG GGGGGGGG     G  G
Sbjct: 375 NGGGHGGGSGGHGNGNGGHGNGNGNGNGGGGGGGGGGGGGGGGGGGGGGGGGG 427

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 45/80 (56%), Positives = 48/80 (60%), Gaps = 3/80 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G    GGG  G    GGG  GGG+ GGG  GG GG+GGG  G G GG+GGG 
Sbjct: 224 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGHGGHGGGGHGDG-GGNGGGN 282

Query: 218 G---GGGRGGGRGGGGGGGG 168
           G   GGG GGG GGGGGGGG
Sbjct: 283 GVGNGGGHGGGHGGGGGGGG 302

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 47/85 (55%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGG-GYGGGRGGGGYGGSGGGYGG 213
           G    G   GGG  GG   GGG  GGG S G GG+GGGG G GGG GGG   G+GGG+GG
Sbjct: 233 GGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGHGGHGGGGHGDGGGNGGGNGVGNGGGHGG 292

Query: 212 GGRGGGRGGG-GGGGGSCYSCGESG 141
           G  GGG GGG GGG G  +  G  G
Sbjct: 293 GHGGGGGGGGHGGGNGGGHGGGNGG 317

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 46/102 (45%), Positives = 49/102 (48%), Gaps = 3/102 (2%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGG 258
           S N       + +G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GG 
Sbjct: 146 SGNGASGGGTSGSGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGT 205

Query: 257 RGGGGYGG--SGGGYGGGG-RGGGRGGGGGGGGSCYSCGESG 141
            GGG  GG  SGGG  GGG  GGG  GGG  GG     G SG
Sbjct: 206 SGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 247

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 43/89 (48%), Positives = 44/89 (49%), Gaps = 2/89 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG--SGG 225
           G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GG  GGG  GG  SGG
Sbjct: 179 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 238

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           G  GGG  GG   GGG  G   S G  GH
Sbjct: 239 GTSGGGTSGGGTSGGGTSGGGTSGGHGGH 267

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 41/78 (52%), Positives = 42/78 (53%), Gaps = 2/78 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG--SGG 225
           G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GG  GGG  GG  SGG
Sbjct: 194 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 253

Query: 224 GYGGGGRGGGRGGGGGGG 171
           G  GGG  GG GG GGGG
Sbjct: 254 GTSGGGTSGGHGGHGGGG 271

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/89 (49%), Positives = 45/89 (50%), Gaps = 3/89 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG--SGG 225
           G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GG  GGG  GG  SGG
Sbjct: 139 GSSGGGTSGNGASGGGTSGSGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 198

Query: 224 GYGGGG-RGGGRGGGGGGGGSCYSCGESG 141
           G  GGG  GGG  GGG  GG     G SG
Sbjct: 199 GTSGGGTSGGGTSGGGTSGGGTSGGGTSG 227

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 46/102 (45%), Positives = 49/102 (48%), Gaps = 3/102 (2%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGG 258
           S N G+    +  G  G    G    G G  G    GGG  GGG+ GGG  GGG   GG 
Sbjct: 131 SGNGGKGDGSSGGGTSGNGASGGGTSGSGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGT 190

Query: 257 RGGGGYGG--SGGGYGGGG-RGGGRGGGGGGGGSCYSCGESG 141
            GGG  GG  SGGG  GGG  GGG  GGG  GG     G SG
Sbjct: 191 SGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 232

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 44/89 (49%), Positives = 45/89 (50%), Gaps = 3/89 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG--SGG 225
           G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GG  GGG  GG  SGG
Sbjct: 169 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 228

Query: 224 GYGGGG-RGGGRGGGGGGGGSCYSCGESG 141
           G  GGG  GGG  GGG  GG     G SG
Sbjct: 229 GTSGGGTSGGGTSGGGTSGGGTSGGGTSG 257

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 42/90 (46%), Positives = 45/90 (50%), Gaps = 4/90 (4%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGG----GYGGGGGYGGGRGGGGYGGS 231
           G  G    G    GGG  G    GGG  GGG+ GGG    G  GGG  GGG  GGG  G 
Sbjct: 204 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 263

Query: 230 GGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GG+GGGG G G  GG GGG    + G  G
Sbjct: 264 HGGHGGGGHGDG--GGNGGGNGVGNGGGHG 291

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 44/93 (47%), Positives = 47/93 (50%), Gaps = 6/93 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGG----GYGGGGGYGGGRGGGGY--G 237
           G  G    G    GGG  G    GGG  GGG+ GGG    G  GGG  GGG  GGG   G
Sbjct: 199 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 258

Query: 236 GSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           G+ GG+GG G GGG G GGG GG        GH
Sbjct: 259 GTSGGHGGHG-GGGHGDGGGNGGGNGVGNGGGH 290

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 42/89 (47%), Positives = 43/89 (48%), Gaps = 2/89 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG--SGG 225
           G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GG  GGG  GG  SGG
Sbjct: 184 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 243

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           G  GGG  GG   GGG  G     G  GH
Sbjct: 244 GTSGGGTSGGGTSGGGTSGGHGGHGGGGH 272

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 47/98 (47%), Positives = 49/98 (50%), Gaps = 12/98 (12%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGG----GYGGGGSYG----GGGYGGGGGYGGGRGGGG 243
           G +G    GT  G GG G    GGG    G  GGG+ G    GGG  GGG  GGG  GGG
Sbjct: 120 GMNGTGSGGTASGNGGKGDGSSGGGTSGNGASGGGTSGSGTSGGGTSGGGTSGGGTSGGG 179

Query: 242 YGG---SGGGYGGGGR-GGGRGGGGGGGGSCYSCGESG 141
             G   SGGG  GGG  GGG  GGG  GG     G SG
Sbjct: 180 TSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 217

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 41/88 (46%), Positives = 43/88 (48%), Gaps = 2/88 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG--SGG 225
           G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GG  GGG  GG  SGG
Sbjct: 189 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 248

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G  GGG  GG   GG GG      G+ G
Sbjct: 249 GTSGGGTSGGGTSGGHGGHGGGGHGDGG 276

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 45/106 (42%), Positives = 47/106 (44%), Gaps = 7/106 (6%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGG----GGGGYERGGGGYGGGGSYGG---GGYGG 279
           S  +G S      GP G +       GG    G GG   G GG G G S GG    G  G
Sbjct: 93  SPGNGGSGGSGAVGPAGVSGSTGSTSGGMNGTGSGGTASGNGGKGDGSSGGGTSGNGASG 152

Query: 278 GGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG  G G  GGG  G GG  GGG  GGG  GGG  GG     G SG
Sbjct: 153 GGTSGSGTSGGGTSG-GGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 197

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 37/90 (41%), Positives = 39/90 (43%), Gaps = 9/90 (10%)
 Frame = -3

Query: 383 NVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYG------GGRGGGGYGGSGGG 222
           +V   R   G G G   GGG  G GGS G G  G  G  G      GG  G G GG+  G
Sbjct: 73  HVYAGRGAAGSGAGNTTGGGSPGNGGSGGSGAVGPAGVSGSTGSTSGGMNGTGSGGTASG 132

Query: 221 YGG---GGRGGGRGGGGGGGGSCYSCGESG 141
            GG   G  GGG  G G  GG     G SG
Sbjct: 133 NGGKGDGSSGGGTSGNGASGGGTSGSGTSG 162

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 35/85 (41%), Positives = 36/85 (42%), Gaps = 2/85 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG--GGYGGSGG 225
           G  G+    T  GG  G G   G G  G  G  G  G   GG  G G GG   G GG G 
Sbjct: 79  GAAGSGAGNTTGGGSPGNGGSGGSGAVGPAGVSGSTGSTSGGMNGTGSGGTASGNGGKGD 138

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCG 150
           G  GGG  G    GGG  GS  S G
Sbjct: 139 GSSGGGTSGNGASGGGTSGSGTSGG 163

[158][TOP]
>UniRef100_A5GPV8 RNA-binding protein, RRM domain n=1 Tax=Synechococcus sp. RCC307
           RepID=A5GPV8_SYNR3
          Length = 204

 Score =  107 bits (266), Expect = 5e-22
 Identities = 57/87 (65%), Positives = 59/87 (67%), Gaps = 2/87 (2%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGG--GGSYGGGGYGGGGGYGGGRG 252
           GR   +N   P G+      RGGGGGGGY  GGGG GG  GG  G GGYGGGGG G G G
Sbjct: 69  GRPLRINKAEPRGS------RGGGGGGGYGGGGGGRGGYGGGGGGRGGYGGGGG-GYGGG 121

Query: 251 GGGYGGSGGGYGGGGRGGGRGGGGGGG 171
           GGGYGG GGGYGGG  GGG GGGGGGG
Sbjct: 122 GGGYGGGGGGYGGG--GGGYGGGGGGG 146

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 48/67 (71%), Positives = 48/67 (71%), Gaps = 2/67 (2%)
 Frame = -3

Query: 335 RGGGGYGGGGSYGGGGYGGGGGYGGGRGG-GGYGGSGGGYGGGGRG-GGRGGGGGGGGSC 162
           RG  G GGGG YGGGG GG GGYGGG GG GGYGG GGGYGGGG G GG GGG GGGG  
Sbjct: 80  RGSRGGGGGGGYGGGG-GGRGGYGGGGGGRGGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 138

Query: 161 YSCGESG 141
           Y  G  G
Sbjct: 139 YGGGGGG 145

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 56/114 (49%), Positives = 57/114 (50%), Gaps = 28/114 (24%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG- 222
           G  G    G   GGGG GGY  GGGGYGG    GGGGYGGGGG G G GGGGYGG GGG 
Sbjct: 92  GGGGGGRGGYGGGGGGRGGYGGGGGGYGG----GGGGYGGGGG-GYGGGGGGYGGGGGGG 146

Query: 221 -------------YGGGGRGG--------------GRGGGGGGGGSCYSCGESG 141
                        YGGGG GG               RGGGGGG  S    G+ G
Sbjct: 147 ERASGARGWEDRSYGGGGGGGEPSRDSFDEGRSRRRRGGGGGGESSGGDWGDYG 200

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/108 (45%), Positives = 49/108 (45%), Gaps = 34/108 (31%)
 Frame = -3

Query: 398 GPDGANVQGTRRGG--GGGGGYERGGGGYGGGGSY---GGGGYGGGGG------------ 270
           G  G    G  RGG  GGGGGY  GGGGYGGGG     GGGGYGGGGG            
Sbjct: 97  GRGGYGGGGGGRGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGGERASGARGWE 156

Query: 269 ---YGGGRGGGG--------------YGGSGGGYGGGGRGGGRGGGGG 177
              YGGG GGG                GG GGG   GG  G  GG  G
Sbjct: 157 DRSYGGGGGGGEPSRDSFDEGRSRRRRGGGGGGESSGGDWGDYGGAEG 204

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 34/54 (62%), Positives = 35/54 (64%)
 Frame = -3

Query: 299 GGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           G  G GGGGGYGGG  GGG GG GGG GG G  GG GGG GGGG  Y  G  G+
Sbjct: 81  GSRGGGGGGGYGGG--GGGRGGYGGGGGGRGGYGGGGGGYGGGGGGYGGGGGGY 132

[159][TOP]
>UniRef100_A9SKS2 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SKS2_PHYPA
          Length = 250

 Score =  107 bits (266), Expect = 5e-22
 Identities = 53/83 (63%), Positives = 56/83 (67%)
 Frame = -3

Query: 383 NVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGR 204
           ++QG    GGGGGG   GGG  GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG 
Sbjct: 77  SIQGRMLAGGGGGG---GGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 133

Query: 203 GGGRGGGGGGGGSCYSCGESGHF 135
           GGG GGGGGGGG     G  G +
Sbjct: 134 GGGGGGGGGGGGDRNRGGGRGPY 156

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 56/100 (56%), Positives = 56/100 (56%), Gaps = 26/100 (26%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G  RGGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 86  GGGGGGGGRGGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 142

Query: 209 G-----RGGGRG---------------------GGGGGGG 168
           G     RGGGRG                     GGGGGGG
Sbjct: 143 GGGDRNRGGGRGPYRPPWNPPRDDRGRGRGRDRGGGGGGG 182

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 55/107 (51%), Positives = 55/107 (51%), Gaps = 21/107 (19%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           GR  A    G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGG
Sbjct: 80  GRMLAGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 139

Query: 245 GYGGSGGGYGGGGRG---------------------GGRGGGGGGGG 168
           G GG G    GGGRG                     GG GGGGGGGG
Sbjct: 140 GGGGGGDRNRGGGRGPYRPPWNPPRDDRGRGRGRDRGGGGGGGGGGG 186

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 54/125 (43%), Positives = 54/125 (43%), Gaps = 48/125 (38%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGG----------------------- 288
           G  G    G   GGGGGGG   GGGG GGGG  GGGG                       
Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDRNRGGGRGPYRPPWNPPRDDRG 168

Query: 287 ------YGGGGGYGGGRGG----------GGYGGSGGGYGGG---------GRGGGRGGG 183
                  GGGGG GGG GG          GG GG GGG GGG         G GGG GGG
Sbjct: 169 RGRGRDRGGGGGGGGGGGGNNNGGRNNPPGGGGGGGGGGGGGICIGWCPGAGAGGGGGGG 228

Query: 182 GGGGG 168
           GGGGG
Sbjct: 229 GGGGG 233

[160][TOP]
>UniRef100_B9QIA3 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii VEG
           RepID=B9QIA3_TOXGO
          Length = 481

 Score =  107 bits (266), Expect = 5e-22
 Identities = 57/92 (61%), Positives = 57/92 (61%), Gaps = 6/92 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSY---GGGGYGGGGGYGGGRGGGGYGGSG 228
           GP      G    GGGGGGY  GGGGYGGGG     GGGGYG GGG G G GGGGYG  G
Sbjct: 53  GPQSDRGYGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGAGGG-GYGAGGGGYGAGG 111

Query: 227 GGYGGGGRGGGRGGGG---GGGGSCYSCGESG 141
           GGYG GG GGG G GG   GG GS Y  G SG
Sbjct: 112 GGYGAGGGGGGYGAGGGNSGGYGSGYGGGRSG 143

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 48/78 (61%), Positives = 48/78 (61%), Gaps = 5/78 (6%)
 Frame = -3

Query: 359 GGGGGGYERGGG----GYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGR 192
           GG G G   GG     GYGGGG  GGGG  GGGG G G GGGGYGG GGGYG GG G G 
Sbjct: 43  GGYGPGSSSGGPQSDRGYGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGAGGGGYGA 102

Query: 191 GGGG-GGGGSCYSCGESG 141
           GGGG G GG  Y  G  G
Sbjct: 103 GGGGYGAGGGGYGAGGGG 120

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/81 (62%), Positives = 51/81 (62%), Gaps = 10/81 (12%)
 Frame = -3

Query: 362 GGGGGG-----GYERGGGGYGGGGS-YGGGGYG-GGGGYGGGRGGGGYGGSGGGYGGGGR 204
           G   GG     GY  GGGGYGGGG  YGGGG G GGGG G G GGGGYG  GGGYG GG 
Sbjct: 48  GSSSGGPQSDRGY--GGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGAGGGGYGAGGG 105

Query: 203 GGGRGGGG---GGGGSCYSCG 150
           G G GGGG   GGGG  Y  G
Sbjct: 106 GYGAGGGGYGAGGGGGGYGAG 126

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 47/75 (62%), Positives = 48/75 (64%), Gaps = 10/75 (13%)
 Frame = -3

Query: 326 GGYGGGGS---------YGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG-G 177
           GGYG G S         YGGGGYGGGGG G G GGGGYGG GGGYGGGG G G GGGG G
Sbjct: 43  GGYGPGSSSGGPQSDRGYGGGGYGGGGG-GYGGGGGGYGGGGGGYGGGGGGYGAGGGGYG 101

Query: 176 GGGSCYSCGESGHFA 132
            GG  Y  G  G+ A
Sbjct: 102 AGGGGYGAGGGGYGA 116

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 51/89 (57%), Positives = 51/89 (57%), Gaps = 25/89 (28%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYG-GGGSYG--GGGYG-GGGGYGGGRGGGGYGGSGG-------GYGG 213
           GGGGGGY  GGGGYG GGG YG  GGGYG GGGGYG G GGGGYG  GG       GYGG
Sbjct: 80  GGGGGGYGGGGGGYGAGGGGYGAGGGGYGAGGGGYGAGGGGGGYGAGGGNSGGYGSGYGG 139

Query: 212 G--------------GRGGGRGGGGGGGG 168
           G              G GG  GGG G  G
Sbjct: 140 GRSGREKHRSRSRSPGGGGAAGGGKGARG 168

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/81 (59%), Positives = 49/81 (60%), Gaps = 16/81 (19%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYG-GGGSYG--GGGYGGGGGYGGG--RGGGGYGGSGGGYGGGGRG-- 201
           GGGGGGY  GGGGYG GGG YG  GGGYG GGG GGG   GGG  GG G GYGGG  G  
Sbjct: 87  GGGGGGYGAGGGGYGAGGGGYGAGGGGYGAGGG-GGGYGAGGGNSGGYGSGYGGGRSGRE 145

Query: 200 ---------GGRGGGGGGGGS 165
                    GG G  GGG G+
Sbjct: 146 KHRSRSRSPGGGGAAGGGKGA 166

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/72 (55%), Positives = 41/72 (56%), Gaps = 11/72 (15%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY-----------GG 213
           G GGGGY  GGGGYG GG  GGGGYG GGG  GG  G GYGG   G            GG
Sbjct: 101 GAGGGGYGAGGGGYGAGG--GGGGYGAGGGNSGGY-GSGYGGGRSGREKHRSRSRSPGGG 157

Query: 212 GGRGGGRGGGGG 177
           G  GGG+G  GG
Sbjct: 158 GAAGGGKGARGG 169

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 45/89 (50%), Positives = 48/89 (53%), Gaps = 16/89 (17%)
 Frame = -3

Query: 350 GGGYERGGGG------YGGGGSYGG---GGYGGGGGYGG-----GRGGGGYGGSGGGYGG 213
           GGG +R   G      + G   Y G   GGYG G   GG     G GGGGYGG GGGYGG
Sbjct: 15  GGGRDRDARGPRSRDSFRGDREYRGDYYGGYGPGSSSGGPQSDRGYGGGGYGGGGGGYGG 74

Query: 212 GGRG--GGRGGGGGGGGSCYSCGESGHFA 132
           GG G  GG GG GGGGG  Y  G  G+ A
Sbjct: 75  GGGGYGGGGGGYGGGGGG-YGAGGGGYGA 102

[161][TOP]
>UniRef100_B9PV72 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1
           RepID=B9PV72_TOXGO
          Length = 488

 Score =  107 bits (266), Expect = 5e-22
 Identities = 59/98 (60%), Positives = 59/98 (60%), Gaps = 12/98 (12%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGY-GGGGSYGGGG---YGGGGGYGG-----GRGGG 246
           GP      G    GGGGGGY  GGGGY GGGG YGGGG    GGGGGYG      G GGG
Sbjct: 53  GPQSDRGYGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGAGGGGYGAGGG 112

Query: 245 GYGGSGGGYGGGGRGGGRGGGG---GGGGSCYSCGESG 141
           GYG  GGGYG GG GGG G GG   GG GS Y  G SG
Sbjct: 113 GYGAGGGGYGAGGGGGGYGAGGGNSGGYGSGYGGGRSG 150

 Score =  103 bits (256), Expect = 8e-21
 Identities = 56/101 (55%), Positives = 59/101 (58%), Gaps = 6/101 (5%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGG---SYGGGGYGGGGGYG 264
           D + R       GP  ++       G GGGGY  GGGGYGGGG     GGGGYGGGGG G
Sbjct: 34  DREYRGDYYGGYGPGSSSGGPQSDRGYGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGG-G 92

Query: 263 GGRGGGGYGGSGGGYGGGGRGGGRGGGG---GGGGSCYSCG 150
            G GGGGYG  GGGYG GG G G GGGG   GGGG  Y  G
Sbjct: 93  YGGGGGGYGAGGGGYGAGGGGYGAGGGGYGAGGGGGGYGAG 133

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/82 (63%), Positives = 53/82 (64%), Gaps = 6/82 (7%)
 Frame = -3

Query: 359 GGGGGGYERGGG----GYGGGG-SYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGG 195
           GG G G   GG     GYGGGG   GGGGYGGGGG G G GGGGYGG GGGYGGGG G G
Sbjct: 43  GGYGPGSSSGGPQSDRGYGGGGYGGGGGGYGGGGG-GYGGGGGGYGGGGGGYGGGGGGYG 101

Query: 194 RGGGG-GGGGSCYSCGESGHFA 132
            GGGG G GG  Y  G  G+ A
Sbjct: 102 AGGGGYGAGGGGYGAGGGGYGA 123

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 52/82 (63%), Positives = 52/82 (63%), Gaps = 8/82 (9%)
 Frame = -3

