BB935156 ( RCC07906 )

[UP]


[1][TOP]
>UniRef100_UPI0001760174 PREDICTED: similar to Splicing factor U2AF 65 kDa subunit (U2
           auxiliary factor 65 kDa subunit) (U2 snRNP auxiliary
           factor large subunit) (hU2AF(65)) n=1 Tax=Danio rerio
           RepID=UPI0001760174
          Length = 578

 Score =  157 bits (396), Expect = 5e-37
 Identities = 85/154 (55%), Positives = 110/154 (71%), Gaps = 10/154 (6%)
 Frame = -2

Query: 434 MGEYEFE-EERRYEQPEGEGEDNYHNDSSPQPPAAA----DEDLTDSKSNHVSRDNDRES 270
           MGEYEFE EER+++Q +   ED+ HNDSSP PP       +EDLTDSK+N  SRDNDRES
Sbjct: 1   MGEYEFEDEERKFQQQD---EDHTHNDSSPPPPPPPPPVDEEDLTDSKTNLGSRDNDRES 57

Query: 269 SKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG 90
           S+SREK+RENGRE+ERKR+KGRDRDR+R+RD +  ++RER+R RD  RD  R +DR    
Sbjct: 58  SRSREKERENGREKERKRDKGRDRDRNRERDRDGEKERERDRDRDHHRD--RHRDRTERR 115

Query: 89  EKSKDRE-----RDRDGEKERDRDRDHHHRDRHR 3
           E+ +DR+     R R  ++ R+ DR+  HR R R
Sbjct: 116 ERVRDRDDDDYHRSRGYDRRREYDREDRHRSRRR 149

[2][TOP]
>UniRef100_B9SGJ4 Splicing factor u2af large subunit, putative n=1 Tax=Ricinus
           communis RepID=B9SGJ4_RICCO
          Length = 549

 Score =  125 bits (314), Expect = 1e-27
 Identities = 70/135 (51%), Positives = 89/135 (65%), Gaps = 8/135 (5%)
 Frame = -2

Query: 389 EGEG----EDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           EG G     DNY + D     P A  +D +DSKS H SRD++RESSKSREK+RE GR++E
Sbjct: 10  EGNGTDFDNDNYGSADGGGSSPPARPDDHSDSKSQHGSRDHERESSKSREKEREKGRDKE 69

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD-GEKSKDRERDRDGEK 48
                 RDRDR RDRD ++ RD++RE+SRDR RD ER +D+ RD   + +DR RDR   +
Sbjct: 70  ------RDRDRDRDRDKDRERDKDREKSRDRDRDRERDRDKDRDRHHRDRDRHRDRSERR 123

Query: 47  E--RDRDRDHHHRDR 9
           E  RDRD D +HR R
Sbjct: 124 ERGRDRDDDDYHRSR 138

[3][TOP]
>UniRef100_Q551H4 Serine/threonine-protein kinase fray2 n=1 Tax=Dictyostelium
            discoideum RepID=FRAY2_DICDI
          Length = 1028

 Score =  120 bits (302), Expect = 4e-26
 Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 1/105 (0%)
 Frame = -2

Query: 314  DSKSNHVSRDNDRESSK-SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSR 138
            +S+S +VSRD +RE  + +R +DR+  RERER R++ RDRDRSRDR  ++SRDRER+RSR
Sbjct: 747  NSRSRNVSRDRERERDRHNRSRDRDRERERERDRDRERDRDRSRDRSRDRSRDRERDRSR 806

Query: 137  DRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            DR RD +RS+DR RD  + +DR+R RD  ++R R RD   RDR R
Sbjct: 807  DRSRDRDRSRDRSRDRSRERDRDRSRDRSRDRSRSRDSDSRDRSR 851

 Score =  105 bits (262), Expect = 2e-21
 Identities = 61/141 (43%), Positives = 82/141 (58%), Gaps = 3/141 (2%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHV---SRDNDRESSKSREKDR 246
            E   RYE      +    + SS       + +    +SN     SR  +    + RE+DR
Sbjct: 704  EHSSRYESDRKSYKKKKSSSSSSNSKRDRERERDRDRSNKTYKNSRSRNVSRDRERERDR 763

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
             N R R+R RE+ R+RDR R+RD ++SRDR R+RSRDR RD  RS+DR RD ++S+DR R
Sbjct: 764  HN-RSRDRDRERERERDRDRERDRDRSRDRSRDRSRDRERD--RSRDRSRDRDRSRDRSR 820

Query: 65   DRDGEKERDRDRDHHHRDRHR 3
            DR  E++RDR RD   RDR R
Sbjct: 821  DRSRERDRDRSRD-RSRDRSR 840

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 56/141 (39%), Positives = 75/141 (53%), Gaps = 21/141 (14%)
 Frame = -2

Query: 383  EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR 204
            E E + HN S        D D    +     R+ DR+ S+ R +DR   RER+R R++ R
Sbjct: 758  ERERDRHNRSR-------DRDRERERERDRDRERDRDRSRDRSRDRSRDRERDRSRDRSR 810

Query: 203  DRDRSRDRDSEKSRDRERERSRDRVRDGERSKD--------------------RGRDG-E 87
            DRDRSRDR  ++SR+R+R+RSRDR RD  RS+D                    R RD   
Sbjct: 811  DRDRSRDRSRDRSRERDRDRSRDRSRDRSRSRDSDSRDRSRDRSRSHSNRRRSRSRDSRN 870

Query: 86   KSKDRERDRDGEKERDRDRDH 24
            KS+DR  D D  ++R RDRD+
Sbjct: 871  KSRDRSSDSDRSRDRSRDRDY 891

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 47/99 (47%), Positives = 61/99 (61%), Gaps = 3/99 (3%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
            RD DRE  + R +DR   R R+R+R++ RDR R RDR  ++SRDR RER RDR RD  R 
Sbjct: 778  RDRDRERDRDRSRDRSRDRSRDRERDRSRDRSRDRDRSRDRSRDRSRERDRDRSRDRSRD 837

Query: 110  KDRGRDGEKSKDRERDRD---GEKERDRDRDHHHRDRHR 3
            + R RD + S+DR RDR      + R R RD  ++ R R
Sbjct: 838  RSRSRDSD-SRDRSRDRSRSHSNRRRSRSRDSRNKSRDR 875

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 52/114 (45%), Positives = 68/114 (59%), Gaps = 9/114 (7%)
 Frame = -2

Query: 317  TDSKSNHVSR-DNDRESSKSREKDRENGRERERKREKGRDRDRSR-----DRDSEKSRDR 156
            T S   H SR ++DR+S K ++K   +    +R RE+ RDRDRS       R    SRDR
Sbjct: 699  TSSSDEHSSRYESDRKSYK-KKKSSSSSSNSKRDRERERDRDRSNKTYKNSRSRNVSRDR 757

Query: 155  ERER---SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            ERER   +R R RD ER ++R RD E+ +DR RDR  ++ RDR+RD   RDR R
Sbjct: 758  ERERDRHNRSRDRDRERERERDRDRERDRDRSRDRSRDRSRDRERD-RSRDRSR 810

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 58/158 (36%), Positives = 78/158 (49%), Gaps = 40/158 (25%)
 Frame = -2

Query: 356  SSPQPPAAADEDLTDSKSNHV-SRDNDRESSKSREKDR--------------ENGRERER 222
            S P  P++  E+ + SKSN   SR + R SS S   D               E+ R+  +
Sbjct: 658  SKPPSPSSDKENNSTSKSNKSKSRQSSRASSLSESSDSTSHTSSSDEHSSRYESDRKSYK 717

Query: 221  KREKGRD-----RDRSRDRDSEK-------------SRDRERE-------RSRDRVRDGE 117
            K++         RDR R+RD ++             SRDRERE       R RDR R+ E
Sbjct: 718  KKKSSSSSSNSKRDRERERDRDRSNKTYKNSRSRNVSRDRERERDRHNRSRDRDRERERE 777

Query: 116  RSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R +DR RD ++S+DR RDR  ++ERDR RD   RDR R
Sbjct: 778  RDRDRERDRDRSRDRSRDRSRDRERDRSRD-RSRDRDR 814

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 46/122 (37%), Positives = 63/122 (51%), Gaps = 3/122 (2%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R    + E + +   D S       + D +  +S    R  DR   +SRE+DR+  R
Sbjct: 773  ERERERDRDRERDRDRSRDRSRDRSRDRERDRSRDRSRDRDRSRDRSRDRSRERDRDRSR 832

Query: 233  ERERKREKGRD---RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
            +R R R + RD   RDRSRDR S    +R R RSRD      +S+DR  D ++S+DR RD
Sbjct: 833  DRSRDRSRSRDSDSRDRSRDR-SRSHSNRRRSRSRD---SRNKSRDRSSDSDRSRDRSRD 888

Query: 62   RD 57
            RD
Sbjct: 889  RD 890

[4][TOP]
>UniRef100_UPI00004E3D56 SWAP/Surp domain-containing protein n=1 Tax=Dictyostelium
           discoideum AX4 RepID=UPI00004E3D56
          Length = 944

 Score =  120 bits (300), Expect = 6e-26
 Identities = 61/131 (46%), Positives = 89/131 (67%), Gaps = 7/131 (5%)
 Frame = -2

Query: 374 DNYHNDSSPQPPAAADEDLTD-------SKSNHVSRDNDRESSKSREKDRENGRERERKR 216
           +N +N++S QPP   + D  D       S+ ++  RD DR+S + R++DR+   +R+R R
Sbjct: 135 NNNNNETSNQPPKELNRDTKDHRCVDRDSRDSYRDRDRDRDS-RDRDRDRDYRGDRDRDR 193

Query: 215 EKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDR 36
           ++ RDRDR R+RD ++ RDR  +R RDR RD ER +DR RD E+ +DRERDRD ++ER+R
Sbjct: 194 DRERDRDRDRERDRDRERDRG-DRDRDRDRDRERERDRDRDRERDRDRERDRDRDRERER 252

Query: 35  DRDHHHRDRHR 3
           DRD  +RDR R
Sbjct: 253 DRDRDYRDRDR 263

 Score =  102 bits (254), Expect = 1e-20
 Identities = 51/94 (54%), Positives = 69/94 (73%), Gaps = 4/94 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDR---ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG 120
           RD DRE  + RE+DR   +  R+R+R+RE+ RDRDR RDRD E+ RDR+RER RDR RD 
Sbjct: 199 RDRDRERDRDRERDRGDRDRDRDRDRERERDRDRDRERDRDRERDRDRDRERERDRDRD- 257

Query: 119 ERSKDRGRD-GEKSKDRERDRDGEKERDRDRDHH 21
              +DR RD  ++ +DR+RDRD +++RDRDRD +
Sbjct: 258 --YRDRDRDYRDRDRDRDRDRDRDRDRDRDRDRY 289

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/125 (37%), Positives = 71/125 (56%), Gaps = 6/125 (4%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLT-----DSKSNHVSRDNDRESSKSREK 252
           + +R  +  + + + +Y  D         D D       D + +   RD DR+  + RE+
Sbjct: 169 DRDRDRDSRDRDRDRDYRGDRDRDRDRERDRDRDRERDRDRERDRGDRDRDRDRDRERER 228

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRE-RERSRDRVRDGERSKDRGRDGEKSKD 75
           DR+  RER+R RE+ RDRDR R+RD    RDR+ R+R RD  RD +R +DR RD ++ +D
Sbjct: 229 DRDRDRERDRDRERDRDRDRERERD----RDRDYRDRDRD-YRDRDRDRDRDRDRDRDRD 283

Query: 74  RERDR 60
           R+RDR
Sbjct: 284 RDRDR 288

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 42/108 (38%), Positives = 64/108 (59%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE 147
           +D+ D   N+ + +N+  +  S +  +E  R+ +  R   RD      RDS + RDR+R+
Sbjct: 121 DDINDDDDNNNNNNNNNNNETSNQPPKELNRDTKDHRCVDRD-----SRDSYRDRDRDRD 175

Query: 146 RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            SRDR RD +   DR RD ++ +DR+RDR  E++RDR+RD   RDR R
Sbjct: 176 -SRDRDRDRDYRGDRDRDRDRERDRDRDR--ERDRDRERDRGDRDRDR 220

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 38/105 (36%), Positives = 55/105 (52%), Gaps = 4/105 (3%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           +Y  + +R  ++      D   +    +     D D    +     RD DRE  + RE+D
Sbjct: 184 DYRGDRDRDRDRERDRDRDRERDRDRERDRGDRDRDRDRDRERERDRDRDRERDRDRERD 243

Query: 248 RENGRERERKREKG---RDRD-RSRDRDSEKSRDRERERSRDRVR 126
           R+  RERER R++    RDRD R RDRD ++ RDR+R+R RDR R
Sbjct: 244 RDRDRERERDRDRDYRDRDRDYRDRDRDRDRDRDRDRDRDRDRDR 288

[5][TOP]
>UniRef100_Q9ZR40 Splicing factor U2af large subunit B n=1 Tax=Nicotiana
           plumbaginifolia RepID=U2A2B_NICPL
          Length = 573

 Score =  120 bits (300), Expect = 6e-26
 Identities = 67/147 (45%), Positives = 92/147 (62%), Gaps = 18/147 (12%)
 Frame = -2

Query: 389 EGEGED--NYHNDSSPQPPAAAD-------EDLTDSKSNHVSRDN--DRESSKSREKDRE 243
           EG GED  NY   SSP P + +        +D +DSKS H SR+N  DR+SS+SREKDRE
Sbjct: 5   EGNGEDIDNYTGGSSPPPKSRSSHGHGPTPDDYSDSKSQHSSRENEKDRDSSRSREKDRE 64

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
            GR+++R R++ RDR R RDR  ++ +DRERE+ RDR   G+R +DR    EK + R+RD
Sbjct: 65  RGRDKDRDRDRDRDRGRDRDRGRDRDKDREREKDRDR-HHGDRHRDRSDRREKERTRDRD 123

Query: 62  -------RDGEKERDRDRDHHHRDRHR 3
                  RD +++R+  +D   R RHR
Sbjct: 124 DDDRHRTRDYDQQREHAKDRESRHRHR 150

[6][TOP]
>UniRef100_UPI0001983175 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983175
          Length = 565

 Score =  119 bits (299), Expect = 8e-26
 Identities = 65/140 (46%), Positives = 93/140 (66%), Gaps = 4/140 (2%)
 Frame = -2

Query: 410 ERRYEQPEGEGEDNYHNDSSPQPPAAAD---EDLTDSKSNHVSRDNDRESSKSREKDREN 240
           E RYE   G GED  +  SSPQP  ++    +D +DSKS H SR+  RESSKSRE++RE 
Sbjct: 5   EGRYEG-NGNGEDLDNYGSSPQPRGSSHGGPDDYSDSKSQHGSREYQRESSKSREREREK 63

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK-DRERD 63
           GR+++R+R++ R+RD+ RDRD ++ ++R+R+R RDR RD    ++R RD +     R RD
Sbjct: 64  GRDKDRERDRDRERDKERDRDRDRDKERDRDR-RDRYRDRSDRRERTRDRDDDDFHRSRD 122

Query: 62  RDGEKERDRDRDHHHRDRHR 3
            D  ++ DRDRD  H+ R R
Sbjct: 123 YDRRRDFDRDRDDRHKRRSR 142

[7][TOP]
>UniRef100_A5BUJ8 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BUJ8_VITVI
          Length = 565

 Score =  119 bits (299), Expect = 8e-26
 Identities = 65/140 (46%), Positives = 93/140 (66%), Gaps = 4/140 (2%)
 Frame = -2

Query: 410 ERRYEQPEGEGEDNYHNDSSPQPPAAAD---EDLTDSKSNHVSRDNDRESSKSREKDREN 240
           E RYE   G GED  +  SSPQP  ++    +D +DSKS H SR+  RESSKSRE++RE 
Sbjct: 5   EGRYEG-NGNGEDLDNYGSSPQPRGSSHGGPDDYSDSKSQHGSREYQRESSKSREREREK 63

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK-DRERD 63
           GR+++R+R++ R+RD+ RDRD ++ ++R+R+R RDR RD    ++R RD +     R RD
Sbjct: 64  GRDKDRERDRDRERDKERDRDRDRDKERDRDR-RDRYRDRSDRRERTRDRDDDDFHRSRD 122

Query: 62  RDGEKERDRDRDHHHRDRHR 3
            D  ++ DRDRD  H+ R R
Sbjct: 123 YDRRRDFDRDRDDRHKRRSR 142

[8][TOP]
>UniRef100_Q8I1T4 Cyclin-dependent kinase, putative n=1 Tax=Plasmodium falciparum 3D7
            RepID=Q8I1T4_PLAF7
          Length = 1339

 Score =  119 bits (299), Expect = 8e-26
 Identities = 56/97 (57%), Positives = 73/97 (75%)
 Frame = -2

Query: 293  SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
            SRD DRE  + RE+DRE  RER+R RE+ R+R+R RDRD ++ RDR RER RDR RD ER
Sbjct: 1204 SRDRDRERDRDRERDRERDRERDRDRERDRERERDRDRDRDRERDRNRERDRDRERDRER 1263

Query: 113  SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             ++R RD ++ +DR+RDRD +++RDRDRD   RDR R
Sbjct: 1264 DRNRERDRDRDRDRDRDRDRDRDRDRDRD-RDRDRDR 1299

 Score =  115 bits (287), Expect = 2e-24
 Identities = 52/102 (50%), Positives = 75/102 (73%)
 Frame = -2

Query: 308  KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
            +S    R+ DR+  + RE+DRE  R+RER RE+ RDRDR RDR+ +++R+R+R+R RDR 
Sbjct: 1203 RSRDRDRERDRDRERDRERDRERDRDRERDRERERDRDRDRDRERDRNRERDRDRERDRE 1262

Query: 128  RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            RD  R +DR RD ++ +DR+RDRD +++RDRDRD   RDR +
Sbjct: 1263 RDRNRERDRDRDRDRDRDRDRDRDRDRDRDRDRD---RDREK 1301

 Score =  113 bits (283), Expect = 6e-24
 Identities = 51/103 (49%), Positives = 75/103 (72%)
 Frame = -2

Query: 311  SKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDR 132
            S+     RD DRE  + R+++R+  RER+R+RE+ RDRDR R+RD  + RDR+RER R+R
Sbjct: 1204 SRDRDRERDRDRERDRERDRERDRDRERDRERERDRDRDRDRERDRNRERDRDRERDRER 1263

Query: 131  VRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             R+ ER +DR RD ++ +DR+RDRD +++RDRDRD   ++R R
Sbjct: 1264 DRNRERDRDRDRDRDRDRDRDRDRDRDRDRDRDRD-REKERKR 1305

 Score =  111 bits (277), Expect = 3e-23
 Identities = 54/110 (49%), Positives = 72/110 (65%), Gaps = 2/110 (1%)
 Frame = -2

Query: 350  PQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSE 171
            P    + D D    +     R+ DRE  + RE+DRE  R+R+R R++ RDR+R RDRD E
Sbjct: 1199 PYGRRSRDRDRERDRDRERDRERDRERDRDRERDRERERDRDRDRDRERDRNRERDRDRE 1258

Query: 170  --KSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
              + RDR RER RDR RD +R +DR RD ++ +DR+RDRD EKER RD+D
Sbjct: 1259 RDRERDRNRERDRDRDRDRDRDRDRDRDRDRDRDRDRDRDREKERKRDKD 1308

 Score =  104 bits (260), Expect = 3e-21
 Identities = 58/141 (41%), Positives = 83/141 (58%), Gaps = 4/141 (2%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E   Y +   EG D+    S+       + D+   + +H SR+ +        + R+  R
Sbjct: 1150 ESNNYFRRSREGIDDRRRYSTICKTGYNNADVYRDRISHRSREREWYKKPYGRRSRDRDR 1209

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD----GERSKDRGRDGEKSKDRER 66
            ER+R RE+ R+RDR RDRD E+ R+RER+R RDR R+     ER +DR RD E+ ++RER
Sbjct: 1210 ERDRDRERDRERDRERDRDRERDRERERDRDRDRDRERDRNRERDRDRERDRERDRNRER 1269

Query: 65   DRDGEKERDRDRDHHHRDRHR 3
            DRD +++RDRDRD   RDR R
Sbjct: 1270 DRDRDRDRDRDRD-RDRDRDR 1289

 Score =  104 bits (259), Expect = 3e-21
 Identities = 47/136 (34%), Positives = 81/136 (59%), Gaps = 2/136 (1%)
 Frame = -2

Query: 413  EERRYEQPEGEG--EDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN 240
            E   Y++P G    + +   D   +     D +    +     R+ DR+  + RE+DR  
Sbjct: 1192 EREWYKKPYGRRSRDRDRERDRDRERDRERDRERDRDRERDRERERDRDRDRDRERDRNR 1251

Query: 239  GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
             R+R+R+R++ RDR+R RDRD ++ RDR+R+R RDR RD +R +DR R+ E+ +D+++D+
Sbjct: 1252 ERDRDRERDRERDRNRERDRDRDRDRDRDRDRDRDRDRDRDRDRDRDREKERKRDKDKDK 1311

Query: 59   DGEKERDRDRDHHHRD 12
            + +K +D D+  H  D
Sbjct: 1312 ENDKSKDADQKKHKLD 1327

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 41/125 (32%), Positives = 69/125 (55%), Gaps = 1/125 (0%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            +  R  + + E + +   D   +     D D    ++    RD +R+  + R ++R+  R
Sbjct: 1214 DRERDRERDRERDRDRERDRERERDRDRDRDRERDRNRERDRDRERDRERDRNRERDRDR 1273

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK-DRERDRD 57
            +R+R R++ RDRDR RDRD ++ RDRE+ER RD+ +D E  K +  D +K K D E  R 
Sbjct: 1274 DRDRDRDRDRDRDRDRDRDRDRDRDREKERKRDKDKDKENDKSKDADQKKHKLDTEELRV 1333

Query: 56   GEKER 42
             +K++
Sbjct: 1334 EKKKK 1338

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 41/127 (32%), Positives = 67/127 (52%), Gaps = 5/127 (3%)
 Frame = -2

Query: 368  YHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERK----REKGRD 201
            Y+++ SP      + +  + +      DN RES+    + RE   +R R     +    +
Sbjct: 1119 YNHNRSPSHAKKYNNEKREKEKKIEGIDNRRESNNYFRRSREGIDDRRRYSTICKTGYNN 1178

Query: 200  RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD-H 24
             D  RDR S +SR+RE  +       G RS+DR R+ ++ ++R+R+RD E++RDR+RD  
Sbjct: 1179 ADVYRDRISHRSREREWYKKPY----GRRSRDRDRERDRDRERDRERDRERDRDRERDRE 1234

Query: 23   HHRDRHR 3
              RDR R
Sbjct: 1235 RERDRDR 1241

[9][TOP]
>UniRef100_Q54TL3 SWAP/Surp domain-containing protein n=1 Tax=Dictyostelium
           discoideum RepID=Q54TL3_DICDI
          Length = 951

 Score =  119 bits (299), Expect = 8e-26
 Identities = 66/136 (48%), Positives = 91/136 (66%), Gaps = 12/136 (8%)
 Frame = -2

Query: 374 DNYHNDSSPQPPAAADEDLTDSK-SNHVSRDNDRESSKS-REKDRE-NGRERERKRE--- 213
           +N +N++S QPP   + D  D +  N   RD DR+S  S R++DR+ + R+R+R R+   
Sbjct: 135 NNNNNETSNQPPKELNRDTKDHRCGNDRDRDMDRDSRDSYRDRDRDRDSRDRDRDRDYRG 194

Query: 212 -KGRDRDRSRDRDSEKSRDRERERSR-----DRVRDGERSKDRGRDGEKSKDRERDRDGE 51
            + RDRDR RDRD ++ RDR+RER R     DR RD ER +DR RD E+ +DRERDRD +
Sbjct: 195 DRDRDRDRERDRDRDRERDRDRERDRGDRDRDRDRDRERERDRDRDRERDRDRERDRDRD 254

Query: 50  KERDRDRDHHHRDRHR 3
           +ER+RDRD  +RDR R
Sbjct: 255 RERERDRDRDYRDRDR 270

 Score =  102 bits (255), Expect = 1e-20
 Identities = 55/130 (42%), Positives = 81/130 (62%), Gaps = 3/130 (2%)
 Frame = -2

Query: 383 EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRER-ERKREKG 207
           +  D+Y +    +     D D          RD +R+  + RE+DR+  R+R +R R++ 
Sbjct: 169 DSRDSYRDRDRDRDSRDRDRDRDYRGDRDRDRDRERDRDRDRERDRDRERDRGDRDRDRD 228

Query: 206 RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG-RDGEKS-KDRERDRDGEKERDRD 33
           RDR+R RDRD ++ RDR+RER RDR R+ ER +DR  RD ++  +DR+RDRD +++RDRD
Sbjct: 229 RDRERERDRDRDRERDRDRERDRDRDRERERDRDRDYRDRDRDYRDRDRDRDRDRDRDRD 288

Query: 32  RDHHHRDRHR 3
           RD   RDR R
Sbjct: 289 RD---RDRDR 295

 Score =  102 bits (254), Expect = 1e-20
 Identities = 51/94 (54%), Positives = 69/94 (73%), Gaps = 4/94 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDR---ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG 120
           RD DRE  + RE+DR   +  R+R+R+RE+ RDRDR RDRD E+ RDR+RER RDR RD 
Sbjct: 206 RDRDRERDRDRERDRGDRDRDRDRDRERERDRDRDRERDRDRERDRDRDRERERDRDRD- 264

Query: 119 ERSKDRGRD-GEKSKDRERDRDGEKERDRDRDHH 21
              +DR RD  ++ +DR+RDRD +++RDRDRD +
Sbjct: 265 --YRDRDRDYRDRDRDRDRDRDRDRDRDRDRDRY 296

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/110 (43%), Positives = 69/110 (62%), Gaps = 2/110 (1%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKS-RDRER 150
           +D+ D   N+ + +N+  +  S +  +E  R+ +  R  G DRDR  DRDS  S RDR+R
Sbjct: 121 DDINDDDDNNNNNNNNNNNETSNQPPKELNRDTKDHR-CGNDRDRDMDRDSRDSYRDRDR 179

Query: 149 ER-SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +R SRDR RD +   DR RD ++ +DR+RDR  E++RDR+RD   RDR R
Sbjct: 180 DRDSRDRDRDRDYRGDRDRDRDRERDRDRDR--ERDRDRERDRGDRDRDR 227

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/125 (37%), Positives = 71/125 (56%), Gaps = 6/125 (4%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLT-----DSKSNHVSRDNDRESSKSREK 252
           + +R  +  + + + +Y  D         D D       D + +   RD DR+  + RE+
Sbjct: 176 DRDRDRDSRDRDRDRDYRGDRDRDRDRERDRDRDRERDRDRERDRGDRDRDRDRDRERER 235

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRE-RERSRDRVRDGERSKDRGRDGEKSKD 75
           DR+  RER+R RE+ RDRDR R+RD    RDR+ R+R RD  RD +R +DR RD ++ +D
Sbjct: 236 DRDRDRERDRDRERDRDRDRERERD----RDRDYRDRDRD-YRDRDRDRDRDRDRDRDRD 290

Query: 74  RERDR 60
           R+RDR
Sbjct: 291 RDRDR 295

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 38/105 (36%), Positives = 55/105 (52%), Gaps = 4/105 (3%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           +Y  + +R  ++      D   +    +     D D    +     RD DRE  + RE+D
Sbjct: 191 DYRGDRDRDRDRERDRDRDRERDRDRERDRGDRDRDRDRDRERERDRDRDRERDRDRERD 250

Query: 248 RENGRERERKREKG---RDRD-RSRDRDSEKSRDRERERSRDRVR 126
           R+  RERER R++    RDRD R RDRD ++ RDR+R+R RDR R
Sbjct: 251 RDRDRERERDRDRDYRDRDRDYRDRDRDRDRDRDRDRDRDRDRDR 295

[10][TOP]
>UniRef100_Q8I5S6 Eukaryotic translation initiation factor 3 subunit 10, putative n=1
            Tax=Plasmodium falciparum 3D7 RepID=Q8I5S6_PLAF7
          Length = 1377

 Score =  119 bits (297), Expect = 1e-25
 Identities = 60/141 (42%), Positives = 85/141 (60%), Gaps = 3/141 (2%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHN---DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            + +R  E+      D  H    D   +     D +    +     RD DRE  + R++DR
Sbjct: 1078 DRDRDRERDRDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDRDRDR 1137

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
            E  R+R+R+R++ RDR+R RDRD E  RDR+R+R RDR RD ER +DR R+ ++ +DRER
Sbjct: 1138 ERDRDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDRER 1197

Query: 65   DRDGEKERDRDRDHHHRDRHR 3
            DRD ++ER+RDRD   RDR R
Sbjct: 1198 DRDRDRERERDRD---RDRDR 1215

 Score =  118 bits (295), Expect = 2e-25
 Identities = 58/127 (45%), Positives = 80/127 (62%), Gaps = 1/127 (0%)
 Frame = -2

Query: 380  GEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRD 201
            G+D+Y            D      + +   RD DR+    RE+DR+  R+RE +R++ RD
Sbjct: 1047 GDDSYRRHDDHHDGTHRDRSEMRDRRDWSGRDRDRD----RERDRDRDRDREHRRDRDRD 1102

Query: 200  RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD-H 24
            R+R RDRD E+ RDR+RER RDR R+  R +DR R+ ++ +DRERDRD ++ERDRDRD  
Sbjct: 1103 RERDRDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDRE 1162

Query: 23   HHRDRHR 3
            H RDR R
Sbjct: 1163 HRRDRDR 1169

 Score =  108 bits (271), Expect = 1e-22
 Identities = 47/109 (43%), Positives = 73/109 (66%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D +    +     RD DR+  + R++DRE  R+R+R+R++ RDR+  RDRD ++ RDR+R
Sbjct: 1118 DRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDR 1177

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +R RDR RD ER +DR R+ ++ +DRER+RD +++RDRD     RD  +
Sbjct: 1178 DRERDRDRDRERDRDRDRERDRDRDRERERDRDRDRDRDIKRSDRDHKK 1226

 Score =  103 bits (258), Expect = 5e-21
 Identities = 52/109 (47%), Positives = 71/109 (65%), Gaps = 2/109 (1%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D D    +     RD DR+  + R++DRE+ R+R+R RE+ RDRDR RDRD ++ RDR+R
Sbjct: 1134 DRDRERDRDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDR 1193

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERD--RDRDHHHRDR 9
            +R RDR RD ER +DR RD ++   R  DRD +K+RD   DRD   R+R
Sbjct: 1194 DRERDRDRDRERERDRDRDRDRDIKRS-DRDHKKDRDDKLDRDSRRRER 1241

 Score =  100 bits (250), Expect = 4e-20
 Identities = 48/135 (35%), Positives = 76/135 (56%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E RR    + E + +   +         D D          RD +R+  + RE+DR+  R
Sbjct: 1094 EHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDR 1153

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
            ER+R R++   RDR RDR+ ++ RDRER+R RDR RD +R ++R RD ++ ++R+RDRD 
Sbjct: 1154 ERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDRERDRDRDRERERDRDRDR 1213

Query: 53   EKERDRDRDHHHRDR 9
            +++  R    H +DR
Sbjct: 1214 DRDIKRSDRDHKKDR 1228

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 39/103 (37%), Positives = 66/103 (64%), Gaps = 1/103 (0%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D +    +     RD DR+  + R++DRE  R+R+R+R++ RDR+R RDRD E+ RDR+R
Sbjct: 1152 DRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDRERDRDRDRERERDRDR 1211

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKD-RERDRDGEKERDRDRDH 24
            +R RD ++  +R   + RD +  +D R R+R G+ E ++ R++
Sbjct: 1212 DRDRD-IKRSDRDHKKDRDDKLDRDSRRRERSGKPENEKKREN 1253

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 63/166 (37%), Positives = 81/166 (48%), Gaps = 26/166 (15%)
 Frame = -2

Query: 422  EFEEERRYEQP-----EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
            E EEER  ++      + E        S  Q     + DL   +    SR ++R   KS 
Sbjct: 970  EEEEERLLKEEMERKKKEEARKKLEEISKAQRERDLEMDLQMKRKKEESRRSERSHRKSS 1029

Query: 257  EKD-----------RENGRERERKREKGRD---RDRSRDRD----SEKSRDRERERSRDR 132
              D            +NG +  R+ +   D   RDRS  RD    S + RDR+RER RDR
Sbjct: 1030 IDDDLTWRRGDKGGSQNGDDSYRRHDDHHDGTHRDRSEMRDRRDWSGRDRDRDRERDRDR 1089

Query: 131  VRDGERSKDRGRDGE--KSKDRERDRDGEKERDRDRD-HHHRDRHR 3
             RD E  +DR RD E  + +DRERDRD ++ERDRDRD  H RDR R
Sbjct: 1090 DRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDRDR 1135

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 37/93 (39%), Positives = 56/93 (60%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
            RD DR+  + R++DRE  R+R+R+R++ RDR+R RDRD ++ RD +R   RD  +D +  
Sbjct: 1173 RDRDRDRERDRDRDRERDRDRDRERDRDRDRERERDRDRDRDRDIKRS-DRDHKKDRDDK 1231

Query: 110  KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
             DR      S+ RER    E E+ R+ D   R+
Sbjct: 1232 LDR-----DSRRRERSGKPENEKKRENDISKRN 1259

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 39/122 (31%), Positives = 64/122 (52%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R    E + + +   D         D D    +     R+ DR+  + R++DR+  R
Sbjct: 1138 ERDRDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDRER 1197

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
            +R+R RE+ RDRDR RDRD ++S DR+ ++ RD   D + S+ R R G+   +++R+ D 
Sbjct: 1198 DRDRDRERERDRDRDRDRDIKRS-DRDHKKDRDDKLDRD-SRRRERSGKPENEKKRENDI 1255

Query: 53   EK 48
             K
Sbjct: 1256 SK 1257

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 42/142 (29%), Positives = 69/142 (48%), Gaps = 10/142 (7%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            E +R  ++      D  H     +     D +    +     RD DRE  + R+++R+  
Sbjct: 1146 ERDRDRDRERDRDRDREHRRDRDR-----DRERDRDRDRERDRDRDRERDRDRDRERDRD 1200

Query: 236  RERERKREKGRDRDRS---RDRDSEKSRDRERER-SRDRVRDGERSKDRGRDGEKSK--- 78
            R+RER+R++ RDRDR     DRD +K RD + +R SR R R G+   ++ R+ + SK   
Sbjct: 1201 RDRERERDRDRDRDRDIKRSDRDHKKDRDDKLDRDSRRRERSGKPENEKKRENDISKRNG 1260

Query: 77   ---DRERDRDGEKERDRDRDHH 21
               +R ++    KE D  +  H
Sbjct: 1261 TTEERTKNAWNLKEDDDSKAKH 1282

[11][TOP]
>UniRef100_B9SAI4 Nuclear inhibitor of protein phosphatase-1, putative n=1
           Tax=Ricinus communis RepID=B9SAI4_RICCO
          Length = 372

 Score =  118 bits (295), Expect = 2e-25
 Identities = 67/151 (44%), Positives = 90/151 (59%), Gaps = 28/151 (18%)
 Frame = -2

Query: 371 NYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR 192
           NY       PP   D D +DSKS H SRD++R+SSKSREK+RE GR++ER R++ RDRD+
Sbjct: 20  NYGGGGGSSPPPRVD-DYSDSKSQHRSRDHERDSSKSREKEREKGRDKERGRDRDRDRDK 78

Query: 191 SRDR--DSEKSRDRERERSRDRVRDGER-------SKDRGRDGEKSK-----DRERDRDG 54
            R+R  + E+SRDR+R+R RDR +D +R        KDR   GE+ +     D +R RD 
Sbjct: 79  DRERVKNRERSRDRDRDRERDRDKDRDRHHRDLDHHKDRSEMGERGRYRDDDDYQRSRDY 138

Query: 53  EKERDRDR--------------DHHHRDRHR 3
           +++R RD               DHHHR RHR
Sbjct: 139 DRDRRRDNDLNREENGQSTSPSDHHHRSRHR 169

[12][TOP]
>UniRef100_A7RX62 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7RX62_NEMVE
          Length = 686

 Score =  118 bits (295), Expect = 2e-25
 Identities = 55/148 (37%), Positives = 90/148 (60%), Gaps = 8/148 (5%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSN--------HVSRDNDRE 273
           E + +E+   +  E EG  +   +   +     D+D    + +        +  RD D+E
Sbjct: 420 ERKIKEDSVTKSDEDEGRSSERREKEEKKSRDKDKDRERERKDKKDRDRGRNKDRDRDKE 479

Query: 272 SSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD 93
             K R++D+E  RE++R+R+K RD++R RD+D E+ +DR++ER RD+ RD ER +D+ RD
Sbjct: 480 RDKDRDRDKERDREKDRERDKDRDKERDRDKDREREKDRDKERDRDKDRDKERDRDKDRD 539

Query: 92  GEKSKDRERDRDGEKERDRDRDHHHRDR 9
            E+ +DR+RDRD E+++DR RD   RDR
Sbjct: 540 KERDRDRDRDRDKERDKDRHRDRDRRDR 567

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 50/134 (37%), Positives = 76/134 (56%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E++ R +  + E E     D         D D    K     ++ DRE  + R+KDR+  
Sbjct: 446 EKKSRDKDKDRERERKDKKDRDRGRNKDRDRDKERDKDRDRDKERDREKDRERDKDRDKE 505

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           R+R++ RE+ +DRD+ RDRD  K RD+ER+R +DR ++ +R +DR RD E+ KDR RDRD
Sbjct: 506 RDRDKDREREKDRDKERDRD--KDRDKERDRDKDRDKERDRDRDRDRDKERDKDRHRDRD 563

Query: 56  GEKERDRDRDHHHR 15
               +++ RD   R
Sbjct: 564 RRDRKEKTRDRTSR 577

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 54/146 (36%), Positives = 82/146 (56%), Gaps = 6/146 (4%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSN----HVSRDNDRESSKS 261
           E E     R E+ E +  D    D   +     D D   +K         +D DR+  + 
Sbjct: 433 EDEGRSSERREKEEKKSRDK-DKDRERERKDKKDRDRGRNKDRDRDKERDKDRDRDKERD 491

Query: 260 REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER--ERSRDRVRDGERSKDRGRDGE 87
           REKDRE  ++R+++R++ +DR+R +DRD E+ RD++R  ER RD+ RD ER +DR RD +
Sbjct: 492 REKDRERDKDRDKERDRDKDREREKDRDKERDRDKDRDKERDRDKDRDKERDRDRDRDRD 551

Query: 86  KSKDRERDRDGEKERDRDRDHHHRDR 9
           K +D++R RD ++   RDR    RDR
Sbjct: 552 KERDKDRHRDRDR---RDRKEKTRDR 574

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 49/136 (36%), Positives = 72/136 (52%), Gaps = 2/136 (1%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN- 240
           E ER+ ++    G  N   D   +     D D    +     RD DR+  + R+KDRE  
Sbjct: 457 ERERKDKKDRDRGR-NKDRDRDKERDKDRDRDKERDREKDRERDKDRDKERDRDKDRERE 515

Query: 239 -GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R++ER R+K RD++R RD+D +K RDR+R+R RD+ RD +R +DR R   K K R+R 
Sbjct: 516 KDRDKERDRDKDRDKERDRDKDRDKERDRDRDRDRDKERDKDRHRDRDRRDRKEKTRDRT 575

Query: 62  RDGEKERDRDRDHHHR 15
                E  +    HH+
Sbjct: 576 SRSPSESPKRSSRHHK 591

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 36/132 (27%), Positives = 68/132 (51%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           R +  + + E +   D   +     D +    +     RD DRE  K R+K+R+  ++R+
Sbjct: 470 RNKDRDRDKERDKDRDRDKERDREKDRERDKDRDKERDRDKDREREKDRDKERDRDKDRD 529

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
           ++R++ +DRD+ RDRD ++ RD+ER++ R R RD    K++ RD       E  +   + 
Sbjct: 530 KERDRDKDRDKERDRDRDRDRDKERDKDRHRDRDRRDRKEKTRDRTSRSPSESPKRSSRH 589

Query: 44  RDRDRDHHHRDR 9
             R +D   +++
Sbjct: 590 HKRKKDKKSKEK 601

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 37/89 (41%), Positives = 59/89 (66%)
 Frame = -2

Query: 269 SKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG 90
           +KS E +  +   RE++ +K RD+D+ R+R+ +  +DR+R R++DR RD ER KDR    
Sbjct: 429 TKSDEDEGRSSERREKEEKKSRDKDKDRERERKDKKDRDRGRNKDRDRDKERDKDR---- 484

Query: 89  EKSKDRERDRDGEKERDRDRDHHHRDRHR 3
               DR+++RD EK+R+RD+D   RD+ R
Sbjct: 485 ----DRDKERDREKDRERDKD---RDKER 506

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 44/100 (44%), Positives = 59/100 (59%), Gaps = 15/100 (15%)
 Frame = -2

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE----------RSRDRVRDGERSK 108
           + D + GR  ER+    ++  +SRD+D    +DRERE          R++DR RD ER K
Sbjct: 430 KSDEDEGRSSERRE---KEEKKSRDKD----KDRERERKDKKDRDRGRNKDRDRDKERDK 482

Query: 107 DRGRDGE--KSKDRERDRDGEKERDRDRDHHH---RDRHR 3
           DR RD E  + KDRERD+D +KERDRD+D      RD+ R
Sbjct: 483 DRDRDKERDREKDRERDKDRDKERDRDKDREREKDRDKER 522

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 36/139 (25%), Positives = 68/139 (48%), Gaps = 12/139 (8%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           ++ R +  + + E +   D         + D    +     RD +R+  K R+K+R+  +
Sbjct: 477 DKERDKDRDRDKERDREKDRERDKDRDKERDRDKDREREKDRDKERDRDKDRDKERDRDK 536

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD------------GERSKDRGRDG 90
           +R+++R++ RDRDR ++RD ++ RDR+R   +++ RD              R   R +D 
Sbjct: 537 DRDKERDRDRDRDRDKERDKDRHRDRDRRDRKEKTRDRTSRSPSESPKRSSRHHKRKKD- 595

Query: 89  EKSKDRERDRDGEKERDRD 33
           +KSK++E  R      D D
Sbjct: 596 KKSKEKESTRRASDYEDSD 614

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 29/77 (37%), Positives = 50/77 (64%)
 Frame = -2

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           ER+ K +     D    R SE+ R++E ++SRD+ +D ER +   +D ++ ++++RDRD 
Sbjct: 420 ERKIKEDSVTKSDEDEGRSSER-REKEEKKSRDKDKDRERERKDKKDRDRGRNKDRDRDK 478

Query: 53  EKERDRDRDHHHRDRHR 3
           E+++DRDRD   RDR +
Sbjct: 479 ERDKDRDRD-KERDREK 494

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/131 (28%), Positives = 56/131 (42%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +E  R +  E E + +   D         D D    K     RD DR+  K R+KDR   
Sbjct: 504 KERDRDKDREREKDRDKERDRDKDRDKERDRDKDRDKER--DRDRDRDRDKERDKDRHRD 561

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           R+R  ++EK RDR      +S K   R  +R +D+    + S  R  D E S   +    
Sbjct: 562 RDRRDRKEKTRDRTSRSPSESPKRSSRHHKRKKDKKSKEKESTRRASDYEDSDIGKMSDT 621

Query: 56  GEKERDRDRDH 24
            ++++ RD  H
Sbjct: 622 EQEKKARDSSH 632

[13][TOP]
>UniRef100_UPI00019850D8 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019850D8
          Length = 1281

 Score =  117 bits (292), Expect = 5e-25
 Identities = 59/140 (42%), Positives = 85/140 (60%), Gaps = 3/140 (2%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           ++++ E P+ +   + + D   +     D D           D DR+  +  ++DR+  R
Sbjct: 334 QQKKSEPPDSDRNRDRNRDRDHEKERERDYDR--------DWDRDRDRDRDHDRDRDRDR 385

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           ERER R++ RDRDR RDRD E+ RDR+R+R RDR RD ER +DR RD ++ +DRERDRD 
Sbjct: 386 ERERDRDRERDRDRERDRDRERDRDRDRDRERDRDRDRERDRDRERDRDRDRDRERDRDH 445

Query: 53  EKERDRDRD---HHHRDRHR 3
            ++RDRDRD      RDR+R
Sbjct: 446 HRDRDRDRDLDQGRERDRNR 465

 Score =  111 bits (278), Expect = 2e-23
 Identities = 68/173 (39%), Positives = 91/173 (52%), Gaps = 30/173 (17%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAA--------DEDLTDSKSNHVSR---- 288
           G Y+ +E+   + PE    DN H D   +             D+ L D K     +    
Sbjct: 280 GRYK-DEKYTDKYPEDLDRDNRHRDDKQRDERLVRDRTSRLDDKHLRDDKETVEIQQKKS 338

Query: 287 ---DNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG- 120
              D+DR   ++R++D E  RER+  R+  RDRDR RD D ++ RDRERER RDR RD  
Sbjct: 339 EPPDSDRNRDRNRDRDHEKERERDYDRDWDRDRDRDRDHDRDRDRDRERERDRDRERDRD 398

Query: 119 -ERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-------------HHRDRHR 3
            ER +DR RD ++ +DRERDRD ++ERDRDR+              HHRDR R
Sbjct: 399 RERDRDRERDRDRDRDRERDRDRDRERDRDRERDRDRDRDRERDRDHHRDRDR 451

 Score =  111 bits (277), Expect = 3e-23
 Identities = 55/137 (40%), Positives = 81/137 (59%), Gaps = 2/137 (1%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +  R    E E E +Y  D         D D    +     RD DRE  + RE+DR+  R
Sbjct: 348 DRNRDRDHEKERERDYDRDWDRDRDRDRDHDRDRDRDRERERDRDRERDRDRERDRDRER 407

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           +R+R R++ RDRDR R+RD ++ RDR+R+R R+R RD  R +DR RD ++ ++R+R+RD 
Sbjct: 408 DRDRDRDRERDRDRDRERDRDRERDRDRDRDRERDRDHHRDRDRDRDLDQGRERDRNRDW 467

Query: 53  EKERDRDRDH--HHRDR 9
           +++  RDRDH  H  DR
Sbjct: 468 DRDGHRDRDHSSHLDDR 484

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 38/109 (34%), Positives = 59/109 (54%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D    +     R+ DR+  + R++DRE  R+R+R RE+ RD  R RDRD +  + RER
Sbjct: 402 DRDRERDRDRDRDRERDRDRDRERDRDRERDRDRDRDRERDRDHHRDRDRDRDLDQGRER 461

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +R+RD  RDG R +D     +    + +D  G+K+   D + H   + R
Sbjct: 462 DRNRDWDRDGHRDRDHSSHLDDRSSKYKDDRGKKKSPDDYEEHSITKSR 510

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 41/127 (32%), Positives = 57/127 (44%), Gaps = 11/127 (8%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
           E E + +   D   +     + D    +     RD DRE  + RE+DR+  R+RER R+ 
Sbjct: 386 ERERDRDRERDRDRERDRDRERDRDRDRDRERDRDRDRERDRDRERDRDRDRDRERDRDH 445

Query: 209 GRDRDRSR--------DRDSEKSRDRERERSRDRVRDGERSK---DRGRDGEKSKDRERD 63
            RDRDR R        DR+ +  RD  R+R      D   SK   DRG+  +KS D   +
Sbjct: 446 HRDRDRDRDLDQGRERDRNRDWDRDGHRDRDHSSHLDDRSSKYKDDRGK--KKSPDDYEE 503

Query: 62  RDGEKER 42
               K R
Sbjct: 504 HSITKSR 510

[14][TOP]
>UniRef100_UPI00017F0566 PREDICTED: similar to mCG119432 n=1 Tax=Sus scrofa
            RepID=UPI00017F0566
          Length = 1588

 Score =  117 bits (292), Expect = 5e-25
 Identities = 64/153 (41%), Positives = 93/153 (60%), Gaps = 11/153 (7%)
 Frame = -2

Query: 428  EYEFEEERR---YEQPEGEGE--DNYHNDSSPQPP----AAADEDLTDSK--SNHVSRDN 282
            E E  E+ R   +E+  GE E  DN   D  P  P       DE   D +     V R  
Sbjct: 611  ERENREQARDSSFERRHGERERRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRAE 670

Query: 281  DRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR 102
            DR   ++RE+DRE  RERER+RE+ RDR+R ++R+ E+ R RERER R+R ++ +R ++R
Sbjct: 671  DRRDERARERDRERDRERERERERERDREREKERELERERAREREREREREKERDRDRER 730

Query: 101  GRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             RD ++ ++RER+RD EKER+R+R+   R+R R
Sbjct: 731  DRDHDRERERERERDREKEREREREREERERER 763

 Score =  100 bits (250), Expect = 4e-20
 Identities = 53/149 (35%), Positives = 88/149 (59%), Gaps = 11/149 (7%)
 Frame = -2

Query: 416  EEERRYEQP---EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            E ++R   P   +G  ++   ++   +      ED  D ++    R+ DRE  + RE++R
Sbjct: 637  ERDQRPSSPIRHQGRNDELERDERREERRVDRAEDRRDERARERDRERDRERERERERER 696

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
            +  RE+ER+ E+ R R+R R+R+ EK RDR+RER RD  R+ ER ++R R+ E+ ++RER
Sbjct: 697  DREREKERELERERAREREREREREKERDRDRERDRDHDRERERERERDREKERERERER 756

Query: 65   -DRDGEKERDRDRDHH-------HRDRHR 3
             +R+ E+ER+R+R+          RDR R
Sbjct: 757  EERERERERERERERERAREREKERDRQR 785

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 53/142 (37%), Positives = 81/142 (57%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  ++ E E E     + + +     + +    +     RD+DRE  + RE+D
Sbjct: 687  ERERERERERDR-EREKERELERERAREREREREREKERDRDRERDRDHDRERERERERD 745

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            RE  RERER+RE+ R+R+R R+R+ E+ R RERE+ RDR RD E  KD+GR+ E+ + R+
Sbjct: 746  REKEREREREREE-RERERERERERERERAREREKERDRQRDWE-DKDKGRE-ERREKRD 802

Query: 68   RDRDGEKERDRDRDHHHRDRHR 3
              R+    RD   +   + R+R
Sbjct: 803  DAREDRNPRDGHEERKSKKRYR 824

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 46/134 (34%), Positives = 68/134 (50%), Gaps = 15/134 (11%)
 Frame = -2

Query: 386  GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS--------------REKD 249
            GE +         +P  +   D  DS+S H SR +  ES +               +E+D
Sbjct: 1224 GERKSRIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGSFDSRDRLQERD 1282

Query: 248  R-ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R E+ RERER+R   R R+  RD D    +D  R R RDR+R+ ER +D+ RD ++ ++R
Sbjct: 1283 RYEHERERERERRDARQREWERDAD----KDWPRNRDRDRLRERERERDKRRDVDRERER 1338

Query: 71   ERDRDGEKERDRDR 30
                  E++RDRDR
Sbjct: 1339 LISDSMERDRDRDR 1352

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 48/141 (34%), Positives = 68/141 (48%), Gaps = 6/141 (4%)
 Frame = -2

Query: 428  EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRE-SSKSRE 255
            E E E ER R  + E E E     D         + +    +     R+ +RE   + RE
Sbjct: 703  ERELERERAREREREREREKERDRDRERDRDHDRERERERERDREKEREREREREERERE 762

Query: 254  KDRENGRERERKREKGRDRDRSRD-RDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            ++RE  RERER RE+ ++RDR RD  D +K R+  RE+ RD  R+    +D G +  KSK
Sbjct: 763  RERERERERERAREREKERDRQRDWEDKDKGREERREK-RDDAREDRNPRD-GHEERKSK 820

Query: 77   DRERDRDGEKERD---RDRDH 24
             R R+      R    R R+H
Sbjct: 821  KRYRNEGSPSPRQSPKRRREH 841

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/91 (39%), Positives = 53/91 (58%)
 Frame = -2

Query: 314  DSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD 135
            DS+     RD   E  + RE++R + R+RE +R+  +D  R+RDRD    R RERER RD
Sbjct: 1273 DSRDRLQERDR-YEHERERERERRDARQREWERDADKDWPRNRDRD----RLRERERERD 1327

Query: 134  RVRDGERSKDRGRDGEKSKDRERDRDGEKER 42
            + RD +R ++R       +DR+RDR  E  +
Sbjct: 1328 KRRDVDRERERLISDSMERDRDRDRTFESSQ 1358

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 48/155 (30%), Positives = 67/155 (43%), Gaps = 55/155 (35%)
 Frame = -2

Query: 302  NHVSRDNDRESSKSREKDRENGRERERK-REKGRD-----RDRSRDRDSE---------- 171
            +H S  N  +S ++R    E  R  ER+ RE+ RD     R   R+R             
Sbjct: 586  SHSSSSNYHDSWETRSSYPERDRYPERENREQARDSSFERRHGERERRDNRERDQRPSSP 645

Query: 170  ------------------------------------KSRDRERERSRDRVRDGERSKDRG 99
                                                + RDRERER R+R RD ER K+R 
Sbjct: 646  IRHQGRNDELERDERREERRVDRAEDRRDERARERDRERDRERERERERERDREREKERE 705

Query: 98   RDGEKSKDRERDRDGEKERDRDRDH---HHRDRHR 3
             + E++++RER+R+ EKERDRDR+    H R+R R
Sbjct: 706  LERERAREREREREREKERDRDRERDRDHDRERER 740

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 39/101 (38%), Positives = 58/101 (57%), Gaps = 4/101 (3%)
 Frame = -2

Query: 293  SRDNDRESSKSREKDR---ENGRERERKREKGRDRDRSRDRDS-EKSRDRERERSRDRVR 126
            S  +DR+ S+S    R   E+ R+   +      RDR ++RD  E  R+RERER   R R
Sbjct: 1241 STSSDRQDSRSHSSRRSSPESDRQVHSRSGSFDSRDRLQERDRYEHERERERERRDARQR 1300

Query: 125  DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            + ER  D+  D  +++DR+R R+ E+ERD+ RD   R+R R
Sbjct: 1301 EWERDADK--DWPRNRDRDRLRERERERDKRRD-VDRERER 1338

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 44/144 (30%), Positives = 71/144 (49%), Gaps = 26/144 (18%)
 Frame = -2

Query: 365 HNDSSPQ----PPAAADEDLTDSKSNH--VSRDNDR------ESSKSREKDRENGRERER 222
           H+ SSPQ    PP          + +H   S+ +DR      E+   R+++++   ERE 
Sbjct: 378 HSLSSPQRKQSPPRHRSPLREKGRHDHERTSQSHDRRHERREETRGKRDREKDAREEREY 437

Query: 221 KREKGRDRDRSRDRDSEKSRDRERER-SRDR--------VRDGERSKDRGRDGEKSKDRE 69
           ++++G  RD   DR+  + R+R   R +RDR        +RD    +D  RD ++S+D  
Sbjct: 438 EQDQGSSRDHRDDREPREGRERRDARDTRDRRELRDSRDLRDSREMRDYSRDNKESRD-P 496

Query: 68  RD----RDGEKERDRD-RDHHHRD 12
           RD    RD    RDR+ RD H ++
Sbjct: 497 RDSRSARDAHDYRDRESRDAHRKE 520

[15][TOP]
>UniRef100_UPI0000F2DFC4 PREDICTED: similar to RIKEN cDNA 3110050K21 n=1 Tax=Monodelphis
            domestica RepID=UPI0000F2DFC4
          Length = 1589

 Score =  117 bits (292), Expect = 5e-25
 Identities = 61/157 (38%), Positives = 95/157 (60%), Gaps = 11/157 (7%)
 Frame = -2

Query: 440  PTMGEYEFEEERR---YEQPEGEGE--DNYHNDSSPQPPAA----ADEDLTDSK--SNHV 294
            P    Y+  ++ R   +E+  GE +  DN   D  P  P       DE   D +     +
Sbjct: 605  PERDRYDARDQARDSSFERRHGERDRRDNRERDPRPNSPVRHQGRGDELERDERREERRI 664

Query: 293  SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
             R +DR   ++RE++RE  RERER+RE+ RDR+R ++R+ E+ R RERER R+R +D ER
Sbjct: 665  DRTDDRRDERARERERERERERERERERERDREREKERELERDRAREREREREREKDRER 724

Query: 113  SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             ++R RD ++ ++RER+R+ EKER+R+R+   R+R R
Sbjct: 725  DRERDRDHDREREREREREREKEREREREERERERER 761

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 48/137 (35%), Positives = 84/137 (61%), Gaps = 8/137 (5%)
 Frame = -2

Query: 389  EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
            +G G++   ++   +      +D  D ++    R+ +RE  + RE++R+  RE+ER+ E+
Sbjct: 647  QGRGDELERDERREERRIDRTDDRRDERARERERERERERERERERERDREREKERELER 706

Query: 209  GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR-ERDRDGEKERDRD 33
             R R+R R+R+ EK R+R+RER RD  R+ ER ++R R+ E+ ++R ER+R+ E+ER+R+
Sbjct: 707  DRAREREREREREKDRERDRERDRDHDREREREREREREKEREREREERERERERERERE 766

Query: 32   RDHH-------HRDRHR 3
            R+          RDR R
Sbjct: 767  RERERGREREKERDRQR 783

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 50/160 (31%), Positives = 73/160 (45%), Gaps = 25/160 (15%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS-------- 261
            E+ +  E P GE +         +P  +   D  DS+S H SR +  ES +         
Sbjct: 1164 EKTKSLEIP-GERKSRIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGSF 1221

Query: 260  ------REKDR-ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR 102
                  +E+DR ++ RERER+R + R R+  RD D +  R+R+R R R+R RD  R  DR
Sbjct: 1222 DSRERLQERDRHDHDRERERERRETRQREWDRDTDKDWPRNRDRLRERERERDKRRDLDR 1281

Query: 101  GRDGEKSKDRERDRD----------GEKERDRDRDHHHRD 12
             R+ +     ERDRD            K  +   D H +D
Sbjct: 1282 ERERQNPDSSERDRDRTLDISSHIESSKRSETKLDEHEKD 1321

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 46/143 (32%), Positives = 75/143 (52%), Gaps = 9/143 (6%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR---EKDRENGR 234
           R  Q +G      +++S        + D  D+      RD  R+SS  R   E+DR + R
Sbjct: 581 RGSQVDGHNSGGNYHESWDSRSGYPERDRYDA------RDQARDSSFERRHGERDRRDNR 634

Query: 233 ERERK-----REKGRDRDRSRDRDSEKSR-DRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           ER+ +     R +GR  +  RD   E+ R DR  +R  +R R+ ER ++R R+ E+ ++R
Sbjct: 635 ERDPRPNSPVRHQGRGDELERDERREERRIDRTDDRRDERARERERERERERERERERER 694

Query: 71  ERDRDGEKERDRDRDHHHRDRHR 3
           +R+R+ E+E +RDR    R+R R
Sbjct: 695 DREREKERELERDR-ARERERER 716

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 46/140 (32%), Positives = 68/140 (48%), Gaps = 5/140 (3%)
 Frame = -2

Query: 428  EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRES-SKSRE 255
            E E E +R R  + E E E +   D         + +    +     R+ +RE   + RE
Sbjct: 701  ERELERDRAREREREREREKDRERDRERDRDHDREREREREREREKEREREREERERERE 760

Query: 254  KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
            ++RE  RERER RE+ ++RDR RD + +K RD  RE+ R+ +R+    +D   D  KSK 
Sbjct: 761  RERERERERERGREREKERDRQRDWE-DKGRDDRREK-REDIREDRNPRD-VHDERKSKK 817

Query: 74   RERDRDGEKERD---RDRDH 24
            R R       R    R R+H
Sbjct: 818  RHRTESSLSPRQSPKRRREH 837

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 43/148 (29%), Positives = 68/148 (45%), Gaps = 6/148 (4%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  ++      D  H+    +      E   + +     R+ +RE  + RE++
Sbjct: 711  EREREREREKDRERDRERDRDHDREREREREREREK--EREREREERERERERERERERE 768

Query: 248  RENGRERERKREKGRD-RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            RE GRERE++R++ RD  D+ RD   EK  D   +R+   V D  +SK R R  E S   
Sbjct: 769  RERGREREKERDRQRDWEDKGRDDRREKREDIREDRNPRDVHDERKSKKRHRT-ESSLSP 827

Query: 71   ERDRDGEKERDRDRDHHH-----RDRHR 3
             +     +E   D D ++      ++HR
Sbjct: 828  RQSPKRRREHSPDSDTYNSGDDKNEKHR 855

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 37/134 (27%), Positives = 63/134 (47%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           R+  P G  +  + ++ + Q      E   D++    +R+ +    +  ++D+ + R+  
Sbjct: 391 RHRSP-GREKGRHDHERTSQSHDRRHERREDTRGKRENREKETREEREYDQDQSSSRDHR 449

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
             RE    RDR   RD+     RE + SRD VRD   ++D  RD + S+D +RD    ++
Sbjct: 450 DDRESRDGRDRRETRDTRDR--RELKESRD-VRDSRDTRDYNRDNKDSRD-QRDSRSTRD 505

Query: 44  RDRDRDHHHRDRHR 3
               RD   RD HR
Sbjct: 506 THDYRDRESRDTHR 519

[16][TOP]
>UniRef100_UPI000155C9E6 PREDICTED: similar to RIKEN cDNA 3110050K21 n=1 Tax=Ornithorhynchus
            anatinus RepID=UPI000155C9E6
          Length = 1592

 Score =  116 bits (290), Expect = 9e-25
 Identities = 61/157 (38%), Positives = 94/157 (59%), Gaps = 11/157 (7%)
 Frame = -2

Query: 440  PTMGEYEFEEERR---YEQPEGEGE--DNYHNDSSPQPPA---AADEDLTDSK---SNHV 294
            P    Y+  E+ R   +E+  GE +  DN   D  P  P      ++DL   +      V
Sbjct: 603  PERDRYDSREQARDSSFERRHGERDRRDNRERDQRPSSPGRHQGRNDDLERDERREDRRV 662

Query: 293  SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
             R +DR   ++RE++RE  R+RER+RE+ R+RDR R+++ E  RDR RER R+R R+ +R
Sbjct: 663  ERADDRRDDRARERERERERDRERERERERERDREREKERELERDRAREREREREREKDR 722

Query: 113  SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             +DR RD E  +DRER+R+ E+E++R+R+   R+R R
Sbjct: 723  ERDRDRDREHDRDREREREREREKEREREREERERER 759

 Score =  103 bits (258), Expect = 5e-21
 Identities = 59/169 (34%), Positives = 88/169 (52%), Gaps = 26/169 (15%)
 Frame = -2

Query: 431  GEYEFEEERRYEQ-PEGEGEDNYHNDSSPQPPAAAD------EDLTDSKSNHVSRDNDRE 273
            GE +  + R  +Q P   G     ND   +     D      +D  D ++    R+ +R+
Sbjct: 624  GERDRRDNRERDQRPSSPGRHQGRNDDLERDERREDRRVERADDRRDDRARERERERERD 683

Query: 272  SSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD 93
              + RE++RE  RERE++RE  RDR R R+R+ E+ +DRER+R RDR  D +R ++R R+
Sbjct: 684  RERERERERERDREREKERELERDRAREREREREREKDRERDRDRDREHDRDRERERERE 743

Query: 92   GEKSKDRERD-------------------RDGEKERDRDRDHHHRDRHR 3
             EK ++RER+                   RD EKERDR RD   +D+ R
Sbjct: 744  REKEREREREERERERERERERERERERGRDREKERDRQRDWEDKDKGR 792

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 55/144 (38%), Positives = 76/144 (52%), Gaps = 3/144 (2%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  E+ E E E     +   +     D      +     +D +R+  + RE D
Sbjct: 675  ERERERERDRER-ERERERERDREREKERELERDRAREREREREREKDRERDRDRDREHD 733

Query: 248  RENGRERERKREKGRDRDRS---RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            R+  RERER+REK R+R+R    R+R+ E+ R+RERER RDR    E+ +DR RD E  K
Sbjct: 734  RDREREREREREKEREREREERERERERERERERERERGRDR----EKERDRQRDWE-DK 788

Query: 77   DRERDRDGEKERDRDRDHHHRDRH 6
            D+ R+   EK  D   D + RD H
Sbjct: 789  DKGREDRREKREDTREDRNPRDVH 812

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 51/142 (35%), Positives = 79/142 (55%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  ++ E E E     D + +     + +    +     R++DR+  + RE++
Sbjct: 685  ERERERERERDR-EREKERELERDRAREREREREREKDRERDRDRDREHDRDRERERERE 743

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            RE  RERER+ E+ R+R+R R+R+ E+ R R+RE+ RDR RD E  KD+GR+  + K RE
Sbjct: 744  REKERERERE-ERERERERERERERERERGRDREKERDRQRDWE-DKDKGREDRREK-RE 800

Query: 68   RDRDGEKERDRDRDHHHRDRHR 3
              R+    RD   +   + RHR
Sbjct: 801  DTREDRNPRDVHDERKSKKRHR 822

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 49/144 (34%), Positives = 68/144 (47%), Gaps = 9/144 (6%)
 Frame = -2

Query: 428  EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E E E +R R  + E E E +   D         D +    +     R+ +RE    RE+
Sbjct: 701  ERELERDRAREREREREREKDRERDRDRDREHDRDREREREREREKEREREREE---RER 757

Query: 251  DRENGRERERKREKGRDRDRSRDR-----DSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
            +RE  RERER+RE+GRDR++ RDR     D +K R+  RE+  D   D  R+     D  
Sbjct: 758  ERERERERERERERGRDREKERDRQRDWEDKDKGREDRREKREDTRED--RNPRDVHDER 815

Query: 86   KSKDRERDRDGEKERD---RDRDH 24
            KSK R R+      R    R R+H
Sbjct: 816  KSKKRHRNESSPSPRQSPKRRREH 839

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 47/124 (37%), Positives = 63/124 (50%), Gaps = 14/124 (11%)
 Frame = -2

Query: 386  GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK----------SREKDRENG 237
            GE +         +P  +   D  DS+S H SR +  ES +          SRE+ +E  
Sbjct: 1177 GERKSRIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGSFDSRERLQERD 1235

Query: 236  R-ERERKREKGRDR--DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD-RE 69
            R E ER+R  GR R  DR  D+D  ++RDRER R R+R R+  R  DR R+ +   D  E
Sbjct: 1236 RHEHERERRDGRQREWDRDADKDWPRARDRERLREREREREKRRELDRERERQMMADSAE 1295

Query: 68   RDRD 57
            RDRD
Sbjct: 1296 RDRD 1299

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 37/138 (26%), Positives = 62/138 (44%), Gaps = 1/138 (0%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  ++      D  H+    +      E   + +     R+ +RE  + RE++
Sbjct: 711  EREREREREKDRERDRDRDREHDRDREREREREREKEREREREERERERERERERERERE 770

Query: 248  RENGRERERKREKG-RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R   RE+ER R++   D+D+ R+   EK  D   +R+   V D  +SK R R+ E S   
Sbjct: 771  RGRDREKERDRQRDWEDKDKGREDRREKREDTREDRNPRDVHDERKSKKRHRN-ESSPSP 829

Query: 71   ERDRDGEKERDRDRDHHH 18
             +     +E   D D ++
Sbjct: 830  RQSPKRRREHSPDSDAYN 847

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 42/126 (33%), Positives = 57/126 (45%), Gaps = 8/126 (6%)
 Frame = -2