Query: 362 GGGGGG-----GYERGGGGYGGGGS-YGGGGYG-GGGGYGGGRGGGGYGGSGGGYGGGGR 204
           G   GG     GY  GGGGYGGGG  YGGGG G GGGG G G GGGGYGG GGGYG GG 
Sbjct: 48  GSSSGGPQSDRGY--GGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGAGGG 105

Query: 203 GGGRGGGG-GGGGSCYSCGESG 141
           G G GGGG G GG  Y  G  G
Sbjct: 106 GYGAGGGGYGAGGGGYGAGGGG 127

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 51/89 (57%), Positives = 51/89 (57%), Gaps = 25/89 (28%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYG-GGGSYG--GGGYG-GGGGYGGGRGGGGYGGSGG-------GYGG 213
           GGGGGGY  GGGGYG GGG YG  GGGYG GGGGYG G GGGGYG  GG       GYGG
Sbjct: 87  GGGGGGYGGGGGGYGAGGGGYGAGGGGYGAGGGGYGAGGGGGGYGAGGGNSGGYGSGYGG 146

Query: 212 G--------------GRGGGRGGGGGGGG 168
           G              G GG  GGG G  G
Sbjct: 147 GRSGREKHRSRSRSPGGGGAAGGGKGARG 175

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/81 (59%), Positives = 49/81 (60%), Gaps = 16/81 (19%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYG-GGGSYG--GGGYGGGGGYGGG--RGGGGYGGSGGGYGGGGRG-- 201
           GGGGGGY  GGGGYG GGG YG  GGGYG GGG GGG   GGG  GG G GYGGG  G  
Sbjct: 94  GGGGGGYGAGGGGYGAGGGGYGAGGGGYGAGGG-GGGYGAGGGNSGGYGSGYGGGRSGRE 152

Query: 200 ---------GGRGGGGGGGGS 165
                    GG G  GGG G+
Sbjct: 153 KHRSRSRSPGGGGAAGGGKGA 173

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/72 (55%), Positives = 41/72 (56%), Gaps = 11/72 (15%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY-----------GG 213
           G GGGGY  GGGGYG GG  GGGGYG GGG  GG  G GYGG   G            GG
Sbjct: 108 GAGGGGYGAGGGGYGAGG--GGGGYGAGGGNSGGY-GSGYGGGRSGREKHRSRSRSPGGG 164

Query: 212 GGRGGGRGGGGG 177
           G  GGG+G  GG
Sbjct: 165 GAAGGGKGARGG 176

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 45/90 (50%), Positives = 48/90 (53%), Gaps = 17/90 (18%)
 Frame = -3

Query: 350 GGGYERGGGG------YGGGGSYGG---GGYGGGGGYGG-----GRGGGGYGGSGGGYGG 213
           GGG +R   G      + G   Y G   GGYG G   GG     G GGGGYGG GGGYGG
Sbjct: 15  GGGRDRDARGPRSRDSFRGDREYRGDYYGGYGPGSSSGGPQSDRGYGGGGYGGGGGGYGG 74

Query: 212 GGRGGGRGGGG---GGGGSCYSCGESGHFA 132
           GG  GG GGGG   GGGG  Y  G  G+ A
Sbjct: 75  GG--GGYGGGGGGYGGGGGGYGGGGGGYGA 102

[162][TOP]
>UniRef100_B7PK11 Glycine-rich RNA-binding protein, putative (Fragment) n=1
           Tax=Ixodes scapularis RepID=B7PK11_IXOSC
          Length = 68

 Score =  107 bits (266), Expect = 5e-22
 Identities = 50/65 (76%), Positives = 50/65 (76%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG 180
           GGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 179 GGGGS 165
           GGG S
Sbjct: 61  GGGDS 65

 Score =  105 bits (263), Expect = 1e-21
 Identities = 49/63 (77%), Positives = 49/63 (77%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 182 GGG 174
           GGG
Sbjct: 61  GGG 63

 Score =  103 bits (258), Expect = 5e-21
 Identities = 49/66 (74%), Positives = 49/66 (74%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGG
Sbjct: 3   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 62

Query: 182 GGGGGS 165
           G   GS
Sbjct: 63  GDSEGS 68

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 45/63 (71%), Positives = 45/63 (71%)
 Frame = -3

Query: 329 GGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCG 150
           GGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     G
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 149 ESG 141
             G
Sbjct: 61  GGG 63

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 44/67 (65%), Positives = 44/67 (65%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG GGG
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 209 GRGGGRG 189
           G G   G
Sbjct: 61  GGGDSEG 67

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 43/67 (64%), Positives = 43/67 (64%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GGG 
Sbjct: 1   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60

Query: 218 GGGGRGG 198
           GGG   G
Sbjct: 61  GGGDSEG 67

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 35/56 (62%), Positives = 35/56 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGS 231
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGG   GS
Sbjct: 13  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDSEGS 68

[163][TOP]
>UniRef100_B6KPI0 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii ME49
           RepID=B6KPI0_TOXGO
          Length = 538

 Score =  107 bits (266), Expect = 5e-22
 Identities = 57/92 (61%), Positives = 57/92 (61%), Gaps = 6/92 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSY---GGGGYGGGGGYGGGRGGGGYGGSG 228
           GP      G    GGGGGGY  GGGGYGGGG     GGGGYG GGG G G GGGGYG  G
Sbjct: 110 GPQSDRGYGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGAGGG-GYGAGGGGYGAGG 168

Query: 227 GGYGGGGRGGGRGGGG---GGGGSCYSCGESG 141
           GGYG GG GGG G GG   GG GS Y  G SG
Sbjct: 169 GGYGAGGGGGGYGAGGGNSGGYGSGYGGGRSG 200

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 48/78 (61%), Positives = 48/78 (61%), Gaps = 5/78 (6%)
 Frame = -3

Query: 359 GGGGGGYERGGG----GYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGR 192
           GG G G   GG     GYGGGG  GGGG  GGGG G G GGGGYGG GGGYG GG G G 
Sbjct: 100 GGYGPGSSSGGPQSDRGYGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGAGGGGYGA 159

Query: 191 GGGG-GGGGSCYSCGESG 141
           GGGG G GG  Y  G  G
Sbjct: 160 GGGGYGAGGGGYGAGGGG 177

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/81 (62%), Positives = 51/81 (62%), Gaps = 10/81 (12%)
 Frame = -3

Query: 362 GGGGGG-----GYERGGGGYGGGGS-YGGGGYG-GGGGYGGGRGGGGYGGSGGGYGGGGR 204
           G   GG     GY  GGGGYGGGG  YGGGG G GGGG G G GGGGYG  GGGYG GG 
Sbjct: 105 GSSSGGPQSDRGY--GGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGAGGGGYGAGGG 162

Query: 203 GGGRGGGG---GGGGSCYSCG 150
           G G GGGG   GGGG  Y  G
Sbjct: 163 GYGAGGGGYGAGGGGGGYGAG 183

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 47/75 (62%), Positives = 48/75 (64%), Gaps = 10/75 (13%)
 Frame = -3

Query: 326 GGYGGGGS---------YGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG-G 177
           GGYG G S         YGGGGYGGGGG G G GGGGYGG GGGYGGGG G G GGGG G
Sbjct: 100 GGYGPGSSSGGPQSDRGYGGGGYGGGGG-GYGGGGGGYGGGGGGYGGGGGGYGAGGGGYG 158

Query: 176 GGGSCYSCGESGHFA 132
            GG  Y  G  G+ A
Sbjct: 159 AGGGGYGAGGGGYGA 173

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 51/89 (57%), Positives = 51/89 (57%), Gaps = 25/89 (28%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYG-GGGSYG--GGGYG-GGGGYGGGRGGGGYGGSGG-------GYGG 213
           GGGGGGY  GGGGYG GGG YG  GGGYG GGGGYG G GGGGYG  GG       GYGG
Sbjct: 137 GGGGGGYGGGGGGYGAGGGGYGAGGGGYGAGGGGYGAGGGGGGYGAGGGNSGGYGSGYGG 196

Query: 212 G--------------GRGGGRGGGGGGGG 168
           G              G GG  GGG G  G
Sbjct: 197 GRSGREKHRSRSRSPGGGGAAGGGKGARG 225

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/81 (59%), Positives = 49/81 (60%), Gaps = 16/81 (19%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYG-GGGSYG--GGGYGGGGGYGGG--RGGGGYGGSGGGYGGGGRG-- 201
           GGGGGGY  GGGGYG GGG YG  GGGYG GGG GGG   GGG  GG G GYGGG  G  
Sbjct: 144 GGGGGGYGAGGGGYGAGGGGYGAGGGGYGAGGG-GGGYGAGGGNSGGYGSGYGGGRSGRE 202

Query: 200 ---------GGRGGGGGGGGS 165
                    GG G  GGG G+
Sbjct: 203 KHRSRSRSPGGGGAAGGGKGA 223

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/72 (55%), Positives = 41/72 (56%), Gaps = 11/72 (15%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY-----------GG 213
           G GGGGY  GGGGYG GG  GGGGYG GGG  GG  G GYGG   G            GG
Sbjct: 158 GAGGGGYGAGGGGYGAGG--GGGGYGAGGGNSGGY-GSGYGGGRSGREKHRSRSRSPGGG 214

Query: 212 GGRGGGRGGGGG 177
           G  GGG+G  GG
Sbjct: 215 GAAGGGKGARGG 226

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 51/115 (44%), Positives = 56/115 (48%), Gaps = 16/115 (13%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGG------YGGGGSYGG---GGYGGG 276
           DGR    +   P   +  G  R    GGG +R   G      + G   Y G   GGYG G
Sbjct: 48  DGREPYSSRGMPPNGDRYG--RDAWRGGGRDRDARGPRSRDSFRGDREYRGDYYGGYGPG 105

Query: 275 GGYGG-----GRGGGGYGGSGGGYGGGGRG--GGRGGGGGGGGSCYSCGESGHFA 132
              GG     G GGGGYGG GGGYGGGG G  GG GG GGGGG  Y  G  G+ A
Sbjct: 106 SSSGGPQSDRGYGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGG-YGAGGGGYGA 159

[164][TOP]
>UniRef100_Q01AC1 Meltrins, fertilins and related Zn-dependent metalloproteinases of
           the ADAMs family (ISS) n=1 Tax=Ostreococcus tauri
           RepID=Q01AC1_OSTTA
          Length = 872

 Score =  106 bits (265), Expect = 7e-22
 Identities = 55/121 (45%), Positives = 58/121 (47%), Gaps = 26/121 (21%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLP-----------PYPPPPRPPP*PPPPPY 288
           P +P +   PP P PPP PPP PPPP PPP P           P PP P PPP PPPPP 
Sbjct: 493 PTAPPVSSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPS 552

Query: 289 P---------------PPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDR 423
           P               PPP  PPPP PPPP S PP PPPP   P    P  PV +     
Sbjct: 553 PPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPPVVVVPSSP 612

Query: 424 P 426
           P
Sbjct: 613 P 613

 Score =  100 bits (250), Expect = 4e-20
 Identities = 48/83 (57%), Positives = 51/83 (61%), Gaps = 5/83 (6%)
 Frame = +1

Query: 169 PPPPPPPPRPPP----RPPPP*PP-PLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPP 333
           PP PPPPP PPP    RPP P PP P PP PPPP PPP P PPP PPPP  PPPP PPPP
Sbjct: 544 PPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPP 603

Query: 334 RS*PPPPPPPRLVP*TLAPSGPV 402
                P  PP ++   + P  PV
Sbjct: 604 PVVVVPSSPPPVLVNDMYPPPPV 626

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 39/68 (57%), Positives = 39/68 (57%), Gaps = 4/68 (5%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYPPP----PRPPP*PPPPPYPPPP*LPPPP*PPPPRS 339
           P    P  PP   PPP P P PP PPP    P PPP PPP P PP P  PPPP P PP S
Sbjct: 488 PSSELPTAPPVSSPPPSPSP-PPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPS 546

Query: 340 *PPPPPPP 363
            PPPP PP
Sbjct: 547 PPPPPSPP 554

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 38/70 (54%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +1

Query: 127 SLAK*PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*P-PPPPYPPPP* 303
           S A+ P  P     PP PPPP  PPP  PPP PPP PP PPPP PPP P    P  PPP 
Sbjct: 557 SAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPP-PPSPPPPSPPPPPVVVVPSSPPPV 615

Query: 304 LPPPP*PPPP 333
           L     PPPP
Sbjct: 616 LVNDMYPPPP 625

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 35/76 (46%), Positives = 37/76 (48%)
 Frame = +1

Query: 202 PRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*T 381
           P    P  PP+   PP P PPP PPP P PP P   PPP PPPP    PPPP P   P  
Sbjct: 488 PSSELPTAPPVSSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSP 547

Query: 382 LAPSGPVTLTALDRPS 429
             P  P   +A   PS
Sbjct: 548 PPPPSPPPGSAARPPS 563

[165][TOP]
>UniRef100_UPI0000DA45DC PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA45DC
          Length = 92

 Score =  106 bits (265), Expect = 7e-22
 Identities = 56/85 (65%), Positives = 60/85 (70%)
 Frame = -3

Query: 419 SKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGY 240
           SK +++ G +      T  GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG 
Sbjct: 10  SKPISI-GLESELSDSTACGGGGGGG---GGGGGGGGG--GGGGGGGGGGGGGGGGGGGG 63

Query: 239 GGSGGGYGGGGRGGGRGGGGGGGGS 165
           GG GGG GGGG GGG GGGGGGGGS
Sbjct: 64  GGGGGGGGGGGGGGGGGGGGGGGGS 88

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 43/62 (69%), Positives = 44/62 (70%)
 Frame = -3

Query: 317 GGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     G  G 
Sbjct: 29  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGS 88

Query: 137 FA 132
           F+
Sbjct: 89  FS 90

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 42/59 (71%), Positives = 42/59 (71%)
 Frame = -3

Query: 317 GGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGG  GGGG GGGGG GGG GGGG GG GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 28  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 38/60 (63%), Positives = 39/60 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GGGGG GGG GGGG GG GG +
Sbjct: 30  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSF 89

[166][TOP]
>UniRef100_A2BZB6 RNA-binding region RNP-1 (RNA recognition motif) n=1
           Tax=Prochlorococcus marinus str. NATL1A
           RepID=A2BZB6_PROM1
          Length = 250

 Score =  106 bits (265), Expect = 7e-22
 Identities = 63/109 (57%), Positives = 69/109 (63%), Gaps = 12/109 (11%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGG--GSYGG---GGYGGG--GGY 267
           GR   +N   P G+  +    GGGGGGGY  GGGGYGGG  G YGG   GGYGGG  GGY
Sbjct: 69  GRPLRINKAEPRGSAPRRGGYGGGGGGGY--GGGGYGGGGQGGYGGGGQGGYGGGGQGGY 126

Query: 266 GGGRGGGGYGGSG-GGYGGGGR----GGGRGGGGGGGGSCYSCGESGHF 135
           GGG G GGYGG G GGYGGGG+    GGG+GG GGGG   Y  G  G +
Sbjct: 127 GGG-GQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGY 174

 Score =  100 bits (248), Expect = 7e-20
 Identities = 59/96 (61%), Positives = 65/96 (67%), Gaps = 11/96 (11%)
 Frame = -3

Query: 362 GGGGGGGYERGG-GGYGGG--GSYGG---GGYGGG--GGYGGGRGGGGYGGSG-GGYGGG 210
           GGGG GGY  GG GGYGGG  G YGG   GGYGGG  GGYGGG G GGYGG G GGYGGG
Sbjct: 111 GGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGG-GQGGYGGGGQGGYGGG 169

Query: 209 GRG--GGRGGGGGGGGSCYSCGESGHFARDCPTSAR 108
           G+G  GG G GG GGG     G++   A+D P+ A+
Sbjct: 170 GQGGYGGGGQGGYGGGGYGGGGQADQSAQDRPSGAK 205

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 43/80 (53%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = -3

Query: 362 GGGGGGGYERGG-GGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGG 186
           GGGG GGY  GG GGYGGGG  GG G GG GGYGGG G GGYG  GGGYGGGG+      
Sbjct: 143 GGGGQGGYGGGGQGGYGGGGQ-GGYGGGGQGGYGGG-GQGGYG--GGGYGGGGQADQSAQ 198

Query: 185 GGGGGGSCYSCGESGHFARD 126
               G   +     G+ ++D
Sbjct: 199 DRPSGAKGWEDRSHGNASQD 218

[167][TOP]
>UniRef100_A4S5W2 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901
           RepID=A4S5W2_OSTLU
          Length = 722

 Score =  106 bits (265), Expect = 7e-22
 Identities = 54/92 (58%), Positives = 60/92 (65%), Gaps = 5/92 (5%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGG-----GGYGGGRGGGGYGG 234
           G  G N  G   GGGGGGG   GGGG GGGG+ G GG GGG     GG GGG  GGG GG
Sbjct: 101 GGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGG 160

Query: 233 SGGGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           +GGG GG G GGG GGGGGGGG+  + G+ G+
Sbjct: 161 TGGGTGGNGGGGGGGGGGGGGGTGGNGGDGGY 192

 Score =  104 bits (259), Expect = 3e-21
 Identities = 55/89 (61%), Positives = 55/89 (61%), Gaps = 3/89 (3%)
 Frame = -3

Query: 398 GPDGANVQGTR-RGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG--GYGGSG 228
           G DG    GT   GGGGGGG   GGGG GGGG  GGGG GG GG GGG GGG  G GG G
Sbjct: 94  GGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGG 153

Query: 227 GGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            G GGGG GGG GG GGGGG     G  G
Sbjct: 154 NGGGGGGTGGGTGGNGGGGGGGGGGGGGG 182

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 53/89 (59%), Positives = 55/89 (61%), Gaps = 2/89 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G DG    GT  G GG GG   G GG GGGG  GGGG GGGGG GGG GGGG GG+GGG 
Sbjct: 84  GGDG----GTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGG 139

Query: 218 G--GGGRGGGRGGGGGGGGSCYSCGESGH 138
           G  GGG GG  GGG GGGG     G  G+
Sbjct: 140 GGTGGGTGGNGGGGNGGGGGGTGGGTGGN 168

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 54/113 (47%), Positives = 62/113 (54%), Gaps = 14/113 (12%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGG-GSYGGGGYGGGGGYGGG 258
           + DG     +  G  G    G   GGG GGG+   GGG+GGG G +GGG  GG GG+GGG
Sbjct: 25  EGDGGHVGGHAVGGQGGGHGG--HGGGQGGGHGGHGGGHGGGHGGHGGGQGGGHGGHGGG 82

Query: 257 RGG-----GGYGGSGG--------GYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
            GG     GG+GG GG        G GGGG GGG GGGGGGGG     G  G+
Sbjct: 83  HGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGN 135

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 47/79 (59%), Positives = 51/79 (64%), Gaps = 5/79 (6%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG-----GGYGGSGGGYGGGGRGG 198
           GGG GGG+   GGG GGG    GGG+GG GG GGG GG     GG GG+GGG GGGG GG
Sbjct: 58  GGGHGGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGG 117

Query: 197 GRGGGGGGGGSCYSCGESG 141
           G GGGGGGG      G +G
Sbjct: 118 GGGGGGGGGTGGGGTGGNG 136

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 50/89 (56%), Positives = 53/89 (59%), Gaps = 2/89 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERG-GGGYGGGGSYGGG-GYGGGGGYGGGRGGGGYGGSGG 225
           G  G    G   G GGG G + G GGG+GG G  GGG G  GGGG GGG GGGG GG GG
Sbjct: 66  GGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGG 125

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           G GGGG GG  GGGGG GG     G  G+
Sbjct: 126 GTGGGGTGGNGGGGGGTGGGTGGNGGGGN 154

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 49/87 (56%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG-G 222
           G  G    G    GGG GG    GGG GG G  GGGG GGGGG GGG GG G GG+GG G
Sbjct: 77  GGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNG 136

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGGG GGG GG GGGG      G  G
Sbjct: 137 GGGGGTGGGTGGNGGGGNGGGGGGTGG 163

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 50/107 (46%), Positives = 57/107 (53%), Gaps = 13/107 (12%)
 Frame = -3

Query: 422 RSKAVNVTGPDGANVQGTRRGGGGGG---GYERGG--GGYGGGGSYGGGGYGG-GGGYGG 261
           R      T  +        RG G GG   G+  GG  GG+GG G   GGG+GG GGG+GG
Sbjct: 4   RGAVTAATTEEADRADDAARGEGDGGHVGGHAVGGQGGGHGGHGGGQGGGHGGHGGGHGG 63

Query: 260 GRG------GGGYGGSGGGYGG-GGRGGGRGGGGGGGGSCYSCGESG 141
           G G      GGG+GG GGG+GG GG GGG GG GG GG     G  G
Sbjct: 64  GHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGG 110

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 44/75 (58%), Positives = 45/75 (60%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    GT   GGGGGG   G GG GGGG+ GGGG G GGG GG  GGGG GG GGG 
Sbjct: 123 GGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGG-GTGGGTGGNGGGGGGGGGGGGG 181

Query: 218 GGGGRGGGRGGGGGG 174
           G GG GG  G   GG
Sbjct: 182 GTGGNGGDGGYPAGG 196

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 42/80 (52%), Positives = 42/80 (52%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           TG  G    G   GG GGG    GGGG GGGG   GGG GG GG GGG GGGG    GGG
Sbjct: 127 TGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGG----GGG 182