Query: 356 SSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK---DRE-----NGRERERKREKGRD 201
           SSP PP +       S S    R   R  S  REK   DRE     + R  ER+ +    
Sbjct: 371 SSPYPPRS-------SSSPQRKRSPSRHRSPGREKGRHDRECTSQSHDRRHERREDTRGK 423

Query: 200 RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHH 21
           RDR +D   E+  D+++  SRD  RD   S+D GRD  +++D    R+  + RD      
Sbjct: 424 RDREKDTREERDYDQDQNSSRDH-RDDRESRD-GRDRREARDNRDRREPRESRDTRDSRD 481

Query: 20  HRDRHR 3
            RD  R
Sbjct: 482 TRDYSR 487

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 39/138 (28%), Positives = 55/138 (39%), Gaps = 5/138 (3%)
 Frame = -2

Query: 407 RRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDR---ESSKSREKDRENG 237
           R +      G     +  SP+           + S  V R +      SS S ++ R   
Sbjct: 330 RHHSSSSQSGSSVQRHSPSPRRKRTPSPSYQRTASPPVRRSSSPYPPRSSSSPQRKRSPS 389

Query: 236 RERERKREKGR-DRD-RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
           R R   REKGR DR+  S+  D    R  +    RDR +D    +D  +D   S+D   D
Sbjct: 390 RHRSPGREKGRHDRECTSQSHDRRHERREDTRGKRDREKDTREERDYDQDQNSSRDHRDD 449

Query: 62  RDGEKERDRDRDHHHRDR 9
           R+    RDR     +RDR
Sbjct: 450 RESRDGRDRREARDNRDR 467

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 36/134 (26%), Positives = 58/134 (43%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           R+  P G  +  +  + + Q      E   D++     R+ D    +  ++D+ + R+  
Sbjct: 390 RHRSP-GREKGRHDRECTSQSHDRRHERREDTRGKR-DREKDTREERDYDQDQNSSRDHR 447

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
             RE    RDR   RD   +RDR   R     RD   ++D  RD + S+D +RD    ++
Sbjct: 448 DDRESRDGRDRREARD---NRDRREPRESRDTRDSRDTRDYSRDNKDSRD-QRDSRSTRD 503

Query: 44  RDRDRDHHHRDRHR 3
               RD   RD HR
Sbjct: 504 THDYRDRESRDTHR 517

[17][TOP]
>UniRef100_A5C811 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5C811_VITVI
          Length = 1499

 Score =  116 bits (290), Expect = 9e-25
 Identities = 58/140 (41%), Positives = 86/140 (61%), Gaps = 3/140 (2%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           ++++ E P+ +   + + D   +     D D           D DR+  +  ++DR+  R
Sbjct: 296 QQKKSEPPDSDRNRDRNRDRDHEKERERDYDR--------DWDRDRDRDRDHDRDRDRDR 347

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           ERER R++ RDRDR RDRD E+ RDR+R+R RDR RD ER +DR RD ++ +DRERDRD 
Sbjct: 348 ERERDRDRERDRDRERDRDRERDRDRDRDRERDRDRDRERDRDRERDRDRDRDRERDRDR 407

Query: 53  EKERDRDRD---HHHRDRHR 3
           +++R+RDRD      RDR+R
Sbjct: 408 DRDRERDRDLDQGRERDRNR 427

 Score =  111 bits (277), Expect = 3e-23
 Identities = 58/135 (42%), Positives = 80/135 (59%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +  R    E E E +Y  D         D D          RD +RE  + RE+DR+  R
Sbjct: 310 DRNRDRDHEKERERDYDRDWD------RDRDRDRDHDRDRDRDRERERDRDRERDRDRER 363

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           +R+R+R++ RDRDR RDRD ++ RDR+RER RDR RD ER +DR RD E+ +D ++ R+ 
Sbjct: 364 DRDRERDRDRDRDRERDRDRDRERDRDRERDRDRDRDRERDRDRDRDRERDRDLDQGRER 423

Query: 53  EKERDRDRDHHHRDR 9
           ++ RD DRD  HRDR
Sbjct: 424 DRNRDWDRD-GHRDR 437

 Score =  109 bits (273), Expect = 8e-23
 Identities = 66/160 (41%), Positives = 89/160 (55%), Gaps = 17/160 (10%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAA--------DEDLTDSKSNHVSR---- 288
           G Y+ +E+   + PE    DN H D   +             D+ L D K     +    
Sbjct: 242 GRYK-DEKYTDKYPEDLDRDNRHRDDKQRDERLVRDRTSRLDDKHLRDDKETVEIQQKKS 300

Query: 287 ---DNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG- 120
              D+DR   ++R++D E  RER+  R+  RDRDR RD D ++ RDRERER RDR RD  
Sbjct: 301 EPPDSDRNRDRNRDRDHEKERERDYDRDWDRDRDRDRDHDRDRDRDRERERDRDRERDRD 360

Query: 119 -ERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            ER +DR RD ++ +DRERDRD ++ERDRDR+   RDR R
Sbjct: 361 RERDRDRERDRDRDRDRERDRDRDRERDRDRE-RDRDRDR 399

 Score =  104 bits (260), Expect = 3e-21
 Identities = 55/140 (39%), Positives = 79/140 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           ++E E ER Y++      D   +    +     D D    +     RD DRE  + RE+D
Sbjct: 316 DHEKERERDYDRDWDRDRDRDRDHDRDR-----DRDRERERDRDRERDRDRERDRDRERD 370

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R+  R+RER R++ R+RDR R+RD ++ RDRER+R RDR R+ +R  D+GR+    +DR 
Sbjct: 371 RDRDRDRERDRDRDRERDRDRERDRDRDRDRERDRDRDRDRERDRDLDQGRE----RDRN 426

Query: 68  RDRDGEKERDRDRDHHHRDR 9
           RD D +  RDRD   H  DR
Sbjct: 427 RDWDRDGHRDRDHSSHLDDR 446

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 42/131 (32%), Positives = 61/131 (46%), Gaps = 9/131 (6%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
           E E + +   D   +     + D    +     RD DRE  + RE+DR+  R+RER R++
Sbjct: 348 ERERDRDRERDRDRERDRDRERDRDRDRDRERDRDRDRERDRDRERDRDRDRDRERDRDR 407

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSK---DRGRDGEKSKDRERDRDG----- 54
            RDR+R RD D  + RDR R+  RD  RD + S    DR     K    + ++       
Sbjct: 408 DRDRERDRDLDQGRERDRNRDWDRDGHRDRDHSSHLDDRSSKSAKGNYSDMEKKSWSSSK 467

Query: 53  -EKERDRDRDH 24
            E + DR R H
Sbjct: 468 VESDADRGRSH 478

[18][TOP]
>UniRef100_UPI00016E5BAA UPI00016E5BAA related cluster n=1 Tax=Takifugu rubripes
            RepID=UPI00016E5BAA
          Length = 1827

 Score =  115 bits (289), Expect = 1e-24
 Identities = 60/150 (40%), Positives = 90/150 (60%), Gaps = 4/150 (2%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
            P  G    +E  R+ + EGE     H D   +     D D  D   +   RD+DR+  ++
Sbjct: 1661 PRKGRSRGKEGERHRETEGER----HRDQDAEKRRDRDRD-RDRTRDSDRRDHDRDRGRN 1715

Query: 260  REKDRENGRERERKRE----KGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD 93
            R+++RE  RERE++RE    K RDRDR RDRD ++ +DR R+R RDR RD ER +DR R+
Sbjct: 1716 RDREREREREREKRRERSRSKERDRDRDRDRDRDRGKDRGRDRDRDRDRDRERDRDRDRE 1775

Query: 92   GEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             ++ +DR+RDRD ++E+D++RD     R +
Sbjct: 1776 RDRDRDRDRDRDRDREKDKERDRRDGSRSK 1805

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 54/157 (34%), Positives = 86/157 (54%), Gaps = 14/157 (8%)
 Frame = -2

Query: 431  GEYEFEEERRYEQPEGEG-EDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE 255
            G  ++  +R  E+  G+  E    ++   +  A A      S+     R  + E  + R+
Sbjct: 1625 GSEQYRFDRLSEEEPGQALEQRSRSEQRKRARARAQPRKGRSRGKEGERHRETEGERHRD 1684

Query: 254  ------KDRENGRERER-------KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
                  +DR+  R+R R        R++GR+RDR R+R+ E+ + RER RS++R RD +R
Sbjct: 1685 QDAEKRRDRDRDRDRTRDSDRRDHDRDRGRNRDREREREREREKRRERSRSKERDRDRDR 1744

Query: 113  SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             +DR R  ++ +DR+RDRD ++ERDRDRD   RDR R
Sbjct: 1745 DRDRDRGKDRGRDRDRDRDRDRERDRDRD-RERDRDR 1780

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 40/129 (31%), Positives = 72/129 (55%), Gaps = 1/129 (0%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            + +R  ++       ++  D         + +    K    SR  +R+  + R++DR+ G
Sbjct: 1692 DRDRDRDRTRDSDRRDHDRDRGRNRDREREREREREKRRERSRSKERDRDRDRDRDRDRG 1751

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG-RDGEKSKDRERDR 60
            ++R R R++ RDRDR RDRD ++ RDR+R+R RDR RD E+ K+R  RDG +SK++  ++
Sbjct: 1752 KDRGRDRDRDRDRDRERDRDRDRERDRDRDRDRDRDRDREKDKERDRRDGSRSKEKREEK 1811

Query: 59   DGEKERDRD 33
              +    ++
Sbjct: 1812 KDKHSTSKE 1820

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 42/127 (33%), Positives = 60/127 (47%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E E+R E+   +  D   +          D D    +     RD DR+  + R++D
Sbjct: 1721 EREREREKRRERSRSKERDRDRDRDR-------DRDRGKDRGRDRDRDRDRDRERDRDRD 1773

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            RE              RDR RDRD ++ RDRE+++ RDR RDG RSK++    EK     
Sbjct: 1774 RE--------------RDRDRDRDRDRDRDREKDKERDR-RDGSRSKEKRE--EKKDKHS 1816

Query: 68   RDRDGEK 48
              ++GEK
Sbjct: 1817 TSKEGEK 1823

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 51/149 (34%), Positives = 68/149 (45%), Gaps = 12/149 (8%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSS-------PQPPAAADEDLTDSKSNHVSRDNDRESSKSRE 255
            E+RR     GE    + N  S       P PP     D     + H  R +    S+   
Sbjct: 1571 EDRRGPPSSGEMSGPHFNPHSQYGSRPHPSPPHRGSFDEHRVPAPHEGRAHHFGGSEQYR 1630

Query: 254  KDRENGRE-----RERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG 90
             DR +  E      +R R + R R R+R +   K R R +E  R R  +GER +D+  D 
Sbjct: 1631 FDRLSEEEPGQALEQRSRSEQRKRARARAQP-RKGRSRGKEGERHRETEGERHRDQ--DA 1687

Query: 89   EKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            EK +DR+RDRD  + RD DR  H RDR R
Sbjct: 1688 EKRRDRDRDRD--RTRDSDRRDHDRDRGR 1714

[19][TOP]
>UniRef100_UPI00016E5B8F UPI00016E5B8F related cluster n=1 Tax=Takifugu rubripes
            RepID=UPI00016E5B8F
          Length = 2124

 Score =  115 bits (289), Expect = 1e-24
 Identities = 60/150 (40%), Positives = 90/150 (60%), Gaps = 4/150 (2%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
            P  G    +E  R+ + EGE     H D   +     D D  D   +   RD+DR+  ++
Sbjct: 1958 PRKGRSRGKEGERHRETEGER----HRDQDAEKRRDRDRD-RDRTRDSDRRDHDRDRGRN 2012

Query: 260  REKDRENGRERERKRE----KGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD 93
            R+++RE  RERE++RE    K RDRDR RDRD ++ +DR R+R RDR RD ER +DR R+
Sbjct: 2013 RDREREREREREKRRERSRSKERDRDRDRDRDRDRGKDRGRDRDRDRDRDRERDRDRDRE 2072

Query: 92   GEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             ++ +DR+RDRD ++E+D++RD     R +
Sbjct: 2073 RDRDRDRDRDRDRDREKDKERDRRDGSRSK 2102

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 40/129 (31%), Positives = 72/129 (55%), Gaps = 1/129 (0%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            + +R  ++       ++  D         + +    K    SR  +R+  + R++DR+ G
Sbjct: 1989 DRDRDRDRTRDSDRRDHDRDRGRNRDREREREREREKRRERSRSKERDRDRDRDRDRDRG 2048

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG-RDGEKSKDRERDR 60
            ++R R R++ RDRDR RDRD ++ RDR+R+R RDR RD E+ K+R  RDG +SK++  ++
Sbjct: 2049 KDRGRDRDRDRDRDRERDRDRDRERDRDRDRDRDRDRDREKDKERDRRDGSRSKEKREEK 2108

Query: 59   DGEKERDRD 33
              +    ++
Sbjct: 2109 KDKHSTSKE 2117

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 49/139 (35%), Positives = 69/139 (49%), Gaps = 2/139 (1%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSS-PQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            E+ R+++   E     H+ +  P PP A       S + H   D+ R  S      +E G
Sbjct: 1879 EQYRFDRLSEEVRPVRHSGALLPTPPEALGSARAQSPNRHRD-DHWRRRSPETAMGQEPG 1937

Query: 236  RERERKREKGRDRDRSRDR-DSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
            +  E+ R +   R R+R R    K R R +E  R R  +GER +D+  D EK +DR+RDR
Sbjct: 1938 QALEQ-RSRSEQRKRARARAQPRKGRSRGKEGERHRETEGERHRDQ--DAEKRRDRDRDR 1994

Query: 59   DGEKERDRDRDHHHRDRHR 3
            D  + RD DR  H RDR R
Sbjct: 1995 D--RTRDSDRRDHDRDRGR 2011

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 42/127 (33%), Positives = 60/127 (47%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E E+R E+   +  D   +          D D    +     RD DR+  + R++D
Sbjct: 2018 EREREREKRRERSRSKERDRDRDRDR-------DRDRGKDRGRDRDRDRDRDRERDRDRD 2070

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            RE              RDR RDRD ++ RDRE+++ RDR RDG RSK++    EK     
Sbjct: 2071 RE--------------RDRDRDRDRDRDRDREKDKERDR-RDGSRSKEKRE--EKKDKHS 2113

Query: 68   RDRDGEK 48
              ++GEK
Sbjct: 2114 TSKEGEK 2120

[20][TOP]
>UniRef100_UPI00016E5B8E UPI00016E5B8E related cluster n=1 Tax=Takifugu rubripes
            RepID=UPI00016E5B8E
          Length = 2146

 Score =  115 bits (289), Expect = 1e-24
 Identities = 60/150 (40%), Positives = 90/150 (60%), Gaps = 4/150 (2%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
            P  G    +E  R+ + EGE     H D   +     D D  D   +   RD+DR+  ++
Sbjct: 1980 PRKGRSRGKEGERHRETEGER----HRDQDAEKRRDRDRD-RDRTRDSDRRDHDRDRGRN 2034

Query: 260  REKDRENGRERERKRE----KGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD 93
            R+++RE  RERE++RE    K RDRDR RDRD ++ +DR R+R RDR RD ER +DR R+
Sbjct: 2035 RDREREREREREKRRERSRSKERDRDRDRDRDRDRGKDRGRDRDRDRDRDRERDRDRDRE 2094

Query: 92   GEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             ++ +DR+RDRD ++E+D++RD     R +
Sbjct: 2095 RDRDRDRDRDRDRDREKDKERDRRDGSRSK 2124

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 40/129 (31%), Positives = 72/129 (55%), Gaps = 1/129 (0%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            + +R  ++       ++  D         + +    K    SR  +R+  + R++DR+ G
Sbjct: 2011 DRDRDRDRTRDSDRRDHDRDRGRNRDREREREREREKRRERSRSKERDRDRDRDRDRDRG 2070

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG-RDGEKSKDRERDR 60
            ++R R R++ RDRDR RDRD ++ RDR+R+R RDR RD E+ K+R  RDG +SK++  ++
Sbjct: 2071 KDRGRDRDRDRDRDRERDRDRDRERDRDRDRDRDRDRDREKDKERDRRDGSRSKEKREEK 2130

Query: 59   DGEKERDRD 33
              +    ++
Sbjct: 2131 KDKHSTSKE 2139

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 52/146 (35%), Positives = 72/146 (49%), Gaps = 9/146 (6%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSS-PQPPAAADEDLTDSKSNHV-------SRDNDRESSKSR 258
            E+ R+++   E     H+ +  P PP A       S + H        S +  R SS +R
Sbjct: 1893 EQYRFDRLSEEVRPVRHSGALLPTPPEALGSARAQSPNRHRDDHWRRRSPEIRRRSSTNR 1952

Query: 257  EKDRENGRERERKREKGRDRDRSRDR-DSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
            E   E G+  E+ R +   R R+R R    K R R +E  R R  +GER +D+  D EK 
Sbjct: 1953 EDAEEPGQALEQ-RSRSEQRKRARARAQPRKGRSRGKEGERHRETEGERHRDQ--DAEKR 2009

Query: 80   KDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR+RDRD  + RD DR  H RDR R
Sbjct: 2010 RDRDRDRD--RTRDSDRRDHDRDRGR 2033

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 42/127 (33%), Positives = 60/127 (47%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E E+R E+   +  D   +          D D    +     RD DR+  + R++D
Sbjct: 2040 EREREREKRRERSRSKERDRDRDRDR-------DRDRGKDRGRDRDRDRDRDRERDRDRD 2092

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            RE              RDR RDRD ++ RDRE+++ RDR RDG RSK++    EK     
Sbjct: 2093 RE--------------RDRDRDRDRDRDRDREKDKERDR-RDGSRSKEKRE--EKKDKHS 2135

Query: 68   RDRDGEK 48
              ++GEK
Sbjct: 2136 TSKEGEK 2142

[21][TOP]
>UniRef100_Q7RG05 Eukaryotic translation initiation factor 3 subunit 10 n=1
            Tax=Plasmodium yoelii yoelii RepID=Q7RG05_PLAYO
          Length = 1268

 Score =  115 bits (287), Expect = 2e-24
 Identities = 62/147 (42%), Positives = 84/147 (57%), Gaps = 12/147 (8%)
 Frame = -2

Query: 407  RRYEQPEGE-GEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRE 231
            RR+E    +  +DNY            D      +     RD +R+  + R++DRE  R+
Sbjct: 972  RRHETGTSQYDDDNYKRHHENNDDHYRDASEKKDRKTWSGRDRERDRERDRDRDRERDRD 1031

Query: 230  RERKREKGRDRDRS----------RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
            R+R+R++ RDRDR           R +D E+ RDRER+R RDR RD ER +DR RD E+ 
Sbjct: 1032 RDRERDRDRDRDRKYRREKEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRERD 1091

Query: 80   KDRERDRDGEKERDRDRDH-HHRDRHR 3
            +DRERDRD E+ERDRDR+    RDR R
Sbjct: 1092 RDRERDRDRERERDRDRERDRERDRDR 1118

 Score =  111 bits (278), Expect = 2e-23
 Identities = 56/161 (34%), Positives = 93/161 (57%), Gaps = 19/161 (11%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAA--------DEDLTDSKSNHVSRDNDRE 273
            +Y+ +  +R+     E  D+++ D+S +             D +    +     RD DRE
Sbjct: 980  QYDDDNYKRHH----ENNDDHYRDASEKKDRKTWSGRDRERDRERDRDRDRERDRDRDRE 1035

Query: 272  SSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD 93
              + R++DR+  RE+E +R++ +DR+R RDR+ ++ RDRER+R RDR R+ +R +DR R+
Sbjct: 1036 RDRDRDRDRKYRREKEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRERDRDRE 1095

Query: 92   GEKSKDRERDRDGEKERDRDRDH-----------HHRDRHR 3
             ++ ++RERDRD E++R+RDRD            H RDR R
Sbjct: 1096 RDRDRERERDRDRERDRERDRDRERGRDYRKDKDHRRDRER 1136

 Score =  110 bits (276), Expect = 4e-23
 Identities = 59/137 (43%), Positives = 76/137 (55%), Gaps = 2/137 (1%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R    + + E +   D         D      K     R  DRE  + RE+DRE  R
Sbjct: 1015 ERDRERDRDRDRERDRDRDRERDRDRDRDRKYRREKEYRRDRSKDRERDRDRERDRERDR 1074

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKD--RGRDGEKSKDRERDR 60
            ER+R+R++ R+RDR RDRD E+ RDRERER RDR RD ER +D  RGRD  K KD  RDR
Sbjct: 1075 ERDRERDRDRERDRERDRDRERDRDRERERDRDRERDRERDRDRERGRDYRKDKDHRRDR 1134

Query: 59   DGEKERDRDRDHHHRDR 9
            + ++ERD  +D    +R
Sbjct: 1135 ERDRERDYRKDGERENR 1151

 Score =  103 bits (258), Expect = 5e-21
 Identities = 46/109 (42%), Positives = 73/109 (66%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            +++    +S    RD DRE  + R+++R+  R+R+R+R++ RDRDR RDRD E+ RDR+R
Sbjct: 1049 EKEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRERDRDRERDRDRERERDRDR 1108

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            ER R+R RD ER +D  +D +  +DRERDR+ +  +D +R++   D  R
Sbjct: 1109 ERDRERDRDRERGRDYRKDKDHRRDRERDRERDYRKDGERENRRGDTRR 1157

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 54/109 (49%), Positives = 70/109 (64%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D D    +     ++  R+ SK RE+DR+  R+RER RE+ R+RDR R+RD E  RDR+R
Sbjct: 1037 DRDRDRDRKYRREKEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRE--RDRDR 1094

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            ER RDR R  ER +DR RD E+ +DRER RD  K++D  RD   RDR R
Sbjct: 1095 ERDRDRER--ERDRDRERDRERDRDRERGRDYRKDKDHRRD-RERDRER 1140

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 50/134 (37%), Positives = 73/134 (54%), Gaps = 6/134 (4%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADE--DLTDSKSNHVSRDNDRESSKSREKDRE 243
            + +R+Y +     E  Y  D S       D   D    +     RD DRE  + R++DRE
Sbjct: 1041 DRDRKYRR-----EKEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRERDRDRE 1095

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRD--RERERSRDRVRDGERS--KDRGRDGEKSKD 75
              R+RER+R++ R+RDR RDRD E+ RD  ++++  RDR RD ER   KD  R+  +   
Sbjct: 1096 RDRDRERERDRDRERDRERDRDRERGRDYRKDKDHRRDRERDRERDYRKDGERENRRGDT 1155

Query: 74   RERDRDGEKERDRD 33
            R  + D EK+RD+D
Sbjct: 1156 RRSENDREKKRDKD 1169

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/136 (34%), Positives = 75/136 (55%), Gaps = 9/136 (6%)
 Frame = -2

Query: 383  EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR 204
            + E++   + S +  +A DE          S+ +D    +  E + ++ R+   K+++  
Sbjct: 949  QNEESRSGEKSLRKSSADDEFTWRRHETGTSQYDDDNYKRHHENNDDHYRDASEKKDRKT 1008

Query: 203  DRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD--------GEKSKDRERDRDGEK 48
               R R+RD E+ RDR+RER RDR R+ +R +DR R          ++SKDRERDRD E+
Sbjct: 1009 WSGRDRERDRERDRDRDRERDRDRDRERDRDRDRDRKYRREKEYRRDRSKDRERDRDRER 1068

Query: 47   ERDRDRDH-HHRDRHR 3
            +R+RDR+    RDR R
Sbjct: 1069 DRERDRERDRERDRDR 1084

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 43/131 (32%), Positives = 65/131 (49%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            +E RR    + E + +   D         + D    +     RD +R+  + RE+DR+  
Sbjct: 1050 KEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRERDRDRERDRDRERERDRDRE 1109

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            R+RER R++ R RD  +D+D    RDRER+R RD  +DGER   RG       DRE+ RD
Sbjct: 1110 RDRERDRDRERGRDYRKDKDHR--RDRERDRERDYRKDGERENRRGDTRRSENDREKKRD 1167

Query: 56   GEKERDRDRDH 24
             +     + D+
Sbjct: 1168 KDDYTPNNSDN 1178

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 38/126 (30%), Positives = 60/126 (47%), Gaps = 2/126 (1%)
 Frame = -2

Query: 404  RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
            R    E + E +   D   +     D D    +     RD DRE  + R++DRE GR+  
Sbjct: 1066 RERDRERDRERDRERDRDRERDRERDRDRERDRDRERERDRDRERDRERDRDRERGRDYR 1125

Query: 224  RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG--EKSKDRERDRDGE 51
            + ++  RDR+R R+RD  K  +RE  R   R  + +R K R +D     + D E++R+  
Sbjct: 1126 KDKDHRRDRERDRERDYRKDGERENRRGDTRRSENDREKKRDKDDYTPNNSDNEKERNAW 1185

Query: 50   KERDRD 33
              R+ D
Sbjct: 1186 NIRNDD 1191

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 41/143 (28%), Positives = 65/143 (45%), Gaps = 5/143 (3%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHN---DSSPQPPAAADEDLTDS--KSNHVSRDNDRESSKSR 258
            E EE  R E+ E + ++  H    D   +     D ++     K N  SR  ++   KS 
Sbjct: 905  EEEERLRKEEIERKKKEEAHKKKLDEISRIQRERDLEIEQQLLKQNEESRSGEKSLRKSS 964

Query: 257  EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
              D    R  E    +  D +  R  ++     R+    +DR     R ++R R+ ++ +
Sbjct: 965  ADDEFTWRRHETGTSQYDDDNYKRHHENNDDHYRDASEKKDRKTWSGRDRERDRERDRDR 1024

Query: 77   DRERDRDGEKERDRDRDHHHRDR 9
            DRERDRD ++ERDRDRD   + R
Sbjct: 1025 DRERDRDRDRERDRDRDRDRKYR 1047

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 42/152 (27%), Positives = 65/152 (42%), Gaps = 14/152 (9%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            EEER+  + E   E+    +   +            + + + R+ D E  +   K  E  
Sbjct: 897  EEERKRREEE---EERLRKEEIERKKKEEAHKKKLDEISRIQRERDLEIEQQLLKQNEES 953

Query: 236  RERERKREKG--------RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR----GRD 93
            R  E+   K         R  +    +  + +  R  E + D  RD    KDR    GRD
Sbjct: 954  RSGEKSLRKSSADDEFTWRRHETGTSQYDDDNYKRHHENNDDHYRDASEKKDRKTWSGRD 1013

Query: 92   GEKSKDRERDRDGE--KERDRDRDHHHRDRHR 3
             E+ ++R+RDRD E  ++RDR+RD   RDR R
Sbjct: 1014 RERDRERDRDRDRERDRDRDRERD-RDRDRDR 1044

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 36/147 (24%), Positives = 58/147 (39%), Gaps = 20/147 (13%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            +  R    E E + +   D           D    K +   R+ DRE    ++ +REN R
Sbjct: 1093 DRERDRDRERERDRDRERDRERDRDRERGRDYRKDKDHRRDRERDRERDYRKDGERENRR 1152

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVR--------------------DGER 114
               R+ E  R++ R +D  +  + D E+ER+   +R                    +G  
Sbjct: 1153 GDTRRSENDREKKRDKDDYTPNNSDNEKERNAWNIRNDDGGIESDENKKNNIEGDDNGNN 1212

Query: 113  SKDRGRDGEKSKDRERDRDGEKERDRD 33
             K   RDGEK+KD E   + ++E   D
Sbjct: 1213 LKGNKRDGEKNKDNENANNDKREEKGD 1239

[22][TOP]
>UniRef100_Q55G70 Initiation factor eIF-4 gamma middle domain-containing protein n=1
           Tax=Dictyostelium discoideum RepID=Q55G70_DICDI
          Length = 925

 Score =  115 bits (287), Expect = 2e-24
 Identities = 61/144 (42%), Positives = 86/144 (59%), Gaps = 2/144 (1%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           EY+   ER Y+       D+Y N S  +  + +     D   N   RD +R+  K RE+D
Sbjct: 20  EYDSRRERDYK-------DSYDNKSKDRERSKSRSRSRDRDRNRYDRDRERDLEKERERD 72

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK--D 75
           R++ R R+R R++ R+RDR RD D  + RDR R+R  DR RD ER KDR RD ++ +  +
Sbjct: 73  RDHDRNRDRDRDRDRNRDRDRDHDRNRDRDRNRDRDHDRDRDREREKDRERDRDRDRYGN 132

Query: 74  RERDRDGEKERDRDRDHHHRDRHR 3
           +ERDRD ++ERDRDR+   RDR R
Sbjct: 133 KERDRDRDRERDRDRE---RDRER 153

 Score =  103 bits (256), Expect = 8e-21
 Identities = 51/122 (41%), Positives = 81/122 (66%), Gaps = 1/122 (0%)
 Frame = -2

Query: 368 YHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR-ERERKREKGRDRDR 192
           Y      +  +  + D  DS  N  S+D +R  S+SR +DR+  R +R+R+R+  ++R+R
Sbjct: 13  YQRGRDSEYDSRRERDYKDSYDNK-SKDRERSKSRSRSRDRDRNRYDRDRERDLEKERER 71

Query: 191 SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
            RD D  + RDR+R+R+RDR RD +R++DR R+ ++  DR+RDR+ EK+R+RDRD   RD
Sbjct: 72  DRDHDRNRDRDRDRDRNRDRDRDHDRNRDRDRNRDRDHDRDRDREREKDRERDRD---RD 128

Query: 11  RH 6
           R+
Sbjct: 129 RY 130

 Score =  101 bits (251), Expect = 3e-20
 Identities = 49/132 (37%), Positives = 78/132 (59%)
 Frame = -2

Query: 425 YEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
           Y+ + ER  E+      D+  N          D D    ++    RD+DR   + R +DR
Sbjct: 57  YDRDRERDLEKERERDRDHDRN---------RDRDRDRDRNRDRDRDHDRNRDRDRNRDR 107

Query: 245 ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
           ++ R+R+R+REK R+RDR RDR   K RDR+R+R RDR R+ +R ++R ++ E+ ++R+R
Sbjct: 108 DHDRDRDREREKDRERDRDRDRYGNKERDRDRDRERDRDRERDREREREKERERERERDR 167

Query: 65  DRDGEKERDRDR 30
           DR G++   RDR
Sbjct: 168 DRYGDRSTSRDR 179

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 52/139 (37%), Positives = 78/139 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E + E+ER  ++      D    D         D D    +  +  RD+DR+  + REKD
Sbjct: 62  ERDLEKERERDRDHDRNRDR-DRDRDRNRDRDRDHDRNRDRDRNRDRDHDRDRDREREKD 120

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           RE  R+R+R   K RDRDR R+RD ++ RDRERER ++R R+ ER +DR  D   S+DR 
Sbjct: 121 RERDRDRDRYGNKERDRDRDRERDRDRERDREREREKERERERERDRDRYGDRSTSRDR- 179

Query: 68  RDRDGEKERDRDRDHHHRD 12
           +D   + E D+D D+ +++
Sbjct: 180 KDTPTKTENDQDNDNTNKE 198

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 34/109 (31%), Positives = 59/109 (54%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D +    +  + +++ DR+  + R++DRE  RERER++E+ R+R+R RDR  ++S  R+R
Sbjct: 120 DRERDRDRDRYGNKERDRDRDRERDRDRERDREREREKERERERERDRDRYGDRSTSRDR 179

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
              +D     E  +D     ++ KD+ +D +    RD DR     D  R
Sbjct: 180 ---KDTPTKTENDQDNDNTNKEDKDKNKDIESNNTRD-DRSTSRDDSKR 224

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 34/97 (35%), Positives = 47/97 (48%), Gaps = 3/97 (3%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RD DRE  + RE+++E  RERER R++  DR  SRDR   K    + E  +D     +  
Sbjct: 143 RDRDRERDREREREKERERERERDRDRYGDRSTSRDR---KDTPTKTENDQDNDNTNKED 199

Query: 110 KDRGRDGEKSK---DRERDRDGEKERDRDRDHHHRDR 9
           KD+ +D E +    DR   RD  K +        R R
Sbjct: 200 KDKNKDIESNNTRDDRSTSRDDSKRKSTSGSSSSRRR 236

[23][TOP]
>UniRef100_C1GJ14 Putative uncharacterized protein n=1 Tax=Paracoccidioides
            brasiliensis Pb18 RepID=C1GJ14_PARBD
          Length = 1036

 Score =  115 bits (287), Expect = 2e-24
 Identities = 50/116 (43%), Positives = 78/116 (67%), Gaps = 1/116 (0%)
 Frame = -2

Query: 347  QPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK 168
            +P    D D    +     RD DR+  + R++DR+  R+R+R R++ RDRDR RDRD ++
Sbjct: 774  KPSRQRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDKDR 833

Query: 167  SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-HHRDRHR 3
             RD++R+R RD+ RD ++ +DR RD ++ +D++RDRD +K+RDRDRD    +DR R
Sbjct: 834  DRDKDRDRDRDKDRDRDKDRDRDRDRDRDRDKDRDRDKDKDRDRDRDRDKDKDRER 889

 Score =  113 bits (283), Expect = 6e-24
 Identities = 55/132 (41%), Positives = 79/132 (59%), Gaps = 3/132 (2%)
 Frame = -2

Query: 389  EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
            EG+       D         D D    +     RD DR+  + R++DR+  R+R+R R+K
Sbjct: 772  EGKPSRQRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDK 831

Query: 209  GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDR 30
             RDRD+ RDRD +K RDR+++R RDR RD +R KDR RD +K +DR+RDRD +K+R+R R
Sbjct: 832  DRDRDKDRDRDRDKDRDRDKDRDRDRDRDRDRDKDRDRDKDKDRDRDRDRDKDKDRERVR 891

Query: 29   DH---HHRDRHR 3
            +      RD+ R
Sbjct: 892  ERDPKRERDKDR 903

 Score =  109 bits (272), Expect = 1e-22
 Identities = 49/105 (46%), Positives = 76/105 (72%)
 Frame = -2