Query: 221 YGGGGRGGGRGGGGGGGGSC 162
            GG G  GG   GG     C
Sbjct: 183 TGGNGGDGGYPAGGDANNPC 202

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 42/92 (45%), Positives = 44/92 (47%), Gaps = 11/92 (11%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG-------GGYGGSGGGYGGGGR 204
           GG GG G + G GG GG GS GGGG  GG G  GG G        GG G +GGGY  GG 
Sbjct: 527 GGDGGDGGDGGEGGEGGDGSIGGGGGDGGDGGDGGDGTTGGDHPIGGDGTTGGGYPVGGD 586

Query: 203 GGGRG----GGGGGGGSCYSCGESGHFARDCP 120
           G   G    GG G  G  Y  G  G    D P
Sbjct: 587 GTTGGGYPVGGDGTTGGGYPVGGDGTTGGDHP 618

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 41/111 (36%), Positives = 45/111 (40%), Gaps = 27/111 (24%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERG---------------------------GGGYGGGGSY 300
           GP+G +  G   G    GG E G                           GG  GGGG+ 
Sbjct: 291 GPEGGDEGGDEEGLNPEGGDEEGPHCRPKFNLPEVNTGCEDALARVDGGDGGDGGGGGNG 350

Query: 299 GGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGE 147
           G GG GG GG GG  G GG GG G G  G   G G  GG GGG +   C E
Sbjct: 351 GEGGEGGEGGEGGEGGEGGEGGDGDGTTGHDGGDGGDGGDGGGDATNPCVE 401

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 39/88 (44%), Positives = 45/88 (51%), Gaps = 11/88 (12%)
 Frame = -3

Query: 371 TRRGGGGGGGYERGGGGYGGGGSYGGGGYGGG---GGYGGGRG------GGGYGGSGGGY 219
           TRRG       E            G GG+ GG   GG GGG G      GGG+GG GGG+
Sbjct: 2   TRRGAVTAATTEEADRADDAARGEGDGGHVGGHAVGGQGGGHGGHGGGQGGGHGGHGGGH 61

Query: 218 GG--GGRGGGRGGGGGGGGSCYSCGESG 141
           GG  GG GGG+GGG GG G  +  G+ G
Sbjct: 62  GGGHGGHGGGQGGGHGGHGGGHG-GDGG 88

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 33/62 (53%), Positives = 34/62 (54%)
 Frame = -3

Query: 323 GYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGES 144
           G G GG  GG   GG GG  GG GGG  GG GG   GGG GGG GG GGG G  +     
Sbjct: 24  GEGDGGHVGGHAVGGQGGGHGGHGGGQGGGHGGH--GGGHGGGHGGHGGGQGGGHGGHGG 81

Query: 143 GH 138
           GH
Sbjct: 82  GH 83

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 35/77 (45%), Positives = 37/77 (48%)
 Frame = -3

Query: 353 GGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGG 174
           GG G + GGGG GG G  G GG GG GG GG  G GG G    G+ GG  G G  GGG  
Sbjct: 338 GGDGGDGGGGGNGGEG--GEGGEGGEGGEGGEGGEGGDGDGTTGHDGGDGGDGGDGGGDA 395

Query: 173 GGSCYSCGESGHFARDC 123
              C      G  A  C
Sbjct: 396 TNPCVEVCREGTDADSC 412

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 38/78 (48%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY---GGGGRGGGR 192
           GG GG G + G GG GG G  G G  GGGGG GG  G GG G +GG +   G G  GGG 
Sbjct: 524 GGDGGDGGDGGDGGEGGEG--GDGSIGGGGGDGGDGGDGGDGTTGGDHPIGGDGTTGGGY 581

Query: 191 G-GGGGGGGSCYSCGESG 141
             GG G  G  Y  G  G
Sbjct: 582 PVGGDGTTGGGYPVGGDG 599

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 44/105 (41%), Positives = 48/105 (45%), Gaps = 19/105 (18%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGG--GGGGYERGGGGYGGGGSYG-----------GGGY--GGGGGYG 264
           G  G   +G   G G  GGGG + G GG GG G+ G           GGGY  GG G  G
Sbjct: 531 GDGGDGGEGGEGGDGSIGGGGGDGGDGGDGGDGTTGGDHPIGGDGTTGGGYPVGGDGTTG 590

Query: 263 GGRGGGGYGGSGGGYGGGGRGGGRG----GGGGGGGSCYSCGESG 141
           GG   GG G +GGGY  GG G   G    GG G  G  Y  G  G
Sbjct: 591 GGYPVGGDGTTGGGYPVGGDGTTGGDHPVGGDGTTGGGYPVGGDG 635

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 43/98 (43%), Positives = 46/98 (46%), Gaps = 12/98 (12%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGG--GGGYERGGGGYGGGG-SYGGGG-------YGG 279
           DG +   +  G DG    G   GG G  GGGY  GG G  GGG   GG G        GG
Sbjct: 562 DGTTGGDHPIGGDGTTGGGYPVGGDGTTGGGYPVGGDGTTGGGYPVGGDGTTGGDHPVGG 621

Query: 278 GGGYGGGRGGGGYGGSGGGY--GGGGRGGGRGGGGGGG 171
            G  GGG   GG G +GGGY  GG G  GG    GG G
Sbjct: 622 DGTTGGGYPVGGDGATGGGYPVGGDGTTGGGYPVGGDG 659

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 43/100 (43%), Positives = 44/100 (44%), Gaps = 14/100 (14%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGG--GGGYERGGGGYGGGG------SYGGGGY--GGGGGYGGGRGG 249
           G DG        GG G  GGGY  GG G  GGG         GGGY  GG G  GG    
Sbjct: 560 GGDGTTGGDHPIGGDGTTGGGYPVGGDGTTGGGYPVGGDGTTGGGYPVGGDGTTGGDHPV 619

Query: 248 GGYGGSGGGYGGGGRGGGRG----GGGGGGGSCYSCGESG 141
           GG G +GGGY  GG G   G    GG G  G  Y  G  G
Sbjct: 620 GGDGTTGGGYPVGGDGATGGGYPVGGDGTTGGGYPVGGDG 659

[168][TOP]
>UniRef100_Q8I519 Erythrocyte membrane protein 1, PfEMP1 n=1 Tax=Plasmodium
           falciparum 3D7 RepID=Q8I519_PLAF7
          Length = 2359

 Score =  106 bits (265), Expect = 7e-22
 Identities = 57/97 (58%), Positives = 58/97 (59%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRG 252
           +DG S      G  G    G   G GGGGG   GGG  GGGGS GGGG GGGGG GGG G
Sbjct: 584 SDGSSSVHVGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGG 643

Query: 251 GGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GG GGSGGG GG G GGG GGGGG GG   S G  G
Sbjct: 644 SGGGGGSGGG-GGSGGGGGSGGGGGSGGGGGSGGGGG 679

 Score =  104 bits (260), Expect = 3e-21
 Identities = 54/86 (62%), Positives = 54/86 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   G GGGGG   GGG  GGGGS GGGG GGGGG GGG G GG GGSGGG 
Sbjct: 607 GSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGG- 665

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG G GGG GGGGG GG   S G  G
Sbjct: 666 GGSGGGGGSGGGGGSGGGGGSGGGGG 691

 Score =  103 bits (258), Expect = 5e-21
 Identities = 54/88 (61%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG- 222
           G  G    G   G GGGGG   GGG  GGGGS GGGG GGGGG GGG G GG GGSGGG 
Sbjct: 601 GSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGG 660

Query: 221 -YGGGGRGGGRGGGGGGGGSCYSCGESG 141
             GGGG  GG GG GGGGGS    G  G
Sbjct: 661 GSGGGGGSGGGGGSGGGGGSGGGGGSGG 688

 Score =  102 bits (255), Expect = 1e-20
 Identities = 52/80 (65%), Positives = 52/80 (65%), Gaps = 2/80 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG- 222
           G  G    G   G GGGGG   GGG  GGGGS GGGG GGGGG GGG G GG GGSGGG 
Sbjct: 613 GSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGG 672

Query: 221 -YGGGGRGGGRGGGGGGGGS 165
             GGGG  GG GG GGGGGS
Sbjct: 673 GSGGGGGSGGGGGSGGGGGS 692

 Score =  100 bits (249), Expect = 5e-20
 Identities = 50/76 (65%), Positives = 50/76 (65%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   G GGGGG   GGG  GGGGS GGGG GGGGG GGG G GG GGSGGG 
Sbjct: 619 GSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGG- 677

Query: 218 GGGGRGGGRGGGGGGG 171
           GG G GGG GGGGG G
Sbjct: 678 GGSGGGGGSGGGGGSG 693

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 47/77 (61%), Positives = 48/77 (62%)
 Frame = -3

Query: 371 TRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGR 192
           T+    G      GGG  GGGGS GGGG GGGGG GGG G GG GGSGGG GG G GGG 
Sbjct: 580 TQNRSDGSSSVHVGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGG-GGSGGGGGS 638

Query: 191 GGGGGGGGSCYSCGESG 141
           GGGGG GG   S G  G
Sbjct: 639 GGGGGSGGGGGSGGGGG 655

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 43/71 (60%), Positives = 44/71 (61%), Gaps = 2/71 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG- 222
           G  G    G   G GGGGG   GGG  GGGGS GGGG GGGGG GGG G GG GGSGGG 
Sbjct: 625 GSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGG 684

Query: 221 -YGGGGRGGGR 192
             GGGG  G +
Sbjct: 685 GSGGGGGSGSK 695

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 32/56 (57%), Positives = 32/56 (57%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGS 231
           G  G    G   G GGGGG   GGG  GGGGS GGGG GGGGG GGG G G    S
Sbjct: 643 GSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGSKSDS 698

[169][TOP]
>UniRef100_A9J0E2 DEAD box helicase n=1 Tax=Macrostomum lignano RepID=A9J0E2_9TURB
          Length = 860

 Score =  106 bits (265), Expect = 7e-22
 Identities = 56/110 (50%), Positives = 64/110 (58%), Gaps = 15/110 (13%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYG--GGGSYG--GGGYGG----------GGGYGG 261
           G  GA+      GGGGG G   GGGG+G  GGG +G  GGG GG          GGG+G 
Sbjct: 203 GGFGAHADDGTEGGGGGFGSRGGGGGFGSRGGGGFGSRGGGRGGFGASADDGADGGGFGF 262

Query: 260 GRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGS-CYSCGESGHFARDCPTS 114
              GGG+G  GGG GG G     G GGGGGGS CY C +SGHFAR+CP +
Sbjct: 263 SSRGGGFGSRGGGRGGFGASADDGAGGGGGGSVCYKCNQSGHFARECPNA 312

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 57/143 (39%), Positives = 66/143 (46%), Gaps = 44/143 (30%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGG-------------GGGGGYERGGGGYGGGGSY- 300
           S +DG        G  G    G+RRGG             GGGGG+   G G GG G++ 
Sbjct: 56  SADDGAEGGRGGFGSRGDGGFGSRRGGRGGFGASADDGADGGGGGFGSRGVGRGGFGAHA 115

Query: 299 ------GGGGYG--GGGGY---GGGR-------------GGGGYGGSGGGYGGGGRGGGR 192
                 GGGG+G  GGGG+   GGGR             GGGG+G  GGG+  G RGGGR
Sbjct: 116 DDGTEGGGGGFGSRGGGGFCSRGGGRGGFGASADDGADGGGGGFGSRGGGF--GSRGGGR 173

Query: 191 GG------GGGGGGSCYSCGESG 141
           GG      GGGGG      GE G
Sbjct: 174 GGFGASADGGGGGFGSRGDGEFG 196

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 44/97 (45%), Positives = 50/97 (51%), Gaps = 13/97 (13%)
 Frame = -3

Query: 392 DGANVQGTRRGGGGGGGYERGGG--GYGGGGSYGGGGYG--GGGGYGGGRGG-GGYG--- 237
           DGA+  G   G  GGG   RGGG  G+G     GGGG+G  G G +G  RGG GG+G   
Sbjct: 150 DGADGGGGGFGSRGGGFGSRGGGRGGFGASADGGGGGFGSRGDGEFGSRRGGRGGFGAHA 209

Query: 236 -----GSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
                G GGG+G  G GGG G  GGGG      G  G
Sbjct: 210 DDGTEGGGGGFGSRGGGGGFGSRGGGGFGSRGGGRGG 246

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 51/112 (45%), Positives = 54/112 (48%), Gaps = 32/112 (28%)
 Frame = -3

Query: 374 GTRRGGGG-----GGGYERGGGGYGG-------GGSYGGGGYGG-GGGYG---GGRGGGG 243
           GT  GGGG     GGG+   GGG GG       G   GGGG+G  GGG+G   GGRGG G
Sbjct: 118 GTEGGGGGFGSRGGGGFCSRGGGRGGFGASADDGADGGGGGFGSRGGGFGSRGGGRGGFG 177

Query: 242 YGGSGGGYGGGGRG--------GGRGGGG--------GGGGSCYSCGESGHF 135
               GGG G G RG        GGRGG G        GGGG   S G  G F
Sbjct: 178 ASADGGGGGFGSRGDGEFGSRRGGRGGFGAHADDGTEGGGGGFGSRGGGGGF 229

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 48/111 (43%), Positives = 52/111 (46%), Gaps = 12/111 (10%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           G  + V  TG  G    G+R GG GG G     G  GG G +G  G GG G   GGRGG 
Sbjct: 29  GADRNVASTGRGGRF--GSRGGGRGGFGASADDGAEGGRGGFGSRGDGGFGSRRGGRGGF 86

Query: 245 GY----GGSGGGYGGGGRGGGRGGGG--------GGGGSCYSCGESGHFAR 129
           G     G  GGG G G RG GRGG G        GGGG   S G  G  +R
Sbjct: 87  GASADDGADGGGGGFGSRGVGRGGFGAHADDGTEGGGGGFGSRGGGGFCSR 137

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 40/89 (44%), Positives = 43/89 (48%), Gaps = 3/89 (3%)
 Frame = -3

Query: 383 NVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYG---GSGGGYGG 213
           NV  T RGG  G    RGGG  G G S   G  GG GG+G  RG GG+G   G  GG+G 
Sbjct: 33  NVASTGRGGRFGS---RGGGRGGFGASADDGAEGGRGGFGS-RGDGGFGSRRGGRGGFGA 88

Query: 212 GGRGGGRGGGGGGGGSCYSCGESGHFARD 126
               G  GGGGG G      G  G  A D
Sbjct: 89  SADDGADGGGGGFGSRGVGRGGFGAHADD 117

[170][TOP]
>UniRef100_B9S5R2 Actin binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9S5R2_RICCO
          Length = 210

 Score =  106 bits (264), Expect = 9e-22
 Identities = 56/102 (54%), Positives = 57/102 (55%), Gaps = 12/102 (11%)
 Frame = +1

Query: 163 QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*P---------PPPPYPPPP---*L 306
           Q PPPPPPP  PPP PPPP PPP PP PPP   PP P         PPPP PPPP     
Sbjct: 41  QPPPPPPPPSPPPPSPPPPSPPPPPPPPPPSPSPPPPTSPPSSLLSPPPPSPPPPASSSS 100

Query: 307 PPPP*PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRPSL 432
           PPPP PPPP S PP PPPP     T   S P+      RPSL
Sbjct: 101 PPPPPPPPPSSPPPSPPPPPTPSYTSNTSPPL------RPSL 136

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 46/96 (47%), Positives = 49/96 (51%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     P PPPP P PPP PPPP P P PP  PP      PPP P PP     PPP 
Sbjct: 45  PPPPPSPPPPSPPPPSPPPPPPPPPPSPSPPPPTSPPSSLLSPPPPSPPPPASSSSPPPP 104

Query: 322 PPPPRS*PPPPPPPRLVP*TLAPSGPVTLTALDRPS 429
           PPPP S PPP PPP   P   + + P    +L  PS
Sbjct: 105 PPPPPSSPPPSPPPPPTPSYTSNTSPPLRPSLRGPS 140

[171][TOP]
>UniRef100_UPI00015539BB PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI00015539BB
          Length = 123

 Score =  106 bits (264), Expect = 9e-22
 Identities = 58/95 (61%), Positives = 60/95 (63%), Gaps = 3/95 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G+   G   GGGG  G   GGGG GGGGS GGGG GGGGG GGG GGGG GGSGGG 
Sbjct: 14  GGGGSGGGGGDSGGGGCSGGGGGGGGGGGGGSGGGGGGGGGGGSGGGGGGGGGGGSGGGG 73

Query: 218 ---GGGGRGGGRGGGGGGGGSCYSCGESGHFARDC 123
              GG G GGG GGGGGGGG     G SG +  DC
Sbjct: 74  VGGGGDGGGGGGGGGGGGGGGGAGGGSSGGWG-DC 107

 Score =  103 bits (257), Expect = 6e-21
 Identities = 52/79 (65%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR-GGGGYGGSGG 225
           +G  G +  G   GGGGGGG   GGGG GGGGS GGGG GGGGG GGG  GGGG GG GG
Sbjct: 25  SGGGGCSGGGGGGGGGGGGGSGGGGGGGGGGGSGGGGGGGGGGGSGGGGVGGGGDGGGGG 84

Query: 224 GYGGGGRGGGRGGGGGGGG 168
           G GGGG GGG  GGG  GG
Sbjct: 85  GGGGGGGGGGGAGGGSSGG 103

 Score =  102 bits (255), Expect = 1e-20
 Identities = 53/81 (65%), Positives = 55/81 (67%), Gaps = 11/81 (13%)
 Frame = -3

Query: 377 QGTRRGGGGGGGYERGGGGY----------GGGGSYGGGGYGGGGGYGGGRGGGGYGGS- 231
           +G   GG GGGG + GGGG           GGGGS GGGG GGGGG GGG GGGG GGS 
Sbjct: 11  EGGGGGGSGGGGGDSGGGGCSGGGGGGGGGGGGGSGGGGGGGGGGGSGGGGGGGGGGGSG 70

Query: 230 GGGYGGGGRGGGRGGGGGGGG 168
           GGG GGGG GGG GGGGGGGG
Sbjct: 71  GGGVGGGGDGGGGGGGGGGGG 91

 Score =  100 bits (249), Expect = 5e-20
 Identities = 48/74 (64%), Positives = 50/74 (67%)
 Frame = -3

Query: 392 DGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGG 213
           +G   +  R GGGGGG    GGGG  GGG   GGG GGGGG GGG GGGG GG GGG GG
Sbjct: 2   EGKGKRPVREGGGGGGS--GGGGGDSGGGGCSGGGGGGGGGGGGGSGGGGGGGGGGGSGG 59

Query: 212 GGRGGGRGGGGGGG 171
           GG GGG GG GGGG
Sbjct: 60  GGGGGGGGGSGGGG 73

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 41/61 (67%), Positives = 41/61 (67%)
 Frame = -3

Query: 323 GYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGES 144
           G GGGGS GGGG  GGGG  GG GGGG GG GGG GGGG GGG GG GGGGG     G  
Sbjct: 12  GGGGGGSGGGGGDSGGGGCSGGGGGGG-GGGGGGSGGGGGGGGGGGSGGGGGGGGGGGSG 70

Query: 143 G 141
           G
Sbjct: 71  G 71

[172][TOP]
>UniRef100_Q9FNR1 Putative uncharacterized protein At5g61030 n=1 Tax=Arabidopsis
           thaliana RepID=Q9FNR1_ARATH
          Length = 309

 Score =  106 bits (264), Expect = 9e-22
 Identities = 62/112 (55%), Positives = 66/112 (58%), Gaps = 15/112 (13%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGG--GGYGGGGGYGGGR 255
           DGR     V   + AN + T  GG GGGGY  GGGGYGG G YGG  GGYGG GGYGGG 
Sbjct: 102 DGRDLHGRVVKVNYANDR-TSGGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGA 160

Query: 254 G------GGGYGG-SGGGYGGGGRGG------GRGGGGGGGGSCYSCGESGH 138
           G      GGGYGG + GGYGG G GG      G GG GGG GS    G SG+
Sbjct: 161 GGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSGGFGSSGN 212

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 45/88 (51%), Positives = 48/88 (54%), Gaps = 3/88 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGG-GGGGGYERGGGGYGG--GGSYGGGGYGGGGGYGGGRGGGGYGGSG 228
           G  G+   G   GG GG GGY  G GGYGG  GG YGG      GGYGG  G GGYGG  
Sbjct: 136 GYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGG---NAAGGYGGS-GAGGYGGDA 191

Query: 227 GGYGGGGRGGGRGGGGGGGGSCYSCGES 144
            G+GG G G G  GG G  G+ Y  G S
Sbjct: 192 TGHGGAGGGYGSSGGFGSSGNTYGEGSS 219

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 42/87 (48%), Positives = 46/87 (52%), Gaps = 2/87 (2%)
 Frame = -3