Query: 317  TDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSR 138
            +D +SN      + + S+ R++DR+  R+R+R R++ RDRDR RDRD ++ RDR+R+R R
Sbjct: 760  SDHRSNKGRSGIEGKPSRQRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDR 819

Query: 137  DRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            DR RD +R +D+ RD +K +DR+RD+D ++++DRDRD   RDR R
Sbjct: 820  DRDRDRDRDRDKDRDRDKDRDRDRDKDRDRDKDRDRD-RDRDRDR 863

 Score =  106 bits (265), Expect = 7e-22
 Identities = 46/109 (42%), Positives = 75/109 (68%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D D    +     RD DR+  + R++D++  R+++R R++ +DRDR +DRD ++ RDR+R
Sbjct: 804  DRDRDRDRDRDRDRDRDRDRDRDRDRDKDRDRDKDRDRDRDKDRDRDKDRDRDRDRDRDR 863

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            ++ RDR +D +R +DR RD +K ++R R+RD ++ERD+DRD   RDR R
Sbjct: 864  DKDRDRDKDKDRDRDRDRDKDKDRERVRERDPKRERDKDRD---RDRKR 909

 Score =  106 bits (264), Expect = 9e-22
 Identities = 55/121 (45%), Positives = 79/121 (65%), Gaps = 2/121 (1%)
 Frame = -2

Query: 359  DSSPQPPAAADEDLTDSKSNHVSRDNDR--ESSKSREKDRENGRERERKREKGRDRDRSR 186
            D +  P +    DL    S+H S       E   SR++DR+  R+R+R R++ RDRDR R
Sbjct: 742  DPNKLPSSEEKLDLAIRSSDHRSNKGRSGIEGKPSRQRDRD--RDRDRDRDRDRDRDRDR 799

Query: 185  DRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
            DRD ++ RDR+R+R RDR RD +R +DR RD ++ +D++RDRD +K+RDRD+D   RDR 
Sbjct: 800  DRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDKDRDRDKDRDRDRDKDRDRDKD-RDRDRD 858

Query: 5    R 3
            R
Sbjct: 859  R 859

 Score =  105 bits (263), Expect = 1e-21
 Identities = 47/109 (43%), Positives = 73/109 (66%), Gaps = 2/109 (1%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D D    +     RD DR+  + R+KDR+  ++R+R R+K RDRD+ RDRD ++ RDR++
Sbjct: 806  DRDRDRDRDRDRDRDRDRDRDRDRDKDRDRDKDRDRDRDKDRDRDKDRDRDRDRDRDRDK 865

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERD--RDGEKERDRDRDHHHRDR 9
            +R RD+ +D +R +DR +D ++ + RERD  R+ +K+RDRDR    RDR
Sbjct: 866  DRDRDKDKDRDRDRDRDKDKDRERVRERDPKRERDKDRDRDRKRSRRDR 914

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 40/108 (37%), Positives = 63/108 (58%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D D    +     RD D++  + R+KDR+  ++R+R R++ RDRD+ RDRD +K RDR+R
Sbjct: 820  DRDRDRDRDRDKDRDRDKDRDRDRDKDRDRDKDRDRDRDRDRDRDKDRDRDKDKDRDRDR 879

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
            +R +D+ R+  R +D  R+ +K +DR+R R          D  H  RH
Sbjct: 880  DRDKDKDRERVRERDPKRERDKDRDRDRKRSRRDRSGSREDTEHSRRH 927

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 39/109 (35%), Positives = 63/109 (57%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D D    +     RD DR+  + +++DR+  R+R+R R++ RD+DR RD+D ++ RDR+R
Sbjct: 822  DRDRDRDRDKDRDRDKDRDRDRDKDRDRDKDRDRDRDRDRDRDKDRDRDKDKDRDRDRDR 881

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            ++ +DR R  ER   R RD ++ +DR+R R        D +H  R   R
Sbjct: 882  DKDKDRERVRERDPKRERDKDRDRDRKRSRRDRSGSREDTEHSRRHARR 930

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 45/138 (32%), Positives = 74/138 (53%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            ++ER+ ++        + + +    P   D +L D +   V  +    S +  +    + 
Sbjct: 701  DKERKSDRKTTSTHWPHRHRTRSLSPRHRDHELGDGEIVGVDPNKLPSSEEKLDLAIRSS 760

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
              R  K   G +   SR RD ++ RDR+R+R RDR RD +R +DR RD ++ +DR+RDRD
Sbjct: 761  DHRSNKGRSGIEGKPSRQRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRD 820

Query: 56   GEKERDRDRDHHHRDRHR 3
             +++RDRDRD   +DR R
Sbjct: 821  RDRDRDRDRD---KDRDR 835

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 39/119 (32%), Positives = 66/119 (55%), Gaps = 11/119 (9%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D+D    K     RD DR+  K R++D++  R+R+R R+K +DR+R R+RD ++ RD++R
Sbjct: 844  DKDRDRDKDRDRDRDRDRDRDKDRDRDKDKDRDRDRDRDKDKDRERVRERDPKRERDKDR 903

Query: 149  ERSRDRVR--------DGERSKDRGRDGEKSKDRER---DRDGEKERDRDRDHHHRDRH 6
            +R R R R        D E S+   R  ++++  E+   DR+ +    R+   H +D H
Sbjct: 904  DRDRKRSRRDRSGSREDTEHSRRHARRLKRNEAEEQMAIDREKKSTEHRESRLHEKDPH 962

[24][TOP]
>UniRef100_Q63ZQ9 LOC494751 protein n=1 Tax=Xenopus laevis RepID=Q63ZQ9_XENLA
          Length = 2234

 Score =  114 bits (286), Expect = 3e-24
 Identities = 60/143 (41%), Positives = 88/143 (61%), Gaps = 4/143 (2%)
 Frame = -2

Query: 419  FEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN 240
            F++ RR   P+G+ E     + +       D++    +SN  SRD D+   +   K++E 
Sbjct: 2058 FDDRRREGDPDGQRERERSRNCNRDRERNWDKNRDWQRSNEPSRDWDKNRDRDANKEKEL 2117

Query: 239  GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG----RDGEKSKDR 72
             R R+R R+K RDR++ RDRD E+ RDRER+R RDRVR+ +R +DR     RDG + +DR
Sbjct: 2118 ERNRDRDRDKERDREKDRDRDRERERDRERDRDRDRVRERDRDRDRDRARERDGYRRRDR 2177

Query: 71   ERDRDGEKERDRDRDHHHRDRHR 3
             R RD +K+R+RDRD   RDR+R
Sbjct: 2178 SRSRDRDKDRERDRD-RDRDRNR 2199

 Score =  114 bits (286), Expect = 3e-24
 Identities = 53/109 (48%), Positives = 73/109 (66%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D D    K    +RD DR+  + REKDR+  RERER RE+ RDRDR R+RD ++ RDR R
Sbjct: 2108 DRDANKEKELERNRDRDRDKERDREKDRDRDRERERDRERDRDRDRVRERDRDRDRDRAR 2167

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            ER   R RD  RS+DR +D E+ +DR+RDR+ ++ER +DRD   ++ H+
Sbjct: 2168 ERDGYRRRDRSRSRDRDKDRERDRDRDRDRNRDRERGKDRDSKSKESHK 2216

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 63/179 (35%), Positives = 86/179 (48%), Gaps = 39/179 (21%)
 Frame = -2

Query: 422  EFEEERRYEQP--EG------EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESS 267
            EF + + +  P  EG      EG +   +DS P PP        D +      D  RE  
Sbjct: 2015 EFRQNKDHRNPPFEGRPRERYEGRNEKFDDSEPHPPDNIPSRGFDDRRREGDPDGQRERE 2074

Query: 266  KSREKDRENGRERERKRE------------KGRDRD--------RSRDRDSEKSRDRERE 147
            +SR  +R+  R  ++ R+            K RDRD        R+RDRD +K RDRE++
Sbjct: 2075 RSRNCNRDRERNWDKNRDWQRSNEPSRDWDKNRDRDANKEKELERNRDRDRDKERDREKD 2134

Query: 146  RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERD----------RDRD-HHHRDRHR 3
            R RDR R+ +R +DR RD  + +DR+RDRD  +ERD          RDRD    RDR R
Sbjct: 2135 RDRDRERERDRERDRDRDRVRERDRDRDRDRARERDGYRRRDRSRSRDRDKDRERDRDR 2193

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 47/119 (39%), Positives = 63/119 (52%), Gaps = 2/119 (1%)
 Frame = -2

Query: 389  EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
            E E E N   D   +     D D    +     RD DR+  + R++DR+  R RER   +
Sbjct: 2114 EKELERNRDRDRDKERDREKDRDRDRERERDRERDRDRDRVRERDRDRDRDRARERDGYR 2173

Query: 209  GRDRDRSRDRDS--EKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERD 39
             RDR RSRDRD   E+ RDR+R+R+RDR    ER KDR     KSK+  +D   +K +D
Sbjct: 2174 RRDRSRSRDRDKDRERDRDRDRDRNRDR----ERGKDR---DSKSKESHKDSKSDKSKD 2225

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 1/121 (0%)
 Frame = -2

Query: 428  EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E E E  R R    E + E +   D   +     D D    +     RD DR+  ++RE+
Sbjct: 2114 EKELERNRDRDRDKERDREKDRDRDRERERDRERDRD----RDRVRERDRDRDRDRARER 2169

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            D    R+R R R++ +DR+R RDRD +++RDRER + RD      +SK+  +D +  K +
Sbjct: 2170 DGYRRRDRSRSRDRDKDRERDRDRDRDRNRDRERGKDRD-----SKSKESHKDSKSDKSK 2224

Query: 71   E 69
            +
Sbjct: 2225 D 2225

[25][TOP]
>UniRef100_UPI00015550CE PREDICTED: hypothetical protein, partial n=1 Tax=Ornithorhynchus
           anatinus RepID=UPI00015550CE
          Length = 178

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/140 (40%), Positives = 83/140 (59%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           + E + R E    E  D+  +D + +     + D    +     RD +RE  +  E+DR 
Sbjct: 15  DLERDERREDRRVERADDRRDDRARERERERERDRERERERERERDREREKERELERDRA 74

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             RERE+ RE+ RDRDR  DRD E+ R+RERE+ R+R R+ ER ++R R+ E+ ++RER 
Sbjct: 75  REREREKDRERDRDRDREHDRDREREREREREKERERERE-ERERERERERERERERERG 133

Query: 62  RDGEKERDRDRDHHHRDRHR 3
           RD EKERDR RD   +D+ R
Sbjct: 134 RDREKERDRQRDWEDKDKGR 153

 Score =  103 bits (257), Expect = 6e-21
 Identities = 51/121 (42%), Positives = 80/121 (66%), Gaps = 3/121 (2%)
 Frame = -2

Query: 356 SSPQPPAAADEDLTDSK---SNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSR 186
           SSP      ++DL   +      V R +DR   ++RE++RE  R+RER+RE+ R+RDR R
Sbjct: 4   SSPGRHQGRNDDLERDERREDRRVERADDRRDDRARERERERERDRERERERERERDRER 63

Query: 185 DRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
           +++ E  RDR RER R+  +D ER +DR R+ ++ ++RER+R+ EKER+R+R+   R+R 
Sbjct: 64  EKERELERDRARERERE--KDRERDRDRDREHDRDREREREREREKEREREREERERERE 121

Query: 5   R 3
           R
Sbjct: 122 R 122

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 47/99 (47%), Positives = 68/99 (68%), Gaps = 7/99 (7%)
 Frame = -2

Query: 278 RESSKSREKDRENGRERERKREKGR-----DR--DRSRDRDSEKSRDRERERSRDRVRDG 120
           R SS  R + R +  ER+ +RE  R     DR  DR+R+R+ E+ RDRERER R+R RD 
Sbjct: 2   RPSSPGRHQGRNDDLERDERREDRRVERADDRRDDRARERERERERDRERERERERERDR 61

Query: 119 ERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ER K+R  + +++++RER++D E++RDRDR+ H RDR R
Sbjct: 62  EREKERELERDRAREREREKDRERDRDRDRE-HDRDRER 99

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/137 (36%), Positives = 72/137 (52%), Gaps = 1/137 (0%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E  R    E E E     D   +     + D    +     R+ DR+  +  ++DRE  R
Sbjct: 42  ERERERDRERERERERERDREREKERELERDRAREREREKDRERDRDRDREHDRDRERER 101

Query: 233 ERERKREKGRDRD-RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           ERER++E+ R+R+ R R+R+ E+ R+RERER RDR    E+ +DR RD E  KD+ R+  
Sbjct: 102 EREREKEREREREERERERERERERERERERGRDR----EKERDRQRDWE-DKDKGREDR 156

Query: 56  GEKERDRDRDHHHRDRH 6
            EK  D   D + RD H
Sbjct: 157 REKREDTREDRNPRDVH 173

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 50/131 (38%), Positives = 70/131 (53%), Gaps = 1/131 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  ++ E E E     D + +     D +    +     RD +RE  + REK+
Sbjct: 50  ERERERERERDR-EREKERELERDRAREREREKDRERDRDRDREHDRDREREREREREKE 108

Query: 248 RENGRE-RERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           RE  RE RER+RE+ R+R+R      E+ R R+RE+ RDR RD E  KD+GR+  + K R
Sbjct: 109 REREREERERERERERERER------ERERGRDREKERDRQRDWE-DKDKGREDRREK-R 160

Query: 71  ERDRDGEKERD 39
           E  R+    RD
Sbjct: 161 EDTREDRNPRD 171

[26][TOP]
>UniRef100_UPI000186D269 conserved hypothetical protein n=1 Tax=Pediculus humanus corporis
           RepID=UPI000186D269
          Length = 2110

 Score =  113 bits (283), Expect = 6e-24
 Identities = 51/110 (46%), Positives = 77/110 (70%), Gaps = 1/110 (0%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D +    +     RD DR+  + RE+DR+  R+R+R+RE+ R+R+R R+R+ E+ RDRER
Sbjct: 443 DRERDRERDRDRDRDRDRDRDRDRERDRDRDRDRDRERERERERERERERERERERDRER 502

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHH-HRDRHR 3
           +R RDR RD ER +DR R+ ++ +DRERDR+ E+ER+RD+D    R+R R
Sbjct: 503 DRERDRERDRERDRDRDRERDRDRDRERDRERERERERDKDREKERERER 552

 Score =  112 bits (279), Expect = 2e-23
 Identities = 56/138 (40%), Positives = 81/138 (58%)
 Frame = -2

Query: 440 PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
           P   E  ++ ER  E+      D   +          D D    +     RD +RE  + 
Sbjct: 435 PAYRETSWDRERDRERDRDRDRDRDRD---------RDRDRERDRDRDRDRDRERERERE 485

Query: 260 REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           RE++RE  RERER RE+ R+RDR RDR+ ++ RDRER+R RDR RD ER ++R RD ++ 
Sbjct: 486 RERERERERERERDRERDRERDRERDRERDRDRDRERDRDRDRERDRERERERERDKDRE 545

Query: 80  KDRERDRDGEKERDRDRD 27
           K+RER+R+ E+ +DR+RD
Sbjct: 546 KERERERERERPKDRERD 563

 Score =  106 bits (265), Expect = 7e-22
 Identities = 51/143 (35%), Positives = 84/143 (58%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           G      ER         E +   +   + PA  +      +     RD DR+  + R++
Sbjct: 405 GNVRGRRERERSTDRSWREKSESTEIRHRAPAYRETSWDRERDRERDRDRDRDRDRDRDR 464

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           DRE  R+R+R R++ R+R+R R+R+ E+ R+RER+R RDR RD ER ++R RD ++ +DR
Sbjct: 465 DRERDRDRDRDRDRERERERERERERERERERERDRERDRERDRERDRERDRDRDRERDR 524

Query: 71  ERDRDGEKERDRDRDHHHRDRHR 3
           +RDR+ ++ER+R+R+   RD+ R
Sbjct: 525 DRDRERDRERERERE---RDKDR 544

 Score =  102 bits (255), Expect = 1e-20
 Identities = 51/128 (39%), Positives = 75/128 (58%), Gaps = 6/128 (4%)
 Frame = -2

Query: 401 YEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERER 222
           Y +   + E +   D         D D    +     RD DRE  + RE++RE  RERER
Sbjct: 437 YRETSWDRERDRERDRDRDRDRDRDRDRDRERDRDRDRDRDRERERERERERERERERER 496

Query: 221 KREKGRDR------DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
           +R++ RDR      DR RDRD ++ RDR+R+R RDR R+ ER +D+ R+ E+ ++RER+R
Sbjct: 497 ERDRERDRERDRERDRERDRDRDRERDRDRDRERDRERERERERDKDREKERERERERER 556

Query: 59  DGEKERDR 36
             ++ERDR
Sbjct: 557 PKDRERDR 564

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 47/111 (42%), Positives = 77/111 (69%), Gaps = 2/111 (1%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKS-REKDRENGRERE-RKREKGRDRDRSRDRDSEKSRDR 156
           + +L   + +  +  N++E  +  R +DR + ++RE R+RE+G +R+R RDRD    R+R
Sbjct: 267 ERELPKVRDDRPAIRNEKEFERDDRNRDRRSDKDREWRRREEGEERERDRDRD----RER 322

Query: 155 ERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +RER RDR +D ER +DR R+ ++ +DRERDRD +++R+RDRD + RD+ R
Sbjct: 323 DRERDRDREKDRERDRDRDRERDRDRDRERDRDRDRDRERDRDRYVRDKDR 373

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/156 (33%), Positives = 80/156 (51%), Gaps = 18/156 (11%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E +R  ++      D Y  D   +    + +D      N V++D +R S +    +    
Sbjct: 351 ERDRDRDRDRERDRDRYVRDKDRKEREGSIKDDVGRDRNKVTKDRERSSVREERGNVRGR 410

Query: 236 RERERK-----REKG------------RDRDRSRDRDSEKSRDRERERSRDRVRDGERSK 108
           RERER      REK             R+    R+RD E+ RDR+R+R RDR RD ER +
Sbjct: 411 RERERSTDRSWREKSESTEIRHRAPAYRETSWDRERDRERDRDRDRDRDRDRDRDRERDR 470

Query: 107 DRGRDGEKSKDRERDRDGEKERDRDRDH-HHRDRHR 3
           DR RD ++ ++RER+R+ E+ER+R+R+    RDR R
Sbjct: 471 DRDRDRDRERERERERERERERERERERDRERDRER 506

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 43/109 (39%), Positives = 67/109 (61%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D+   D +S+       RE  + RE+DR+  RER+R+R++ R++DR RDRD ++ RDR+R
Sbjct: 289 DDRNRDRRSDKDREWRRREEGEERERDRDRDRERDRERDRDREKDRERDRDRDRERDRDR 348

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +R RDR RD +R +DR R       +ER+   + +  RDR+   +DR R
Sbjct: 349 DRERDRDRDRDRERDRDRYVRDKDRKEREGSIKDDVGRDRNKVTKDRER 397

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 58/198 (29%), Positives = 85/198 (42%), Gaps = 60/198 (30%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +++R + + E   E     D   +     D D    +     RD +R+  + RE+DR+  
Sbjct: 298 DKDREWRRREEGEERERDRDRDRERDRERDRDREKDRERDRDRDRERDRDRDRERDRDRD 357

Query: 236 RERERKREK------------------GRD-------------------------RDRSR 186
           R+RER R++                  GRD                         R+RS 
Sbjct: 358 RDRERDRDRYVRDKDRKEREGSIKDDVGRDRNKVTKDRERSSVREERGNVRGRRERERST 417

Query: 185 DRD-----------------SEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           DR                   E S DRER+R RDR RD +R +DR RD E+ +DR+RDRD
Sbjct: 418 DRSWREKSESTEIRHRAPAYRETSWDRERDRERDRDRDRDRDRDRDRDRERDRDRDRDRD 477

Query: 56  GEKERDRDRDHHHRDRHR 3
            E+ER+R+R+   R+R R
Sbjct: 478 RERERERERE-RERERER 494

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 36/81 (44%), Positives = 54/81 (66%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RD +R+  + RE+DRE  R+R+R+R++ RDR+R R+R+ E+ RD++RE+ R+R R+ ER 
Sbjct: 498 RDRERDRERDRERDRERDRDRDRERDRDRDRERDRERERERERDKDREKERERERERERP 557

Query: 110 KDRGRDGEKSKDRERDRDGEK 48
           KDR RD     D    R   K
Sbjct: 558 KDRERDRSPCSDASNYRKRPK 578

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 48/138 (34%), Positives = 74/138 (53%), Gaps = 18/138 (13%)
 Frame = -2

Query: 362 NDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR----- 198
           +D+  +   +   ++     + + R+ ++E S+ +  D     + ER+  K RD      
Sbjct: 222 SDTKVEVNVSPSRNMNGENCDWIERNEEKEKSRDKYWDGNIDGKDERELPKVRDDRPAIR 281

Query: 197 --------DRSRDRDSEKSRDRER-----ERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
                   DR+RDR S+K R+  R     ER RDR RD ER ++R RD EK ++R+RDRD
Sbjct: 282 NEKEFERDDRNRDRRSDKDREWRRREEGEERERDRDRDRERDRERDRDREKDRERDRDRD 341

Query: 56  GEKERDRDRDHHHRDRHR 3
            E++RDRDR+   RDR R
Sbjct: 342 RERDRDRDRE-RDRDRDR 358

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 32/101 (31%), Positives = 52/101 (51%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           R  + E E E     +   +     + D    +     RD DR+  + R++DRE  RERE
Sbjct: 476 RDRERERERERERERERERERERDRERDRERDRERDRERDRDRDRERDRDRDRERDRERE 535

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR 102
           R+RE+ +DR++ R+R+ E+ R ++RER R    D    + R
Sbjct: 536 RERERDKDREKERERERERERPKDRERDRSPCSDASNYRKR 576

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 31/98 (31%), Positives = 53/98 (54%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
           E E E     +   +     D +    +     R+ DR+  + R++DR+  R+RER+RE+
Sbjct: 479 ERERERERERERERERERERDRERDRERDRERDRERDRDRDRERDRDRDRERDRERERER 538

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR 96
            RD+DR ++R+ E+ R+R ++R RDR    + S  R R
Sbjct: 539 ERDKDREKERERERERERPKDRERDRSPCSDASNYRKR 576

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 45/173 (26%), Positives = 71/173 (41%), Gaps = 52/173 (30%)
 Frame = -2

Query: 365 HNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSR 186
           +N ++ +  A    D +     HV  ++D +   +    R    E     E+  ++++SR
Sbjct: 195 YNANNKKYDAPQSWDASKPWEQHVPLESDTKVEVNVSPSRNMNGENCDWIERNEEKEKSR 254

Query: 185 DR----------------------------------------------------DSEKSR 162
           D+                                                      E+ R
Sbjct: 255 DKYWDGNIDGKDERELPKVRDDRPAIRNEKEFERDDRNRDRRSDKDREWRRREEGEERER 314

Query: 161 DRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           DR+R+R RDR RD +R KDR RD ++ ++R+RDRD E++RDRDRD   RDR R
Sbjct: 315 DRDRDRERDRERDRDREKDRERDRDRDRERDRDRDRERDRDRDRD-RERDRDR 366

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 37/96 (38%), Positives = 55/96 (57%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E +   D         + D    +     RD +R+  + RE+D
Sbjct: 481 ERERERERERER-ERERERDRERDR--------ERDRERDRERDRDRDRERDRDRDRERD 531

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERS 141
           RE  RERER+R+K R+++R R+R+ E+ +DRER+RS
Sbjct: 532 RE--RERERERDKDREKERERERERERPKDRERDRS 565

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 36/96 (37%), Positives = 50/96 (52%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E + E +   D         D D    +     RD +RE  + R+KD
Sbjct: 485 ERERERERERER-ERDRERDRERDRERDRERDRDRDRERDRDRDRERDRERERERERDKD 543

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERS 141
           RE  RERER+RE+ +DR+R R   S+ S  R+R +S
Sbjct: 544 REKERERERERERPKDRERDRSPCSDASNYRKRPKS 579

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 31/99 (31%), Positives = 51/99 (51%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E     +   +     D +    +     RD DRE  + RE++
Sbjct: 479 ERERERERERER-ERERERERDRERDRERDRERDRERDRDRDRERDRDRDRERDRERERE 537

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDR 132
           RE  ++RE++RE+ R+R+R +DR+ ++S   +    R R
Sbjct: 538 RERDKDREKERERERERERPKDRERDRSPCSDASNYRKR 576

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 31/99 (31%), Positives = 49/99 (49%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E ER  E+ E E E     D         + D    +     RD DR+  + RE++RE
Sbjct: 479 ERERERERER-ERERERERERDRERDRERDRERDRERDRDRDRERDRDRDRERDRERERE 537

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVR 126
             R+++R++E+ R+R+R R +D E+ R    + S  R R
Sbjct: 538 RERDKDREKERERERERERPKDRERDRSPCSDASNYRKR 576

[27][TOP]
>UniRef100_UPI00005A4144 PREDICTED: similar to Protein KIAA0853 n=1 Tax=Canis lupus familiaris
            RepID=UPI00005A4144
          Length = 1656

 Score =  113 bits (282), Expect = 7e-24
 Identities = 58/141 (41%), Positives = 88/141 (62%), Gaps = 8/141 (5%)
 Frame = -2

Query: 401  YEQPEGEGE--DNYHNDSSPQPP----AAADEDLTDSK--SNHVSRDNDRESSKSREKDR 246
            +E+  GE +  DN   D  P  P       DE   D +     V R  DR   ++RE+DR
Sbjct: 623  FERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRVEDRRDERARERDR 682

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
            E  R+RER+RE+ RDR+R ++R+ E+ R RERER R+R ++ +R ++R RD ++ ++RER
Sbjct: 683  ERERDRERERERERDREREKERELERERAREREREREREKERDRERERDRDHDRERERER 742

Query: 65   DRDGEKERDRDRDHHHRDRHR 3
            +RD EKER+R+R+   R+R R
Sbjct: 743  ERDREKEREREREERERERER 763

 Score =  100 bits (248), Expect = 7e-20
 Identities = 54/142 (38%), Positives = 88/142 (61%), Gaps = 4/142 (2%)
 Frame = -2

Query: 416  EEERRYEQP---EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            E ++R   P   +G  ++   ++   +      ED  D ++    RD +RE  + RE++R
Sbjct: 637  ERDQRPSSPIRHQGRNDELERDERREERRVDRVEDRRDERARE--RDRERERDRERERER 694

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
            E  RERE++RE  R+R R R+R+ E+ ++R+RER RDR  D ER ++R RD EK ++RER
Sbjct: 695  ERDREREKERELERERAREREREREREKERDRERERDRDHDRERERERERDREKERERER 754

Query: 65   -DRDGEKERDRDRDHHHRDRHR 3
             +R+ E+ER+R+R+   R+R R
Sbjct: 755  EERERERERERERE-RERERER 775

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 48/143 (33%), Positives = 85/143 (59%), Gaps = 3/143 (2%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E E + R E+   +  ++  ++ + +     + D    +     R+ ++E    RE+ RE
Sbjct: 654  ELERDERREERRVDRVEDRRDERARERDRERERDRERERERERDREREKERELERERARE 713

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVR---DGERSKDRGRDGEKSKDR 72
              RERER++E+ R+R+R RD D E+ R+RER+R ++R R   + ER ++R R+ E+ ++R
Sbjct: 714  REREREREKERDRERERDRDHDRERERERERDREKEREREREERERERERERERERERER 773

Query: 71   ERDRDGEKERDRDRDHHHRDRHR 3
            ER R+ +KER+R RD   +D+ R
Sbjct: 774  ERARERDKERERQRDWEDKDKGR 796

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 53/144 (36%), Positives = 80/144 (55%), Gaps = 2/144 (1%)
 Frame = -2

Query: 428  EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E + E ER  E+  E E E     + + +     + +    +     RD+DRE  + RE+
Sbjct: 685  ERDRERERERERDREREKERELERERAREREREREREKERDRERERDRDHDRERERERER 744

Query: 251  DRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
            DRE  RERER+ RE+ R+R+R R+R+ E+ R RER++ R+R RD E  KD+GRD  + K 
Sbjct: 745  DREKEREREREERERERERERERERERERERARERDKERERQRDWE-DKDKGRDDRREK- 802

Query: 74   RERDRDGEKERDRDRDHHHRDRHR 3
            RE  R+    RD   +   + R+R
Sbjct: 803  REDTREDRNPRDGHDERKSKKRYR 826

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 57/152 (37%), Positives = 84/152 (55%), Gaps = 11/152 (7%)
 Frame = -2

Query: 425  YEFEEERRYEQPEGEGEDNY-HNDSSPQPPAAADEDLTDSKSNHVSRDND-RESSKSREK 252
            Y    E R   PE    D Y   D+  Q   ++ E     +    +R+ D R SS  R +
Sbjct: 593  YHDSWETRSSYPE---RDRYPERDNRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQ 649

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR------DG 90
             R +  ER+ +RE+ R  DR  DR  E++R+R+RER RDR R+ ER +DR R      + 
Sbjct: 650  GRNDELERDERREERRV-DRVEDRRDERARERDRERERDRERERERERDREREKERELER 708

Query: 89   EKSKDRERDRDGEKERDRDRDH---HHRDRHR 3
            E++++RER+R+ EKERDR+R+    H R+R R
Sbjct: 709  ERAREREREREREKERDRERERDRDHDRERER 740

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 47/133 (35%), Positives = 70/133 (52%), Gaps = 13/133 (9%)
 Frame = -2

Query: 386  GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK----------SREKDRENG 237
            GE +         +P  +   D  DS+S H SR +  ES +          SR++ +E  
Sbjct: 1234 GERKSRIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGSFDSRDRLQERD 1292

Query: 236  R---ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
            R   +RER RE+   R R  DRD++K  D  R R RDR+R+ ER +D+ RD ++ ++R  
Sbjct: 1293 RYEHDRERDRERRDTRQREWDRDADK--DWPRNRDRDRLRERERERDKRRDLDRERERLI 1350

Query: 65   DRDGEKERDRDRD 27
                E++RDRDRD
Sbjct: 1351 SDSVERDRDRDRD 1363

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 47/139 (33%), Positives = 64/139 (46%), Gaps = 4/139 (2%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  E+      D  H+    +      E   D +        +RE  + RE++
Sbjct: 713  EREREREREKERDRERERDRDHDRERER------ERERDREKEREREREERERERERERE 766

Query: 248  RENGRERERKREKGRDRDRSRD-RDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            RE  RERER RE+ ++R+R RD  D +K RD  RE+  D   D  R+   G D  KSK R
Sbjct: 767  RERERERERARERDKERERQRDWEDKDKGRDDRREKREDTRED--RNPRDGHDERKSKKR 824

Query: 71   ERDRDGEKERD---RDRDH 24
             R+      R    R R+H
Sbjct: 825  YRNEGSPSPRQSPKRRREH 843

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 36/108 (33%), Positives = 57/108 (52%)
 Frame = -2

Query: 374  DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRD 195
            D Y +D         D +  D++     RD D++  ++R++DR   RERER+R+K RD D
Sbjct: 1292 DRYEHDRE------RDRERRDTRQREWDRDADKDWPRNRDRDRL--RERERERDKRRDLD 1343

Query: 194  RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGE 51
            R R+R    S +R+R+R RDR  +     +  +  E   + E +RD E
Sbjct: 1344 RERERLISDSVERDRDRDRDRTFESSSQIESVKRSEAKLESEHERDLE 1391

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/90 (37%), Positives = 49/90 (54%), Gaps = 6/90 (6%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER------SRDRV 129
            RD +R  ++ RE DR+  ++  R R++ R R+R R+RD  +  DRERER       RDR 
Sbjct: 1300 RDRERRDTRQREWDRDADKDWPRNRDRDRLRERERERDKRRDLDRERERLISDSVERDRD 1359

Query: 128  RDGERSKDRGRDGEKSKDRERDRDGEKERD 39
            RD +R+ +     E  K  E   + E ERD
Sbjct: 1360 RDRDRTFESSSQIESVKRSEAKLESEHERD 1389

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 43/109 (39%), Positives = 55/109 (50%)
 Frame = -2

Query: 356  SSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRD 177
            SS +    +D  +     +  SRD  +E  +  E DRE  RER   R++  DRD  +D  
Sbjct: 1263 SSRRSSPESDRQVHSRSGSFDSRDRLQERDRY-EHDRERDRERRDTRQREWDRDADKDWP 1321

Query: 176  SEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDR 30
              + RDR RER R+  RD  R  DR R+   S   ERDRD    RDRDR
Sbjct: 1322 RNRDRDRLRERERE--RDKRRDLDRERERLISDSVERDRD----RDRDR 1364

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 43/142 (30%), Positives = 66/142 (46%), Gaps = 21/142 (14%)
 Frame = -2

Query: 365 HNDSSPQ----PPAAAD-------EDLTDSKSNHVSRDNDRESSKS-REKDRENGRERER 222
           H+ SSPQ    PP            D   +  +H  R   RE ++S R+++++   ERE 
Sbjct: 378 HSLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREETRSKRDREKDAREEREY 437

Query: 221 KREKGRDRDRSRDRDSEKSRDRERER-SRDR--------VRDGERSKDRGRDGEKSKDRE 69
           ++++   RD   DR+    RDR   R +RDR        +RD    +D  RD ++S+D  
Sbjct: 438 EQDQSSSRDHRDDREPRDGRDRRDARDARDRRELRDSRDIRDSREMRDYSRDNKESRD-P 496

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
           RD    ++    RD   RD HR
Sbjct: 497 RDSRSARDTHDYRDRESRDTHR 518

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 37/116 (31%), Positives = 59/116 (50%), Gaps = 9/116 (7%)
 Frame = -2

Query: 323  DLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERE 147
            ++T  + + + +    E S+S   DR++ R    +R     DR       S  SRDR +E
Sbjct: 1231 EITGERKSRIDQLKRGEPSRSTSSDRQDSRSHSSRRSSPESDRQVHSRSGSFDSRDRLQE 1290