Query: 389 GANVQGTRRG-GGGGGGYE-RGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYG 216
           GA   G   G GGG GGY    GGGYGG  +   GGYGG G  G G    G+GG+GGGYG
Sbjct: 146 GAGGYGGSGGYGGGAGGYGGNSGGGYGGNAA---GGYGGSGAGGYGGDATGHGGAGGGYG 202

Query: 215 GGGRGGGRGGGGGGGGSCYSCGESGHF 135
             G G G  G   G GS  S G  G +
Sbjct: 203 SSG-GFGSSGNTYGEGSSASAGAVGDY 228

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 35/59 (59%), Positives = 38/59 (64%), Gaps = 5/59 (8%)
 Frame = -3

Query: 296 GGGYGGGGGYGGGRGG----GGYGGSGGGYGG-GGRGGGRGGGGGGGGSCYSCGESGHF 135
           GGG+GG GGYGGG GG    GGYGG  GGYGG GG GGG GG GG  G  Y    +G +
Sbjct: 122 GGGFGG-GGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGY 179

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 42/98 (42%), Positives = 45/98 (45%), Gaps = 10/98 (10%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGG----GYE-RGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGG 225
           GA   G   GGG GG    GY   G GGYGG  +   G  G GGGYG     GG+G SG 
Sbjct: 159 GAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDAT---GHGGAGGGYG---SSGGFGSSGN 212

Query: 224 GYGGGGRGG----GRGGGGGGGGSCYSCGES-GHFARD 126
            YG G        G   G  G GS  + G S G FA D
Sbjct: 213 TYGEGSSASAGAVGDYNGSSGYGSANTYGSSNGGFAGD 250

[173][TOP]
>UniRef100_B6VA25 Putative glycine-rich RNA-binding protein n=1 Tax=Chorispora
           bungeana RepID=B6VA25_CHOBU
          Length = 175

 Score =  106 bits (264), Expect = 9e-22
 Identities = 61/102 (59%), Positives = 62/102 (60%), Gaps = 13/102 (12%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGY-GGGGSYGGGG-------YGG 279
           D DGRS  VN     G+   G  RGGGGGG    GGGGY GGGGSYGGGG        GG
Sbjct: 73  DLDGRSITVNEAQSRGSGGGGGGRGGGGGGYRSGGGGGYGGGGGSYGGGGGRREGGYSGG 132

Query: 278 GGGY-GGGRGGGGYGGSG----GGYGGGGRGGGRGGGGGGGG 168
           GGGY   G GGGGYGG G    GGYGGG  GG  G GGGGGG
Sbjct: 133 GGGYPSRGGGGGGYGGGGGRREGGYGGGESGGYGGSGGGGGG 174

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 51/119 (42%), Positives = 57/119 (47%), Gaps = 21/119 (17%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR-- 255
           D +S    + G +G ++ G  R         RG GG       GGGG GGGGG  G R  
Sbjct: 58  DEKSMKDAIEGMNGQDLDG--RSITVNEAQSRGSGG-------GGGGRGGGGG--GYRSG 106

Query: 254 GGGGYGGSGGGYGGGG----------------RGGGRGGGGGGGG---SCYSCGESGHF 135
           GGGGYGG GG YGGGG                RGGG GG GGGGG     Y  GESG +
Sbjct: 107 GGGGYGGGGGSYGGGGGRREGGYSGGGGGYPSRGGGGGGYGGGGGRREGGYGGGESGGY 165

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 31/54 (57%), Positives = 33/54 (61%)
 Frame = -3

Query: 290 GYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGHFAR 129
           G GGGGG  GG GGG   G GGGYGGGG  G  GGGGG     YS G  G+ +R
Sbjct: 88  GSGGGGGGRGGGGGGYRSGGGGGYGGGG--GSYGGGGGRREGGYSGGGGGYPSR 139

[174][TOP]
>UniRef100_B4FFJ9 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4FFJ9_MAIZE
          Length = 234

 Score =  106 bits (264), Expect = 9e-22
 Identities = 61/102 (59%), Positives = 65/102 (63%), Gaps = 12/102 (11%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGP--DGANVQ----GTRRGGGGGGGYERGGGGYGGGGSYGGG----G 288
           S+N       N+ G   DG N+      +R GGGGGGGY   GGG GGGG YGGG    G
Sbjct: 133 SENSMLDAIENMNGKELDGRNITVNQAQSRGGGGGGGGY---GGGRGGGGGYGGGRRDGG 189

Query: 287 YGGGGGYGGGR--GGGGYGGSGGGYGGGGRGGGRGGGGGGGG 168
           YGGGGGYGG R  GGGGYGG GGGYGG   GGG G GGGGGG
Sbjct: 190 YGGGGGYGGRREGGGGGYGG-GGGYGGRREGGGGGYGGGGGG 230

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 50/84 (59%), Positives = 51/84 (60%), Gaps = 5/84 (5%)
 Frame = -3

Query: 428 DGRSKAVNVT----GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGG 261
           DGR+  VN      G  G    G  RGGGGG G  R  GGYGGGG YGG   GGGGGYGG
Sbjct: 150 DGRNITVNQAQSRGGGGGGGGYGGGRGGGGGYGGGRRDGGYGGGGGYGGRREGGGGGYGG 209

Query: 260 GRG-GGGYGGSGGGYGGGGRGGGR 192
           G G GG   G GGGYGGGG GG R
Sbjct: 210 GGGYGGRREGGGGGYGGGGGGGWR 233

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 38/57 (66%), Positives = 38/57 (66%), Gaps = 6/57 (10%)
 Frame = -3

Query: 293 GGYGGGGGYGGGR-GGGGYGGS--GGGYGGGGRGGGR---GGGGGGGGSCYSCGESG 141
           GG GGGGGYGGGR GGGGYGG    GGYGGGG  GGR   GGGG GGG  Y     G
Sbjct: 163 GGGGGGGGYGGGRGGGGGYGGGRRDGGYGGGGGYGGRREGGGGGYGGGGGYGGRREG 219

[175][TOP]
>UniRef100_B4JYE9 GH14280 n=1 Tax=Drosophila grimshawi RepID=B4JYE9_DROGR
          Length = 214

 Score =  106 bits (264), Expect = 9e-22
 Identities = 62/118 (52%), Positives = 62/118 (52%), Gaps = 31/118 (26%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGG---GGYGGGGSYGGGGYGGGGGYG------------ 264
           G  G    G   GG  GGGY  GG   GGY GGG YGGGGYGGGGGYG            
Sbjct: 31  GGGGYGGGGYSGGGYSGGGYSGGGYSGGGYSGGGGYGGGGYGGGGGYGGGGGVQVIKIID 90

Query: 263 GGRGGGGYGG--------SGGGYGGGG-------RGGGRGGGGG-GGGSCYSCGESGH 138
           GG GGGGYGG        SGGGY GGG        GGG GGGGG GGG  Y  G  GH
Sbjct: 91  GGHGGGGYGGGGYGGGGYSGGGYSGGGYSGGGYSGGGGYGGGGGYGGGGGYGGGHGGH 148

 Score =  102 bits (253), Expect = 2e-20
 Identities = 59/108 (54%), Positives = 64/108 (59%), Gaps = 21/108 (19%)
 Frame = -3

Query: 392 DGANVQGTRRGGG-GGGGYERGG---GGYGGGGSYGGGGYGGGGGYGGGRG-GGGYGG-- 234
           DG +  G   GGG GGGGY  GG   GGY GGG  GGGGYGGGGGYGGG G GGG+GG  
Sbjct: 90  DGGHGGGGYGGGGYGGGGYSGGGYSGGGYSGGGYSGGGGYGGGGGYGGGGGYGGGHGGHV 149

Query: 233 --------------SGGGYGGGGRGGGRGGGGGGGGSCYSCGESGHFA 132
                          GGGYGGGG GGG  GGGG GG  +  G SG ++
Sbjct: 150 QVYKVYTTTVHTGGGGGGYGGGGYGGGGYGGGGYGGGGHG-GYSGGYS 196

 Score =  100 bits (249), Expect = 5e-20
 Identities = 54/90 (60%), Positives = 56/90 (62%), Gaps = 18/90 (20%)
 Frame = -3

Query: 365 RGGGGGGGYERGG---GGYGGGG----SYGGGGYGGGGGYGGGR--GGGGYGGSG----- 228
           +GGGGGGGY  GG   GGY GGG     Y GGGY GGGGYGGG   GGGGYGG G     
Sbjct: 27  KGGGGGGGYGGGGYSGGGYSGGGYSGGGYSGGGYSGGGGYGGGGYGGGGGYGGGGGVQVI 86

Query: 227 ----GGYGGGGRGGGRGGGGGGGGSCYSCG 150
               GG+GGGG GGG  GGGG  G  YS G
Sbjct: 87  KIIDGGHGGGGYGGGGYGGGGYSGGGYSGG 116

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 54/92 (58%), Positives = 54/92 (58%), Gaps = 15/92 (16%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGG-RGGGGYGGSGGG 222
           G  G  V     GG GGGGY  GGGGYGGGG Y GGGY GGG  GGG  GGGGYGG GG 
Sbjct: 79  GGGGVQVIKIIDGGHGGGGY--GGGGYGGGG-YSGGGYSGGGYSGGGYSGGGGYGGGGGY 135

Query: 221 YGGGGRGGGRGG--------------GGGGGG 168
            GGGG GGG GG              GGGGGG
Sbjct: 136 GGGGGYGGGHGGHVQVYKVYTTTVHTGGGGGG 167

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 55/107 (51%), Positives = 56/107 (52%), Gaps = 21/107 (19%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGG-YGGG-----------------G 273
           G  G +  G   GG  GGGY  GGGGYGGGG YGGGG YGGG                 G
Sbjct: 104 GGGGYSGGGYSGGGYSGGGYS-GGGGYGGGGGYGGGGGYGGGHGGHVQVYKVYTTTVHTG 162

Query: 272 GYGGGRGGGGYGGSG---GGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GGG GGGGYGG G   GGYGGGG GG  GG   G       G SG
Sbjct: 163 GGGGGYGGGGYGGGGYGGGGYGGGGHGGYSGGYSSGSSYSSGGGSSG 209

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/75 (58%), Positives = 45/75 (60%), Gaps = 4/75 (5%)
 Frame = -3

Query: 350 GGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG----SGGGYGGGGRGGGRGGG 183
           GG     G G GGGG YGGGGY GGG  GGG  GGGY G     GGGYGGGG GGG G G
Sbjct: 19  GGLLSLLGKGGGGGGGYGGGGYSGGGYSGGGYSGGGYSGGGYSGGGGYGGGGYGGGGGYG 78

Query: 182 GGGGGSCYSCGESGH 138
           GGGG       + GH
Sbjct: 79  GGGGVQVIKIIDGGH 93

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 39/63 (61%), Positives = 40/63 (63%), Gaps = 6/63 (9%)
 Frame = -3

Query: 320 YGGGGSYGGGGYGGGGGY-GGGRGGGGYGG---SGGGYGGGG--RGGGRGGGGGGGGSCY 159
           +GG  S  G G GGGGGY GGG  GGGY G   SGGGY GGG   GGG GGGG GGG  Y
Sbjct: 18  HGGLLSLLGKGGGGGGGYGGGGYSGGGYSGGGYSGGGYSGGGYSGGGGYGGGGYGGGGGY 77

Query: 158 SCG 150
             G
Sbjct: 78  GGG 80

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 29/60 (48%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -3

Query: 416 KAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYG-GGGYGGGGGYGGGRGGGGY 240
           K    T   G    G   GG GGGGY  GGGGYGGGG  G  GGY  G  Y  G G  G+
Sbjct: 153 KVYTTTVHTGGGGGGYGGGGYGGGGY--GGGGYGGGGHGGYSGGYSSGSSYSSGGGSSGW 210

[176][TOP]
>UniRef100_B3MW45 GF22329 n=1 Tax=Drosophila ananassae RepID=B3MW45_DROAN
          Length = 207

 Score =  106 bits (264), Expect = 9e-22
 Identities = 55/87 (63%), Positives = 57/87 (65%), Gaps = 9/87 (10%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGG------GGYGGGGSYGGGGYGGGGG-YGGGRGG--GGYGGSGGG 222
           G   GGGGGGGY  GG      GGYGGGG  GGGGYGGGGG +GGG GG  GGYGG GG 
Sbjct: 21  GLLGGGGGGGGYGGGGSGGGGQGGYGGGGGQGGGGYGGGGGKHGGGGGGGQGGYGGGGGK 80

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESG 141
           +GGGG G G  GGGGGG   Y  G  G
Sbjct: 81  HGGGGGGQGGYGGGGGGQGGYGGGGGG 107

 Score =  101 bits (252), Expect = 2e-20
 Identities = 51/95 (53%), Positives = 61/95 (64%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           G   + ++ G  G++V   + G  GGGG + GGGG GG G YGGGG+G GGG  GG GGG
Sbjct: 105 GGGGSKSLAGNRGSSVSW-QGGNSGGGGNKHGGGGGGGQGGYGGGGFGKGGGGQGGYGGG 163

Query: 245 GYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G G  GGGYGGG +GGG  GGGGGGG  +  G  G
Sbjct: 164 GSG--GGGYGGGNQGGGHHGGGGGGGGHHGGGGGG 196

 Score =  100 bits (250), Expect = 4e-20
 Identities = 55/92 (59%), Positives = 57/92 (61%), Gaps = 6/92 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYE----RGGGGY-GGGGSYGGGGYGGGGGYGGGRG-GGGYG 237
           G  G    G   GGGG GGY     +GGGGY GGGG +GGGG GG GGYGGG G  GG G
Sbjct: 26  GGGGGGYGGGGSGGGGQGGYGGGGGQGGGGYGGGGGKHGGGGGGGQGGYGGGGGKHGGGG 85

Query: 236 GSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G  GGYGGGG G G  GGGGGGGS    G  G
Sbjct: 86  GGQGGYGGGGGGQGGYGGGGGGGSKSLAGNRG 117

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 50/77 (64%), Positives = 54/77 (70%), Gaps = 8/77 (10%)
 Frame = -3

Query: 374 GTRRGGGGGGG---YERGGGGYGGGGS--YGGGGYGGGGGYGGGRGGGGY---GGSGGGY 219
           G + GGGGGGG   Y  GG G GGGG   YGGGG  GGGGYGGG  GGG+   GG GGG+
Sbjct: 131 GNKHGGGGGGGQGGYGGGGFGKGGGGQGGYGGGG-SGGGGYGGGNQGGGHHGGGGGGGGH 189

Query: 218 GGGGRGGGRGGGGGGGG 168
            GGG GGG+ GGGGGGG
Sbjct: 190 HGGGGGGGKYGGGGGGG 206

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 56/106 (52%), Positives = 61/106 (57%), Gaps = 20/106 (18%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGG--GGGYERGGGGYGGGGSYGGGGYGGGGG-YGGGRGG-GGYGGS 231
           G  G   QG   GGGG  GGGY  GGG +GGGG  G GGYGGGGG +GGG GG GGYGG 
Sbjct: 35  GGSGGGGQGGYGGGGGQGGGGYGGGGGKHGGGGGGGQGGYGGGGGKHGGGGGGQGGYGGG 94

Query: 230 G---GGYGGGGRGGGR-------------GGGGGGGGSCYSCGESG 141
           G   GGYGGGG GG +             GG  GGGG+ +  G  G
Sbjct: 95  GGGQGGYGGGGGGGSKSLAGNRGSSVSWQGGNSGGGGNKHGGGGGG 140

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/119 (46%), Positives = 58/119 (48%), Gaps = 33/119 (27%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGG----YGGGGSYGGGGYGGGGG------------- 270
           G  G    G + G GGGGG   GGGG    YGGGG  G GGYGGGGG             
Sbjct: 61  GKHGGGGGGGQGGYGGGGGKHGGGGGGQGGYGGGGG-GQGGYGGGGGGGSKSLAGNRGSS 119

Query: 269 --------------YGGGRGG--GGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
                         +GGG GG  GGYGG G G GGGG+GG  GGG GGGG  Y  G  G
Sbjct: 120 VSWQGGNSGGGGNKHGGGGGGGQGGYGGGGFGKGGGGQGGYGGGGSGGGG--YGGGNQG 176

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 36/63 (57%), Positives = 39/63 (61%)
 Frame = -3

Query: 326 GGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGE 147
           G  GGGG  GGGGYGGGG  GGG+GG  YGG     GGG  GGG GGGGG  G     G+
Sbjct: 21  GLLGGGG--GGGGYGGGGSGGGGQGG--YGG-----GGGQGGGGYGGGGGKHGGGGGGGQ 71

Query: 146 SGH 138
            G+
Sbjct: 72  GGY 74

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 32/58 (55%), Positives = 33/58 (56%), Gaps = 7/58 (12%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERG-------GGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           G  G    G   GG GGGGY  G       GGG GGGG +GGG  GGGG YGGG GGG
Sbjct: 151 GKGGGGQGGYGGGGSGGGGYGGGNQGGGHHGGGGGGGGHHGGG--GGGGKYGGGGGGG 206

[177][TOP]
>UniRef100_Q8YQB7 All3916 protein n=1 Tax=Nostoc sp. PCC 7120 RepID=Q8YQB7_ANASP
          Length = 383

 Score =  105 bits (263), Expect = 1e-21
 Identities = 46/67 (68%), Positives = 46/67 (68%), Gaps = 2/67 (2%)
 Frame = +1

Query: 169 PPP--PPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS* 342
           PPP  PPPPP PPP P PP P P PP PPPP  PP PP PP PPPP  PPPP PPPP   
Sbjct: 313 PPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRP 372

Query: 343 PPPPPPP 363
           PPPPP P
Sbjct: 373 PPPPPEP 379

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 46/72 (63%), Positives = 46/72 (63%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     PPPPP P  PPP PPPP PPP P  PPPP PPP PPPP  PPPP  PPP  
Sbjct: 315 PSDPPPPPDPPPPPDP--PPPDPPPPDPPPPPDPPPPPDPPP-PPPPDPPPPPDPPPPDR 371

Query: 322 PPPPRS*PPPPP 357
           PPPP   PPPPP
Sbjct: 372 PPPPPPEPPPPP 383

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 45/75 (60%), Positives = 45/75 (60%)
 Frame = +1

Query: 175 PPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPP 354
           P PPPP  PP PP P PPP PP  PP  PPP PPPPP PPPP  PPPP PP P   P PP
Sbjct: 310 PDPPPPSDPPPPPDPPPPPDPP--PPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPP 367

Query: 355 PPPRLVP*TLAPSGP 399
           PP R  P    P  P
Sbjct: 368 PPDRPPPPPPEPPPP 382

[178][TOP]
>UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH
          Length = 470

 Score =  105 bits (263), Expect = 1e-21
 Identities = 46/69 (66%), Positives = 48/69 (69%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP PPP PP PPPP   P PPPPP  PPP + PP  PPPP   PP
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPP--PPPPYVYPP 436

Query: 349 PPPPPRLVP 375
           PP PP + P
Sbjct: 437 PPSPPYVYP 445

 Score =  104 bits (260), Expect = 3e-21
 Identities = 48/71 (67%), Positives = 49/71 (69%), Gaps = 5/71 (7%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPP--YPPPPRPPP*PPPPPYPPPP*LPP---PP*PPPP 333
           PPPPPPPP PPP PPPP PPP PP  YP PP PPP PPP  YPPPP  PP   PP P PP
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP--PPYVYPPPPSPP 441

Query: 334 RS*PPPPPPPR 366
              PPPPP P+
Sbjct: 442 YVYPPPPPSPQ 452

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 43/69 (62%), Positives = 44/69 (63%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP PPPP   P PP PPPP PPP   PPP PPP   PPPP PP     PP
Sbjct: 391 PPPPPPPPPPPPPPPPPYVYPSPP-PPPPSPPPYVYPPP-PPPYVYPPPPSPPYVYPPPP 448

Query: 349 PPPPPRLVP 375
           P P P + P
Sbjct: 449 PSPQPYMYP 457

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 38/60 (63%), Positives = 39/60 (65%), Gaps = 4/60 (6%)
 Frame = +1

Query: 208 PPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*L----PPPP*PPPPRS*PPPPPPPRLVP 375
           PP P PPP PP PPPP PPP PPPPP PPPP      PPPP P PP    PPPPPP + P
Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYP 435

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 42/72 (58%), Positives = 43/72 (59%), Gaps = 3/72 (4%)
 Frame = +1

Query: 169 PPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PP 348
           PPPPPPPP PPP    P PPP PP PPP   PP PPP  YPPPP  PP   PPPP S  P
Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP-SPPYVYPPPPPSPQP 453

Query: 349 ---PPPPPRLVP 375
              P PP   +P
Sbjct: 454 YMYPSPPCNDLP 465

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 35/55 (63%), Positives = 36/55 (65%)
 Frame = +1

Query: 235 PPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           PP PPPP PPP PPPPP PPPP  PPPP PPPP   P PPPPP   P  + P  P
Sbjct: 376 PPSPPPPPPPP-PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429

[179][TOP]
>UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1
           Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE
          Length = 472

 Score =  105 bits (263), Expect = 1e-21
 Identities = 51/82 (62%), Positives = 54/82 (65%), Gaps = 4/82 (4%)
 Frame = +1