Query: 146  RSR---DRVRDGERSKDRGRDGEKSKDRE--RDRDGEKERDRDRDHHHR---DRHR 3
            R R   DR RD ER   R R+ ++  D++  R+RD ++ R+R+R+   R   DR R
Sbjct: 1291 RDRYEHDRERDRERRDTRQREWDRDADKDWPRNRDRDRLRERERERDKRRDLDRER 1346

[28][TOP]
>UniRef100_Q4SR86 Chromosome 11 SCAF14528, whole genome shotgun sequence n=1
            Tax=Tetraodon nigroviridis RepID=Q4SR86_TETNG
          Length = 2196

 Score =  113 bits (282), Expect = 7e-24
 Identities = 57/150 (38%), Positives = 87/150 (58%), Gaps = 10/150 (6%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E + +RR    E E E +   D S       D D    +     RD DR+  + R++DRE
Sbjct: 2004 EHDRDRRNRDRERERERDKRRDRSRSRDRDRDRDRDRDRGKDRGRDRDRDRDRDRDRDRE 2063

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVR----------DGERSKDRGRD 93
              ++R+R R+K R++D+ RDR+ +K RDRE+++ +DR R          D +R KD+ RD
Sbjct: 2064 RDKDRDRDRDKDREKDKDRDREKDKDRDREKDKDKDRDREKDKDREKDKDRDREKDKDRD 2123

Query: 92   GEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             EK KDR++D+D EK++DRD+D   RDR +
Sbjct: 2124 REKDKDRDKDKDREKDKDRDKD-KDRDREK 2152

 Score =  110 bits (274), Expect = 6e-23
 Identities = 58/140 (41%), Positives = 83/140 (59%), Gaps = 2/140 (1%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLT-DSKSNHVSRDNDRESSKSREKDREN 240
            +E  R  + EGE   +   +         D D T DS      RD  R   + RE++R+ 
Sbjct: 1964 KEGERQRETEGERHRDQDGEKRRDRDRERDRDRTKDSDRREHDRDR-RNRDRERERERDK 2022

Query: 239  GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
             R+R R R++ RDRDR RDR  ++ RDR+R+R RDR RD ER KDR RD +K +++++DR
Sbjct: 2023 RRDRSRSRDRDRDRDRDRDRGKDRGRDRDRDRDRDRDRDRERDKDRDRDRDKDREKDKDR 2082

Query: 59   DGEKERDRDRD-HHHRDRHR 3
            D EK++DRDR+    +DR R
Sbjct: 2083 DREKDKDRDREKDKDKDRDR 2102

 Score =  107 bits (267), Expect = 4e-22
 Identities = 48/138 (34%), Positives = 83/138 (60%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            + +R  ++    G+D    D         D D    K     RD DRE  K R+++++  
Sbjct: 2031 DRDRDRDRDRDRGKDR-GRDRDRDRDRDRDRDRERDKDRDRDRDKDREKDKDRDREKDKD 2089

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            R+RE+ ++K RDR++ +DR+ +K RDRE+++ RDR +D +R KD+ R+ +K +D+++DRD
Sbjct: 2090 RDREKDKDKDRDREKDKDREKDKDRDREKDKDRDREKDKDRDKDKDREKDKDRDKDKDRD 2149

Query: 56   GEKERDRDRDHHHRDRHR 3
             EK++DRDR    R + +
Sbjct: 2150 REKDKDRDRRDGSRGKDK 2167

 Score =  105 bits (261), Expect = 2e-21
 Identities = 55/152 (36%), Positives = 91/152 (59%), Gaps = 12/152 (7%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRES--------S 267
            E E ER  +Q   +GE     D         D D  +   +  +RD +RE         S
Sbjct: 1971 ETEGERHRDQ---DGEKRRDRDRERDRDRTKDSDRREHDRDRRNRDRERERERDKRRDRS 2027

Query: 266  KSREKDRENGRERERKREKGRDRDR----SRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
            +SR++DR+  R+R+R +++GRDRDR     RDRD E+ +DR+R+R +DR +D +R +++ 
Sbjct: 2028 RSRDRDRDRDRDRDRGKDRGRDRDRDRDRDRDRDRERDKDRDRDRDKDREKDKDRDREKD 2087

Query: 98   RDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +D ++ KD+++DRD EK++DR++D   RDR +
Sbjct: 2088 KDRDREKDKDKDRDREKDKDREKD-KDRDREK 2118

 Score =  104 bits (260), Expect = 3e-21
 Identities = 60/146 (41%), Positives = 86/146 (58%), Gaps = 6/146 (4%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR---EK 252
            E + ER  E+    G++        +     D+D    +     RD DR     R   ++
Sbjct: 1949 EKDRERSRERERSRGKEG-ERQRETEGERHRDQDGEKRRDRDRERDRDRTKDSDRREHDR 2007

Query: 251  DREN-GRERERKREKGRDRDRSRDRDSEKSRDRER--ERSRDRVRDGERSKDRGRDGEKS 81
            DR N  RERER+R+K RDR RSRDRD ++ RDR+R  +R RDR RD +R +DR R+ +K 
Sbjct: 2008 DRRNRDRERERERDKRRDRSRSRDRDRDRDRDRDRGKDRGRDRDRDRDRDRDRDRERDKD 2067

Query: 80   KDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR+RD+D EK++DRDR+   +DR R
Sbjct: 2068 RDRDRDKDREKDKDRDRE-KDKDRDR 2092

 Score =  103 bits (258), Expect = 5e-21
 Identities = 49/137 (35%), Positives = 80/137 (58%), Gaps = 2/137 (1%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R    E + + +   +         ++D    ++    RD DR   K R++ +E  R
Sbjct: 1873 ERDRDRSKEKDRDQDRSKEKDRDQDRNKEKDRDQDRNKEKDRDQDRNKEKDRDRSKEKDR 1932

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSR--DRVRDGERSKDRGRDGEKSKDRERDR 60
            +++R +EK RDRDRS+++D E+SR+RER R +  +R R+ E  + R +DGEK +DR+R+R
Sbjct: 1933 DQDRNKEKDRDRDRSKEKDRERSRERERSRGKEGERQRETEGERHRDQDGEKRRDRDRER 1992

Query: 59   DGEKERDRDRDHHHRDR 9
            D ++ +D DR  H RDR
Sbjct: 1993 DRDRTKDSDRREHDRDR 2009

 Score =  102 bits (254), Expect = 1e-20
 Identities = 59/161 (36%), Positives = 85/161 (52%), Gaps = 24/161 (14%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            ++ R ++ + + + N   D         D+D    K     R  +++  +SRE++R  G+
Sbjct: 1905 DQDRNKEKDRDQDRNKEKDRDRSKEKDRDQDRNKEKDRDRDRSKEKDRERSRERERSRGK 1964

Query: 233  ERERKRE------------KGRDRDRSRDRDSEK------------SRDRERERSRDRVR 126
            E ER+RE            K RDRDR RDRD  K            +RDRERER RD+ R
Sbjct: 1965 EGERQRETEGERHRDQDGEKRRDRDRERDRDRTKDSDRREHDRDRRNRDRERERERDKRR 2024

Query: 125  DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            D  RS+DR RD ++ +DR +DR  +++RDRDRD   RDR R
Sbjct: 2025 DRSRSRDRDRDRDRDRDRGKDRGRDRDRDRDRD-RDRDRER 2064

 Score =  102 bits (253), Expect = 2e-20
 Identities = 47/123 (38%), Positives = 77/123 (62%), Gaps = 4/123 (3%)
 Frame = -2

Query: 359  DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDR 180
            D S +     D      +    +++ DR+  +++EKDR+  R +E+ R++ +++DR +DR
Sbjct: 1877 DRSKEKDRDQDRSKEKDRDQDRNKEKDRDQDRNKEKDRDQDRNKEKDRDRSKEKDRDQDR 1936

Query: 179  DSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD----RERDRDGEKERDRDRDHHHRD 12
            + EK RDR+R + +DR R  ER + RG++GE+ ++    R RD+DGEK RDRDR+   RD
Sbjct: 1937 NKEKDRDRDRSKEKDRERSRERERSRGKEGERQRETEGERHRDQDGEKRRDRDRE---RD 1993

Query: 11   RHR 3
            R R
Sbjct: 1994 RDR 1996

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 55/160 (34%), Positives = 87/160 (54%), Gaps = 22/160 (13%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            E++R  ++ + +  D   N    +     D+D    K    S++ DR+  +++EKDR+  
Sbjct: 1891 EKDRDQDRNKEKDRDQDRNKEKDR-----DQDRNKEKDRDRSKEKDRDQDRNKEKDRDRD 1945

Query: 236  RERERKREKGRDRDRS----------------RDRDSEKSRDRERERSRDRVRDGER--- 114
            R +E+ RE+ R+R+RS                RD+D EK RDR+RER RDR +D +R   
Sbjct: 1946 RSKEKDRERSRERERSRGKEGERQRETEGERHRDQDGEKRRDRDRERDRDRTKDSDRREH 2005

Query: 113  ---SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
                ++R R+ E+ +D+ RDR   ++RDRDRD   RDR R
Sbjct: 2006 DRDRRNRDRERERERDKRRDRSRSRDRDRDRD---RDRDR 2042

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 47/138 (34%), Positives = 82/138 (59%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            E+ RR  + E         D       + D D +  +    SR+ +R+  +S+EKDR+  
Sbjct: 1828 EDRRREREREAPHGGRALWDRGQGKRWSRDRDRSRDRDADRSRERERDRDRSKEKDRDQD 1887

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            R +E+ R++ R++++ RD+D  K +DR+++R++++ RD  + KDR +D  K KDR+RDR 
Sbjct: 1888 RSKEKDRDQDRNKEKDRDQDRNKEKDRDQDRNKEKDRDRSKEKDRDQDRNKEKDRDRDRS 1947

Query: 56   GEKERDRDRDHHHRDRHR 3
             EK+R+R R+   R+R R
Sbjct: 1948 KEKDRERSRE---RERSR 1962

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 59/165 (35%), Positives = 83/165 (50%), Gaps = 28/165 (16%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSR--DNDRESSKSREKDREN 240
            ++ R ++ + + + N   D         D D +  K     R  + DR+  +S+EKDRE 
Sbjct: 1895 DQDRNKEKDRDQDRNKEKDRDQDRNKEKDRDRSKEKDRDQDRNKEKDRDRDRSKEKDRER 1954

Query: 239  GRERERKREKGRDR------DRSRDRDSEKSRDRERERSRDRVRDGERS----------- 111
             RERER R K  +R      +R RD+D EK RDR+RER RDR +D +R            
Sbjct: 1955 SRERERSRGKEGERQRETEGERHRDQDGEKRRDRDRERDRDRTKDSDRREHDRDRRNRDR 2014

Query: 110  ---------KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
                     +DR R  ++ +DR+RDRD  K+R RDRD   RDR R
Sbjct: 2015 ERERERDKRRDRSRSRDRDRDRDRDRDRGKDRGRDRD-RDRDRDR 2058

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 44/108 (40%), Positives = 72/108 (66%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D+D    K     +D DR+  K ++KDR+  ++++R+++K RDR++ +DRD EK  D++R
Sbjct: 2073 DKDREKDKDRDREKDKDRDREKDKDKDRDREKDKDREKDKDRDREKDKDRDREK--DKDR 2130

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
            ++ +DR +D +R KD+ RD EK KDR+R RDG   R +D+    RD+H
Sbjct: 2131 DKDKDREKDKDRDKDKDRDREKDKDRDR-RDG--SRGKDKREEKRDKH 2175

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 51/139 (36%), Positives = 86/139 (61%), Gaps = 7/139 (5%)
 Frame = -2

Query: 398  EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR----E 231
            E  E  G D +    S +  A+     ++ ++   S D  RE    RE++  +G     +
Sbjct: 1792 EDTELHGGDRFARFESHREAASGSVQPSEERTREASEDRRRE----REREAPHGGRALWD 1847

Query: 230  RERKREKGRDRDRSRDRDSEKSRDRE--RERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            R + +   RDRDRSRDRD+++SR+RE  R+RS+++ RD +RSK++ RD +++K+++RD+D
Sbjct: 1848 RGQGKRWSRDRDRSRDRDADRSRERERDRDRSKEKDRDQDRSKEKDRDQDRNKEKDRDQD 1907

Query: 56   GEKERDRDRDHH-HRDRHR 3
              KE+DRD+D +  +DR R
Sbjct: 1908 RNKEKDRDQDRNKEKDRDR 1926

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 38/116 (32%), Positives = 78/116 (67%), Gaps = 7/116 (6%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSR--DRDSEKSRDR 156
            D D   S+     RD  +E  + +++ +E  R+++R +EK RD+DR++  DRD ++++++
Sbjct: 1863 DRDADRSRERERDRDRSKEKDRDQDRSKEKDRDQDRNKEKDRDQDRNKEKDRDQDRNKEK 1922

Query: 155  ERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHR-----DRHR 3
            +R+RS+++ RD +R+K++ RD ++SK+++R+R  E+ER R ++   +     +RHR
Sbjct: 1923 DRDRSKEKDRDQDRNKEKDRDRDRSKEKDRERSRERERSRGKEGERQRETEGERHR 1978

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 34/94 (36%), Positives = 52/94 (55%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D D    K     +D DRE  K R+++++  R++++ REK +DRD+ +DRD EK +DR+R
Sbjct: 2099 DRDREKDKDREKDKDRDREKDKDRDREKDKDRDKDKDREKDKDRDKDKDRDREKDKDRDR 2158

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
                   RDG R KD+    EK       ++ EK
Sbjct: 2159 -------RDGSRGKDKRE--EKRDKHSSSKESEK 2183

[29][TOP]
>UniRef100_B9PW17 Protein phosphatase 2C, putative n=1 Tax=Toxoplasma gondii GT1
           RepID=B9PW17_TOXGO
          Length = 867

 Score =  113 bits (282), Expect = 7e-24
 Identities = 54/135 (40%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = -2

Query: 410 ERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDN--DRESSKSREKDRENG 237
           +R++ +PEG   +   +    +     D D    +     RD   DRE  + REK+RE  
Sbjct: 129 QRQWRRPEGSWRNREGDTGDRERQRERDRDRERDRERERDRDRERDRERQREREKERERE 188

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           R+RER RE+ R RDR RDRD ++ RDR+RER R+R R+ +R ++R RD E+ ++RERDR+
Sbjct: 189 RDRERDRERERFRDRDRDRDRDRERDRDRERERERERERDRERERDRDRERDRERERDRE 248

Query: 56  GEKERDRDRDHHHRD 12
            E+ER+R+++   R+
Sbjct: 249 REREREREKEGEERE 263

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 52/143 (36%), Positives = 88/143 (61%), Gaps = 3/143 (2%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS-REKDR 246
           E  +ER + +   E E +   + S +  +    +  +++ +  S+   R    S R ++ 
Sbjct: 85  EVTDERVHTRRRSERERSLSAEESSESRSGRRRERREARKDAGSQRQWRRPEGSWRNREG 144

Query: 245 ENGRERERKREKGRD--RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           + G +RER+RE+ RD  RDR R+RD ++ RDRER+R R++ R+ ER ++R R+ E+ +DR
Sbjct: 145 DTG-DRERQRERDRDRERDRERERDRDRERDRERQREREKERERERDRERDRERERFRDR 203

Query: 71  ERDRDGEKERDRDRDHHHRDRHR 3
           +RDRD ++ERDRDR+   R+R R
Sbjct: 204 DRDRDRDRERDRDRE-RERERER 225

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 44/132 (33%), Positives = 71/132 (53%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           G+    E +R    + E +     D   +       +    +     R+ DRE  + R++
Sbjct: 144 GDTGDRERQRERDRDRERDRERERDRDRERDRERQREREKERERERDRERDRERERFRDR 203

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           DR+  R+RER R++ R+R+R R+RD E+ RDR+RER R+R RD ER ++R R+ E     
Sbjct: 204 DRDRDRDRERDRDRERERERERERDRERERDRDRERDRERERDREREREREREKE---GE 260

Query: 71  ERDRDGEKERDR 36
           ER+  G ++R R
Sbjct: 261 EREEKGSEDRKR 272

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 42/95 (44%), Positives = 61/95 (64%), Gaps = 5/95 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D +    +     RD DR+  + R++DRE  RERER+R++ R+RDR R+RD E+ RDRER
Sbjct: 190 DRERDRERERFRDRDRDRDRDRERDRDRERERERERERDRERERDRDRERDRERERDRER 249

Query: 149 ERSRDRVRDGER-----SKDRGRDGEKSKDRERDR 60
           ER R+R ++GE      S+DR R  ++ +DRE  R
Sbjct: 250 EREREREKEGEEREEKGSEDRKRGWKRREDREERR 284

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 46/136 (33%), Positives = 75/136 (55%), Gaps = 3/136 (2%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           G+ E + ER  ++ E + E     D         + +    +     RD +RE  + R++
Sbjct: 147 GDRERQRERDRDR-ERDRERERDRDRERDRERQREREKERERERDRERDRERERFRDRDR 205

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRER--ERSRDRVRDGERSKDR-GRDGEKS 81
           DR+  RER+R RE+ R+R+R RDR+ E+ RDRER  ER RDR R+ ER +++ G + E+ 
Sbjct: 206 DRDRDRERDRDRERERERERERDRERERDRDRERDRERERDREREREREREKEGEEREEK 265

Query: 80  KDRERDRDGEKERDRD 33
              +R R  ++  DR+
Sbjct: 266 GSEDRKRGWKRREDRE 281

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 56/166 (33%), Positives = 79/166 (47%), Gaps = 53/166 (31%)
 Frame = -2

Query: 341 PAAADEDLTDSKSNHVSRDNDRESSKSR---------------------EKDR------- 246
           P ++ E    S+    SRD+  E+ + R                     E++R       
Sbjct: 49  PVSSRESRLPSRRGASSRDSREETYEGRSSGEAAAREVTDERVHTRRRSERERSLSAEES 108

Query: 245 ---ENGRERER-------------KREKGR---------DRDRSRDRDSEKSRDRERERS 141
               +GR RER             +R +G          DR+R R+RD ++ RDRERER 
Sbjct: 109 SESRSGRRRERREARKDAGSQRQWRRPEGSWRNREGDTGDRERQRERDRDRERDRERERD 168

Query: 140 RDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           RDR RD ER ++R ++ E+ +DRERDR+ E+ RDRDRD   RDR R
Sbjct: 169 RDRERDRERQREREKERERERDRERDRERERFRDRDRD-RDRDRER 213

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 50/141 (35%), Positives = 78/141 (55%), Gaps = 6/141 (4%)
 Frame = -2

Query: 407 RRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN--GR 234
           RR        E+ Y   SS +   AA  ++TD +  H  R ++RE S S E+  E+  GR
Sbjct: 60  RRGASSRDSREETYEGRSSGE---AAAREVTDERV-HTRRRSERERSLSAEESSESRSGR 115

Query: 233 ERERK---REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
            RER+   ++ G  R   R   S ++R+ +   + DR R  ER +DR RD E+ +DR+R+
Sbjct: 116 RRERREARKDAGSQRQWRRPEGSWRNREGD---TGDRERQRERDRDRERDRERERDRDRE 172

Query: 62  RDGEKERDRDRD-HHHRDRHR 3
           RD E++R+R+++    RDR R
Sbjct: 173 RDRERQREREKERERERDRER 193

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 34/108 (31%), Positives = 54/108 (50%), Gaps = 2/108 (1%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  ++      + + + D         D D    +     RD +RE  + RE+
Sbjct: 180 EREKERERERDRERDRERERFRDRDRDRDRDRERDRDRERERERERERDRERERDRDRER 239

Query: 251 DRENGRERERKREKGRDRDR-SRDRDSEKSRDRERERSRDRVRDGERS 111
           DRE  RER+R+RE+ R+R++   +R+ + S DR+R   R   R+  RS
Sbjct: 240 DRE--RERDREREREREREKEGEEREEKGSEDRKRGWKRREDREERRS 285

[30][TOP]
>UniRef100_Q5T200-2 Isoform 2 of Zinc finger CCCH domain-containing protein 13 n=1
            Tax=Homo sapiens RepID=Q5T200-2
          Length = 1564

 Score =  113 bits (282), Expect = 7e-24
 Identities = 58/141 (41%), Positives = 88/141 (62%), Gaps = 8/141 (5%)
 Frame = -2

Query: 401  YEQPEGEGE--DNYHNDSSPQPP----AAADEDLTDSK--SNHVSRDNDRESSKSREKDR 246
            +E+  GE +  DN   D  P  P       DE   D +     V R +DR   ++RE+DR
Sbjct: 622  FERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRVDDRRDERARERDR 681

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
            E  R+RER+RE+ R+RDR R+++ E  R+R RER R+R ++ +R +DR RD ++ ++RER
Sbjct: 682  ERERDRERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDRERERER 741

Query: 65   DRDGEKERDRDRDHHHRDRHR 3
            +RD EKER+R+R+   R+R R
Sbjct: 742  ERDREKEREREREERERERER 762

 Score =  102 bits (254), Expect = 1e-20
 Identities = 50/145 (34%), Positives = 85/145 (58%), Gaps = 5/145 (3%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E E + R E+   +  D+  ++ + +     + D    +     RD +RE  +  E++R 
Sbjct: 653  ELERDERREERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERA 712

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDR-----VRDGERSKDRGRDGEKSK 78
              RERER++E+ R+RDR RD D E+ R+RER+R ++R      R+ ER ++R R+ E+ +
Sbjct: 713  REREREREKERDRERDRDRDHDRERERERERDREKEREREREERERERERERERERERER 772

Query: 77   DRERDRDGEKERDRDRDHHHRDRHR 3
            +RER R+ +KER+R RD   +D+ R
Sbjct: 773  ERERARERDKERERQRDWEDKDKGR 797

 Score =  100 bits (248), Expect = 7e-20
 Identities = 51/142 (35%), Positives = 88/142 (61%), Gaps = 4/142 (2%)
 Frame = -2

Query: 416  EEERRYEQP---EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            E ++R   P   +G  ++   ++   +      +D  D ++    R+ +R+  + RE++R
Sbjct: 636  ERDQRPSSPIRHQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRERERERER 695

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR-E 69
            E  RERE++RE  R+R R R+R+ EK RDRER+R RD  R+ ER ++R R+ E+ ++R E
Sbjct: 696  ERDREREKERELERERAREREREREKERDRERDRDRDHDRERERERERDREKEREREREE 755

Query: 68   RDRDGEKERDRDRDHHHRDRHR 3
            R+R+ E+ER+R+R+   R+R R
Sbjct: 756  RERERERERERERE-RERERER 776

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 59/153 (38%), Positives = 84/153 (54%), Gaps = 30/153 (19%)
 Frame = -2

Query: 371  NYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR---EKDRENGRER--------- 228
            NYH DS     +  + D    + N   RD  R+SS  R   E+DR + RER         
Sbjct: 591  NYH-DSWETRSSYPERDRYPERDN---RDQARDSSFERRHGERDRRDNRERDQRPSSPIR 646

Query: 227  -----------ERKREKGRDR------DRSRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
                       ER+ E+  DR      +R+R+RD E+ RDRERER R+R RD ER K+R 
Sbjct: 647  HQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERE 706

Query: 98   RDGEKSKDRERDRDGEKERDRDRDH-HHRDRHR 3
             + E++++RER+R+ E++R+RDRD  H R+R R
Sbjct: 707  LERERAREREREREKERDRERDRDRDHDRERER 739

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 53/145 (36%), Positives = 81/145 (55%), Gaps = 3/145 (2%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  ++ E E E     + + +     +++    +     RD+DRE  + RE+D
Sbjct: 688  ERERERERERDR-EREKERELERERAREREREREKERDRERDR--DRDHDRERERERERD 744

Query: 248  RENGRERERK---REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            RE  RERER+   RE+ R+R+R R+R+ E+ R RER++ R+R RD E  KD+GRD  + K
Sbjct: 745  REKEREREREERERERERERERERERERERERARERDKERERQRDWE-DKDKGRDDRREK 803

Query: 77   DRERDRDGEKERDRDRDHHHRDRHR 3
             RE  R+    RD   +   + R+R
Sbjct: 804  -REEIREDRNPRDGHDERKSKKRYR 827

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 47/135 (34%), Positives = 71/135 (52%), Gaps = 15/135 (11%)
 Frame = -2

Query: 386  GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS--------------REKD 249
            GE +         +P  +   D  DS+S H SR +  ES +               +E+D
Sbjct: 1245 GERKSRIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGSFDSRDRLQERD 1303

Query: 248  R-ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R E+ RERER+R   R R+  RD D +  R+R+R+R R+R R  ER +D+ RD ++ ++R
Sbjct: 1304 RYEHDRERERERRDTRQREWDRDADKDWPRNRDRDRLRERER--ERERDKRRDLDRERER 1361

Query: 71   ERDRDGEKERDRDRD 27
                  E++RDRDRD
Sbjct: 1362 LISDSVERDRDRDRD 1376

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 47/144 (32%), Positives = 71/144 (49%), Gaps = 9/144 (6%)
 Frame = -2

Query: 428  EYEFEEER-----RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK 264
            E E E ER     R  + E + E +   D   +     + D  + +      + +RE  +
Sbjct: 704  ERELERERAREREREREKERDRERDRDRDHDRERERERERD-REKEREREREERERERER 762

Query: 263  SREKDRENGRERERKREKGRDRDRSRD-RDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
             RE++RE  RERER RE+ ++R+R RD  D +K RD  RE+ R+ +R+    +D G D  
Sbjct: 763  ERERERERERERERARERDKERERQRDWEDKDKGRDDRREK-REEIREDRNPRD-GHDER 820

Query: 86   KSKDRERDRDGEKERD---RDRDH 24
            KSK R R+      R    R R+H
Sbjct: 821  KSKKRYRNEGSPSPRQSPKRRREH 844

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 3/127 (2%)
 Frame = -2

Query: 374  DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRD 195
            D Y +D         + +  D++     RD D++  ++R++DR   RERER+R+K RD D
Sbjct: 1303 DRYEHDRE------RERERRDTRQREWDRDADKDWPRNRDRDRLRERERERERDKRRDLD 1356

Query: 194  RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRD---RDH 24
            R R+R    S +R+R+R RDR  +  +        E  K  E   +GE ERD +   RD 
Sbjct: 1357 RERERLISDSVERDRDRDRDRTFESSQI-------ESVKRCEAKLEGEHERDLESTSRDS 1409

Query: 23   HHRDRHR 3
               D+ R
Sbjct: 1410 LALDKER 1416

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/91 (38%), Positives = 52/91 (57%)
 Frame = -2

Query: 314  DSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD 135
            DS+     RD   E  + RE++R + R+RE  R+  +D  R+RDRD  + R+RERER + 
Sbjct: 1294 DSRDRLQERDR-YEHDRERERERRDTRQREWDRDADKDWPRNRDRDRLRERERERERDKR 1352

Query: 134  RVRDGERSKDRGRDGEKSKDRERDRDGEKER 42
            R  D ER +      E+ +DR+RDR  E  +
Sbjct: 1353 RDLDRERERLISDSVERDRDRDRDRTFESSQ 1383

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 42/142 (29%), Positives = 66/142 (46%), Gaps = 21/142 (14%)
 Frame = -2

Query: 365 HNDSSPQ----PPAAAD-------EDLTDSKSNHVSRDNDRESSKS-REKDRENGRERER 222
           H+ SSPQ    PP            D   +  +H  R   RE ++  R++++++  ERE 
Sbjct: 377 HSLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREDTRGKRDREKDSREEREY 436

Query: 221 KREKGRDRDRSRDRDSEKSRDRERER-SRDR--------VRDGERSKDRGRDGEKSKDRE 69
           ++++   RD   DR+    RDR   R +RDR        +RD    +D  RD ++S+D  
Sbjct: 437 EQDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDMRDSREMRDYSRDTKESRD-P 495

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
           RD    ++    RD   RD HR
Sbjct: 496 RDSRSTRDAHDYRDREGRDTHR 517

[31][TOP]
>UniRef100_Q5T200 Zinc finger CCCH domain-containing protein 13 n=2 Tax=Homo sapiens
            RepID=ZC3HD_HUMAN
          Length = 1668

 Score =  113 bits (282), Expect = 7e-24
 Identities = 58/141 (41%), Positives = 88/141 (62%), Gaps = 8/141 (5%)
 Frame = -2

Query: 401  YEQPEGEGE--DNYHNDSSPQPP----AAADEDLTDSK--SNHVSRDNDRESSKSREKDR 246
            +E+  GE +  DN   D  P  P       DE   D +     V R +DR   ++RE+DR
Sbjct: 622  FERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRVDDRRDERARERDR 681

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
            E  R+RER+RE+ R+RDR R+++ E  R+R RER R+R ++ +R +DR RD ++ ++RER
Sbjct: 682  ERERDRERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDRERERER 741

Query: 65   DRDGEKERDRDRDHHHRDRHR 3
            +RD EKER+R+R+   R+R R
Sbjct: 742  ERDREKEREREREERERERER 762

 Score =  102 bits (254), Expect = 1e-20
 Identities = 50/145 (34%), Positives = 85/145 (58%), Gaps = 5/145 (3%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E E + R E+   +  D+  ++ + +     + D    +     RD +RE  +  E++R 
Sbjct: 653  ELERDERREERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERA 712

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDR-----VRDGERSKDRGRDGEKSK 78
              RERER++E+ R+RDR RD D E+ R+RER+R ++R      R+ ER ++R R+ E+ +
Sbjct: 713  REREREREKERDRERDRDRDHDRERERERERDREKEREREREERERERERERERERERER 772

Query: 77   DRERDRDGEKERDRDRDHHHRDRHR 3
            +RER R+ +KER+R RD   +D+ R
Sbjct: 773  ERERARERDKERERQRDWEDKDKGR 797

 Score =  100 bits (248), Expect = 7e-20
 Identities = 51/142 (35%), Positives = 88/142 (61%), Gaps = 4/142 (2%)
 Frame = -2

Query: 416  EEERRYEQP---EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            E ++R   P   +G  ++   ++   +      +D  D ++    R+ +R+  + RE++R
Sbjct: 636  ERDQRPSSPIRHQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRERERERER 695

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR-E 69
            E  RERE++RE  R+R R R+R+ EK RDRER+R RD  R+ ER ++R R+ E+ ++R E
Sbjct: 696  ERDREREKERELERERAREREREREKERDRERDRDRDHDRERERERERDREKEREREREE 755

Query: 68   RDRDGEKERDRDRDHHHRDRHR 3
            R+R+ E+ER+R+R+   R+R R
Sbjct: 756  RERERERERERERE-RERERER 776

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 59/153 (38%), Positives = 84/153 (54%), Gaps = 30/153 (19%)
 Frame = -2

Query: 371  NYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR---EKDRENGRER--------- 228
            NYH DS     +  + D    + N   RD  R+SS  R   E+DR + RER         
Sbjct: 591  NYH-DSWETRSSYPERDRYPERDN---RDQARDSSFERRHGERDRRDNRERDQRPSSPIR 646

Query: 227  -----------ERKREKGRDR------DRSRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
                       ER+ E+  DR      +R+R+RD E+ RDRERER R+R RD ER K+R 
Sbjct: 647  HQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERE 706

Query: 98   RDGEKSKDRERDRDGEKERDRDRDH-HHRDRHR 3
             + E++++RER+R+ E++R+RDRD  H R+R R
Sbjct: 707  LERERAREREREREKERDRERDRDRDHDRERER 739

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 53/145 (36%), Positives = 81/145 (55%), Gaps = 3/145 (2%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  ++ E E E     + + +     +++    +     RD+DRE  + RE+D
Sbjct: 688  ERERERERERDR-EREKERELERERAREREREREKERDRERDR--DRDHDRERERERERD 744

Query: 248  RENGRERERK---REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            RE  RERER+   RE+ R+R+R R+R+ E+ R RER++ R+R RD E  KD+GRD  + K
Sbjct: 745  REKEREREREERERERERERERERERERERERARERDKERERQRDWE-DKDKGRDDRREK 803

Query: 77   DRERDRDGEKERDRDRDHHHRDRHR 3
             RE  R+    RD   +   + R+R
Sbjct: 804  -REEIREDRNPRDGHDERKSKKRYR 827

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 47/135 (34%), Positives = 71/135 (52%), Gaps = 15/135 (11%)
 Frame = -2

Query: 386  GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS--------------REKD 249
            GE +         +P  +   D  DS+S H SR +  ES +               +E+D
Sbjct: 1245 GERKSRIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGSFDSRDRLQERD 1303

Query: 248  R-ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R E+ RERER+R   R R+  RD D +  R+R+R+R R+R R  ER +D+ RD ++ ++R
Sbjct: 1304 RYEHDRERERERRDTRQREWDRDADKDWPRNRDRDRLRERER--ERERDKRRDLDRERER 1361

Query: 71   ERDRDGEKERDRDRD 27
                  E++RDRDRD
Sbjct: 1362 LISDSVERDRDRDRD 1376

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 47/144 (32%), Positives = 71/144 (49%), Gaps = 9/144 (6%)
 Frame = -2

Query: 428  EYEFEEER-----RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK 264
            E E E ER     R  + E + E +   D   +     + D  + +      + +RE  +
Sbjct: 704  ERELERERAREREREREKERDRERDRDRDHDRERERERERD-REKEREREREERERERER 762

Query: 263  SREKDRENGRERERKREKGRDRDRSRD-RDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
             RE++RE  RERER RE+ ++R+R RD  D +K RD  RE+ R+ +R+    +D G D  
Sbjct: 763  ERERERERERERERARERDKERERQRDWEDKDKGRDDRREK-REEIREDRNPRD-GHDER 820

Query: 86   KSKDRERDRDGEKERD---RDRDH 24
            KSK R R+      R    R R+H
Sbjct: 821  KSKKRYRNEGSPSPRQSPKRRREH 844

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 3/127 (2%)
 Frame = -2

Query: 374  DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRD 195
            D Y +D         + +  D++     RD D++  ++R++DR   RERER+R+K RD D
Sbjct: 1303 DRYEHDRE------RERERRDTRQREWDRDADKDWPRNRDRDRLRERERERERDKRRDLD 1356