Query: 172 PPPPPPPRPP-PRPPPP*PPPLPPYPPPPRPPP*---PPPPPYPPPP*LPPPP*PPPPRS 339
           PPPPP P+PP P+PP P PPP PP P PP PPP    PP PP PPPP  PPPP PPPP  
Sbjct: 220 PPPPPSPQPPSPQPPSPSPPP-PPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPP 278

Query: 340 *PPPPPPPRLVP*TLAPSGPVT 405
            PPPPP P   P  L P+ PVT
Sbjct: 279 PPPPPPSPSPPPPELPPAQPVT 300

 Score =  104 bits (259), Expect = 3e-21
 Identities = 49/85 (57%), Positives = 49/85 (57%), Gaps = 11/85 (12%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SPQ     PPPPP P PP  PPP   PP PP PPPP PPP PPPPP PPPP  PP P 
Sbjct: 228 PPSPQPPSPSPPPPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPS 287

Query: 322 PPPP-----------RS*PPPPPPP 363
           PPPP           R  PPPP PP
Sbjct: 288 PPPPELPPAQPVTPARKRPPPPAPP 312

 Score =  101 bits (251), Expect = 3e-20
 Identities = 49/78 (62%), Positives = 49/78 (62%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SPQ    P PP P P PPP P PP PPP  P PP P PPP P PPP PPPP  PPPP 
Sbjct: 223 PPSPQP-PSPQPPSPSPPPPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPP--PPPPP 279

Query: 322 PPPPRS*PPPPPPPRLVP 375
           PPPP S  P PPPP L P
Sbjct: 280 PPPPPS--PSPPPPELPP 295

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 39/64 (60%), Positives = 39/64 (60%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P SP     PPPPP PP PPP PPPP PPP PP P PP PP  PP  P  P    PPPP 
Sbjct: 256 PPSPP----PPPPPSPPPPPPPPPPPPPPPPPPSPSPP-PPELPPAQPVTPARKRPPPPA 310

Query: 322 PPPP 333
           PPPP
Sbjct: 311 PPPP 314

[180][TOP]
>UniRef100_UPI00015539C6 PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI00015539C6
          Length = 123

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/95 (61%), Positives = 60/95 (63%), Gaps = 3/95 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G+   G   GGGG  G   GGGG GGGGS GGGG GGGGG GGG GGGG GGSGGG 
Sbjct: 14  GGGGSGGGGGDSGGGGCSGGGGGGGGGGGGGSGGGGGGGGGGGSGGGGGGGGGGGSGGGG 73

Query: 218 ---GGGGRGGGRGGGGGGGGSCYSCGESGHFARDC 123
              GG G GGG GGGGGGGG     G SG +  DC
Sbjct: 74  VGGGGDGGGGGGGGGGGGGGGGGGGGSSGGWG-DC 107

 Score =  105 bits (263), Expect = 1e-21
 Identities = 52/83 (62%), Positives = 54/83 (65%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           +G  G +  G   GGGGGGG   GGGG GGGGS GGGG GGGGG GGG  GGG  G GGG
Sbjct: 25  SGGGGCSGGGGGGGGGGGGGSGGGGGGGGGGGSGGGGGGGGGGGSGGGGVGGGGDGGGGG 84

Query: 221 YGGGGRGGGRGGGGGGGGSCYSC 153
            GGGG GGG GGGGG  G    C
Sbjct: 85  GGGGGGGGGGGGGGGSSGGWGDC 107

 Score =  102 bits (255), Expect = 1e-20
 Identities = 53/81 (65%), Positives = 55/81 (67%), Gaps = 11/81 (13%)
 Frame = -3

Query: 377 QGTRRGGGGGGGYERGGGGY----------GGGGSYGGGGYGGGGGYGGGRGGGGYGGS- 231
           +G   GG GGGG + GGGG           GGGGS GGGG GGGGG GGG GGGG GGS 
Sbjct: 11  EGGGGGGSGGGGGDSGGGGCSGGGGGGGGGGGGGSGGGGGGGGGGGSGGGGGGGGGGGSG 70

Query: 230 GGGYGGGGRGGGRGGGGGGGG 168
           GGG GGGG GGG GGGGGGGG
Sbjct: 71  GGGVGGGGDGGGGGGGGGGGG 91

 Score =  100 bits (249), Expect = 5e-20
 Identities = 48/74 (64%), Positives = 50/74 (67%)
 Frame = -3

Query: 392 DGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGG 213
           +G   +  R GGGGGG    GGGG  GGG   GGG GGGGG GGG GGGG GG GGG GG
Sbjct: 2   EGKGKRPVREGGGGGGS--GGGGGDSGGGGCSGGGGGGGGGGGGGSGGGGGGGGGGGSGG 59

Query: 212 GGRGGGRGGGGGGG 171
           GG GGG GG GGGG
Sbjct: 60  GGGGGGGGGSGGGG 73

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 41/61 (67%), Positives = 41/61 (67%)
 Frame = -3

Query: 323 GYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGES 144
           G GGGGS GGGG  GGGG  GG GGGG GG GGG GGGG GGG GG GGGGG     G  
Sbjct: 12  GGGGGGSGGGGGDSGGGGCSGGGGGGG-GGGGGGSGGGGGGGGGGGSGGGGGGGGGGGSG 70

Query: 143 G 141
           G
Sbjct: 71  G 71

[181][TOP]
>UniRef100_UPI0001552E25 PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI0001552E25
          Length = 112

 Score =  105 bits (263), Expect = 1e-21
 Identities = 49/65 (75%), Positives = 49/65 (75%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG   GGGG GGGG  GG G GGGGG GGG GGGG GG GGG G GG GGG GGG
Sbjct: 17  GGGGGGGSGGGGGGGGGGGGGGGDGGGGGGGAGGGGGGGGGGGGGGGGGDGGDGGGGGGG 76

Query: 182 GGGGG 168
           GGGGG
Sbjct: 77  GGGGG 81

 Score =  100 bits (248), Expect = 7e-20
 Identities = 50/75 (66%), Positives = 50/75 (66%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG 180
           GGGGGG   GGGG GGGG  GGGG GGGG  GGG GG G GG GGG GGGG GGG GG G
Sbjct: 14  GGGGGG---GGGGSGGGGGGGGGGGGGGGDGGGGGGGAGGGGGGGGGGGGGGGGGDGGDG 70

Query: 179 GGGGSCYSCGESGHF 135
           GGGG     G  G F
Sbjct: 71  GGGGGGGGGGGGGWF 85

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 48/74 (64%), Positives = 49/74 (66%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           +G  G    G   GGGGGGG   GGGG GG G  GGGG GGGGG GGG GGGG GG GG 
Sbjct: 13  SGGGGGGGGGGSGGGGGGGG---GGGGGGGDGGGGGGGAGGGGGGGGGGGGGGGGGDGGD 69

Query: 221 YGGGGRGGGRGGGG 180
            GGGG GGG GGGG
Sbjct: 70  GGGGGGGGGGGGGG 83

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 38/65 (58%), Positives = 41/65 (63%), Gaps = 5/65 (7%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGG-----GRGGGGYGG 234
           G  G+   G   GGGGGGG + GGGG G GG  GGGG GGGGG GG     G GGGG GG
Sbjct: 20  GGGGSGGGGGGGGGGGGGGGDGGGGGGGAGGGGGGGGGGGGGGGGGDGGDGGGGGGGGGG 79

Query: 233 SGGGY 219
            GGG+
Sbjct: 80  GGGGW 84

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 33/57 (57%), Positives = 34/57 (59%), Gaps = 4/57 (7%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGG----GGGYGGGRGGGGY 240
           G  G    G   GGGGGGG   GGGG GGGG  GGGG GG    GGG GGG GGG +
Sbjct: 29  GGGGGGGGGGGDGGGGGGGAGGGGGGGGGGGGGGGGGDGGDGGGGGGGGGGGGGGWF 85

[182][TOP]
>UniRef100_Q6RY61 Glycine-rich RNA-binding protein RGP-1c (Fragment) n=1
           Tax=Nicotiana sylvestris RepID=Q6RY61_NICSY
          Length = 136

 Score =  105 bits (263), Expect = 1e-21
 Identities = 60/105 (57%), Positives = 63/105 (60%), Gaps = 15/105 (14%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYG-----GGGSY-------GGG 291
           D DGR+  VN         +   RGGGGGGG   GGGGYG     GGG Y       GGG
Sbjct: 35  DLDGRNITVN---------EAQSRGGGGGGG-RGGGGGYGGGRREGGGGYGGGRREGGGG 84

Query: 290 GYGGGGGYGGGRGGGGYGGSGGGYGGGGR---GGGRGGGGGGGGS 165
           GYGGGGGYGGGR  GGYGG GGGYGGG R   GG R   GGGGG+
Sbjct: 85  GYGGGGGYGGGRREGGYGGGGGGYGGGDRYNDGGSRYSRGGGGGA 129

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 54/118 (45%), Positives = 59/118 (50%), Gaps = 22/118 (18%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR-- 255
           D +S    + G +G ++ G  R         RGGGG        GGG GGGGGYGGGR  
Sbjct: 20  DEQSMKDAIEGMNGQDLDG--RNITVNEAQSRGGGG--------GGGRGGGGGYGGGRRE 69

Query: 254 GGGGYG-----------GSGGGYGGGGRGGGRGGGGGG---------GGSCYSCGESG 141
           GGGGYG           G GGGYGGG R GG GGGGGG         GGS YS G  G
Sbjct: 70  GGGGYGGGRREGGGGGYGGGGGYGGGRREGGYGGGGGGYGGGDRYNDGGSRYSRGGGG 127

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 34/66 (51%), Positives = 34/66 (51%), Gaps = 3/66 (4%)
 Frame = -3

Query: 374 GTRRGGGGG---GGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGR 204
           G R GGGGG   G      GGYGGG   GG G GGGGGYG   GG  Y   G  Y  GG 
Sbjct: 77  GRREGGGGGYGGG------GGYGGGRREGGYG-GGGGGYG---GGDRYNDGGSRYSRGGG 126

Query: 203 GGGRGG 186
           GG   G
Sbjct: 127 GGASDG 132

[183][TOP]
>UniRef100_Q41453 Putative glycine rich RNA binding protein n=1 Tax=Solanum tuberosum
           RepID=Q41453_SOLTU
          Length = 175

 Score =  105 bits (263), Expect = 1e-21
 Identities = 59/98 (60%), Positives = 60/98 (61%), Gaps = 8/98 (8%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYER--GGGGYGGGGSY-----GGGGY-GG 279
           D DGR+  VN     G    G  RGGGG GG  R  GGGGYGG G       GGGGY GG
Sbjct: 71  DLDGRNITVNEAQSRGGVEAGGGRGGGGYGGGRREGGGGGYGGYGGGRREGGGGGGYSGG 130

Query: 278 GGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGS 165
           GGGYGGGR  GGYGG GGGYGGG R   R   GGGGGS
Sbjct: 131 GGGYGGGRREGGYGGGGGGYGGGDRYSDRSSRGGGGGS 168

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 33/51 (64%), Positives = 34/51 (66%), Gaps = 3/51 (5%)
 Frame = -3

Query: 281 GGGGYGGGRGGGGYGG---SGGGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           GG   GGGRGGGGYGG    GGG G GG GGGR  GGGGGG  YS G  G+
Sbjct: 86  GGVEAGGGRGGGGYGGGRREGGGGGYGGYGGGRREGGGGGG--YSGGGGGY 134

[184][TOP]
>UniRef100_B9SLQ3 Glycine-rich RNA-binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9SLQ3_RICCO
          Length = 166

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/103 (56%), Positives = 64/103 (62%), Gaps = 9/103 (8%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQG---------TRRGGGGGGGYERGGGGYGGGGSYGGGGYGG 279
           N+ +S    + G +G N+ G         +R GGGGGGG  R GGG G GG    GGYGG
Sbjct: 57  NNEKSMRDAIEGMNGQNLDGRNITVNEAQSRGGGGGGGGGYRNGGGGGYGGGRREGGYGG 116

Query: 278 GGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCG 150
           GGGY   RGGGGYGG GGGY GGGR  G GGGGG GGS YS G
Sbjct: 117 GGGY--SRGGGGYGGGGGGY-GGGRDRGYGGGGGDGGSRYSRG 156

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 40/65 (61%), Positives = 41/65 (63%), Gaps = 5/65 (7%)
 Frame = -3

Query: 398 GPDGANVQGTRRGG-GGGGGYERGGGGY-GGGGSYGGG---GYGGGGGYGGGRGGGGYGG 234
           G  G    G R GG GGGGGY RGGGGY GGGG YGGG   GYGGGGG GG R   G G 
Sbjct: 100 GGGGGYGGGRREGGYGGGGGYSRGGGGYGGGGGGYGGGRDRGYGGGGGDGGSRYSRGGGA 159

Query: 233 SGGGY 219
           S G +
Sbjct: 160 SEGNW 164

[185][TOP]
>UniRef100_A8W7L0 Putative RNA helicase n=1 Tax=Phytophthora infestans
           RepID=A8W7L0_PHYIN
          Length = 544

 Score =  105 bits (263), Expect = 1e-21
 Identities = 53/80 (66%), Positives = 55/80 (68%), Gaps = 2/80 (2%)
 Frame = -3

Query: 401 TGPDGANVQGTRR--GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSG 228
           +G D      +RR  GGGG GGY  GGGGYGGG   GGGG  GGGG G   GGGGYGG G
Sbjct: 4   SGGDRYGDSSSRRDYGGGGSGGY--GGGGYGGGSRGGGGGGYGGGGGGYSGGGGGYGGGG 61

Query: 227 GGYGGGGRGGGRGGGGGGGG 168
           GGY GGGRGGG GGG GGGG
Sbjct: 62  GGYSGGGRGGGGGGGFGGGG 81

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 38/63 (60%), Positives = 38/63 (60%), Gaps = 7/63 (11%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGG------GYERGGGGYGGGGS-YGGGGYGGGGGYGGGRGGGGY 240
           G  G    G  RGGGGGG      GY  GGGGYGGGG  Y GGG GGGGG  GG GGGG 
Sbjct: 25  GYGGGGYGGGSRGGGGGGYGGGGGGYSGGGGGYGGGGGGYSGGGRGGGGG--GGFGGGGD 82

Query: 239 GGS 231
            GS
Sbjct: 83  LGS 85

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/69 (50%), Positives = 36/69 (52%), Gaps = 1/69 (1%)
 Frame = -3

Query: 341 YERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGG-GGGGS 165
           Y  GG  YG   S    G GG GGYGGG           GYGGG RGGG  GGG GGGG 
Sbjct: 2   YSSGGDRYGDSSSRRDYGGGGSGGYGGG-----------GYGGGSRGGG--GGGYGGGGG 48

Query: 164 CYSCGESGH 138
            YS G  G+
Sbjct: 49  GYSGGGGGY 57

[186][TOP]
>UniRef100_C0H6D7 Putative cuticle protein n=1 Tax=Bombyx mori RepID=C0H6D7_BOMMO
          Length = 224

 Score =  105 bits (263), Expect = 1e-21
 Identities = 53/71 (74%), Positives = 53/71 (74%), Gaps = 2/71 (2%)
 Frame = -3

Query: 374 GTRRGGG-GGGGYERGGGGYGGGGSYGGGG-YGGGGGYGGGRGGGGYGGSGGGYGGGGRG 201
           G  RGGG GGGG   GGGGYGGGG YGGGG YGGGGGYG   GG GYGG GG  GGGG G
Sbjct: 123 GYDRGGGYGGGGGYGGGGGYGGGGGYGGGGGYGGGGGYG---GGSGYGGGGGYGGGGGHG 179

Query: 200 GGRGGGGGGGG 168
           GG GGGGG GG
Sbjct: 180 GGYGGGGGHGG 190

 Score =  104 bits (260), Expect = 3e-21
 Identities = 55/85 (64%), Positives = 55/85 (64%), Gaps = 2/85 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGG-YGGGGGYGGGRGGGGYGGSGGG 222
           G D     G   G GGGGGY  GGGGYGGGG YGGGG YGGG GYGGG G GG GG GGG
Sbjct: 123 GYDRGGGYGGGGGYGGGGGYG-GGGGYGGGGGYGGGGGYGGGSGYGGGGGYGGGGGHGGG 181

Query: 221 Y-GGGGRGGGRGGGGGGGGSCYSCG 150
           Y GGGG GGG GG  G  G    CG
Sbjct: 182 YGGGGGHGGGYGGNQGNYGYPTGCG 206

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 53/82 (64%), Positives = 56/82 (68%), Gaps = 9/82 (10%)
 Frame = -3

Query: 353 GGGGYERGGGGYGGGGSYGGGG-YGGGGGYGGG---RGGGGYG-----GSGGGYGGGGRG 201
           G  GY+RGGG YGGGG YGGGG YGGGGGYGGG    GGGGYG     G GGGYGGGG  
Sbjct: 120 GHHGYDRGGG-YGGGGGYGGGGGYGGGGGYGGGGGYGGGGGYGGGSGYGGGGGYGGGGGH 178

Query: 200 GGRGGGGGGGGSCYSCGESGHF 135
           GG  GGGGG G  Y  G  G++
Sbjct: 179 GGGYGGGGGHGGGYG-GNQGNY 199

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 54/78 (69%), Positives = 57/78 (73%), Gaps = 7/78 (8%)
 Frame = -3

Query: 380 VQGTRRGGGG---GGGYERGGGGYGGGGSYGGGG-YGGGGGYGGGRGGGGYGGSGGGYGG 213
           ++G R+G  G   GGGY  GGGGYGGGG YGGGG YGGGGGYGGG   GGYGG G GYGG
Sbjct: 114 LKGYRKGHHGYDRGGGYG-GGGGYGGGGGYGGGGGYGGGGGYGGG---GGYGG-GSGYGG 168

Query: 212 G---GRGGGRGGGGGGGG 168
           G   G GGG GGG GGGG
Sbjct: 169 GGGYGGGGGHGGGYGGGG 186

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 55/87 (63%), Positives = 56/87 (64%), Gaps = 10/87 (11%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGG-GYGGGGGYGGGRG-GGGYGGSGG 225
           G  G    G   G GGGGGY  GGGGYGGGG YGGG GYGGGGGYGGG G GGGYGG GG
Sbjct: 129 GYGGGGGYGGGGGYGGGGGYG-GGGGYGGGGGYGGGSGYGGGGGYGGGGGHGGGYGGGGG 187

Query: 224 GYGGGGRGGGRG--------GGGGGGG 168
              GGG GG +G        GGG GGG
Sbjct: 188 --HGGGYGGNQGNYGYPTGCGGGCGGG 212

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/83 (61%), Positives = 52/83 (62%), Gaps = 9/83 (10%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGG-YGGGGGYGGGRGGGGYGGSGGG 222
           G  G    G   G GGGGGY  GGGGYGGG  YGGGG YGGGGG+GGG GGG  GG GGG
Sbjct: 135 GYGGGGGYGGGGGYGGGGGYG-GGGGYGGGSGYGGGGGYGGGGGHGGGYGGG--GGHGGG 191

Query: 221 YGGG--------GRGGGRGGGGG 177
           YGG         G GGG GGG G
Sbjct: 192 YGGNQGNYGYPTGCGGGCGGGQG 214

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 48/75 (64%), Positives = 49/75 (65%), Gaps = 7/75 (9%)
 Frame = -3

Query: 344 GYERGGGGYGGGGSYGGGGY-GGGGGYGGG---RGGGGYGGSGGGYGGG---GRGGGRGG 186
           GY +G  GY  GG YGGGG  GGGGGYGGG    GGGGYGG GGGYGGG   G GGG GG
Sbjct: 116 GYRKGHHGYDRGGGYGGGGGYGGGGGYGGGGGYGGGGGYGG-GGGYGGGSGYGGGGGYGG 174

Query: 185 GGGGGGSCYSCGESG 141
           GGG GG     G  G
Sbjct: 175 GGGHGGGYGGGGGHG 189

[187][TOP]
>UniRef100_P17816 Glycine-rich cell wall structural protein n=1 Tax=Hordeum vulgare
           RepID=GRP1_HORVU
          Length = 200

 Score =  105 bits (263), Expect = 1e-21
 Identities = 57/103 (55%), Positives = 59/103 (57%), Gaps = 16/103 (15%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGS-------YGGGGYGGGGGY--GGGRGGG 246
           G  G    G    GGGGGGY  GGGGYGGGG         GGGGYGGGGGY   GG GGG
Sbjct: 56  GHGGGGYGGGGGYGGGGGGYPGGGGGYGGGGGGYPGHGGEGGGGYGGGGGYPGHGGEGGG 115

Query: 245 GYGGSGGGYGGGGRGGGRGGGGGG-------GGSCYSCGESGH 138
           GYGG GG +G GG GGG  GGGGG       GG  Y  G  G+
Sbjct: 116 GYGGGGGYHGHGGEGGGGYGGGGGYHGHGGEGGGGYGGGGGGY 158