Query: 194  RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRD---RDH 24
            R R+R    S +R+R+R RDR  +  +        E  K  E   +GE ERD +   RD 
Sbjct: 1357 RERERLISDSVERDRDRDRDRTFESSQI-------ESVKRCEAKLEGEHERDLESTSRDS 1409

Query: 23   HHRDRHR 3
               D+ R
Sbjct: 1410 LALDKER 1416

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/91 (38%), Positives = 52/91 (57%)
 Frame = -2

Query: 314  DSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD 135
            DS+     RD   E  + RE++R + R+RE  R+  +D  R+RDRD  + R+RERER + 
Sbjct: 1294 DSRDRLQERDR-YEHDRERERERRDTRQREWDRDADKDWPRNRDRDRLRERERERERDKR 1352

Query: 134  RVRDGERSKDRGRDGEKSKDRERDRDGEKER 42
            R  D ER +      E+ +DR+RDR  E  +
Sbjct: 1353 RDLDRERERLISDSVERDRDRDRDRTFESSQ 1383

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 42/142 (29%), Positives = 66/142 (46%), Gaps = 21/142 (14%)
 Frame = -2

Query: 365 HNDSSPQ----PPAAAD-------EDLTDSKSNHVSRDNDRESSKS-REKDRENGRERER 222
           H+ SSPQ    PP            D   +  +H  R   RE ++  R++++++  ERE 
Sbjct: 377 HSLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREDTRGKRDREKDSREEREY 436

Query: 221 KREKGRDRDRSRDRDSEKSRDRERER-SRDR--------VRDGERSKDRGRDGEKSKDRE 69
           ++++   RD   DR+    RDR   R +RDR        +RD    +D  RD ++S+D  
Sbjct: 437 EQDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDMRDSREMRDYSRDTKESRD-P 495

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
           RD    ++    RD   RD HR
Sbjct: 496 RDSRSTRDAHDYRDREGRDTHR 517

[32][TOP]
>UniRef100_A5K5X2 Protein kinase domain containing protein n=1 Tax=Plasmodium vivax
            RepID=A5K5X2_PLAVI
          Length = 1544

 Score =  111 bits (278), Expect = 2e-23
 Identities = 59/141 (41%), Positives = 87/141 (61%), Gaps = 4/141 (2%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHV----SRDNDRESSKSRE 255
            E E ER  EQ E E E +   D   +   A D +    K        +RD DRE  + +E
Sbjct: 1379 EQERERGREQ-ERERERDRERDREKERERARDREREREKEKEKERERARDRDRERDREKE 1437

Query: 254  KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
            ++RE  RER+R++EK ++R+R+RDRD E+ R++ERER RDR RD E+ ++R RD E+ +D
Sbjct: 1438 RERERDRERDREKEKEKERERARDRDRERDREKERERERDRERDREKERERERDRERDRD 1497

Query: 74   RERDRDGEKERDRDRDHHHRD 12
            R RDR+ E  + R RD+ +R+
Sbjct: 1498 RNRDRNREPHKRRSRDNPNRN 1518

 Score =  110 bits (274), Expect = 6e-23
 Identities = 58/144 (40%), Positives = 86/144 (59%), Gaps = 4/144 (2%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E E  R  E+  G  E         +     D +    K    +RD +RE  K +EK+RE
Sbjct: 1365 ELERGREQERERGR-EQERERGREQERERERDRERDREKERERARDREREREKEKEKERE 1423

Query: 242  NGRERERKR----EKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
              R+R+R+R    E+ R+RDR RDR+ EK ++RER R RDR RD E+ ++R RD E+ ++
Sbjct: 1424 RARDRDRERDREKERERERDRERDREKEKEKERERARDRDRERDREKERERERDRERDRE 1483

Query: 74   RERDRDGEKERDRDRDHHHRDRHR 3
            +ER+R+ ++ERDRDR   +RDR+R
Sbjct: 1484 KERERERDRERDRDR---NRDRNR 1504

 Score =  100 bits (250), Expect = 4e-20
 Identities = 45/138 (32%), Positives = 87/138 (63%), Gaps = 1/138 (0%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            + +R  + E E E +   D+  +     +++    +     R  ++E  + R+++R+  +
Sbjct: 1343 DRKRDREREREWERDKRRDTGRELERGREQERERGREQERERGREQERERERDRERDREK 1402

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
            ERER R++ R+R++ ++++ E++RDR+RER R++ R+ ER ++R R+ EK K+RER RD 
Sbjct: 1403 ERERARDREREREKEKEKERERARDRDRERDREKERERERDRERDREKEKEKERERARDR 1462

Query: 53   EKERDRDRD-HHHRDRHR 3
            ++ERDR+++    RDR R
Sbjct: 1463 DRERDREKERERERDRER 1480

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 45/140 (32%), Positives = 77/140 (55%), Gaps = 1/140 (0%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEG-EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E + E +R  E+    + E     +   +   A D D    +     R+ DRE  + +EK
Sbjct: 1393 ERDRERDREKERERARDREREREKEKEKERERARDRDRERDREKERERERDRERDREKEK 1452

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            ++E  R R+R RE+ R+++R R+RD E+ R++ERER RDR RD +R++DR R+  K + R
Sbjct: 1453 EKERERARDRDRERDREKERERERDRERDREKERERERDRERDRDRNRDRNREPHKRRSR 1512

Query: 71   ERDRDGEKERDRDRDHHHRD 12
            +     E+ + +++  H  D
Sbjct: 1513 DNPNRNEENQLKEQKKHKLD 1532

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 38/97 (39%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
            RD  RE  + R+++RE   ER+++R+ GR+ +R R+++ E+ R++ERER R++ R+ ER 
Sbjct: 1336 RDIGRERDRKRDREREREWERDKRRDTGRELERGREQERERGREQERERGREQERERERD 1395

Query: 110  KDRGRDGEKSKDRERDRDGEKERDRDRDH-HHRDRHR 3
            ++R R+ E+ + R+R+R+ EKE++++R+    RDR R
Sbjct: 1396 RERDREKERERARDREREREKEKEKERERARDRDRER 1432

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 41/102 (40%), Positives = 66/102 (64%)
 Frame = -2

Query: 308  KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
            K ++  R  +      RE  R+ GRER+RKR++ R+R+  RD+  +  R+ ER R ++R 
Sbjct: 1316 KRDYAERGRESGRDMGRENGRDIGRERDRKRDREREREWERDKRRDTGRELERGREQERE 1375

Query: 128  RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R  E+ ++RGR+ E+ ++R+R+RD EKER+R RD   R+R R
Sbjct: 1376 RGREQERERGREQERERERDRERDREKERERARD---RERER 1414

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 40/101 (39%), Positives = 67/101 (66%), Gaps = 3/101 (2%)
 Frame = -2

Query: 296  VSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE 117
            + R+N R+  + R++ R+  RERE +R+K RD  R  +R  E+ R+R RE+ R+R R+ E
Sbjct: 1330 MGRENGRDIGRERDRKRDREREREWERDKRRDTGRELERGREQERERGREQERERGREQE 1389

Query: 116  RSKDRGRDGEKSKDRERDRDGEKERDRDRDHHH---RDRHR 3
            R ++R R+ ++ K+RER RD E+ER+++++      RDR R
Sbjct: 1390 RERERDRERDREKERERARDREREREKEKEKERERARDRDR 1430

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 43/132 (32%), Positives = 67/132 (50%), Gaps = 1/132 (0%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E E E+E+  E+      D   + +   +     + D    K     R  DR+  + REK
Sbjct: 1411 EREREKEKEKERERARDRDRERDREKERERERDRERDREKEKEKERERARDRDRERDREK 1470

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            +RE  R+RER REK R+R+R R+RD +++RDR RE  + R RD     +  +  E+ K +
Sbjct: 1471 ERERERDRERDREKERERERDRERDRDRNRDRNREPHKRRSRDNPNRNEENQLKEQKKHK 1530

Query: 71   ERDRDGEKERDR 36
                D ++ER R
Sbjct: 1531 LDAEDAKRERKR 1542

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 45/106 (42%), Positives = 69/106 (65%), Gaps = 4/106 (3%)
 Frame = -2

Query: 308  KSNHVSRDNDRESSKS--REKDRENGRE--RERKREKGRDRDRSRDRDSEKSRDRERERS 141
            +S H  R  +RE  K    E+ RE+GR+  RE  R+ GR+RDR RDR  E+ R+ ER++ 
Sbjct: 1303 RSRH-DRSREREWYKRDYAERGRESGRDMGRENGRDIGRERDRKRDR--EREREWERDKR 1359

Query: 140  RDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            RD  R+ ER +++ R+  + ++RER R+ E+ER+RDR+   RDR +
Sbjct: 1360 RDTGRELERGREQERERGREQERERGREQERERERDRE---RDREK 1402

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 44/113 (38%), Positives = 62/113 (54%), Gaps = 10/113 (8%)
 Frame = -2

Query: 311  SKSNHVSRDNDRESSKSREK-DRENGRE------RERKREKGRDRDRSRDRDSEKSRDRE 153
            S    VSR  D  S   R + DR   RE       ER RE GRD  R   RD  + RDR+
Sbjct: 1286 SYRGRVSRIRDSTSRVERSRHDRSREREWYKRDYAERGRESGRDMGRENGRDIGRERDRK 1345

Query: 152  RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD---HHHRDRHR 3
            R+R R+R  + ++ +D GR+ E+ +++ER+R  E+ER+R R+      RDR R
Sbjct: 1346 RDREREREWERDKRRDTGRELERGREQERERGREQERERGREQERERERDRER 1398

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 34/120 (28%), Positives = 64/120 (53%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E + E+ER  E+   + E +   +   +   A D D    +     R+ DRE  + REK+
Sbjct: 1431 ERDREKERERER---DRERDREKEKEKERERARDRDRERDREKERERERDRE--RDREKE 1485

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            RE  RER+R+R++ R+RDR+R+    +SRD       +++++ ++ K    D ++ + R+
Sbjct: 1486 RE--RERDRERDRDRNRDRNREPHKRRSRDNPNRNEENQLKEQKKHKLDAEDAKRERKRK 1543

[33][TOP]
>UniRef100_UPI000155C2B7 PREDICTED: similar to RBM25 protein n=1 Tax=Ornithorhynchus
           anatinus RepID=UPI000155C2B7
          Length = 1017

 Score =  111 bits (277), Expect = 3e-23
 Identities = 54/139 (38%), Positives = 84/139 (60%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E     +   +     + +    +     RD DR+ +K R++DRE
Sbjct: 478 EIEKERRERERERERERE-RREREREREREREREKEKERERERERDRDRDRTKERDRDRE 536

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R RE+  DR++ R R  EKSRDRERER R+R R+ ER ++R R+ E+ ++RER+
Sbjct: 537 RDRDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERERE 596

Query: 62  RDGEKERDRDRDHHHRDRH 6
           R+ EK++ RDR+    D +
Sbjct: 597 REREKDKKRDREEDEEDAY 615

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/129 (37%), Positives = 73/129 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     R+ DR+  + RE+ 
Sbjct: 489 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRDRERS 548

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            +  ++R R REK RDR+R R+R+ E+ R+RERER R+R R+ ER ++R R+ +K +DRE
Sbjct: 549 SDRNKDRSRSREKSRDREREREREREREREREREREREREREREREREREREKDKKRDRE 608

Query: 68  RDRDGEKER 42
            D +   ER
Sbjct: 609 EDEEDAYER 617

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 55/105 (52%), Positives = 71/105 (67%), Gaps = 13/105 (12%)
 Frame = -2

Query: 278 RESSKSREKDRENG-RERERKR--------EKGRDRDRSRDRDSEKSRDRERERSRDRVR 126
           RE  + RE++RE   RERER+R        E+ R+R+R RDRD  K RDR+RER RDR R
Sbjct: 484 RERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDR 543

Query: 125 DGERS----KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ERS    KDR R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 544 DRERSSDRNKDRSRSREKSRDRERERERERERERERE-RERERER 587

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 46/97 (47%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR R  ER
Sbjct: 472 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 531

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR RD ++ +DRER  D  K+R R R+   RDR R
Sbjct: 532 DRDRERDRDRDRDRERSSDRNKDRSRSRE-KSRDRER 567

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 45/101 (44%), Positives = 67/101 (66%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRV----R 126
           ++      + RE++RE  RERER+ RE+ R+R+R R+++ E+ R+RER+R RDR     R
Sbjct: 474 KERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDR 533

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ER +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 534 DRERDRDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 573

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/115 (38%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK-SRDRE 153
           +ED  D  S  +S+  D       EK ++    +E ++E+ R+R+R R+R+ E+  R+RE
Sbjct: 444 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKER-RERERERERERERRERERE 502

Query: 152 RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           RER R+R ++ ER ++R RD ++ + +ERDRD E++RDRDRD       ++DR R
Sbjct: 503 REREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRDRERSSDRNKDRSR 557

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 49/153 (32%), Positives = 77/153 (50%), Gaps = 15/153 (9%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNY-HNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E+ER  E+      D     D   +     D D   S   +  R   RE S+ RE+
Sbjct: 508 EREKEKERERERERDRDRDRTKERDRDRERDRDRDRDRERSSDRNKDRSRSREKSRDRER 567

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD- 75
           +RE  RERER+RE+ R+R+R R+R+ E+ R+RE+++ RDR  D E + +R +   K ++ 
Sbjct: 568 EREREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREK 627

Query: 74  -------------RERDRDGEKERDRDRDHHHR 15
                        RER +  E E++ +R+   R
Sbjct: 628 EAAYQERLKNWEIRERKKTREYEKEAEREEERR 660

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 49/141 (34%), Positives = 81/141 (57%), Gaps = 1/141 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E+  E E E +   D + +     + D    +    S D +++ S+SREK
Sbjct: 502 EREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRDRERSSDRNKDRSRSREK 561

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R+  RERER+RE+ R+R+R R+R+ E+ R+RERER R      ER KD+ RD E+ ++ 
Sbjct: 562 SRD--RERERERERERERERERERERERERERERERER------EREKDKKRDREEDEED 613

Query: 71  ERDRDGEKERDRDRDHHHRDR 9
             +R   + + R+++  +++R
Sbjct: 614 AYERRKLERKLREKEAAYQER 634

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 43/113 (38%), Positives = 64/113 (56%), Gaps = 7/113 (6%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 433 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 492

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDHHHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDR+   RDR R
Sbjct: 493 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRE-RDRDRDR 543

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 42/147 (28%), Positives = 73/147 (49%), Gaps = 13/147 (8%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E +R  ++ +    D   + D       ++D +   S+S   SRD +RE  + RE+
Sbjct: 516 ERERERDRDRDRTKERDRDRERDRDRDRDRERSSDRNKDRSRSREKSRDRERERERERER 575

Query: 251 DRENGRERERK----REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD--- 93
           +RE  RERER+    RE+ R+R+R +D+  ++  D E    R ++    R K+       
Sbjct: 576 EREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERL 635

Query: 92  -----GEKSKDRERDRDGEKERDRDRD 27
                 E+ K RE +++ E+E +R R+
Sbjct: 636 KNWEIRERKKTREYEKEAEREEERRRE 662

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 27/89 (30%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE- 117
           R+ +RE  + RE++RE  RE+++KR++  D + + +R   + + RE+E + ++R+++ E 
Sbjct: 581 REREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEI 640

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           R + + R+ EK  +RE +R  E  ++  R
Sbjct: 641 RERKKTREYEKEAEREEERRREMAKEAKR 669

[34][TOP]
>UniRef100_Q7RBW9 Putative uncharacterized protein PY06017 (Fragment) n=1
           Tax=Plasmodium yoelii yoelii RepID=Q7RBW9_PLAYO
          Length = 229

 Score =  111 bits (277), Expect = 3e-23
 Identities = 55/108 (50%), Positives = 70/108 (64%), Gaps = 2/108 (1%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE 147
           E+    K     R  DRE  + RE+DRE  RER+R+R++ R+RDR RDRD E+ RDRERE
Sbjct: 5   ENTEGEKEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRERDRDRERDRDRERE 64

Query: 146 RSRDRVRDGERSKD--RGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           R RDR RD ER +D  RGRD  K KD  RDR+ ++ERD  +D    +R
Sbjct: 65  RDRDRERDRERDRDRERGRDYRKDKDHRRDRERDRERDYRKDGERENR 112

 Score =  103 bits (258), Expect = 5e-21
 Identities = 46/109 (42%), Positives = 73/109 (66%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           +++    +S    RD DRE  + R+++R+  R+R+R+R++ RDRDR RDRD E+ RDR+R
Sbjct: 10  EKEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRERDRDRERDRDRERERDRDR 69

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ER R+R RD ER +D  +D +  +DRERDR+ +  +D +R++   D  R
Sbjct: 70  ERDRERDRDRERGRDYRKDKDHRRDRERDRERDYRKDGERENRRGDTRR 118

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 52/96 (54%), Positives = 66/96 (68%), Gaps = 1/96 (1%)
 Frame = -2

Query: 287 DNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSK 108
           + ++E  + R KDRE  R+RER RE+ R+RDR RDRD E  RDRER+R R+R RD ER +
Sbjct: 8   EGEKEYRRDRSKDRERDRDRERDRERDRERDRERDRDRE--RDRERDRDRERDRDRERER 65

Query: 107 DRGRDGEKSKDRERDRDGEKERDRDRD-HHHRDRHR 3
           DR R+    +DRERDRD E+ RD  +D  H RDR R
Sbjct: 66  DRDRE----RDRERDRDRERGRDYRKDKDHRRDRER 97

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 45/138 (32%), Positives = 69/138 (50%)
 Frame = -2

Query: 437 TMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           T GE E+  +R  ++ E + +     +   +     D D    +     R+ DR+  + R
Sbjct: 7   TEGEKEYRRDRSKDR-ERDRDRERDRERDRERDRERDRDRERDRERDRDRERDRDRERER 65

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           ++DRE  RER+R RE+GRD  + +D      RDRER+R RD  +DGER   RG       
Sbjct: 66  DRDRERDRERDRDRERGRDYRKDKDH----RRDRERDRERDYRKDGERENRRGDTRRSEN 121

Query: 77  DRERDRDGEKERDRDRDH 24
           DRE+ RD +     + D+
Sbjct: 122 DREKKRDKDDYTPNNSDN 139

[35][TOP]
>UniRef100_Q4YT27 Putative uncharacterized protein (Fragment) n=1 Tax=Plasmodium
           berghei RepID=Q4YT27_PLABE
          Length = 476

 Score =  110 bits (276), Expect = 4e-23
 Identities = 55/145 (37%), Positives = 87/145 (60%), Gaps = 7/145 (4%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAA-------ADEDLTDSKSNHVSRDNDRES 270
           +Y+ +  +RY +  G   D+Y + S  +            + D    +     RD DRE 
Sbjct: 290 QYDDDNYKRYHENNG---DHYRDASEKKDRKTWSGRDRERERDRERDRERDRDRDRDRER 346

Query: 269 SKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG 90
            + R++DRE  R+R+ +REK   RDRS+DR+ ++ RDRER+R RDR R+ +R ++R RD 
Sbjct: 347 DRDRDRDRERDRDRKYRREKEYRRDRSKDRERDRDRDRERDRERDRERERDRDRERDRDR 406

Query: 89  EKSKDRERDRDGEKERDRDRDHHHR 15
           ++ +DRERDRD E++RDR+R   +R
Sbjct: 407 DRERDRERDRDRERDRDRERGRDYR 431

 Score =  107 bits (267), Expect = 4e-22
 Identities = 64/166 (38%), Positives = 95/166 (57%), Gaps = 21/166 (12%)
 Frame = -2

Query: 437 TMGEYEFEEE---RRYEQPEGEGEDN----YHNDSSPQPPAAADEDLTDSKSNHVSRDND 279
           T+G+   ++E   RR+E    + +D+    YH ++          D ++ K        D
Sbjct: 269 TLGKSSADDEFTWRRHETGTSQYDDDNYKRYHENNGDHY-----RDASEKKDRKTWSGRD 323

Query: 278 RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK------------SRDRERERSRD 135
           RE  + RE+DRE  R+R+R RE+ RDRDR R+RD ++            S+DRER+R RD
Sbjct: 324 RERERDRERDRERDRDRDRDRERDRDRDRDRERDRDRKYRREKEYRRDRSKDRERDRDRD 383

Query: 134 RVRDGERSKDRGRDGEKSKDRERDR--DGEKERDRDRDHHHRDRHR 3
           R RD ER ++R RD ++ +DR+RDR  D E++RDR+RD   RDR R
Sbjct: 384 RERDRERDRERERDRDRERDRDRDRERDRERDRDRERD---RDRER 426

 Score =  101 bits (251), Expect = 3e-20
 Identities = 54/142 (38%), Positives = 78/142 (54%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E + ER  E+      D    D         D D    +     RD  ++  + R++D
Sbjct: 325 ERERDRERDRERDRDRDRDR-ERDRDRDRDRERDRDRKYRREKEYRRDRSKDRERDRDRD 383

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           RE  RER+R+RE  RDRDR RDRD ++ RDRER+R R+R RD ER +D  +D +  +DRE
Sbjct: 384 RERDRERDRERE--RDRDRERDRDRDRERDRERDRDRERDRDRERGRDYRKDKDCRRDRE 441

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
           RDR+ +  +D +R++   D  R
Sbjct: 442 RDRERDYRKDSERENRKGDTRR 463

 Score =  100 bits (248), Expect = 7e-20
 Identities = 47/135 (34%), Positives = 77/135 (57%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +  R    E + E +   D   +     D D    +     R+ +    +S++++R+  R
Sbjct: 323 DRERERDRERDRERDRDRDRDRERDRDRDRDRERDRDRKYRREKEYRRDRSKDRERDRDR 382

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           +RER RE+ R+R+R RDR+ ++ RDRER+R RDR R+ +R ++RGRD  K KD  RDR+ 
Sbjct: 383 DRERDRERDRERERDRDRERDRDRDRERDRERDRDRERDRDRERGRDYRKDKDCRRDRER 442

Query: 53  EKERDRDRDHHHRDR 9
           ++ERD  +D    +R
Sbjct: 443 DRERDYRKDSERENR 457

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 49/138 (35%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E ++ + +   + E E +   D         D +    +     RD DR+  + +E  R+
Sbjct: 312 EKKDRKTWSGRDRERERDRERDRERDRDRDRDRERDRDRDRDRERDRDRKYRREKEYRRD 371

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKD--RGRDGEKSKDRE 69
             ++RER R++ R+RDR RDR+ E+ RDRER+R RDR RD ER +D  R RD E+ +D  
Sbjct: 372 RSKDRERDRDRDRERDRERDRERERDRDRERDRDRDRERDRERDRDRERDRDRERGRDYR 431

Query: 68  RDRDGEKERDRDRDHHHR 15
           +D+D  ++R+RDR+  +R
Sbjct: 432 KDKDCRRDRERDRERDYR 449

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 42/109 (38%), Positives = 69/109 (63%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           +++    +S    RD DR+  + RE+DRE  R+R+R+R++ RDR+R R+RD ++ RDR+R
Sbjct: 365 EKEYRRDRSKDRERDRDRDRERDRERDRERERDRDRERDRDRDRERDRERDRDRERDRDR 424

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ER RD  +D +  +DR RD E+   ++ +R+  K  D  R  H R++ R
Sbjct: 425 ERGRDYRKDKDCRRDRERDRERDYRKDSERENRK-GDTRRSEHDREKKR 472

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/134 (37%), Positives = 73/134 (54%), Gaps = 4/134 (2%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E + +R+Y +     E  Y  D S       D D          RD +R+  + R++DRE
Sbjct: 355 ERDRDRKYRR-----EKEYRRDRSKDRERDRDRDR--------ERDRERDRERERDRDRE 401

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRD--RERERSRDRVRDGERS--KDRGRDGEKSKD 75
             R+R+R+R++ RDRDR RDRD E+ RD  ++++  RDR RD ER   KD  R+  K   
Sbjct: 402 RDRDRDRERDRERDRDRERDRDRERGRDYRKDKDCRRDRERDRERDYRKDSERENRKGDT 461

Query: 74  RERDRDGEKERDRD 33
           R  + D EK+RD+D
Sbjct: 462 RRSEHDREKKRDKD 475

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 56/162 (34%), Positives = 84/162 (51%), Gaps = 20/162 (12%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLT----DSKSNHVSRDN-DRESSK 264
           + E E++   +  E    D     SS      AD++ T    ++ ++    DN  R    
Sbjct: 249 DLEIEQQLLKQNEESRSGDKTLGKSS------ADDEFTWRRHETGTSQYDDDNYKRYHEN 302

Query: 263 SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD--- 93
           + +  R+   +++RK   GRDR+R RDR+    RDRER+R RDR R+ +R +DR R+   
Sbjct: 303 NGDHYRDASEKKDRKTWSGRDRERERDRE----RDRERDRDRDRDRERDRDRDRDRERDR 358

Query: 92  -----------GEKSKDRERDRDGEKERDRDRD-HHHRDRHR 3
                       ++SKDRERDRD ++ERDR+RD    RDR R
Sbjct: 359 DRKYRREKEYRRDRSKDRERDRDRDRERDRERDRERERDRDR 400

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 50/152 (32%), Positives = 67/152 (44%), Gaps = 12/152 (7%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHN---DSSPQPPAAADEDLTDS--KSNHVSRDNDRESSKSR 258
           E EE  R E+ E + ++  H    D   +     D ++     K N  SR  D+   KS 
Sbjct: 215 EEEERLRKEEIERKKKEEAHKKKLDEISRIQRERDLEIEQQLLKQNEESRSGDKTLGKSS 274

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR----GRDG 90
             D    R  E    +        D D+ K   R  E + D  RD    KDR    GRD 
Sbjct: 275 ADDEFTWRRHETGTSQ-------YDDDNYK---RYHENNGDHYRDASEKKDRKTWSGRDR 324

Query: 89  EKSKDRERDR--DGEKERDRDRDH-HHRDRHR 3
           E+ +DRERDR  D +++RDR+RD    RDR R
Sbjct: 325 ERERDRERDRERDRDRDRDRERDRDRDRDRER 356

[36][TOP]
>UniRef100_UPI00017F0784 PREDICTED: hypothetical protein n=1 Tax=Sus scrofa
           RepID=UPI00017F0784
          Length = 193

 Score =  110 bits (275), Expect = 5e-23
 Identities = 48/102 (47%), Positives = 74/102 (72%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           +   V R  DR   ++RE+DRE  RERER+RE+ RDR+R ++R+ E+ R RERER R+R 
Sbjct: 35  EERRVDRAEDRRDERARERDRERDRERERERERERDREREKERELERERARERERERERE 94

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ++ +R ++R RD ++ ++RER+RD EKER+R+R+   R+R R
Sbjct: 95  KERDRDRERDRDHDRERERERERDREKEREREREREERERER 136

 Score =  106 bits (265), Expect = 7e-22
 Identities = 58/145 (40%), Positives = 83/145 (57%), Gaps = 5/145 (3%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E  EERR ++ E         D   +     D +    +     R+ DRE  K RE +RE
Sbjct: 32  ERREERRVDRAE---------DRRDERARERDRERDRERERERERERDREREKERELERE 82

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER-----SKDRGRDGEKSK 78
             RERER+RE+ ++RDR R+RD +  R+RERER RDR ++ ER      ++R R+ E+ +
Sbjct: 83  RAREREREREREKERDRDRERDRDHDRERERERERDREKEREREREREERERERERERER 142

Query: 77  DRERDRDGEKERDRDRDHHHRDRHR 3
           +RER R+ EKERDR RD   +D+ R
Sbjct: 143 ERERAREREKERDRQRDWEDKDKGR 167

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/111 (39%), Positives = 73/111 (65%)
 Frame = -2

Query: 335 AADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDR 156
           +A +    S   H  R+++ E  + RE+ R + R  +R+ E+ R+RDR RDR+ E+ R+R
Sbjct: 9   SAGDQRPSSPIRHQGRNDELERDERREERRVD-RAEDRRDERARERDRERDRERERERER 67

Query: 155 ERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ER+R R++ R+ ER + R R+ E+ +++ERDRD E++RD DR+   R+R R
Sbjct: 68  ERDREREKERELERERAREREREREREKERDRDRERDRDHDRE-RERERER 117

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 52/141 (36%), Positives = 76/141 (53%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  ++ E E E     + + +     + +    +     RD+DRE  + RE+D
Sbjct: 60  ERERERERERDR-EREKERELERERAREREREREREKERDRDRERDRDHDRERERERERD 118

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           RE  RERER+RE+       R+R+ E+ R+RERER+R+R    E+ +DR RD E  KD+ 
Sbjct: 119 REKEREREREREE-------RERERERERERERERARER----EKERDRQRDWE-DKDKG 166

Query: 68  RDRDGEKERDRDRDHHHRDRH 6
           R+   EK  D   D + RD H
Sbjct: 167 REERREKRDDAREDRNPRDGH 187

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 50/142 (35%), Positives = 69/142 (48%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E     D         + D    +     R+ DRE  + RE++
Sbjct: 76  ERELERERARER-EREREREKERDRD------RERDRDHDRERERERERDREKERERERE 128

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           RE  RERER+RE+ R+R+R+          RERE+ RDR RD E  KD+GR+     +R 
Sbjct: 129 REE-RERERERERERERERA----------REREKERDRQRDWE-DKDKGRE-----ERR 171

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
             RD  +E    RD H   + +
Sbjct: 172 EKRDDAREDRNPRDGHEERKSK 193

[37][TOP]
>UniRef100_UPI000194B92B PREDICTED: zinc finger CCCH-type containing 13 n=1 Tax=Taeniopygia
            guttata RepID=UPI000194B92B
          Length = 1584

 Score =  110 bits (274), Expect = 6e-23
 Identities = 56/140 (40%), Positives = 85/140 (60%), Gaps = 3/140 (2%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSK---SNHVSRDNDRESSKSREKDRE 243
            E R  E+   +  +     SSP       +DL   +      V R +DR   ++RE++RE
Sbjct: 619  ERRHSERDRRDNRERDQRASSPVRHQGRSDDLERDERREERRVDRSDDRRDERARERERE 678

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
              RER+R+RE+ RDR+R R+++ E  RDR RER RDR RD +R ++R RD +  ++RER+
Sbjct: 679  --RERDRERERERDREREREKERELERDRARERERDRERDKDRDRERDRDRDHDRERERE 736

Query: 62   RDGEKERDRDRDHHHRDRHR 3
            R+ EKER+R+R+   R+R R
Sbjct: 737  REREKEREREREERERERER 756

 Score =  104 bits (260), Expect = 3e-21
 Identities = 56/145 (38%), Positives = 86/145 (59%), Gaps = 5/145 (3%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            + E + R E+   +  D+  ++ + +     + D    +     RD +RE  K RE +R+
Sbjct: 649  DLERDERREERRVDRSDDRRDERARERERERERD----RERERERDREREREKERELERD 704

Query: 242  NGRERERKREKGRDRDRSRDRDS----EKSRDRERERSRDRVR-DGERSKDRGRDGEKSK 78
              RERER RE+ +DRDR RDRD     E+ R+RERE+ R+R R + ER ++R RD E+ +
Sbjct: 705  RARERERDRERDKDRDRERDRDRDHDREREREREREKEREREREERERERERERDRERER 764

Query: 77   DRERDRDGEKERDRDRDHHHRDRHR 3
            +RER RD +KERDR RD   +++ R
Sbjct: 765  ERERGRDRDKERDRQRDWDDKEKGR 789

 Score =  102 bits (255), Expect = 1e-20
 Identities = 55/142 (38%), Positives = 88/142 (61%), Gaps = 4/142 (2%)
 Frame = -2

Query: 416  EEERRYEQP---EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            E ++R   P   +G  +D   ++   +      +D  D ++    R+ +R+  + RE+DR
Sbjct: 632  ERDQRASSPVRHQGRSDDLERDERREERRVDRSDDRRDERARERERERERDRERERERDR 691

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR-E 69
            E  RERE++RE  RDR R R+RD E+ +DR+RER RDR  D ER ++R R+ E+ ++R E
Sbjct: 692  E--REREKERELERDRARERERDRERDKDRDRERDRDRDHDREREREREREKEREREREE 749

Query: 68   RDRDGEKERDRDRDHHHRDRHR 3
            R+R+ E+ERDR+R+   R+R R
Sbjct: 750  RERERERERDRERE---RERER 768

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 59/160 (36%), Positives = 88/160 (55%), Gaps = 26/160 (16%)
 Frame = -2

Query: 404  RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSK-----SNHVSRDNDRESSKSREKD--- 249
            R  Q +G      ++DS     + AD D  DS+     S+   R ++R+   +RE+D   
Sbjct: 578  RGSQADGHSSSGNYHDSWDSRSSYADRDRYDSRDQARDSSFERRHSERDRRDNRERDQRA 637

Query: 248  ----RENGRERERKREKGRDR---DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD- 93
                R  GR  + +R++ R+    DRS DR  E++R+RERER RDR R+ ER ++R R+ 
Sbjct: 638  SSPVRHQGRSDDLERDERREERRVDRSDDRRDERARERERERERDRERERERDREREREK 697

Query: 92   ---------GEKSKDRERDRDGEKERDRDRDH-HHRDRHR 3
                      E+ +DRERD+D ++ERDRDRDH   R+R R
Sbjct: 698  ERELERDRARERERDRERDKDRDRERDRDRDHDRERERER 737

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 49/138 (35%), Positives = 74/138 (53%), Gaps = 1/138 (0%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R  + E E E     D + +     + D    +     RD+DRE  + RE+++E  R
Sbjct: 686  ERERDREREREKERELERDRARERERDRERDKDRDRERDRDRDHDREREREREREKERER 745