 Score =  105 bits (261), Expect = 2e-21
 Identities = 60/105 (57%), Positives = 61/105 (58%), Gaps = 13/105 (12%)
 Frame = -3

Query: 398 GPDGANVQGTRRG-GGGGGGYE----RGGGGYGGGGSY------GGGGYGGGGGYGG--G 258
           G  G    G   G GGGGGGY      GGGGYGGGG Y      GGGGYGGGGGY G  G
Sbjct: 69  GGGGGGYPGGGGGYGGGGGGYPGHGGEGGGGYGGGGGYPGHGGEGGGGYGGGGGYHGHGG 128

Query: 257 RGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGHFARDC 123
            GGGGYGG GG +G GG GGG G GGGGGG     G  GH    C
Sbjct: 129 EGGGGYGGGGGYHGHGGEGGG-GYGGGGGGYPGHGGGGGHGGGRC 172

 Score =  101 bits (251), Expect = 3e-20
 Identities = 56/98 (57%), Positives = 57/98 (58%), Gaps = 13/98 (13%)
 Frame = -3

Query: 362 GGGGGGGYE----RGGGGYGGGGSY------GGGGYGGGGGY--GGGRGGGGYGGSGGGY 219
           G GGGGGY      GGGGYGGGG Y      GGGGYGGGGGY   GG GGGGYGG GGGY
Sbjct: 99  GYGGGGGYPGHGGEGGGGYGGGGGYHGHGGEGGGGYGGGGGYHGHGGEGGGGYGGGGGGY 158

Query: 218 GGGGRGGGRGGGGGGGGSC-YSCGESGHFARDCPTSAR 108
            G G     GGGG GGG C + C   G     C   AR
Sbjct: 159 PGHG-----GGGGHGGGRCKWGCCGHGFLHHGCRCCAR 191

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 55/94 (58%), Positives = 59/94 (62%), Gaps = 12/94 (12%)
 Frame = -3

Query: 386 ANVQGTRRGGGGGGGYERGG---GGYGGGGSYGGGG---YGGGGGYGGGRGG-GGYGG-S 231
           A V+    GGGG  G+ RGG   GGYGGGG YGGGG    GGGGGYGGG GG  G+GG  
Sbjct: 37  AGVENFFHGGGGHHGHGRGGHGGGGYGGGGGYGGGGGGYPGGGGGYGGGGGGYPGHGGEG 96

Query: 230 GGGYGGG----GRGGGRGGGGGGGGSCYSCGESG 141
           GGGYGGG    G GG  GGG GGGG  +  G  G
Sbjct: 97  GGGYGGGGGYPGHGGEGGGGYGGGGGYHGHGGEG 130

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 50/83 (60%), Positives = 52/83 (62%), Gaps = 10/83 (12%)
 Frame = -3

Query: 356 GGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY------GGGGRGGG 195
           GGGG +  G GG+GGGG  GGGGYGGGGG G   GGGGYGG GGGY      GGGG GGG
Sbjct: 45  GGGGHHGHGRGGHGGGGYGGGGGYGGGGG-GYPGGGGGYGGGGGGYPGHGGEGGGGYGGG 103

Query: 194 RG----GGGGGGGSCYSCGESGH 138
            G    GG GGGG     G  GH
Sbjct: 104 GGYPGHGGEGGGGYGGGGGYHGH 126

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 32/55 (58%), Positives = 34/55 (61%)
 Frame = -3

Query: 302 YGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           +GGGG+ G G   GG GGGGYGG GGGYGGGG G     GGGGG      G  GH
Sbjct: 44  HGGGGHHGHGR--GGHGGGGYGG-GGGYGGGGGGYP---GGGGGYGGGGGGYPGH 92

[188][TOP]
>UniRef100_Q42421 Chitinase n=1 Tax=Beta vulgaris subsp. vulgaris RepID=Q42421_BETVU
          Length = 439

 Score =  105 bits (262), Expect = 2e-21
 Identities = 55/98 (56%), Positives = 57/98 (58%), Gaps = 4/98 (4%)
 Frame = +1

Query: 118 VGQSLAK*PDSPQL*QLPPPPPPPPRPPP-RPPPP*PPPLPPYPPPPRPP---P*PPPPP 285
           VG+     P  P   + PPP PP PRPPP RPP P PPP  P PPPPRPP   P PPP P
Sbjct: 45  VGRPSRPTPPRPPTPRPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTP 104

Query: 286 YPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
            PPPP  P P  PPPP   PPPPP PR  P    PS P
Sbjct: 105 RPPPPRPPTPRPPPPPTPRPPPPPTPRPPP----PSPP 138

 Score =  105 bits (262), Expect = 2e-21
 Identities = 54/96 (56%), Positives = 56/96 (58%), Gaps = 10/96 (10%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPP---RPPPP*PP-PLPPYPPPPRPPP*PPPPPYPPPP*LP 309
           P  P   + PPP PP PRPPP   RPPPP PP P PP PP PRPPP  PP P PPPP  P
Sbjct: 63  PPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTP 122

Query: 310 PPP*PPPPRS*PP------PPPPPRLVP*TLAPSGP 399
            PP PP PR  PP      PPPPP   P T +P  P
Sbjct: 123 RPPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPSP 158

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 54/95 (56%), Positives = 56/95 (58%), Gaps = 5/95 (5%)
 Frame = +1

Query: 142 PDSPQL*QLPPPP---PPPPRPP-PRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LP 309
           P  P   + PPPP   PPPPRPP PRPPPP P P PP PP PRPPP  PP P PPPP  P
Sbjct: 90  PPRPPTPRPPPPPTPRPPPPRPPTPRPPPP-PTPRPPPPPTPRPPPPSPPTPRPPPPPPP 148

Query: 310 PPP*PPPPR-S*PPPPPPPRLVP*TLAPSGPVTLT 411
            PP P PP    P PP PP   P T  P+ P  LT
Sbjct: 149 SPPTPSPPSPPSPEPPTPPEPTPPT--PTPPTHLT 181

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 48/78 (61%), Positives = 48/78 (61%), Gaps = 5/78 (6%)
 Frame = +1

Query: 187 PPRP-PPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP-*LPPPP*PPPPRS*PPP--- 351
           P RP PPRPP P PP  PP PP PRPPP  PP P PPPP   PPPP PP PR  PPP   
Sbjct: 48  PSRPTPPRPPTPRPP--PPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPR 105

Query: 352 PPPPRLVP*TLAPSGPVT 405
           PPPPR  P T  P  P T
Sbjct: 106 PPPPR--PPTPRPPPPPT 121

[189][TOP]
>UniRef100_B4NYZ4 GE18300 n=1 Tax=Drosophila yakuba RepID=B4NYZ4_DROYA
          Length = 688

 Score =  105 bits (262), Expect = 2e-21
 Identities = 51/82 (62%), Positives = 54/82 (65%), Gaps = 5/82 (6%)
 Frame = +1

Query: 166 LPPPPPPPPRPPPRPPPP*PP---PLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPR 336
           +PPPPPPPP P P PPPP PP   P PP PPPP+P P PPPPP PPP   P PP  PPP 
Sbjct: 200 VPPPPPPPPAPAPTPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPPAPKPSPP-TPPPT 258

Query: 337 S*PPP--PPPPRLVP*TLAPSG 396
           + PPP  PPPP  VP    PSG
Sbjct: 259 TPPPPTAPPPPPSVP---IPSG 277

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 44/76 (57%), Positives = 46/76 (60%)
 Frame = +1

Query: 172 PPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPP 351
           P  PPPP PPP P P  PPP PP  P P+PPP PPP P PPPP  PPPP PP P+  PP 
Sbjct: 198 PFVPPPPPPPPAPAPT-PPPPPPPAPKPKPPPPPPPKPKPPPP--PPPPPPPAPKPSPPT 254

Query: 352 PPPPRLVP*TLAPSGP 399
           PPP    P T  P  P
Sbjct: 255 PPPTTPPPPTAPPPPP 270

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 44/75 (58%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PP-PLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P  P      PPPPPPP P P+PPPP PP P PP PPPP PPP P P P  PPP  PPPP
Sbjct: 204 PPPPPAPAPTPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPPAPKPSPPTPPPTTPPPP 263

Query: 319 *PPPPRS*PPPPPPP 363
             PPP   PP  P P
Sbjct: 264 TAPPP---PPSVPIP 275

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 44/74 (59%), Positives = 46/74 (62%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPPPPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP* 321
           P  P     P PPPPPP P P+P PP PPP  P PPPP PPP PPP P P PP  PPP  
Sbjct: 203 PPPPPPAPAPTPPPPPP-PAPKPKPPPPPPPKPKPPPPPPPP-PPPAPKPSPP-TPPPTT 259

Query: 322 PPPPRS*PPPPPPP 363
           PPPP + PPPP  P
Sbjct: 260 PPPPTAPPPPPSVP 273

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 38/70 (54%), Positives = 39/70 (55%)
 Frame = +1

Query: 196 PPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP 375
           PPP PPPP P P PP PPPP P P PPPPP         PP P PP   PPPPPPP   P
Sbjct: 201 PPPPPPPPAPAPTPPPPPPPAPKPKPPPPP---------PPKPKPP---PPPPPPPPPAP 248

Query: 376 *TLAPSGPVT 405
               P+ P T
Sbjct: 249 KPSPPTPPPT 258

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 39/77 (50%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +1

Query: 142 PDSPQL*QLPPPPPP-PPRPPPRPPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP 318
           P  P     P PPPP PP+P P PPPP PPP  P P PP PPP  PPPP  P    PPPP
Sbjct: 215 PPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPPAPKPSPPTPPPTTPPPPTAP----PPPP 270

Query: 319 *PPPPRS*PPPPPPPRL 369
             P P        PP+L
Sbjct: 271 SVPIPSGQDSGIRPPQL 287

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/73 (52%), Positives = 40/73 (54%)
 Frame = +1

Query: 208 PPPP*PPPLPPYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLA 387
           PPPP PPP P     P PPP PPP P P PP  PPP   PPP   PPPPP P+  P T  
Sbjct: 201 PPPPPPPPAPA----PTPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPPAPKPSPPTPP 256

Query: 388 PSGPVTLTALDRP 426
           P+ P   TA   P
Sbjct: 257 PTTPPPPTAPPPP 269

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 43/97 (44%), Positives = 45/97 (46%), Gaps = 10/97 (10%)
 Frame = +1

Query: 136 K*PDSPQL*QLPPPPPPPPRPP-PRPPPP*PPPLPPYPPPPRPPP*PPPPPYPP------ 294
           K P  P     PPPPPPPP PP P+P PP PPP    PPPP  PP PP  P P       
Sbjct: 225 KPPPPPPPKPKPPPPPPPPPPPAPKPSPPTPPPTT--PPPPTAPPPPPSVPIPSGQDSGI 282

Query: 295 -PP*L--PPPP*PPPPRS*PPPPPPPRLVP*TLAPSG 396
            PP L   PP  P  P   PP  P    +P    P G
Sbjct: 283 RPPQLGWSPPYGPSNPGGYPPSLPGWITLPVAPNPGG 319

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 28/54 (51%), Positives = 31/54 (57%)
 Frame = +1

Query: 238 PYPPPPRPPP*PPPPPYPPPP*LPPPP*PPPPRS*PPPPPPPRLVP*TLAPSGP 399
           P+   P  PP PPPPP P P   PPPP PP P+  PPPPPPP+  P    P  P
Sbjct: 193 PFEHFPFVPPPPPPPPAPAP--TPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPP 244

[190][TOP]
>UniRef100_Q7V9D6 RNA-binding region RNP-1 (RNA recognition motif) n=1
           Tax=Prochlorococcus marinus str. MIT 9313
           RepID=Q7V9D6_PROMM
          Length = 199

 Score =  105 bits (262), Expect = 2e-21
 Identities = 57/86 (66%), Positives = 59/86 (68%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           GR   +N   P G+     RRGGG GGG   GGGGYGGGG   GGGYGGGGG G G GGG
Sbjct: 69  GRPLRINKAEPRGS---APRRGGGYGGGGGGGGGGYGGGG---GGGYGGGGG-GYGGGGG 121

Query: 245 GYGGSGGGYGGGGRGGGRGGGGGGGG 168
           GYGG  GGYGGGG GGG  GGGGGGG
Sbjct: 122 GYGG--GGYGGGGYGGGGYGGGGGGG 145

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 46/72 (63%), Positives = 46/72 (63%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG 210
           G    G   GGGGGGGY  GGGGYGG    GGGGYG     GGG GGGGYG  GGGYGGG
Sbjct: 93  GGGGGGGGYGGGGGGGYGGGGGGYGG----GGGGYG-----GGGYGGGGYG--GGGYGGG 141

Query: 209 GRGGGRGGGGGG 174
           G GG RG G  G
Sbjct: 142 GGGGDRGSGARG 153

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 42/57 (73%), Positives = 42/57 (73%)
 Frame = -3

Query: 311 GGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG YGGGG GGGGGYGGG GGGGYGG GGGYGGGG  GG GGGG GGG     G  G
Sbjct: 87  GGGYGGGGGGGGGGYGGG-GGGGYGGGGGGYGGGG--GGYGGGGYGGGGYGGGGYGG 140

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 46/84 (54%), Positives = 46/84 (54%), Gaps = 16/84 (19%)
 Frame = -3

Query: 359 GGGGGGYERGGGGYGGGG----SYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGG------ 210
           GGGGGGY  GGGGYGGGG     YGGGGYGGGGG GG RG G  G     YGG       
Sbjct: 110 GGGGGGYGGGGGGYGGGGYGGGGYGGGGYGGGGG-GGDRGSGARGWEDRSYGGASPETSS 168

Query: 209 ---GRGGGRGGGG---GGGGSCYS 156
              GR   R GG    G GG  YS
Sbjct: 169 YDEGRTRRRRGGAAPEGEGGDSYS 192

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 35/58 (60%), Positives = 35/58 (60%)
 Frame = -3

Query: 314 GGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G     GGGYGGGGG     GGGGYGG GGG  GGG GG  GGGGG GG  Y  G  G
Sbjct: 81  GSAPRRGGGYGGGGG----GGGGGYGGGGGGGYGGGGGGYGGGGGGYGGGGYGGGGYG 134

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 27/40 (67%), Positives = 28/40 (70%)
 Frame = -3

Query: 257 RGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           R GGGYGG GGG GGGG GGG GGG GGGG  Y  G  G+
Sbjct: 85  RRGGGYGGGGGG-GGGGYGGGGGGGYGGGGGGYGGGGGGY 123

[191][TOP]
>UniRef100_Q1BU84 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia
           AU 1054 RepID=Q1BU84_BURCA
          Length = 517

 Score =  105 bits (262), Expect = 2e-21
 Identities = 51/86 (59%), Positives = 53/86 (61%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G    N  G   GGGGGGG   GGGG GGGG  GGGG G GGG GGG GGGG GG  GG 
Sbjct: 309 GGGNGNGGGHGNGGGGGGGGGGGGGGGGGGGGGGGGGGGNGGGNGGGNGGGGNGGGNGGG 368

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGG GGG GGG GGG    + G +G
Sbjct: 369 NGGGNGGGNGGGNGGGNGGGNGGGNG 394

 Score =  101 bits (251), Expect = 3e-20
 Identities = 49/87 (56%), Positives = 51/87 (58%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGGGGG   GGGG GGG   G GG G GGG GGG GGG  GG+GGG 
Sbjct: 322 GGGGGGGGGGGGGGGGGGGGGGGGGGNGGGNGGGNGGGGNGGGNGGGNGGGNGGGNGGGN 381

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESGH 138
           GGG  GG  GG GGG G  +  G  GH
Sbjct: 382 GGGNGGGNGGGNGGGNGGGHGNGGGGH 408

 Score =  100 bits (250), Expect = 4e-20
 Identities = 52/92 (56%), Positives = 58/92 (63%), Gaps = 5/92 (5%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGG---GGGYERGGGGYGGGGSYG--GGGYGGGGGYGGGRGGGGYGG 234
           G    N  G   GGGG   GGG+  GGGG+G GG +G  GGG G GGG+G G GGGG GG
Sbjct: 270 GGGHGNGGGHGDGGGGHGNGGGHGDGGGGHGNGGGHGNGGGGNGNGGGHGNGGGGGGGGG 329

Query: 233 SGGGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
            GGG GGGG GGG GGGG GGG+    G  G+
Sbjct: 330 GGGGGGGGGGGGGGGGGGNGGGNGGGNGGGGN 361

 Score =  100 bits (248), Expect = 7e-20
 Identities = 50/89 (56%), Positives = 54/89 (60%), Gaps = 5/89 (5%)
 Frame = -3

Query: 392 DGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGG-----YGGSG 228
           DG    G   G G GGG    GGG+G GG  GGGG GGGGG GGG GGGG      GG+G
Sbjct: 294 DGGGGHGNGGGHGNGGGGNGNGGGHGNGGGGGGGGGGGGGGGGGGGGGGGGGGGNGGGNG 353

Query: 227 GGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG GGGG GGG GGG GGG    + G +G
Sbjct: 354 GGNGGGGNGGGNGGGNGGGNGGGNGGGNG 382

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 50/91 (54%), Positives = 56/91 (61%), Gaps = 5/91 (5%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYG--GGGYGGGGGYGGGRGGGGYGG--- 234
           G  G    G   G G GGG+  GGGG+G GG +G  GGG+G GGG+G G GG G GG   
Sbjct: 260 GGHGGGGDGDGGGHGNGGGHGDGGGGHGNGGGHGDGGGGHGNGGGHGNGGGGNGNGGGHG 319

Query: 233 SGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           +GGG GGGG GGG GGGGGGGG     G  G
Sbjct: 320 NGGGGGGGGGGGGGGGGGGGGGGGGGGGNGG 350

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 50/99 (50%), Positives = 58/99 (58%), Gaps = 12/99 (12%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSY--GGGGYGGGGGYGGGRG-------- 252
           T   G +  GT  GGG GGG +  GGG+G GG +  GGGG+G GGG+G G G        
Sbjct: 246 TSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGGHGDGGGGHGNGGGHGDGGGGHGNGGGH 305

Query: 251 --GGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
             GGG  G+GGG+G GG GGG GGGGGGGG     G  G
Sbjct: 306 GNGGGGNGNGGGHGNGGGGGGGGGGGGGGGGGGGGGGGG 344

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 49/87 (56%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGY-GGGGGYGGGRGGGGYGGSGGG 222
           G  G +  G    G GGG    GGGG GGGG  GGGG  GGGGG GGG GGG  GG+GGG
Sbjct: 300 GNGGGHGNGGGGNGNGGGHGNGGGGGGGGGGGGGGGGGGGGGGGGGGGNGGGNGGGNGGG 359

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESG 141
             GGG GGG GGG GGG    + G +G
Sbjct: 360 GNGGGNGGGNGGGNGGGNGGGNGGGNG 386

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 49/88 (55%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERG-GGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           G  G    G   GGGGGGG   G GGG GGGG+ GG G G GGG GGG GGG  GG+GGG
Sbjct: 329 GGGGGGGGGGGGGGGGGGGNGGGNGGGNGGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGG 388

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESGH 138
            GGG  GG  GG G GGG   + G +G+
Sbjct: 389 NGGGNGGGNGGGHGNGGGGHGNGGGNGN 416

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 45/86 (52%), Positives = 48/86 (55%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GG GGGG   G GG  GGG+ GG G G GGG GGG GGG  GG+GGG+
Sbjct: 342 GGGGGGNGGGNGGGNGGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGH 401

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESG 141
           G GG G G GGG G G      G  G
Sbjct: 402 GNGGGGHGNGGGNGNGNGSGGAGNGG 427

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 45/84 (53%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG-GGYGGSGGGYGG 213
           G    G   GGG  GG   GGGG+GGGG   GGG+G GGG+G G GG G  GG G G GG
Sbjct: 239 GGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGGHGDGGGGHGNGGGHGDGGGG 298

Query: 212 GGRGGGRGGGGGGGGSCYSCGESG 141
            G GGG G GGGG G+    G  G
Sbjct: 299 HGNGGGHGNGGGGNGNGGGHGNGG 322

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 47/90 (52%), Positives = 53/90 (58%), Gaps = 3/90 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGG-GYGGGRG-GGGYGGSGG 225
           G  G    G    GGG  G    GGG  GGG+ GGGG+GGGG G GGG G GGG+G  GG
Sbjct: 225 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGGHGDGGG 284

Query: 224 GYG-GGGRGGGRGGGGGGGGSCYSCGESGH 138
           G+G GGG G G GG G GGG     G +G+
Sbjct: 285 GHGNGGGHGDGGGGHGNGGGHGNGGGGNGN 314

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 44/84 (52%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G +G    G   GGG GGG   G GG  GGG+ GG G G GGG GGG  GGG+G  GGG+
Sbjct: 350 GGNGGGNGGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGG-NGGGHGNGGGGH 408

Query: 218 G-GGGRGGGRGGGGGGGGSCYSCG 150
           G GGG G G G GG G G     G
Sbjct: 409 GNGGGNGNGNGSGGAGNGGANGVG 432

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 44/87 (50%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GG  GGGG+GG G G 
Sbjct: 210 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGD 269

Query: 218 GGG-GRGGGRGGGGGGGGSCYSCGESG 141
           GGG G GGG G GGGG G+    G+ G
Sbjct: 270 GGGHGNGGGHGDGGGGHGNGGGHGDGG 296

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 44/87 (50%), Positives = 48/87 (55%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G    GGG  G    GGG  GGG+ GGG  GGGG  GGG G GG  G+GGG+
Sbjct: 220 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGGGGDGDGGGHGNGGGH 279

Query: 218 GGGGRGGGRGGGGGGGGSCYSCGESGH 138
           G GG G G GGG G GG  +  G  GH
Sbjct: 280 GDGGGGHGNGGGHGDGGGGHGNG-GGH 305

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 49/104 (47%), Positives = 54/104 (51%), Gaps = 6/104 (5%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGG------GYGGGGG 270
           N G +   N  G  G N  G   GGG GGG+  GGGG+G GG  G G      G GG  G
Sbjct: 373 NGGGNGGGNGGGNGGGN--GGGNGGGNGGGHGNGGGGHGNGGGNGNGNGSGGAGNGGANG 430

Query: 269 YGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
            G GRG GG  G+ GG  G G GGG G GGG GG   + G  GH
Sbjct: 431 VGNGRGNGGNSGNAGGSNGNG-GGGAGNGGGSGG---ANGTGGH 470

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 47/102 (46%), Positives = 50/102 (49%), Gaps = 3/102 (2%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGG 258
           S N G     + +G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GG 
Sbjct: 142 SGNGGSGGGTSGSGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGT 201

Query: 257 RGGGGYGG--SGGGYGGGG-RGGGRGGGGGGGGSCYSCGESG 141
            GGG  GG  SGGG  GGG  GGG  GGG  GG     G SG
Sbjct: 202 SGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 243

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 46/98 (46%), Positives = 49/98 (50%), Gaps = 3/98 (3%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYG-GGGGYGGGRGG 249
           G     N  G  G N  G   G GGG G   GGG  GG G   GGG+G GGGG+G G G 
Sbjct: 355 GNGGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGNGGGHGNGGGGHGNGGGN 414

Query: 248 GGYGGSGGGYGGG--GRGGGRGGGGGGGGSCYSCGESG 141
           G   GSGG   GG  G G GRG GG  G +  S G  G
Sbjct: 415 GNGNGSGGAGNGGANGVGNGRGNGGNSGNAGGSNGNGG 452

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 47/103 (45%), Positives = 51/103 (49%), Gaps = 15/103 (14%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGG-----GGGYERGGGGYGGGGSYGG----GGYGGG 276
           +G        G  GAN  G  RG GG     GG    GGGG G GG  GG    GG+G G
Sbjct: 414 NGNGNGSGGAGNGGANGVGNGRGNGGNSGNAGGSNGNGGGGAGNGGGSGGANGTGGHGNG 473

Query: 275 GGYGGGRGGGGYG-----GSGGGYG-GGGRGGGRGGGGGGGGS 165
           GG G G G GG G     G G G+G G G GGG G GG  GG+
Sbjct: 474 GGNGNGNGSGGAGNGGANGVGNGHGTGNGNGGGHGNGGSSGGN 516

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 46/98 (46%), Positives = 49/98 (50%), Gaps = 3/98 (3%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           GR    +  G  G    G+   GGG  G    GGG  GGG+ GGG  GGG   GG  GGG
Sbjct: 136 GRGGNASGNGGSGGGTSGSGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGG 195

Query: 245 GYGG--SGGGYGGGG-RGGGRGGGGGGGGSCYSCGESG 141
             GG  SGGG  GGG  GGG  GGG  GG     G SG
Sbjct: 196 TSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 233

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 43/95 (45%), Positives = 45/95 (47%), Gaps = 8/95 (8%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GG  GGG  GG G G 
Sbjct: 205 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGGHGG 264

Query: 218 GGGGRGGGRGGGGG--------GGGSCYSCGESGH 138
           GG G GGG G GGG        G G  +  G  GH
Sbjct: 265 GGDGDGGGHGNGGGHGDGGGGHGNGGGHGDGGGGH 299

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 43/88 (48%), Positives = 44/88 (50%), Gaps = 2/88 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG--SGG 225
           G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GG  GGG  GG  SGG
Sbjct: 190 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 249

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G  GGG  GG G GGGG G     G  G
Sbjct: 250 GTSGGGTSGGGGHGGGGDGDGGGHGNGG 277

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/95 (48%), Positives = 49/95 (51%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           G S + + TG  G N  G    GGG  G    GGG  GGG+  GGG  GGG  GGG  GG
Sbjct: 127 GTSGSTSGTGR-GGNASGNGGSGGGTSGSGTSGGGTSGGGT-SGGGTSGGGTSGGGTSGG 184

Query: 245 GYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G  G GG  GGG  GGG  GGG  GG     G SG
Sbjct: 185 GTSG-GGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 218

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 49/105 (46%), Positives = 52/105 (49%), Gaps = 6/105 (5%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGG---GGYGGGGSYGGGGYGGGGGY 267
           S   G   +   T   G +  GT  GG  GGG   GG   GG  GGG+ GGG  GGG   
Sbjct: 154 SGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 213

Query: 266 GGGRGGGGYGG--SGGGYGGGG-RGGGRGGGGGGGGSCYSCGESG 141
           GG  GGG  GG  SGGG  GGG  GGG  GGG  GG     G SG
Sbjct: 214 GGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 258

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 43/90 (47%), Positives = 45/90 (50%), Gaps = 4/90 (4%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGG--SGG 225
           G  G    G    GGG  G    GGG  GGG+ GGG  GGG   GG  GGG  GG  SGG
Sbjct: 175 GTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGGGTSGG 234

Query: 224 GYGGGGRGGG--RGGGGGGGGSCYSCGESG 141
           G  GGG  GG   GGG  GGG+    G  G
Sbjct: 235 GTSGGGTSGGGTSGGGTSGGGTSGGGGHGG 264

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 43/87 (49%), Positives = 44/87 (50%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           TG    +  GT RGG   G    GGG  G G S  GGG  GGG  GGG  GGG  G GG 
Sbjct: 125 TGGTSGSTSGTGRGGNASGNGGSGGGTSGSGTS--GGGTSGGGTSGGGTSGGGTSG-GGT 181

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGG  GGG  GGG  GG     G SG
Sbjct: 182 SGGGTSGGGTSGGGTSGGGTSGGGTSG 208

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 39/92 (42%), Positives = 43/92 (46%), Gaps = 9/92 (9%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYG---------GGGYGGGGGYGGGRGGG 246
           G  G N  G   GG G GG    G G G GG+ G         GGG G GGG GG  G G
Sbjct: 409 GNGGGNGNGNGSGGAGNGGANGVGNGRGNGGNSGNAGGSNGNGGGGAGNGGGSGGANGTG 468

Query: 245 GYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCG 150
           G+G  GG   G G GG   GG  G G+ +  G
Sbjct: 469 GHGNGGGNGNGNGSGGAGNGGANGVGNGHGTG 500

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 42/92 (45%), Positives = 44/92 (47%), Gaps = 9/92 (9%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGG------GGGYGGGRGGG--GYGG 234
           G +  G   G G GGG   G GG  G G+ G  G GG      G   G GRGG   G GG
Sbjct: 87  GGSGSGNGNGSGNGGGNGNGSGGNNGNGAVGPAGVGGTTGGTSGSTSGTGRGGNASGNGG 146

Query: 233 SGGGYGGGG-RGGGRGGGGGGGGSCYSCGESG 141
           SGGG  G G  GGG  GGG  GG     G SG
Sbjct: 147 SGGGTSGSGTSGGGTSGGGTSGGGTSGGGTSG 178

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 45/99 (45%), Positives = 47/99 (47%), Gaps = 1/99 (1%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGG-GGYERGGGGYGGGGSYGGGGYGGGGGYGGG 258
           +  G +      GP G  V GT  G  G   G  RGG   G GGS  GGG  G G  GGG
Sbjct: 105 NGSGGNNGNGAVGPAG--VGGTTGGTSGSTSGTGRGGNASGNGGS--GGGTSGSGTSGGG 160

Query: 257 RGGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
             GGG  G GG  GGG  GGG  GGG  GG     G SG
Sbjct: 161 TSGGGTSG-GGTSGGGTSGGGTSGGGTSGGGTSGGGTSG 198

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 36/82 (43%), Positives = 38/82 (46%), Gaps = 3/82 (3%)
 Frame = -3

Query: 377 QGTRRGGGGGGGYERGGG---GYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGG 207
           +G   GG G GG   G G   G GGG   G GG  G G  G    GG  GG+ G   G G
Sbjct: 77  RGVGNGGAGAGGSGSGNGNGSGNGGGNGNGSGGNNGNGAVGPAGVGGTTGGTSGSTSGTG 136

Query: 206 RGGGRGGGGGGGGSCYSCGESG 141
           RGG   G GG GG     G SG
Sbjct: 137 RGGNASGNGGSGGGTSGSGTSG 158

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 36/79 (45%), Positives = 40/79 (50%)
 Frame = -3

Query: 431 NDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRG 252
           N G +   N  G  GA   G   G  G GG+  GGG   G GS GG G GG  G G G G
Sbjct: 440 NSGNAGGSNGNGGGGAGNGGGSGGANGTGGHGNGGGNGNGNGS-GGAGNGGANGVGNGHG 498

Query: 251 GGGYGGSGGGYGGGGRGGG 195
            G   G+GGG+G GG  GG
Sbjct: 499 TG--NGNGGGHGNGGSSGG 515

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 35/74 (47%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYG-GGGYGGGGGYGG 261
           S+ +G   A N  G  GAN  G   G GGG G   G GG G GG+ G G G+G G G GG
Sbjct: 447 SNGNGGGGAGNGGGSGGANGTGGH-GNGGGNGNGNGSGGAGNGGANGVGNGHGTGNGNGG 505

Query: 260 GRGGGGYGGSGGGY 219
           G G G  G SGG +
Sbjct: 506 GHGNG--GSSGGNH 517

[192][TOP]
>UniRef100_Q9SIH2 Putative uncharacterized protein At2g36120 n=1 Tax=Arabidopsis
           thaliana RepID=Q9SIH2_ARATH
          Length = 255

 Score =  105 bits (262), Expect = 2e-21
 Identities = 54/89 (60%), Positives = 57/89 (64%), Gaps = 3/89 (3%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGG-GGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           GP G    G+  GGG G GG E GG G GGGG  GGGG GGGG +GGG GGG   G+GGG
Sbjct: 99  GPGGGYGGGSGEGGGAGYGGGEAGGHGGGGGGGAGGGGGGGGGAHGGGYGGGQGAGAGGG 158

Query: 221 YGGGGRG--GGRGGGGGGGGSCYSCGESG 141
           YGGGG G  GG GGGG GGG     GE G
Sbjct: 159 YGGGGAGGHGGGGGGGNGGGGGGGSGEGG 187

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 56/109 (51%), Positives = 61/109 (55%), Gaps = 12/109 (11%)
 Frame = -3

Query: 431 NDGRSKAVNVT---GPDGANVQGTRRG-GGGGGGYERG-----GGGYGGGGSYGGGGYGG 279
           N G S  + V    GP G +  G   G GGG GG+  G     GGG  GGG+ GGGG G 
Sbjct: 41  NSGLSAGLGVGIGGGPGGGSGYGGGSGEGGGAGGHGEGHIGGGGGGGHGGGAGGGGGGGP 100

Query: 278 GGGYGGGR---GGGGYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GGGYGGG    GG GYGG   G  GGG GGG GGGGGGGG  +  G  G
Sbjct: 101 GGGYGGGSGEGGGAGYGGGEAGGHGGGGGGGAGGGGGGGGGAHGGGYGG 149

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 57/112 (50%), Positives = 58/112 (51%), Gaps = 33/112 (29%)
 Frame = -3

Query: 374 GTRRGGGGGGGYERGGGGYGG------GGSYGGGGYGG-GGGYGGGRGGGGYGGS----- 231
           G   GGGGGGG    GGGYGG      GG YGGGG GG GGG GGG GGGG GGS     
Sbjct: 129 GGGAGGGGGGGGGAHGGGYGGGQGAGAGGGYGGGGAGGHGGGGGGGNGGGGGGGSGEGGA 188

Query: 230 -GGGY--------------------GGGGRGGGRGGGGGGGGSCYSCGESGH 138
            GGGY                    GGGG GGG GGGGGGGG   +    GH
Sbjct: 189 HGGGYGAGGGAGEGYGGGAGAGGHGGGGGGGGGSGGGGGGGGGYAAASGYGH 240

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 49/77 (63%), Positives = 50/77 (64%), Gaps = 2/77 (2%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGG--GGGYGGGRGGGGYGGSGGGYG 216
           GA   G   GG GGGG    GGG GGGG   GGGYGG  G G GGG GGGG GG GGG G
Sbjct: 113 GAGYGGGEAGGHGGGGGGGAGGGGGGGGGAHGGGYGGGQGAGAGGGYGGGGAGGHGGG-G 171

Query: 215 GGGRGGGRGGGGGGGGS 165
           GGG GGG GGG G GG+
Sbjct: 172 GGGNGGGGGGGSGEGGA 188

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 47/73 (64%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRG-GGGYGGSGGGYGGGGRGGGRGG 186
           GGGGGGG+  G GG GGGG   GGGYGGG G GGG G GGG  G  GG GGGG GGG GG
Sbjct: 81  GGGGGGGHGGGAGGGGGGGP--GGGYGGGSGEGGGAGYGGGEAGGHGGGGGGGAGGGGGG 138

Query: 185 GGGGGGSCYSCGE 147
           GGG  G  Y  G+
Sbjct: 139 GGGAHGGGYGGGQ 151

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 50/96 (52%), Positives = 54/96 (56%), Gaps = 1/96 (1%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGG 246
           G  +     G  G    G   GGGGGG    GGGG G GG++GGG YG GGG G G GGG
Sbjct: 148 GGGQGAGAGGGYGGGGAGGHGGGGGGGNGGGGGGGSGEGGAHGGG-YGAGGGAGEGYGGG 206

Query: 245 -GYGGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
            G GG GGG GGGG  GG GGGGGG  +    G  G
Sbjct: 207 AGAGGHGGGGGGGGGSGGGGGGGGGYAAASGYGHGG 242

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 47/81 (58%), Positives = 49/81 (60%), Gaps = 4/81 (4%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGG-GYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           G  G    G+  GG  GGGY  GGG G G GG  G GG+GGGGG GGG GGGG  G GGG
Sbjct: 174 GNGGGGGGGSGEGGAHGGGYGAGGGAGEGYGGGAGAGGHGGGGGGGGGSGGGG--GGGGG 231

Query: 221 Y---GGGGRGGGRGGGGGGGG 168
           Y    G G GGG GGG G GG
Sbjct: 232 YAAASGYGHGGGAGGGEGSGG 252

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 44/84 (52%), Positives = 47/84 (55%), Gaps = 12/84 (14%)
 Frame = -3

Query: 356 GGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGR-----------GGGGYGGSGGGYGGG 210
           G   G   G G   GGG  GG GYGGG G GGG            GGGG+GG  GG GGG
Sbjct: 39  GVNSGLSAGLGVGIGGGPGGGSGYGGGSGEGGGAGGHGEGHIGGGGGGGHGGGAGGGGGG 98

Query: 209 GRGGGRGGGGG-GGGSCYSCGESG 141
           G GGG GGG G GGG+ Y  GE+G
Sbjct: 99  GPGGGYGGGSGEGGGAGYGGGEAG 122

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 38/74 (51%), Positives = 41/74 (55%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGG 222
           +G  GA+  G   GGG G GY  G G  G GG  GGGG  G    GGG GGGGY  + G 
Sbjct: 183 SGEGGAHGGGYGAGGGAGEGYGGGAGAGGHGGGGGGGGGSG----GGGGGGGGYAAASGY 238

Query: 221 YGGGGRGGGRGGGG 180
             GGG GGG G GG
Sbjct: 239 GHGGGAGGGEGSGG 252

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 31/50 (62%), Positives = 31/50 (62%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGY 240
           GA   G   GGGGGGG   GGGG GGGG     GYG GGG GGG G GGY
Sbjct: 206 GAGAGG--HGGGGGGGGGSGGGGGGGGGYAAASGYGHGGGAGGGEGSGGY 253

[193][TOP]
>UniRef100_Q39337 Glycine-rich_protein_(Aa1-291) n=1 Tax=Brassica napus
           RepID=Q39337_BRANA
          Length = 291

 Score =  105 bits (262), Expect = 2e-21
 Identities = 54/87 (62%), Positives = 57/87 (65%), Gaps = 9/87 (10%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGG-GGYGGGGSYGGGGYGG-----GGGYGGGRG---GG 246
           GP G +  G   G GGG GY  GG GG+GGGG  GGGG GG     GGGYGGG G   GG
Sbjct: 95  GPGGGSGYGGGSGEGGGAGYGGGGAGGHGGGGGSGGGGGGGAGGAHGGGYGGGEGAGAGG 154

Query: 245 GYGGSGGGYGGGGRGGGRGGGGGGGGS 165
           GYGG G G  GGG GGG GGGGGGGG+
Sbjct: 155 GYGGGGAGGHGGGGGGGNGGGGGGGGA 181

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 58/113 (51%), Positives = 61/113 (53%), Gaps = 26/113 (23%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERG-----GGGYGGGGSYGGGGYGGGGGYGGGRGGG---- 246
           G  G N  G   GG  GGGY  G     GGGYGGGG+ GG G GGGGG GGG GGG    
Sbjct: 167 GGGGGNGGGGGGGGAHGGGYGGGEGAGAGGGYGGGGA-GGHGGGGGGGKGGGGGGGSGAG 225

Query: 245 ---------------GYGGSG--GGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
                          GYGG G  GG+GGGG GGG  GGGGGGG  Y+   SGH
Sbjct: 226 GAHGGGYGAGGGAGEGYGGGGGEGGHGGGGGGGGGAGGGGGGGGGYAAAGSGH 278

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 51/87 (58%), Positives = 55/87 (63%), Gaps = 5/87 (5%)
 Frame = -3

Query: 377 QGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGG--GGGYGGGRG---GGGYGGSGGGYGG 213
           +G   GGG GGG   G GG GGGG+ GGGG GG  GGGYGGG G   GGGYGG G G  G
Sbjct: 148 EGAGAGGGYGGGGAGGHGGGGGGGNGGGGGGGGAHGGGYGGGEGAGAGGGYGGGGAGGHG 207

Query: 212 GGRGGGRGGGGGGGGSCYSCGESGHFA 132
           GG GGG+GGGGGGG         G+ A
Sbjct: 208 GGGGGGKGGGGGGGSGAGGAHGGGYGA 234

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 49/85 (57%), Positives = 51/85 (60%), Gaps = 5/85 (5%)
 Frame = -3

Query: 389 GANVQGTRRGGGGGGGYERGGGGYGGGGSYGGG-----GYGGGGGYGGGRGGGGYGGSGG 225
           GA   G   GG GGGG   GGGG G GG++GGG     G G GGGYGGG  GG  GG GG
Sbjct: 111 GAGYGGGGAGGHGGGGGSGGGGGGGAGGAHGGGYGGGEGAGAGGGYGGGGAGGHGGGGGG 170

Query: 224 GYGGGGRGGGRGGGGGGGGSCYSCG 150
           G GGGG GGG  GGG GGG     G
Sbjct: 171 GNGGGGGGGGAHGGGYGGGEGAGAG 195

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 48/73 (65%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = -3

Query: 362 GGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGG 183
           GGGGGGG+  G GG GGGG  GG GYGGG G GGG G GG GG+GG  GGGG GGG GGG
Sbjct: 77  GGGGGGGHGGGAGGGGGGGPGGGSGYGGGSGEGGGAGYGG-GGAGGHGGGGGSGGGGGGG 135

Query: 182 GGGG-GSCYSCGE 147
            GG  G  Y  GE
Sbjct: 136 AGGAHGGGYGGGE 148

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 56/97 (57%), Positives = 60/97 (61%), Gaps = 10/97 (10%)
 Frame = -3

Query: 401 TGPDGANVQGTRRGGGGGGGYERG-GGGYGGGGS--YGGGGYGGGGGYGGGRG--GGGYG 237
           +G  G    G   GGG GGG   G GGGYGGGG+  +GGGG GG GG GGG G  GGGYG
Sbjct: 128 SGGGGGGGAGGAHGGGYGGGEGAGAGGGYGGGGAGGHGGGGGGGNGGGGGGGGAHGGGYG 187

Query: 236 G-----SGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           G     +GGGYGGGG  GG GGGGGGG      G SG
Sbjct: 188 GGEGAGAGGGYGGGG-AGGHGGGGGGGKGGGGGGGSG 223

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 57/105 (54%), Positives = 60/105 (57%), Gaps = 19/105 (18%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGG-----GY-----ERGGGGYGGGGSYG-GGGYGG 279
           G   A  + G  G    G   GGGGGG     GY     E GG GYGGGG+ G GGG G 
Sbjct: 69  GYGGAEGIGGGGGGGHGGGAGGGGGGGPGGGSGYGGGSGEGGGAGYGGGGAGGHGGGGGS 128