Query: 233  ERE-RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            ERE R+RE+ R+RDR R+R+ E+ RDR++ER R R  D    K++GR+  + K RE  R+
Sbjct: 746  EREERERERERERDRERERERERGRDRDKERDRQRDWD---DKEKGREDRRDK-REDTRE 801

Query: 56   GEKERDRDRDHHHRDRHR 3
                RD   +   + RHR
Sbjct: 802  ERGSRDVHEERKSKKRHR 819

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 52/147 (35%), Positives = 72/147 (48%), Gaps = 12/147 (8%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEG-EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRE---SSKS 261
            E E E+ER  E+    E E +   D         D D    +     R+ +RE     + 
Sbjct: 692  EREREKERELERDRARERERDRERDKDRDRERDRDRDHDREREREREREKEREREREERE 751

Query: 260  REKDRENGRERERKREKGRDRDRSRDR-----DSEKSRDRERERSRDRVRDGERSKDRGR 96
            RE++RE  RERER+RE+GRDRD+ RDR     D EK R+  R++ R+  R+   S+D   
Sbjct: 752  RERERERDRERERERERGRDRDKERDRQRDWDDKEKGREDRRDK-REDTREERGSRD-VH 809

Query: 95   DGEKSKDRERDRDGEKERD---RDRDH 24
            +  KSK R R+      R    R RDH
Sbjct: 810  EERKSKKRHRNESSPSPRQSPKRRRDH 836

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 45/122 (36%), Positives = 66/122 (54%), Gaps = 15/122 (12%)
 Frame = -2

Query: 347  QPPAAADEDLTDSKSNHVSRDNDRESSKS--------------REKDR-ENGRERERKRE 213
            +P  +   D  DS+S H SR +  ES +               +E+DR E+ RERER R 
Sbjct: 1179 EPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGSFDSRERLQERDRHEHDRERERDRR 1237

Query: 212  KGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRD 33
            +GR RD  RD D +  R RERER    +R+ ER +++ R+ E+ +DR+     E+ER+R 
Sbjct: 1238 EGRQRDWDRDVDKDWPRSRERER----LRERERDREKRRELERERDRQLPDPAERERERT 1293

Query: 32   RD 27
             D
Sbjct: 1294 LD 1295

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 4/101 (3%)
 Frame = -2

Query: 314  DSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDS--EKSRDRERERS 141
            DS+     RD   E  + RE+DR  GR+R+  R+  +D  RSR+R+   E+ RDRE+ R 
Sbjct: 1215 DSRERLQERDR-HEHDRERERDRREGRQRDWDRDVDKDWPRSRERERLRERERDREKRRE 1273

Query: 140  RDRVRDGERSKDRGRDGEKSKDRERDRDGEK--ERDRDRDH 24
             +R RD +      R+ E++ D    ++  K  E   DRDH
Sbjct: 1274 LERERDRQLPDPAERERERTLDSSSQKESTKHSETKLDRDH 1314

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 36/98 (36%), Positives = 50/98 (51%), Gaps = 6/98 (6%)
 Frame = -2

Query: 314  DSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD 135
            D   +   R+ DR   + R+ DR+  ++  R RE+ R R+R RDR  EK R+ ERER R 
Sbjct: 1224 DRHEHDRERERDRREGRQRDWDRDVDKDWPRSRERERLRERERDR--EKRRELERERDRQ 1281

Query: 134  RVRDGERSKDRGRDGEKSKDRER------DRDGEKERD 39
                 ER ++R  D    K+  +      DRD EKE D
Sbjct: 1282 LPDPAERERERTLDSSSQKESTKHSETKLDRDHEKEFD 1319

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 43/120 (35%), Positives = 61/120 (50%), Gaps = 14/120 (11%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D T S+S+    +   E+   REK+RE   +R+  +E+   RD   DR+S   RDR  
Sbjct: 401 DRDRT-SQSHDRRHERRDETRGKREKERETRDDRDYDQEQSTSRDHRDDRESRDGRDRRD 459

Query: 149 ER-SRDR--------VRDGERSKDRGRDGEKSKDRERD----RDGEKERDRD-RDHHHRD 12
            R +RDR         RD   ++D  RD + S+D +RD    RD    RDR+ RD H +D
Sbjct: 460 TRDTRDRREPRESRDTRDSRDTRDYSRDAKDSRD-QRDSRSTRDSHDYRDRESRDAHKKD 518

[38][TOP]
>UniRef100_UPI00005BDD30 PREDICTED: zinc finger CCCH-type containing 13 isoform 1 n=1 Tax=Bos
            taurus RepID=UPI00005BDD30
          Length = 1652

 Score =  110 bits (274), Expect = 6e-23
 Identities = 61/157 (38%), Positives = 91/157 (57%), Gaps = 11/157 (7%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGE--DNYHNDSSPQPP----AAADEDLTDSK--SNHVSRD 285
            P     E   +  +E+  GE +  DN   D  P  P       DE   D +     V R 
Sbjct: 610  PERDNREQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRT 669

Query: 284  NDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK---SRDRERERSRDRVRDGER 114
            +DR   ++RE+DRE  RERER+RE+ RDR+R ++R+ E+   +R+RERER R++ RD ER
Sbjct: 670  DDRRDERARERDRERERERERERERERDREREKERELERERAAREREREREREKERDRER 729

Query: 113  SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             +DR  D E+ ++RER+R+ E+ER+R+     R+R R
Sbjct: 730  ERDREHDREREREREREREKEREREREERERERERER 766

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 45/140 (32%), Positives = 76/140 (54%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  E+      +        +     + +    K     R+ DRE  + RE++
Sbjct: 683  ERERERERERERERDREREKERELERERAAREREREREREKERDRERERDREHDRERERE 742

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            RE  RE+ER+RE+  +R+R R+R+ E+ R+RERER+R+R R+ ER ++   D EK+++  
Sbjct: 743  REREREKERERER-EERERERERERERERERERERARERERERERQRE-WEDKEKAREDR 800

Query: 68   RDRDGEKERDRDRDHHHRDR 9
            R++  +   DR+    H +R
Sbjct: 801  REKREDLREDRNPRDGHEER 820

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 59/177 (33%), Positives = 90/177 (50%), Gaps = 31/177 (17%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
            P M E      R  +        NYH DS     +  + D    + N   R+  R+SS  
Sbjct: 569  PEMPEKGSRGTRGSQIDSHSSSSNYH-DSWETRSSYPERDRYPERDN---REQARDSSFE 624

Query: 260  R---EKDRENGRERERK-----REKGRDR-------------DRSRDRDSEKSRDRERER 144
            R   E+DR + RER+++     R +GR+              DR+ DR  E++R+R+RER
Sbjct: 625  RRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRTDDRRDERARERDRER 684

Query: 143  SRDRVRDGERSKDRGRDGEK-------SKDRERDRDGEKERDRDRD---HHHRDRHR 3
             R+R R+ ER +DR R+ E+       +++RER+R+ EKERDR+R+    H R+R R
Sbjct: 685  ERERERERERERDREREKERELERERAAREREREREREKERDRERERDREHDRERER 741

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 46/143 (32%), Positives = 78/143 (54%), Gaps = 1/143 (0%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  ++   +  +     ++ +     + +    +     R++DRE  + RE++
Sbjct: 687  ERERERERERDREREKERELERERAAREREREREREKERDRERERDREHDRERERERERE 746

Query: 248  RENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            RE  RERER+ RE+ R+R+R R+R+ E+ R RERER R+R R+ E  K++ R+  + K R
Sbjct: 747  REKEREREREERERERERERERERERERERARERERERERQREWE-DKEKAREDRREK-R 804

Query: 71   ERDRDGEKERDRDRDHHHRDRHR 3
            E  R+    RD   +   + R+R
Sbjct: 805  EDLREDRNPRDGHEERKSKKRYR 827

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 52/136 (38%), Positives = 68/136 (50%), Gaps = 17/136 (12%)
 Frame = -2

Query: 386  GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS--------------REKD 249
            GE +         +P  +   D  DS+S H SR +  ES +               +E+D
Sbjct: 1230 GERKSRIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGSFDSRERLQERD 1288

Query: 248  R-ENGRERERKREKGRDRDRSRDRDSE--KSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            R E+ RERER+R   R RD  RD D +  ++RDR+R R R+R RD  R  DR R+   S 
Sbjct: 1289 RYEHERERERERRDVRQRDWERDADKDWPRNRDRDRLRERERERDKRRDLDRERERLLSD 1348

Query: 77   DRERDRDGEKERDRDR 30
              ERDR    ERDRDR
Sbjct: 1349 ALERDR----ERDRDR 1360

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 41/149 (27%), Positives = 68/149 (45%), Gaps = 14/149 (9%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDR-ESSKSREKDREN 240
            E  R       +   +    SSP+             S    ++ DR E  + RE++R +
Sbjct: 1243 EPSRSTSSDRQDSRSHSSRRSSPESDRQVHSRSGSFDSRERLQERDRYEHERERERERRD 1302

Query: 239  GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
             R+R+ +R+  +D  R+RDRD  + R+RER++ RD  R+ ER      + ++ +DR+R  
Sbjct: 1303 VRQRDWERDADKDWPRNRDRDRLRERERERDKRRDLDRERERLLSDALERDRERDRDRTF 1362

Query: 59   DG-------------EKERDRDRDHHHRD 12
            +G             E E DRD +   RD
Sbjct: 1363 EGSQVESVKRSEVKLESEHDRDLEGSSRD 1391

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 41/140 (29%), Positives = 65/140 (46%), Gaps = 5/140 (3%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  E+      D  H+    +      E   + +     R+ +RE  + RE++
Sbjct: 714  EREREREREKERDRERERDREHDREREREREREREKEREREREERERERERERERERERE 773

Query: 248  RENGRE--RERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
            RE  RE  RER+R++  +       D EK+R+  RE+ R+ +R+    +D G +  KSK 
Sbjct: 774  RERARERERERERQREWE-------DKEKAREDRREK-REDLREDRNPRD-GHEERKSKK 824

Query: 74   RERDRDGEKERD---RDRDH 24
            R R+      R    R R+H
Sbjct: 825  RYRNEGSPSPRQSPKRRREH 844

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 38/117 (32%), Positives = 52/117 (44%), Gaps = 12/117 (10%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRD-------RDRSRDRDSEK 168
           E  + S      R  +    + REKD    RE E+ +   RD       RD    RD+  
Sbjct: 405 ERASQSHDRRHERREETRGKRDREKDTREEREYEQDQSSSRDHRDDREPRDGRDRRDARD 464

Query: 167 SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD----RDGEKERDRD-RDHHHRD 12
           +RDR   R    VRD    +D  RD ++S+D  RD    RD    RDR+ RD H ++
Sbjct: 465 TRDRRELRDSRDVRDSREMRDYSRDNKESRD-PRDSRSTRDAHDYRDRESRDAHRKE 520

[39][TOP]
>UniRef100_UPI00017978C7 PREDICTED: similar to RNA binding motif protein 25 n=1 Tax=Equus
           caballus RepID=UPI00017978C7
          Length = 843

 Score =  109 bits (273), Expect = 8e-23
 Identities = 53/139 (38%), Positives = 84/139 (60%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E     +   +     + +    +     RD DR+ +K R++DR+
Sbjct: 304 EIEKERRERERERERERE-RREREREREREREREKEKERERERERDRDRDRTKERDRDRD 362

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R RE+  DR++ R R  EKSRDRERER R+R R+ ER ++R R+ E+ ++RER+
Sbjct: 363 RERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERERE 422

Query: 62  RDGEKERDRDRDHHHRDRH 6
           R+ EK++ RDR+    D +
Sbjct: 423 REREKDKKRDREEDEEDAY 441

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/129 (37%), Positives = 73/129 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     RD +R+  + RE+ 
Sbjct: 315 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERS 374

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            +  ++R R REK RDR+R R+R+ E+ R+RERER R+R R+ ER ++R R+ +K +DRE
Sbjct: 375 SDRNKDRSRSREKSRDREREREREREREREREREREREREREREREREREREKDKKRDRE 434

Query: 68  RDRDGEKER 42
            D +   ER
Sbjct: 435 EDEEDAYER 443

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/105 (51%), Positives = 71/105 (67%), Gaps = 13/105 (12%)
 Frame = -2

Query: 278 RESSKSREKDRENG-RERERKR--------EKGRDRDRSRDRDSEKSRDRERERSRDRVR 126
           RE  + RE++RE   RERER+R        E+ R+R+R RDRD  K RDR+R+R RDR R
Sbjct: 310 RERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDR 369

Query: 125 DGERS----KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ERS    KDR R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 370 DRERSSDRNKDRSRSREKSRDRERERERERERERERE-RERERER 413

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/97 (46%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR R  ER
Sbjct: 298 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 357

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR R+ ++ +DRER  D  K+R R R+   RDR R
Sbjct: 358 DRDRDRERDRDRDRERSSDRNKDRSRSRE-KSRDRER 393

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/101 (43%), Positives = 67/101 (66%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRV----R 126
           ++      + RE++RE  RERER+ RE+ R+R+R R+++ E+ R+RER+R RDR     R
Sbjct: 300 KERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDR 359

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +R +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 360 DRDRERDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 399

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/115 (38%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK-SRDRE 153
           +ED  D  S  +S+  D       EK ++    +E ++E+ R+R+R R+R+ E+  R+RE
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKER-RERERERERERERRERERE 328

Query: 152 RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           RER R+R ++ ER ++R RD ++ + +ERDRD ++ERDRDRD       ++DR R
Sbjct: 329 REREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSR 383

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 48/141 (34%), Positives = 80/141 (56%), Gaps = 1/141 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E+  E E E +   D + +     D +    +    S D +++ S+SREK
Sbjct: 328 EREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREK 387

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R+  RERER+RE+ R+R+R R+R+ E+ R+RERER        ER KD+ RD E+ ++ 
Sbjct: 388 SRDRERERERERERERERERERERERERERERERER--------EREKDKKRDREEDEED 439

Query: 71  ERDRDGEKERDRDRDHHHRDR 9
             +R   + + R+++  +++R
Sbjct: 440 AYERRKLERKLREKEAAYQER 460

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 15/149 (10%)
 Frame = -2

Query: 428 EYEFEEER---RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           E E E ER   R    E + + +   D       ++D +   S+S   SRD +RE    R
Sbjct: 340 ERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERE----R 395

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS- 81
           E++RE  RERER+RE+ R+R+R R+R+ E+ +D++R+R  D     ER K   +  EK  
Sbjct: 396 EREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEA 455

Query: 80  -----------KDRERDRDGEKERDRDRD 27
                      ++R++ R+ EKE +R+ +
Sbjct: 456 AYQERLKNWEIRERKKTREYEKEAEREEE 484

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/113 (38%), Positives = 64/113 (56%), Gaps = 7/113 (6%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 259 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 318

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDHHHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDRD   RDR R
Sbjct: 319 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRD-RERDRDR 369

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/129 (27%), Positives = 64/129 (49%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +  R    + E   + + D S     + D +    +     R+ +RE  + RE++RE  R
Sbjct: 362 DRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERER 421

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           ERER+++K RDR+   + D+ + R  ER+         ER K+     E+ K RE +++ 
Sbjct: 422 EREREKDKKRDREED-EEDAYERRKLERKLREKEAAYQERLKN-WEIRERKKTREYEKEA 479

Query: 53  EKERDRDRD 27
           E+E +R R+
Sbjct: 480 EREEERRRE 488

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 27/89 (30%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE- 117
           R+ +RE  + RE++RE  RE+++KR++  D + + +R   + + RE+E + ++R+++ E 
Sbjct: 407 REREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEI 466

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           R + + R+ EK  +RE +R  E  ++  R
Sbjct: 467 RERKKTREYEKEAEREEERRREMAKEAKR 495

[40][TOP]
>UniRef100_UPI0001797420 PREDICTED: similar to KIAA0853 n=1 Tax=Equus caballus
            RepID=UPI0001797420
          Length = 1656

 Score =  109 bits (273), Expect = 8e-23
 Identities = 59/143 (41%), Positives = 89/143 (62%), Gaps = 10/143 (6%)
 Frame = -2

Query: 401  YEQPEGEGE--DNYHNDSSPQPP----AAADEDLTDSK--SNHVSRDNDRESSKSREKDR 246
            +E+  GE +  DN   D  P  P       DE   D +     V R +DR   ++RE+DR
Sbjct: 623  FERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRVDDRRDERARERDR 682

Query: 245  ENGRERERKREKGRDRDRSR--DRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            E  R+RER+RE+ R+RDR R  +R+ E+ R RERER R+R ++ +R ++R RD ++ ++R
Sbjct: 683  ERERDRERERERERERDREREKERELERERAREREREREREKERDRERERDRDHDRERER 742

Query: 71   ERDRDGEKERDRDRDHHHRDRHR 3
            ER+RD EKER+R+R+   R+R R
Sbjct: 743  ERERDREKEREREREERERERER 765

 Score =  105 bits (263), Expect = 1e-21
 Identities = 54/140 (38%), Positives = 87/140 (62%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E E + R E+   +  D+  ++ + +     + D    +     RD +RE  +  E++R 
Sbjct: 654  ELERDERREERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERA 713

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
              RERER+REK RDR+R RDRD ++ R+RERER R++ R+ ER ++R R+ E+ ++RER+
Sbjct: 714  REREREREREKERDRERERDRDHDRERERERERDREKERERER-EERERERERERERERE 772

Query: 62   RDGEKERDRDRDHHHRDRHR 3
            R+ E+ER R+RD   R+R R
Sbjct: 773  RERERERARERD-KERERQR 791

 Score =  100 bits (248), Expect = 7e-20
 Identities = 51/142 (35%), Positives = 88/142 (61%), Gaps = 4/142 (2%)
 Frame = -2

Query: 416  EEERRYEQP---EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            E ++R   P   +G  ++   ++   +      +D  D ++    R+ +R+  + RE++R
Sbjct: 637  ERDQRPSSPIRHQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRERERERER 696

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
            E  RERE++RE  R+R R R+R+ E+ ++R+RER RDR  D ER ++R RD EK ++RER
Sbjct: 697  ERDREREKERELERERAREREREREREKERDRERERDRDHDRERERERERDREKERERER 756

Query: 65   -DRDGEKERDRDRDHHHRDRHR 3
             +R+ E+ER+R+R+   R+R R
Sbjct: 757  EERERERERERERE-RERERER 777

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 60/155 (38%), Positives = 84/155 (54%), Gaps = 32/155 (20%)
 Frame = -2

Query: 371  NYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR---EKDRENGRER--------- 228
            NYH DS     +  + D    + N   RD  R+SS  R   E+DR + RER         
Sbjct: 592  NYH-DSWETRSSYPERDRYPERDN---RDQARDSSFERRHGERDRRDNRERDQRPSSPIR 647

Query: 227  -----------ERKREKGRDR------DRSRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
                       ER+ E+  DR      +R+R+RD E+ RDRERER R+R RD ER K+R 
Sbjct: 648  HQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERE 707

Query: 98   RDGEKSKDRERDRDGEKERDRDRDH---HHRDRHR 3
             + E++++RER+R+ EKERDR+R+    H R+R R
Sbjct: 708  LERERAREREREREREKERDRERERDRDHDRERER 742

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 53/145 (36%), Positives = 80/145 (55%), Gaps = 3/145 (2%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  ++ E E E     + + +     + +    +     RD+DRE  + RE+D
Sbjct: 689  ERERERERERDR-EREKERELERERAREREREREREKERDRERERDRDHDRERERERERD 747

Query: 248  RENGRERERK---REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            RE  RERER+   RE+ R+R+R R+R+ E+ R RER++ R+R RD E  KD+GRD  + K
Sbjct: 748  REKEREREREERERERERERERERERERERERARERDKERERQRDWE-DKDKGRDDRREK 806

Query: 77   DRERDRDGEKERDRDRDHHHRDRHR 3
             RE  R+    RD   +   + R+R
Sbjct: 807  -REDIREERNLRDGHDERKSKKRYR 830

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 47/133 (35%), Positives = 71/133 (53%), Gaps = 13/133 (9%)
 Frame = -2

Query: 386  GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK----------SREKDRENG 237
            GE +         +P  +   D  DS+S H SR +  ES +          SR++ +E  
Sbjct: 1233 GERKSRIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGSFDSRDRLQERD 1291

Query: 236  R---ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
            R   +RER+RE+   R R  DRD++K  D  R R RDR+R+ ER +D+ RD ++ ++R  
Sbjct: 1292 RYEHDRERERERRDTRQREWDRDADK--DWPRNRDRDRLRERERERDKRRDLDRERERLI 1349

Query: 65   DRDGEKERDRDRD 27
                E++RDRDRD
Sbjct: 1350 PDSLERDRDRDRD 1362

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 48/139 (34%), Positives = 69/139 (49%), Gaps = 4/139 (2%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  E+      D  H D   +     D +    +      + +RE  + RE++
Sbjct: 715  EREREREREKERDRERERDRDH-DRERERERERDREKERERERE---ERERERERERERE 770

Query: 248  RENGRERERKREKGRDRDRSRD-RDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            RE  RERER RE+ ++R+R RD  D +K RD  RE+ R+ +R+ ER+   G D  KSK R
Sbjct: 771  RERERERERARERDKERERQRDWEDKDKGRDDRREK-REDIRE-ERNLRDGHDERKSKKR 828

Query: 71   ERDRDGEKERD---RDRDH 24
             R+      R    R R+H
Sbjct: 829  YRNEGSPSPRQSPKRRREH 847

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 9/105 (8%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER------SRDRV 129
            R+ +R  ++ RE DR+  ++  R R++ R R+R R+RD  +  DRERER       RDR 
Sbjct: 1299 RERERRDTRQREWDRDADKDWPRNRDRDRLRERERERDKRRDLDRERERLIPDSLERDRD 1358

Query: 128  RDGERSKDRGRDGEKSKDRERDRDGEKERDRD---RDHHHRDRHR 3
            RD +R+ +     E  K  E   + E ERD +   RD    D+ R
Sbjct: 1359 RDRDRTFESSSQIESVKRSEAKLESEHERDLEGTSRDSVALDKER 1403

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 35/108 (32%), Positives = 57/108 (52%)
 Frame = -2

Query: 374  DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRD 195
            D Y +D         + +  D++     RD D++  ++R++DR   RERER+R+K RD D
Sbjct: 1291 DRYEHDRE------RERERRDTRQREWDRDADKDWPRNRDRDRL--RERERERDKRRDLD 1342

Query: 194  RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGE 51
            R R+R    S +R+R+R RDR  +     +  +  E   + E +RD E
Sbjct: 1343 RERERLIPDSLERDRDRDRDRTFESSSQIESVKRSEAKLESEHERDLE 1390

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 44/144 (30%), Positives = 69/144 (47%), Gaps = 26/144 (18%)
 Frame = -2

Query: 365 HNDSSPQ----PPAAADEDLTDSKSNH--VSRDNDR------ESSKSREKDRENGRERER 222
           H+ SSPQ    PP          + +H   S+ +DR      E+   R+++++   ERE 
Sbjct: 378 HSLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREETRGKRDREKDTREEREY 437

Query: 221 KREKGRDRDRSRDRDSEKSRDRERER-SRDR--------VRDGERSKDRGRDGEKSKDRE 69
           ++++   RD   DR+    RDR   R +RDR        +RD    +D  RD ++S+D  
Sbjct: 438 EQDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDIRDSREMRDYSRDNKESRD-P 496

Query: 68  RD----RDGEKERDRD-RDHHHRD 12
           RD    RD    RDR+ RD H ++
Sbjct: 497 RDSRSARDAHDYRDRESRDTHRKE 520

[41][TOP]
>UniRef100_UPI0000D9BCCE PREDICTED: similar to RNA binding motif protein 25 isoform 1 n=1
           Tax=Macaca mulatta RepID=UPI0000D9BCCE
          Length = 706

 Score =  109 bits (273), Expect = 8e-23
 Identities = 53/139 (38%), Positives = 84/139 (60%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E     +   +     + +    +     RD DR+ +K R++DR+
Sbjct: 304 EIEKERRERERERERERE-RREREREREREREREKEKERERERERDRDRDRTKERDRDRD 362

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R RE+  DR++ R R  EKSRDRERER R+R R+ ER ++R R+ E+ ++RER+
Sbjct: 363 RERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERERE 422

Query: 62  RDGEKERDRDRDHHHRDRH 6
           R+ EK++ RDR+    D +
Sbjct: 423 REREKDKKRDREEDEEDAY 441

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/129 (37%), Positives = 73/129 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     RD +R+  + RE+ 
Sbjct: 315 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERS 374

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            +  ++R R REK RDR+R R+R+ E+ R+RERER R+R R+ ER ++R R+ +K +DRE
Sbjct: 375 SDRNKDRSRSREKSRDREREREREREREREREREREREREREREREREREREKDKKRDRE 434

Query: 68  RDRDGEKER 42
            D +   ER
Sbjct: 435 EDEEDAYER 443

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/105 (51%), Positives = 71/105 (67%), Gaps = 13/105 (12%)
 Frame = -2

Query: 278 RESSKSREKDRENG-RERERKR--------EKGRDRDRSRDRDSEKSRDRERERSRDRVR 126
           RE  + RE++RE   RERER+R        E+ R+R+R RDRD  K RDR+R+R RDR R
Sbjct: 310 RERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDR 369

Query: 125 DGERS----KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ERS    KDR R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 370 DRERSSDRNKDRSRSREKSRDRERERERERERERERE-RERERER 413

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/97 (46%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR R  ER
Sbjct: 298 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 357

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR R+ ++ +DRER  D  K+R R R+   RDR R
Sbjct: 358 DRDRDRERDRDRDRERSSDRNKDRSRSRE-KSRDRER 393

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/101 (43%), Positives = 67/101 (66%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRV----R 126
           ++      + RE++RE  RERER+ RE+ R+R+R R+++ E+ R+RER+R RDR     R
Sbjct: 300 KERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDR 359

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +R +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 360 DRDRERDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 399

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/115 (38%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK-SRDRE 153
           +ED  D  S  +S+  D       EK ++    +E ++E+ R+R+R R+R+ E+  R+RE
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKER-RERERERERERERRERERE 328

Query: 152 RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           RER R+R ++ ER ++R RD ++ + +ERDRD ++ERDRDRD       ++DR R
Sbjct: 329 REREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSR 383

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 48/141 (34%), Positives = 80/141 (56%), Gaps = 1/141 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E+  E E E +   D + +     D +    +    S D +++ S+SREK
Sbjct: 328 EREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREK 387

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R+  RERER+RE+ R+R+R R+R+ E+ R+RERER        ER KD+ RD E+ ++ 
Sbjct: 388 SRDRERERERERERERERERERERERERERERERER--------EREKDKKRDREEDEED 439

Query: 71  ERDRDGEKERDRDRDHHHRDR 9
             +R   + + R+++  +++R
Sbjct: 440 AYERRKLERKLREKEAAYQER 460

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 15/149 (10%)
 Frame = -2

Query: 428 EYEFEEER---RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           E E E ER   R    E + + +   D       ++D +   S+S   SRD +RE    R
Sbjct: 340 ERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERE----R 395

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS- 81
           E++RE  RERER+RE+ R+R+R R+R+ E+ +D++R+R  D     ER K   +  EK  
Sbjct: 396 EREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEA 455

Query: 80  -----------KDRERDRDGEKERDRDRD 27
                      ++R++ R+ EKE +R+ +
Sbjct: 456 AYQERLKNWEIRERKKTREYEKEAEREEE 484

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/113 (38%), Positives = 64/113 (56%), Gaps = 7/113 (6%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 259 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 318

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDHHHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDRD   RDR R
Sbjct: 319 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRD-RERDRDR 369

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/129 (27%), Positives = 64/129 (49%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +  R    + E   + + D S     + D +    +     R+ +RE  + RE++RE  R
Sbjct: 362 DRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERER 421

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           ERER+++K RDR+   + D+ + R  ER+         ER K+     E+ K RE +++ 
Sbjct: 422 EREREKDKKRDREED-EEDAYERRKLERKLREKEAAYQERLKN-WEIRERKKTREYEKEA 479

Query: 53  EKERDRDRD 27
           E+E +R R+
Sbjct: 480 EREEERRRE 488

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 27/89 (30%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE- 117
           R+ +RE  + RE++RE  RE+++KR++  D + + +R   + + RE+E + ++R+++ E 
Sbjct: 407 REREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEI 466

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           R + + R+ EK  +RE +R  E  ++  R
Sbjct: 467 RERKKTREYEKEAEREEERRREMAKEAKR 495

[42][TOP]
>UniRef100_UPI00005A1803 PREDICTED: similar to RNA binding motif protein 25 isoform 9 n=1
           Tax=Canis lupus familiaris RepID=UPI00005A1803
          Length = 708

 Score =  109 bits (273), Expect = 8e-23
 Identities = 53/139 (38%), Positives = 84/139 (60%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E     +   +     + +    +     RD DR+ +K R++DR+
Sbjct: 304 EIEKERRERERERERERE-RREREREREREREREKEKERERERERDRDRDRTKERDRDRD 362

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R RE+  DR++ R R  EKSRDRERER R+R R+ ER ++R R+ E+ ++RER+
Sbjct: 363 RERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERERE 422

Query: 62  RDGEKERDRDRDHHHRDRH 6
           R+ EK++ RDR+    D +
Sbjct: 423 REREKDKKRDREEDEEDAY 441

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/129 (37%), Positives = 73/129 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     RD +R+  + RE+ 
Sbjct: 315 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERS 374

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            +  ++R R REK RDR+R R+R+ E+ R+RERER R+R R+ ER ++R R+ +K +DRE
Sbjct: 375 SDRNKDRSRSREKSRDREREREREREREREREREREREREREREREREREREKDKKRDRE 434

Query: 68  RDRDGEKER 42
            D +   ER
Sbjct: 435 EDEEDAYER 443

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/105 (51%), Positives = 71/105 (67%), Gaps = 13/105 (12%)
 Frame = -2

Query: 278 RESSKSREKDRENG-RERERKR--------EKGRDRDRSRDRDSEKSRDRERERSRDRVR 126
           RE  + RE++RE   RERER+R        E+ R+R+R RDRD  K RDR+R+R RDR R
Sbjct: 310 RERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDR 369

Query: 125 DGERS----KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ERS    KDR R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 370 DRERSSDRNKDRSRSREKSRDRERERERERERERERE-RERERER 413

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/97 (46%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR R  ER
Sbjct: 298 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 357

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR R+ ++ +DRER  D  K+R R R+   RDR R
Sbjct: 358 DRDRDRERDRDRDRERSSDRNKDRSRSRE-KSRDRER 393

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/101 (43%), Positives = 67/101 (66%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRV----R 126
           ++      + RE++RE  RERER+ RE+ R+R+R R+++ E+ R+RER+R RDR     R
Sbjct: 300 KERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDR 359

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +R +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 360 DRDRERDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 399

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/115 (38%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK-SRDRE 153
           +ED  D  S  +S+  D       EK ++    +E ++E+ R+R+R R+R+ E+  R+RE
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKER-RERERERERERERRERERE 328

Query: 152 RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           RER R+R ++ ER ++R RD ++ + +ERDRD ++ERDRDRD       ++DR R
Sbjct: 329 REREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSR 383

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 48/141 (34%), Positives = 80/141 (56%), Gaps = 1/141 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E+  E E E +   D + +     D +    +    S D +++ S+SREK
Sbjct: 328 EREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREK 387

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R+  RERER+RE+ R+R+R R+R+ E+ R+RERER        ER KD+ RD E+ ++ 
Sbjct: 388 SRDRERERERERERERERERERERERERERERERER--------EREKDKKRDREEDEED 439

Query: 71  ERDRDGEKERDRDRDHHHRDR 9
             +R   + + R+++  +++R
Sbjct: 440 AYERRKLERKLREKEAAYQER 460

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 15/149 (10%)
 Frame = -2

Query: 428 EYEFEEER---RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           E E E ER   R    E + + +   D       ++D +   S+S   SRD +RE    R
Sbjct: 340 ERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERE----R 395

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS- 81
           E++RE  RERER+RE+ R+R+R R+R+ E+ +D++R+R  D     ER K   +  EK  
Sbjct: 396 EREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEA 455

Query: 80  -----------KDRERDRDGEKERDRDRD 27
                      ++R++ R+ EKE +R+ +
Sbjct: 456 AYQERLKNWEIRERKKTREYEKEAEREEE 484

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/113 (38%), Positives = 64/113 (56%), Gaps = 7/113 (6%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 259 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 318

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDHHHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDRD   RDR R
Sbjct: 319 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRD-RERDRDR 369

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/129 (27%), Positives = 64/129 (49%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +  R    + E   + + D S     + D +    +     R+ +RE  + RE++RE  R
Sbjct: 362 DRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERER 421

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           ERER+++K RDR+   + D+ + R  ER+         ER K+     E+ K RE +++ 
Sbjct: 422 EREREKDKKRDREED-EEDAYERRKLERKLREKEAAYQERLKN-WEIRERKKTREYEKEA 479

Query: 53  EKERDRDRD 27
           E+E +R R+
Sbjct: 480 EREEERRRE 488

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 27/89 (30%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE- 117
           R+ +RE  + RE++RE  RE+++KR++  D + + +R   + + RE+E + ++R+++ E 
Sbjct: 407 REREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEI 466

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           R + + R+ EK  +RE +R  E  ++  R
Sbjct: 467 RERKKTREYEKEAEREEERRREMAKEAKR 495

[43][TOP]
>UniRef100_UPI00005A17FF PREDICTED: similar to RNA binding motif protein 25 isoform 3 n=1
           Tax=Canis lupus familiaris RepID=UPI00005A17FF
          Length = 708

 Score =  109 bits (273), Expect = 8e-23
 Identities = 53/139 (38%), Positives = 84/139 (60%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E     +   +     + +    +     RD DR+ +K R++DR+
Sbjct: 304 EIEKERRERERERERERE-RREREREREREREREKEKERERERERDRDRDRTKERDRDRD 362