Query: 278 GGGYGGGRG---GGGYG-----GSGGGYGGGGRGGGRGGGGGGGG 168
           GGG GGG G   GGGYG     G+GGGYGGGG GG  GGGGGG G
Sbjct: 129 GGGGGGGAGGAHGGGYGGGEGAGAGGGYGGGGAGGHGGGGGGGNG 173

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/97 (54%), Positives = 56/97 (57%), Gaps = 7/97 (7%)
 Frame = -3

Query: 410 VNVTGPDGANVQGTRRGGGGGGGYER----GGGGYGGG-GSYGGGGYGGGGGYGGGRG-G 249
           + V    G    G   GG G GG E     GGGG+GGG G  GGGG GGG GYGGG G G
Sbjct: 50  IGVDAGVGVGGGGGEGGGAGYGGAEGIGGGGGGGHGGGAGGGGGGGPGGGSGYGGGSGEG 109

Query: 248 GGYGGSGGGYGGGGRGGGRGGGGGGG-GSCYSCGESG 141
           GG G  GGG GG G GGG GGGGGGG G  +  G  G
Sbjct: 110 GGAGYGGGGAGGHGGGGGSGGGGGGGAGGAHGGGYGG 146

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 52/104 (50%), Positives = 56/104 (53%), Gaps = 18/104 (17%)
 Frame = -3

Query: 425 GRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGG---------GYGGGG 273
           G  +     G  G    G   GGGGGG    GGGG G GG++GGG         GYGGGG
Sbjct: 187 GGGEGAGAGGGYGGGGAGGHGGGGGGGKGGGGGGGSGAGGAHGGGYGAGGGAGEGYGGGG 246

Query: 272 GYGG-GRGGGGYGGSGGGYGGG--------GRGGGRGGGGGGGG 168
           G GG G GGGG GG+GGG GGG        G GGG G G GGGG
Sbjct: 247 GEGGHGGGGGGGGGAGGGGGGGGGYAAAGSGHGGGAGRGEGGGG 290

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 44/75 (58%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = -3

Query: 356 GGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGG 177
           G G G + G G  GGGG  GG GYGG  G GGG GGGG+GG  GG GGGG GGG G GGG
Sbjct: 47  GYGIGVDAGVGVGGGGGEGGGAGYGGAEGIGGG-GGGGHGGGAGGGGGGGPGGGSGYGGG 105

Query: 176 ---GGGSCYSCGESG 141
              GGG+ Y  G +G
Sbjct: 106 SGEGGGAGYGGGGAG 120

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 41/69 (59%), Positives = 43/69 (62%), Gaps = 7/69 (10%)
 Frame = -3

Query: 323 GYG-----GGGSYGGGGYGGGGGYGG--GRGGGGYGGSGGGYGGGGRGGGRGGGGGGGGS 165
           GYG     G G  GGGG GGG GYGG  G GGGG GG GGG GGGG GGG GGG G GG 
Sbjct: 47  GYGIGVDAGVGVGGGGGEGGGAGYGGAEGIGGGGGGGHGGGAGGGG-GGGPGGGSGYGGG 105

Query: 164 CYSCGESGH 138
               G +G+
Sbjct: 106 SGEGGGAGY 114

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 30/53 (56%), Positives = 31/53 (58%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGY 240
           G  G   +G   GGGGGGG    GGG GGGG Y   G G GGG G G GGGGY
Sbjct: 241 GYGGGGGEGGHGGGGGGGG--GAGGGGGGGGGYAAAGSGHGGGAGRGEGGGGY 291

[194][TOP]
>UniRef100_C0PEX7 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0PEX7_MAIZE
          Length = 98

 Score =  105 bits (262), Expect = 2e-21
 Identities = 57/85 (67%), Positives = 59/85 (69%), Gaps = 10/85 (11%)
 Frame = -3

Query: 392 DGANVQ----GTRRGGGGGGGYERGGGGYGGGGSYGGG----GYGGGGGYGGGR--GGGG 243
           DG N+      +R GGGGGGGY   GGG GGGG YGGG    GYGGGGGYGG R  GGGG
Sbjct: 14  DGRNITVNQAQSRGGGGGGGGY---GGGRGGGGGYGGGRRDGGYGGGGGYGGRREGGGGG 70

Query: 242 YGGSGGGYGGGGRGGGRGGGGGGGG 168
           YGG GGGYGG   GGG G GGGGGG
Sbjct: 71  YGG-GGGYGGRREGGGGGYGGGGGG 94

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 50/84 (59%), Positives = 51/84 (60%), Gaps = 5/84 (5%)
 Frame = -3

Query: 428 DGRSKAVNVT----GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGG 261
           DGR+  VN      G  G    G  RGGGGG G  R  GGYGGGG YGG   GGGGGYGG
Sbjct: 14  DGRNITVNQAQSRGGGGGGGGYGGGRGGGGGYGGGRRDGGYGGGGGYGGRREGGGGGYGG 73

Query: 260 GRG-GGGYGGSGGGYGGGGRGGGR 192
           G G GG   G GGGYGGGG GG R
Sbjct: 74  GGGYGGRREGGGGGYGGGGGGGWR 97

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 45/71 (63%), Positives = 45/71 (63%), Gaps = 12/71 (16%)
 Frame = -3

Query: 317 GGGGSYGGGGY----GGGGGYGGGRGGGGYGGSGGGYGG--GGRGGGRGGGGG------G 174
           GGGG  GGGGY    GGGGGYGGGR  GGYGG GGGYGG   G GGG GGGGG      G
Sbjct: 27  GGGG--GGGGYGGGRGGGGGYGGGRRDGGYGG-GGGYGGRREGGGGGYGGGGGYGGRREG 83

Query: 173 GGSCYSCGESG 141
           GG  Y  G  G
Sbjct: 84  GGGGYGGGGGG 94

[195][TOP]
>UniRef100_B2YKT9 Glycine-rich RNA-binding protein n=1 Tax=Nicotiana tabacum
           RepID=B2YKT9_TOBAC
          Length = 157

 Score =  105 bits (262), Expect = 2e-21
 Identities = 56/93 (60%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = -3

Query: 434 DNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGY------GGGG 273
           D DGR+  VN         +   RG GGGGG   GGGGYGGGG YGGGG       GGGG
Sbjct: 71  DLDGRNITVN---------EAQSRGSGGGGGRGGGGGGYGGGGGYGGGGRREGGYGGGGG 121

Query: 272 GYGGGRGGGGYGGSGGGYGGGGRGGGRGGGGGG 174
           GYGGGR  GGYGG GGGYGGG R GG GGG  G
Sbjct: 122 GYGGGRRDGGYGG-GGGYGGGRREGGYGGGSEG 153

[196][TOP]
>UniRef100_A9S1L9 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9S1L9_PHYPA
          Length = 187

 Score =  105 bits (262), Expect = 2e-21
 Identities = 64/130 (49%), Positives = 72/130 (55%), Gaps = 21/130 (16%)
 Frame = -3

Query: 437 SDNDGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYG-- 264
           S  DGR+KA+ VTGP GA VQG          Y R G  YGGGG  GG G+GG G  G  
Sbjct: 66  SSEDGRTKALAVTGPGGAFVQGA--------SYRRDG--YGGGGDGGGRGFGGSGARGRG 115

Query: 263 -GGRGGGGYGGSGGG------YGGGGR----------GGGRGGGGGGGGS--CYSCGESG 141
            GGRG GG+GG GGG       G GG           G  R GG G GGS  C++CGE+G
Sbjct: 116 RGGRGSGGFGGVGGGDRPCYNCGEGGHIARDCQNEPTGSVRQGGSGAGGSRNCHTCGEAG 175

Query: 140 HFARDCPTSA 111
           HFARDC  +A
Sbjct: 176 HFARDCTPAA 185

[197][TOP]
>UniRef100_O02049 Putative uncharacterized protein n=1 Tax=Caenorhabditis elegans
           RepID=O02049_CAEEL
          Length = 259

 Score =  105 bits (262), Expect = 2e-21
 Identities = 61/108 (56%), Positives = 63/108 (58%), Gaps = 29/108 (26%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGG------GYERGGGGYGGGGS--YGGGGYGGGG--GYGGGRGG 249
           GP G  + G   GGGGGG      G   GGGGYGGGG   YGGGG+GGGG  GYGGG GG
Sbjct: 143 GPGGYGMGGYGGGGGGGGDFGGYGGGGMGGGGYGGGGDGGYGGGGFGGGGMGGYGGGMGG 202

Query: 248 GGYGGSG---GGYGGGGRGG-----GRGGG-----------GGGGGSC 162
           GGYGG G   GGYGGGG GG     G GGG           GGGGG C
Sbjct: 203 GGYGGGGMGGGGYGGGGDGGYGPSGGYGGGYGPGGGYGMGGGGGGGGC 250

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 55/91 (60%), Positives = 57/91 (62%), Gaps = 4/91 (4%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGG--GYGGGG--GYGGGRGGGGYGGS 231
           G  G    G   GG GGGGY  GGGGYGGGG  GGG  GYGGGG  G GGG GG G GG 
Sbjct: 95  GQGGYGGGGDFGGGMGGGGY--GGGGYGGGGDGGGGYGGYGGGGYGGMGGGPGGYGMGGY 152

Query: 230 GGGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           GGG GGGG  GG GGGG GGG     G+ G+
Sbjct: 153 GGGGGGGGDFGGYGGGGMGGGGYGGGGDGGY 183

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 51/81 (62%), Positives = 51/81 (62%), Gaps = 5/81 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGG--GGYGGGGSYGGGGYGGGGGYGGGRGG---GGYGG 234
           G  G    G   GG G GGY  GG  GG  GGG YGGGGYGGGG  GGG GG   GGYGG
Sbjct: 80  GGSGGGAFGGFNGGYGQGGYGGGGDFGGGMGGGGYGGGGYGGGGDGGGGYGGYGGGGYGG 139

Query: 233 SGGGYGGGGRGGGRGGGGGGG 171
            GGG GG G GG  GGGGGGG
Sbjct: 140 MGGGPGGYGMGGYGGGGGGGG 160

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 58/111 (52%), Positives = 61/111 (54%), Gaps = 24/111 (21%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGG-------------GGYGGGGSYGG--GGYGGG---- 276
           G  G    G   GGGG GGY  GG             GGYGGGG  GG  GGYGGG    
Sbjct: 113 GYGGGGYGGGGDGGGGYGGYGGGGYGGMGGGPGGYGMGGYGGGGGGGGDFGGYGGGGMGG 172

Query: 275 GGYG----GGRGGGGYGGSG-GGYGGGGRGGGRGGGGGGGGSCYSCGESGH 138
           GGYG    GG GGGG+GG G GGYGGG  GGG GGGG GGG     G+ G+
Sbjct: 173 GGYGGGGDGGYGGGGFGGGGMGGYGGGMGGGGYGGGGMGGGGYGGGGDGGY 223

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 58/105 (55%), Positives = 59/105 (56%), Gaps = 19/105 (18%)
 Frame = -3

Query: 398 GPDGANVQGTRRGG-GGGGGYERGG-------GGYGGGGSY----GGGGYGGGGGYGGGR 255
           GP  A      RGG GG GG   GG       GGYGGGG +    GGGGYGGGG  GGG 
Sbjct: 65  GPFAAMTGSYGRGGYGGSGGGAFGGFNGGYGQGGYGGGGDFGGGMGGGGYGGGGYGGGGD 124

Query: 254 GGGGYGG-SGGGYGGGGRG------GGRGGGGGGGGSCYSCGESG 141
           GGGGYGG  GGGYGG G G      GG GGGGGGGG     G  G
Sbjct: 125 GGGGYGGYGGGGYGGMGGGPGGYGMGGYGGGGGGGGDFGGYGGGG 169

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 52/90 (57%), Positives = 54/90 (60%), Gaps = 13/90 (14%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGG--GGSYGG-----GGYGGGGGYGGGRGGGGY 240
           G  G  + G   GGGG GG   GGGGYGG  GG YGG     GGYG GG  GGG GGG +
Sbjct: 103 GDFGGGMGGGGYGGGGYGGGGDGGGGYGGYGGGGYGGMGGGPGGYGMGGYGGGGGGGGDF 162

Query: 239 GG------SGGGYGGGGRGGGRGGGGGGGG 168
           GG       GGGYGGGG GG  GGG GGGG
Sbjct: 163 GGYGGGGMGGGGYGGGGDGGYGGGGFGGGG 192

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 43/70 (61%), Positives = 43/70 (61%), Gaps = 3/70 (4%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGG--GGYGGGGGYGGGRG-GGGYGGSG 228
           G  G    G   GG GGGGY  GGGG GGGG  GG  GGYG  GGYGGG G GGGYG  G
Sbjct: 186 GGFGGGGMGGYGGGMGGGGY--GGGGMGGGGYGGGGDGGYGPSGGYGGGYGPGGGYGMGG 243

Query: 227 GGYGGGGRGG 198
           GG GGG   G
Sbjct: 244 GGGGGGCPNG 253

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 40/72 (55%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -3

Query: 365 RGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSG---GGYGGGGRGGG 195
           R  G  G +    G YG GG YGG G G  GG+ GG G GGYGG G   GG GGGG GGG
Sbjct: 59  RTRGQRGPFAAMTGSYGRGG-YGGSGGGAFGGFNGGYGQGGYGGGGDFGGGMGGGGYGGG 117

Query: 194 RGGGGGGGGSCY 159
             GGGG GG  Y
Sbjct: 118 GYGGGGDGGGGY 129

[198][TOP]
>UniRef100_UPI0000DA2377 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA2377
          Length = 132

 Score =  105 bits (261), Expect = 2e-21
 Identities = 54/87 (62%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYG-GGGGYGGGRGGGGYGGSGGG 222
           G DG    G   GGGG GG   GG G GGGG  GGGG G GGGG GGG GGGG GG GGG
Sbjct: 8   GGDGGGGDGGGSGGGGDGGGGGGGDGGGGGGGGGGGGGGDGGGGDGGGDGGGGGGGGGGG 67

Query: 221 YGGGGRGGGRGGGGGGGGSCYSCGESG 141
            GGGG GG  GGGGGGGG     G+ G
Sbjct: 68  GGGGGDGGDDGGGGGGGGGGGGGGDGG 94

 Score =  100 bits (250), Expect = 4e-20
 Identities = 51/77 (66%), Positives = 51/77 (66%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G DG    G   GGGGGGG   GGGG GGGG  GG G GGGGG GGG GGGG GG  GG 
Sbjct: 22  GGDGGGGGGGDGGGGGGGG-GGGGGGDGGGGDGGGDGGGGGGGGGGGGGGGGDGGDDGGG 80

Query: 218 GGGGRGGGRGGGGGGGG 168
           GGGG GGG GG GG GG
Sbjct: 81  GGGGGGGGGGGDGGSGG 97

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 48/75 (64%), Positives = 50/75 (66%)
 Frame = -3

Query: 365 RGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGYGGGGRGGGRGG 186
           +GGGGG G    GGG GGGG  GGGG G GGG GGG GGGG G  GGG GGG  GGG GG
Sbjct: 4   QGGGGGDGGGGDGGGSGGGGDGGGGGGGDGGGGGGGGGGGGGGDGGGGDGGGDGGGGGGG 63

Query: 185 GGGGGGSCYSCGESG 141
           GGGGGG     G+ G
Sbjct: 64  GGGGGGGGGDGGDDG 78

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 48/77 (62%), Positives = 48/77 (62%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G DG    G   GGGGG G    GGG GGGG  GGGG GGGGG GG  GGGG GG GGG 
Sbjct: 30  GGDGGGGGGGGGGGGGGDGGGGDGGGDGGGGGGGGGGGGGGGGDGGDDGGGGGGGGGGGG 89

Query: 218 GGGGRGGGRGGGGGGGG 168
           GG G  GG G GG GGG
Sbjct: 90  GGDGGSGGDGSGGDGGG 106

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 50/83 (60%), Positives = 50/83 (60%), Gaps = 6/83 (7%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G DG    G   GGGGGGG   GGGG G GG  GGGG GGGGG GGG GG G  GSGG  
Sbjct: 45  GGDGGGGDGGGDGGGGGGGGGGGGGGGGDGGDDGGGGGGGGGGGGGGDGGSGGDGSGGDG 104

Query: 218 GG------GGRGGGRGGGGGGGG 168
           GG      GG GGG GG GGG G
Sbjct: 105 GGRDDDGSGGDGGGSGGDGGGSG 127

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 49/79 (62%), Positives = 49/79 (62%), Gaps = 2/79 (2%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG--GGYGGSGG 225
           G  G    G   GGGGGGG   GGGG GGG   GGGG GGGGG GGG GG  GG GG GG
Sbjct: 26  GGGGGGDGGGGGGGGGGGGGGDGGGGDGGGDGGGGGGGGGGGGGGGGDGGDDGGGGGGGG 85

Query: 224 GYGGGGRGGGRGGGGGGGG 168
           G GGGG GG  G G GG G
Sbjct: 86  GGGGGGDGGSGGDGSGGDG 104

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 53/92 (57%), Positives = 54/92 (58%), Gaps = 6/92 (6%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGG GG + GGGG GGGG  GGGG GG  G GGG GGGG GG  GG 
Sbjct: 36  GGGGGGGGGGGDGGGGDGGGDGGGGGGGGGGGGGGGGDGGDDGGGGGGGGGGGGGGDGGS 95

Query: 218 GG---GGRGGGR---GGGGGGGGSCYSCGESG 141
           GG   GG GGGR   G GG GGGS    G SG
Sbjct: 96  GGDGSGGDGGGRDDDGSGGDGGGSGGDGGGSG 127

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 48/87 (55%), Positives = 48/87 (55%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGG 249
           DG        G  G    G   GGGGGGG    GGG  GGG  GGGG GGGGG GGG  G
Sbjct: 15  DGGGSGGGGDGGGGGGGDGGGGGGGGGGGGGGDGGGGDGGGDGGGGGGGGGGGGGGGGDG 74

Query: 248 GGYGGSGGGYGGGGRGGGRGGGGGGGG 168
           G  GG GGG GGGG GG  G GG G G
Sbjct: 75  GDDGGGGGGGGGGGGGGDGGSGGDGSG 101

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 44/77 (57%), Positives = 45/77 (58%)
 Frame = -3

Query: 398 GPDGANVQGTRRGGGGGGGYERGGGGYGGGGSYGGGGYGGGGGYGGGRGGGGYGGSGGGY 219
           G  G    G   GGGG GG + GGGG GGGG  GGGG GG GG G G  GGG    G G 
Sbjct: 57  GGGGGGGGGGGGGGGGDGGDDGGGGGGGGGG--GGGGDGGSGGDGSGGDGGGRDDDGSGG 114

Query: 218 GGGGRGGGRGGGGGGGG 168
            GGG GG  GG GGGGG
Sbjct: 115 DGGGSGGDGGGSGGGGG 131

[199][TOP]
>UniRef100_Q9FUD5 Glycine-rich RNA-binding protein n=1 Tax=Sorghum bicolor
           RepID=Q9FUD5_SORBI
          Length = 170

 Score =  105 bits (261), Expect = 2e-21
 Identities = 57/93 (61%), Positives = 61/93 (65%), Gaps = 9/93 (9%)
 Frame = -3

Query: 392 DGANVQ----GTRRGGGGGGGYERGGGGYGG---GGSY--GGGGYGGGGGYGGGRGGGGY 240
           DG N+      +R GGGGGGGY  GGGGYGG   GG Y  GGGGYGG    GGG GGGGY
Sbjct: 75  DGRNITVNQAQSRGGGGGGGGYGGGGGGYGGRREGGGYGGGGGGYGGRREGGGGYGGGGY 134

Query: 239 GGSGGGYGGGGRGGGRGGGGGGGGSCYSCGESG 141
           GG GGGYGG   GGG  GGGGG G   + G+SG
Sbjct: 135 GGGGGGYGGRREGGGGYGGGGGYGG--NRGDSG 165

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/95 (57%), Positives = 56/95 (58%), Gaps = 10/95 (10%)
 Frame = -3

Query: 428 DGRSKAVNVTGPDGANVQGTRRGGGGGG-GYERGGGGYGGGGS------YGGGGYGGGGG 270
           DGR+  VN     G    G   GGGGGG G  R GGGYGGGG        GGGGY GGGG
Sbjct: 75  DGRNITVNQAQSRGGGGGGGGYGGGGGGYGGRREGGGYGGGGGGYGGRREGGGGY-GGGG 133

Query: 269 YGGGRGGGGYGG---SGGGYGGGGRGGGRGGGGGG 174
           YGG  GGGGYGG    GGGYGGGG  GG  G  GG
Sbjct: 134 YGG--GGGGYGGRREGGGGYGGGGGYGGNRGDSGG 166

[200][TOP]
>UniRef100_C0Z304 AT2G21660 protein n=2 Tax=Arabidopsis thaliana RepID=C