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R RE+  DR++ R R  EKSRDRERER R+R R+ ER ++R R+ E+ ++RER+
Sbjct: 363 RERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERERE 422

Query: 62  RDGEKERDRDRDHHHRDRH 6
           R+ EK++ RDR+    D +
Sbjct: 423 REREKDKKRDREEDEEDAY 441

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/129 (37%), Positives = 73/129 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     RD +R+  + RE+ 
Sbjct: 315 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERS 374

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            +  ++R R REK RDR+R R+R+ E+ R+RERER R+R R+ ER ++R R+ +K +DRE
Sbjct: 375 SDRNKDRSRSREKSRDREREREREREREREREREREREREREREREREREREKDKKRDRE 434

Query: 68  RDRDGEKER 42
            D +   ER
Sbjct: 435 EDEEDAYER 443

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/105 (51%), Positives = 71/105 (67%), Gaps = 13/105 (12%)
 Frame = -2

Query: 278 RESSKSREKDRENG-RERERKR--------EKGRDRDRSRDRDSEKSRDRERERSRDRVR 126
           RE  + RE++RE   RERER+R        E+ R+R+R RDRD  K RDR+R+R RDR R
Sbjct: 310 RERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDR 369

Query: 125 DGERS----KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ERS    KDR R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 370 DRERSSDRNKDRSRSREKSRDRERERERERERERERE-RERERER 413

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/97 (46%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR R  ER
Sbjct: 298 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 357

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR R+ ++ +DRER  D  K+R R R+   RDR R
Sbjct: 358 DRDRDRERDRDRDRERSSDRNKDRSRSRE-KSRDRER 393

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/101 (43%), Positives = 67/101 (66%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRV----R 126
           ++      + RE++RE  RERER+ RE+ R+R+R R+++ E+ R+RER+R RDR     R
Sbjct: 300 KERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDR 359

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +R +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 360 DRDRERDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 399

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/115 (38%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK-SRDRE 153
           +ED  D  S  +S+  D       EK ++    +E ++E+ R+R+R R+R+ E+  R+RE
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKER-RERERERERERERRERERE 328

Query: 152 RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           RER R+R ++ ER ++R RD ++ + +ERDRD ++ERDRDRD       ++DR R
Sbjct: 329 REREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSR 383

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 48/141 (34%), Positives = 80/141 (56%), Gaps = 1/141 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E+  E E E +   D + +     D +    +    S D +++ S+SREK
Sbjct: 328 EREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREK 387

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R+  RERER+RE+ R+R+R R+R+ E+ R+RERER        ER KD+ RD E+ ++ 
Sbjct: 388 SRDRERERERERERERERERERERERERERERERER--------EREKDKKRDREEDEED 439

Query: 71  ERDRDGEKERDRDRDHHHRDR 9
             +R   + + R+++  +++R
Sbjct: 440 AYERRKLERKLREKEAAYQER 460

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 15/149 (10%)
 Frame = -2

Query: 428 EYEFEEER---RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           E E E ER   R    E + + +   D       ++D +   S+S   SRD +RE    R
Sbjct: 340 ERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERE----R 395

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS- 81
           E++RE  RERER+RE+ R+R+R R+R+ E+ +D++R+R  D     ER K   +  EK  
Sbjct: 396 EREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEA 455

Query: 80  -----------KDRERDRDGEKERDRDRD 27
                      ++R++ R+ EKE +R+ +
Sbjct: 456 AYQERLKNWEIRERKKTREYEKEAEREEE 484

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/113 (38%), Positives = 64/113 (56%), Gaps = 7/113 (6%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 259 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 318

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDHHHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDRD   RDR R
Sbjct: 319 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRD-RERDRDR 369

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/129 (27%), Positives = 64/129 (49%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +  R    + E   + + D S     + D +    +     R+ +RE  + RE++RE  R
Sbjct: 362 DRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERER 421

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           ERER+++K RDR+   + D+ + R  ER+         ER K+     E+ K RE +++ 
Sbjct: 422 EREREKDKKRDREED-EEDAYERRKLERKLREKEAAYQERLKN-WEIRERKKTREYEKEA 479

Query: 53  EKERDRDRD 27
           E+E +R R+
Sbjct: 480 EREEERRRE 488

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 27/89 (30%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE- 117
           R+ +RE  + RE++RE  RE+++KR++  D + + +R   + + RE+E + ++R+++ E 
Sbjct: 407 REREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEI 466

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           R + + R+ EK  +RE +R  E  ++  R
Sbjct: 467 RERKKTREYEKEAEREEERRREMAKEAKR 495

[44][TOP]
>UniRef100_UPI00001D7B5D PREDICTED: hypothetical protein isoform 4 n=1 Tax=Pan troglodytes
           RepID=UPI00001D7B5D
          Length = 706

 Score =  109 bits (273), Expect = 8e-23
 Identities = 53/139 (38%), Positives = 84/139 (60%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E     +   +     + +    +     RD DR+ +K R++DR+
Sbjct: 304 EIEKERRERERERERERE-RREREREREREREREKEKERERERERDRDRDRTKERDRDRD 362

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R RE+  DR++ R R  EKSRDRERER R+R R+ ER ++R R+ E+ ++RER+
Sbjct: 363 RERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERERE 422

Query: 62  RDGEKERDRDRDHHHRDRH 6
           R+ EK++ RDR+    D +
Sbjct: 423 REREKDKKRDREEDEEDAY 441

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/129 (37%), Positives = 73/129 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     RD +R+  + RE+ 
Sbjct: 315 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERS 374

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            +  ++R R REK RDR+R R+R+ E+ R+RERER R+R R+ ER ++R R+ +K +DRE
Sbjct: 375 SDRNKDRSRSREKSRDREREREREREREREREREREREREREREREREREREKDKKRDRE 434

Query: 68  RDRDGEKER 42
            D +   ER
Sbjct: 435 EDEEDAYER 443

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/105 (51%), Positives = 71/105 (67%), Gaps = 13/105 (12%)
 Frame = -2

Query: 278 RESSKSREKDRENG-RERERKR--------EKGRDRDRSRDRDSEKSRDRERERSRDRVR 126
           RE  + RE++RE   RERER+R        E+ R+R+R RDRD  K RDR+R+R RDR R
Sbjct: 310 RERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDR 369

Query: 125 DGERS----KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ERS    KDR R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 370 DRERSSDRNKDRSRSREKSRDRERERERERERERERE-RERERER 413

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/97 (46%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR R  ER
Sbjct: 298 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 357

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR R+ ++ +DRER  D  K+R R R+   RDR R
Sbjct: 358 DRDRDRERDRDRDRERSSDRNKDRSRSRE-KSRDRER 393

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/101 (43%), Positives = 67/101 (66%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRV----R 126
           ++      + RE++RE  RERER+ RE+ R+R+R R+++ E+ R+RER+R RDR     R
Sbjct: 300 KERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDR 359

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +R +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 360 DRDRERDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 399

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/115 (38%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK-SRDRE 153
           +ED  D  S  +S+  D       EK ++    +E ++E+ R+R+R R+R+ E+  R+RE
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKER-RERERERERERERRERERE 328

Query: 152 RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           RER R+R ++ ER ++R RD ++ + +ERDRD ++ERDRDRD       ++DR R
Sbjct: 329 REREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSR 383

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 48/141 (34%), Positives = 80/141 (56%), Gaps = 1/141 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E+  E E E +   D + +     D +    +    S D +++ S+SREK
Sbjct: 328 EREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREK 387

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R+  RERER+RE+ R+R+R R+R+ E+ R+RERER        ER KD+ RD E+ ++ 
Sbjct: 388 SRDRERERERERERERERERERERERERERERERER--------EREKDKKRDREEDEED 439

Query: 71  ERDRDGEKERDRDRDHHHRDR 9
             +R   + + R+++  +++R
Sbjct: 440 AYERRKLERKLREKEAAYQER 460

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 15/149 (10%)
 Frame = -2

Query: 428 EYEFEEER---RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           E E E ER   R    E + + +   D       ++D +   S+S   SRD +RE    R
Sbjct: 340 ERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERE----R 395

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS- 81
           E++RE  RERER+RE+ R+R+R R+R+ E+ +D++R+R  D     ER K   +  EK  
Sbjct: 396 EREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEA 455

Query: 80  -----------KDRERDRDGEKERDRDRD 27
                      ++R++ R+ EKE +R+ +
Sbjct: 456 AYQERLKNWEIRERKKTREYEKEAEREEE 484

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/113 (38%), Positives = 64/113 (56%), Gaps = 7/113 (6%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 259 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 318

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDHHHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDRD   RDR R
Sbjct: 319 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRD-RERDRDR 369

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/129 (27%), Positives = 64/129 (49%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +  R    + E   + + D S     + D +    +     R+ +RE  + RE++RE  R
Sbjct: 362 DRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERER 421

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           ERER+++K RDR+   + D+ + R  ER+         ER K+     E+ K RE +++ 
Sbjct: 422 EREREKDKKRDREED-EEDAYERRKLERKLREKEAAYQERLKN-WEIRERKKTREYEKEA 479

Query: 53  EKERDRDRD 27
           E+E +R R+
Sbjct: 480 EREEERRRE 488

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 27/89 (30%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE- 117
           R+ +RE  + RE++RE  RE+++KR++  D + + +R   + + RE+E + ++R+++ E 
Sbjct: 407 REREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEI 466

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           R + + R+ EK  +RE +R  E  ++  R
Sbjct: 467 RERKKTREYEKEAEREEERRREMAKEAKR 495

[45][TOP]
>UniRef100_UPI00016E5BAB UPI00016E5BAB related cluster n=1 Tax=Takifugu rubripes
            RepID=UPI00016E5BAB
          Length = 2174

 Score =  109 bits (273), Expect = 8e-23
 Identities = 60/163 (36%), Positives = 91/163 (55%), Gaps = 17/163 (10%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPA--------AADEDLTDSKS-----N 300
            P     +  EER  E  E    +      S +PP         + D D +  K      +
Sbjct: 1991 PASAPLQPSEERTREASEDRRRERDREAHSGRPPWDRNQVKRWSRDRDRSKEKERERERS 2050

Query: 299  HVSRDNDRESSKSREKDRENGRERERKRE----KGRDRDRSRDRDSEKSRDRERERSRDR 132
               RD+DR+  ++R+++RE  RERE++RE    K RDRDR RDRD ++ +DR R+R RDR
Sbjct: 2051 RERRDHDRDRGRNRDREREREREREKRRERSRSKERDRDRDRDRDRDRGKDRGRDRDRDR 2110

Query: 131  VRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             RD ER +DR R+ ++ +DR+RDRD ++E+D++RD     R +
Sbjct: 2111 DRDRERDRDRDRERDRDRDRDRDRDRDREKDKERDRRDGSRSK 2153

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 50/114 (43%), Positives = 72/114 (63%), Gaps = 6/114 (5%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRES------SKSREKDRENGRERERKREKGRDRDRSRDRDSEK 168
            D D   ++     R+ +RE       SK R++DR+  R+R+R +++GRDRDR RDRD E+
Sbjct: 2057 DRDRGRNRDREREREREREKRRERSRSKERDRDRDRDRDRDRGKDRGRDRDRDRDRDRER 2116

Query: 167  SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
             RDR+RER RDR RD    +DR RD EK K+R+R RDG   R +++    +D+H
Sbjct: 2117 DRDRDRERDRDRDRD----RDRDRDREKDKERDR-RDG--SRSKEKREEKKDKH 2163

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 45/133 (33%), Positives = 76/133 (57%), Gaps = 1/133 (0%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  E+ + + +   + D         + +    K    SR  +R+  + R++D
Sbjct: 2042 EKERERERSRERRDHDRDRGRNRDRE------REREREREKRRERSRSKERDRDRDRDRD 2095

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG-RDGEKSKDR 72
            R+ G++R R R++ RDRDR RDRD ++ RDR+R+R RDR RD E+ K+R  RDG +SK++
Sbjct: 2096 RDRGKDRGRDRDRDRDRDRERDRDRDRERDRDRDRDRDRDRDREKDKERDRRDGSRSKEK 2155

Query: 71   ERDRDGEKERDRD 33
              ++  +    ++
Sbjct: 2156 REEKKDKHSTSKE 2168

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 42/127 (33%), Positives = 60/127 (47%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E E+R E+   +  D   +          D D    +     RD DR+  + R++D
Sbjct: 2069 EREREREKRRERSRSKERDRDRDRDR-------DRDRGKDRGRDRDRDRDRDRERDRDRD 2121

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            RE              RDR RDRD ++ RDRE+++ RDR RDG RSK++    EK     
Sbjct: 2122 RE--------------RDRDRDRDRDRDRDREKDKERDR-RDGSRSKEKRE--EKKDKHS 2164

Query: 68   RDRDGEK 48
              ++GEK
Sbjct: 2165 TSKEGEK 2171

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 46/166 (27%), Positives = 68/166 (40%), Gaps = 25/166 (15%)
 Frame = -2

Query: 425  YEFEEERRYEQPEG--EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            Y      +YE   G    +  Y +   P PP     D     + H  R +    S+    
Sbjct: 1896 YRGPPPNQYEDRRGPPSSDSQYGSRPHPSPPHRGSFDEHRVPAPHEGRAHHFGGSEQYRF 1955

Query: 251  DR---ENGRERERKREKGRDRDRSRDRDS-------------EKSRDRERERSRDRVRDG 120
            DR   E   E E+ + +GR R  S +R S             + S +R RE S DR R+ 
Sbjct: 1956 DRLSEERNTEEEQHQSRGR-RSHSGERFSRFESHREPASAPLQPSEERTREASEDRRRER 2014

Query: 119  ERSK-------DRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +R         DR +    S+DR+R ++ E+ER+R R+    DR R
Sbjct: 2015 DREAHSGRPPWDRNQVKRWSRDRDRSKEKERERERSRERRDHDRDR 2060

[46][TOP]
>UniRef100_UPI000057F387 PREDICTED: RNA binding motif protein 25 isoform 5 n=1 Tax=Bos
           taurus RepID=UPI000057F387
          Length = 843

 Score =  109 bits (273), Expect = 8e-23
 Identities = 53/139 (38%), Positives = 84/139 (60%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E     +   +     + +    +     RD DR+ +K R++DR+
Sbjct: 304 EIEKERRERERERERERE-RREREREREREREREKEKERERERERDRDRDRTKERDRDRD 362

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R RE+  DR++ R R  EKSRDRERER R+R R+ ER ++R R+ E+ ++RER+
Sbjct: 363 RERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERERE 422

Query: 62  RDGEKERDRDRDHHHRDRH 6
           R+ EK++ RDR+    D +
Sbjct: 423 REREKDKKRDREEDEEDAY 441

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/129 (37%), Positives = 73/129 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     RD +R+  + RE+ 
Sbjct: 315 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERS 374

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            +  ++R R REK RDR+R R+R+ E+ R+RERER R+R R+ ER ++R R+ +K +DRE
Sbjct: 375 SDRNKDRSRSREKSRDREREREREREREREREREREREREREREREREREREKDKKRDRE 434

Query: 68  RDRDGEKER 42
            D +   ER
Sbjct: 435 EDEEDAYER 443

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/105 (51%), Positives = 71/105 (67%), Gaps = 13/105 (12%)
 Frame = -2

Query: 278 RESSKSREKDRENG-RERERKR--------EKGRDRDRSRDRDSEKSRDRERERSRDRVR 126
           RE  + RE++RE   RERER+R        E+ R+R+R RDRD  K RDR+R+R RDR R
Sbjct: 310 RERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDR 369

Query: 125 DGERS----KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ERS    KDR R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 370 DRERSSDRNKDRSRSREKSRDRERERERERERERERE-RERERER 413

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/97 (46%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR R  ER
Sbjct: 298 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 357

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR R+ ++ +DRER  D  K+R R R+   RDR R
Sbjct: 358 DRDRDRERDRDRDRERSSDRNKDRSRSRE-KSRDRER 393

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/101 (43%), Positives = 67/101 (66%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRV----R 126
           ++      + RE++RE  RERER+ RE+ R+R+R R+++ E+ R+RER+R RDR     R
Sbjct: 300 KERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDR 359

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +R +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 360 DRDRERDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 399

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/115 (38%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK-SRDRE 153
           +ED  D  S  +S+  D       EK ++    +E ++E+ R+R+R R+R+ E+  R+RE
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKER-RERERERERERERRERERE 328

Query: 152 RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           RER R+R ++ ER ++R RD ++ + +ERDRD ++ERDRDRD       ++DR R
Sbjct: 329 REREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSR 383

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 48/141 (34%), Positives = 80/141 (56%), Gaps = 1/141 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E+  E E E +   D + +     D +    +    S D +++ S+SREK
Sbjct: 328 EREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREK 387

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R+  RERER+RE+ R+R+R R+R+ E+ R+RERER        ER KD+ RD E+ ++ 
Sbjct: 388 SRDRERERERERERERERERERERERERERERERER--------EREKDKKRDREEDEED 439

Query: 71  ERDRDGEKERDRDRDHHHRDR 9
             +R   + + R+++  +++R
Sbjct: 440 AYERRKLERKLREKEAAYQER 460

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 15/149 (10%)
 Frame = -2

Query: 428 EYEFEEER---RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           E E E ER   R    E + + +   D       ++D +   S+S   SRD +RE    R
Sbjct: 340 ERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERE----R 395

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS- 81
           E++RE  RERER+RE+ R+R+R R+R+ E+ +D++R+R  D     ER K   +  EK  
Sbjct: 396 EREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEA 455

Query: 80  -----------KDRERDRDGEKERDRDRD 27
                      ++R++ R+ EKE +R+ +
Sbjct: 456 AYQERLKNWEIRERKKTREYEKEAEREEE 484

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/113 (38%), Positives = 64/113 (56%), Gaps = 7/113 (6%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 259 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 318

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDHHHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDRD   RDR R
Sbjct: 319 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRD-RERDRDR 369

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/129 (27%), Positives = 64/129 (49%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +  R    + E   + + D S     + D +    +     R+ +RE  + RE++RE  R
Sbjct: 362 DRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERER 421

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           ERER+++K RDR+   + D+ + R  ER+         ER K+     E+ K RE +++ 
Sbjct: 422 EREREKDKKRDREED-EEDAYERRKLERKLREKEAAYQERLKN-WEIRERKKTREYEKEA 479

Query: 53  EKERDRDRD 27
           E+E +R R+
Sbjct: 480 EREEERRRE 488

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 27/89 (30%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE- 117
           R+ +RE  + RE++RE  RE+++KR++  D + + +R   + + RE+E + ++R+++ E 
Sbjct: 407 REREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEI 466

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           R + + R+ EK  +RE +R  E  ++  R
Sbjct: 467 RERKKTREYEKEAEREEERRREMAKEAKR 495

[47][TOP]
>UniRef100_P49756 RNA-binding protein 25 n=2 Tax=Homo sapiens RepID=RBM25_HUMAN
          Length = 843

 Score =  109 bits (273), Expect = 8e-23
 Identities = 53/139 (38%), Positives = 84/139 (60%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E     +   +     + +    +     RD DR+ +K R++DR+
Sbjct: 304 EIEKERRERERERERERE-RREREREREREREREKEKERERERERDRDRDRTKERDRDRD 362

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R RE+  DR++ R R  EKSRDRERER R+R R+ ER ++R R+ E+ ++RER+
Sbjct: 363 RERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERERE 422

Query: 62  RDGEKERDRDRDHHHRDRH 6
           R+ EK++ RDR+    D +
Sbjct: 423 REREKDKKRDREEDEEDAY 441

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/129 (37%), Positives = 73/129 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     RD +R+  + RE+ 
Sbjct: 315 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERS 374

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            +  ++R R REK RDR+R R+R+ E+ R+RERER R+R R+ ER ++R R+ +K +DRE
Sbjct: 375 SDRNKDRSRSREKSRDREREREREREREREREREREREREREREREREREREKDKKRDRE 434

Query: 68  RDRDGEKER 42
            D +   ER
Sbjct: 435 EDEEDAYER 443

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/105 (51%), Positives = 71/105 (67%), Gaps = 13/105 (12%)
 Frame = -2

Query: 278 RESSKSREKDRENG-RERERKR--------EKGRDRDRSRDRDSEKSRDRERERSRDRVR 126
           RE  + RE++RE   RERER+R        E+ R+R+R RDRD  K RDR+R+R RDR R
Sbjct: 310 RERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDR 369

Query: 125 DGERS----KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ERS    KDR R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 370 DRERSSDRNKDRSRSREKSRDRERERERERERERERE-RERERER 413

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/97 (46%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR R  ER
Sbjct: 298 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 357

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR R+ ++ +DRER  D  K+R R R+   RDR R
Sbjct: 358 DRDRDRERDRDRDRERSSDRNKDRSRSRE-KSRDRER 393

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/101 (43%), Positives = 67/101 (66%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRV----R 126
           ++      + RE++RE  RERER+ RE+ R+R+R R+++ E+ R+RER+R RDR     R
Sbjct: 300 KERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDR 359

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +R +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 360 DRDRERDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 399

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/115 (38%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK-SRDRE 153
           +ED  D  S  +S+  D       EK ++    +E ++E+ R+R+R R+R+ E+  R+RE
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKER-RERERERERERERRERERE 328

Query: 152 RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           RER R+R ++ ER ++R RD ++ + +ERDRD ++ERDRDRD       ++DR R
Sbjct: 329 REREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSR 383

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 48/141 (34%), Positives = 80/141 (56%), Gaps = 1/141 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E+  E E E +   D + +     D +    +    S D +++ S+SREK
Sbjct: 328 EREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREK 387

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R+  RERER+RE+ R+R+R R+R+ E+ R+RERER        ER KD+ RD E+ ++ 
Sbjct: 388 SRDRERERERERERERERERERERERERERERERER--------EREKDKKRDREEDEED 439

Query: 71  ERDRDGEKERDRDRDHHHRDR 9
             +R   + + R+++  +++R
Sbjct: 440 AYERRKLERKLREKEAAYQER 460

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 15/149 (10%)
 Frame = -2

Query: 428 EYEFEEER---RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           E E E ER   R    E + + +   D       ++D +   S+S   SRD +RE    R
Sbjct: 340 ERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERE----R 395

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS- 81
           E++RE  RERER+RE+ R+R+R R+R+ E+ +D++R+R  D     ER K   +  EK  
Sbjct: 396 EREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEA 455

Query: 80  -----------KDRERDRDGEKERDRDRD 27
                      ++R++ R+ EKE +R+ +
Sbjct: 456 AYQERLKNWEIRERKKTREYEKEAEREEE 484

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/113 (38%), Positives = 64/113 (56%), Gaps = 7/113 (6%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 259 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 318

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDHHHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDRD   RDR R
Sbjct: 319 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRD-RERDRDR 369

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/129 (27%), Positives = 64/129 (49%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +  R    + E   + + D S     + D +    +     R+ +RE  + RE++RE  R
Sbjct: 362 DRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERER 421

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           ERER+++K RDR+   + D+ + R  ER+         ER K+     E+ K RE +++ 
Sbjct: 422 EREREKDKKRDREED-EEDAYERRKLERKLREKEAAYQERLKN-WEIRERKKTREYEKEA 479

Query: 53  EKERDRDRD 27
           E+E +R R+
Sbjct: 480 EREEERRRE 488

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 27/89 (30%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE- 117
           R+ +RE  + RE++RE  RE+++KR++  D + + +R   + + RE+E + ++R+++ E 
Sbjct: 407 REREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEI 466

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           R + + R+ EK  +RE +R  E  ++  R
Sbjct: 467 RERKKTREYEKEAEREEERRREMAKEAKR 495

[48][TOP]
>UniRef100_UPI0000E7FBBC PREDICTED: similar to KIAA0853 protein n=1 Tax=Gallus gallus
            RepID=UPI0000E7FBBC
          Length = 1689

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/157 (36%), Positives = 94/157 (59%), Gaps = 11/157 (7%)
 Frame = -2

Query: 440  PTMGEYEFEEERR---YEQPEGEGE--DNYHND---SSPQPPAAADEDLTDSK---SNHV 294
            P    Y+  ++ R   +E+  GE +  DN   D   SSP       +DL   +      V
Sbjct: 708  PDRDRYDSRDQARDSSFERRHGERDRRDNRERDQRASSPVRHQGRSDDLERDERRDERRV 767

Query: 293  SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
             R +DR   ++RE++RE  R+RER+RE+ R+R+R ++R+ E+ R RERER R+R +D +R
Sbjct: 768  DRSDDRRDERARERERERERDRERERERDREREREKERELERDRARERERERERDKDRDR 827

Query: 113  SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             +DR RD ++ ++RER+R+ E+ER+R+     R+R R
Sbjct: 828  ERDRDRDHDREREREREREKEREREREERERERERER 864

 Score =  101 bits (251), Expect = 3e-20
 Identities = 54/142 (38%), Positives = 88/142 (61%), Gaps = 4/142 (2%)
 Frame = -2

Query: 416  EEERRYEQP---EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            E ++R   P   +G  +D   ++   +      +D  D ++    R+ +R+  + RE+DR
Sbjct: 738  ERDQRASSPVRHQGRSDDLERDERRDERRVDRSDDRRDERARERERERERDRERERERDR 797

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR-E 69
            E  RERE++RE  RDR R R+R+ E+ +DR+RER RDR  D ER ++R R+ E+ ++R E
Sbjct: 798  E--REREKERELERDRARERERERERDKDRDRERDRDRDHDREREREREREKEREREREE 855

Query: 68   RDRDGEKERDRDRDHHHRDRHR 3
            R+R+ E+ERDR+R+   R+R R
Sbjct: 856  RERERERERDRERE---RERER 874

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 56/181 (30%), Positives = 86/181 (47%), Gaps = 47/181 (25%)
 Frame = -2

Query: 404  RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSK--------------------------- 306
            R  Q +G      ++DS     +  D D  DS+                           
Sbjct: 684  RGSQVDGHSSSGNYHDSWESRSSYPDRDRYDSRDQARDSSFERRHGERDRRDNRERDQRA 743

Query: 305  --------------------SNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSR 186
                                   V R +DR   ++RE++RE  RER+R+RE+ RDR+R R
Sbjct: 744  SSPVRHQGRSDDLERDERRDERRVDRSDDRRDERARERERE--RERDRERERERDRERER 801

Query: 185  DRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
            +++ E  RDR RER R+R RD +R ++R RD +  ++RER+R+ EKER+R+R+   R+R 
Sbjct: 802  EKERELERDRARERERERERDKDRDRERDRDRDHDREREREREREKEREREREERERERE 861

Query: 5    R 3
            R
Sbjct: 862  R 862

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 49/138 (35%), Positives = 74/138 (53%), Gaps = 1/138 (0%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R  + E E E     D + +     + D    +     RD+DRE  + RE+++E  R
Sbjct: 792  ERERDREREREKERELERDRARERERERERDKDRDRERDRDRDHDREREREREREKERER 851

Query: 233  ERE-RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            ERE R+RE+ R+RDR R+R+ E+ RDR++ER R R  D    KD+GR+  + + RE  R+
Sbjct: 852  EREERERERERERDRERERERERGRDRDKERERQRDWD---DKDKGREDRRDR-REDIRE 907

Query: 56   GEKERDRDRDHHHRDRHR 3
                RD   +   + RHR
Sbjct: 908  ERSSRDVHEERKSKKRHR 925

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 51/145 (35%), Positives = 71/145 (48%), Gaps = 10/145 (6%)
 Frame = -2

Query: 428  EYEFEEERRYEQP---EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRE-SSKS 261
            E E E+ER  E+    E E E     D   +     D D    +     ++ +RE   + 
Sbjct: 798  EREREKERELERDRARERERERERDKDRDRERDRDRDHDREREREREREKEREREREERE 857

Query: 260  REKDRENGRERERKREKGRDRDRSRDRDSE-KSRDRERERSRDRVRD--GERSKDRGRDG 90
            RE++RE  RERER+RE+GRDRD+ R+R  +   +D+ RE  RDR  D   ERS     + 
Sbjct: 858  RERERERDRERERERERGRDRDKERERQRDWDDKDKGREDRRDRREDIREERSSRDVHEE 917

Query: 89   EKSKDRERDRDGEKERD---RDRDH 24
             KSK R R+      R    R R+H
Sbjct: 918  RKSKKRHRNESSPSPRQSPKRRREH 942

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 48/141 (34%), Positives = 73/141 (51%), Gaps = 5/141 (3%)
 Frame = -2

Query: 416  EEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN 240
            + E++   P  GE +         +P  +   D  DS+S H SR +  ES +       +
Sbjct: 1259 DREKKNNSPMTGERKSIIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGS 1317

Query: 239  GRERERKREKGR-DRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
               RER +E+ R D DR RDRD  + R R+ +R RD  +D  RS++R R  E+ ++RE+ 
Sbjct: 1318 FDSRERLQERDRHDHDRERDRDRREGRQRDWDRDRDVDKDWPRSRERERLREREREREKR 1377

Query: 62   RDGEKERDR---DRDHHHRDR 9
            R+ ++ERDR   D     RDR
Sbjct: 1378 RELDRERDRQLPDAAERERDR 1398

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D D  + +     RD D +    R ++RE  RERER+REK R+ DR RDR    + +RER
Sbjct: 1337 DRDRREGRQRDWDRDRDVDKDWPRSRERERLREREREREKRRELDRERDRQLPDAAERER 1396

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERD 39
            +R+ D            ++  K  + + DRD EKE D
Sbjct: 1397 DRTLD--------TSSQKESTKHSETKLDRDHEKEFD 1425

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 28/100 (28%), Positives = 54/100 (54%)
 Frame = -2

Query: 326  EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE 147
            E L +   +   R+ DR+  + R++D +  R+ ++   + R+R+R R+R+ E+ + RE +
Sbjct: 1322 ERLQERDRHDHDRERDRDRREGRQRDWDRDRDVDKDWPRSRERERLREREREREKRRELD 1381

Query: 146  RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
            R RDR       ++R R  + S  +E  +  E + DRD +
Sbjct: 1382 RERDRQLPDAAERERDRTLDTSSQKESTKHSETKLDRDHE 1421

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 44/120 (36%), Positives = 61/120 (50%), Gaps = 14/120 (11%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D T S+S+    D   E+   REK+RE   +R+  +E+   RD   DR+S   RDR  
Sbjct: 507 DRDRT-SQSHDRRHDRRDETRGKREKERETRDDRDYDQEQSTSRDHRDDRESRDGRDRRD 565

Query: 149 ER-SRDR--------VRDGERSKDRGRDGEKSKDRERD----RDGEKERDRD-RDHHHRD 12
            R +RDR         RD   ++D  RD + S+D +RD    RD    RDR+ RD H +D
Sbjct: 566 TRDNRDRRETRESRDTRDSRDTRDYSRDNKDSRD-QRDSRSTRDSHDYRDRESRDAHKKD 624

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 37/116 (31%), Positives = 49/116 (42%), Gaps = 1/116 (0%)
 Frame = -2

Query: 356 SSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRD 177
           SSP PP ++            S    R  S+ R   RE GR    +  +  DR   R  +
Sbjct: 476 SSPYPPRSSS-----------SPQRKRSPSRHRSPGREKGRHDRDRTSQSHDRRHDRRDE 524

Query: 176 SEKSRDRERERSRDRVRDGERSKDRG-RDGEKSKDRERDRDGEKERDRDRDHHHRD 12
           +   R++ERE   DR  D E+S  R  RD  +S+D    RD    RDR      RD
Sbjct: 525 TRGKREKERETRDDRDYDQEQSTSRDHRDDRESRDGRDRRDTRDNRDRRETRESRD 580

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 36/148 (24%), Positives = 67/148 (45%), Gaps = 6/148 (4%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  ++      D  H+    +      E   + +     R+ +R+  + RE++
Sbjct: 814  ERERERERDKDRDRERDRDRDHDREREREREREKEREREREERERERERERDRERERERE 873

Query: 248  RENGRERERKREKG-RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R   R++ER+R++   D+D+ R+   ++  D   ERS   V +  +SK R R+ E S   
Sbjct: 874  RGRDRDKERERQRDWDDKDKGREDRRDRREDIREERSSRDVHEERKSKKRHRN-ESSPSP 932

Query: 71   ERDRDGEKERDRDRDHHH-----RDRHR 3
             +     +E   D D ++      ++HR
Sbjct: 933  RQSPKRRREHSPDSDAYNSGDDKNEKHR 960

[49][TOP]
>UniRef100_UPI0000ECD64D Zinc finger CCCH domain-containing protein 13. n=1 Tax=Gallus gallus
            RepID=UPI0000ECD64D
          Length = 1588

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/157 (36%), Positives = 94/157 (59%), Gaps = 11/157 (7%)
 Frame = -2

Query: 440  PTMGEYEFEEERR---YEQPEGEGE--DNYHND---SSPQPPAAADEDLTDSK---SNHV 294
            P    Y+  ++ R   +E+  GE +  DN   D   SSP       +DL   +      V
Sbjct: 606  PDRDRYDSRDQARDSSFERRHGERDRRDNRERDQRASSPVRHQGRSDDLERDERRDERRV 665

Query: 293  SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
             R +DR   ++RE++RE  R+RER+RE+ R+R+R ++R+ E+ R RERER R+R +D +R
Sbjct: 666  DRSDDRRDERARERERERERDRERERERDREREREKERELERDRARERERERERDKDRDR 725

Query: 113  SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             +DR RD ++ ++RER+R+ E+ER+R+     R+R R
Sbjct: 726  ERDRDRDHDREREREREREKEREREREERERERERER 762

 Score =  101 bits (251), Expect = 3e-20
 Identities = 54/142 (38%), Positives = 88/142 (61%), Gaps = 4/142 (2%)
 Frame = -2

Query: 416  EEERRYEQP---EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            E ++R   P   +G  +D   ++   +      +D  D ++    R+ +R+  + RE+DR
Sbjct: 636  ERDQRASSPVRHQGRSDDLERDERRDERRVDRSDDRRDERARERERERERDRERERERDR 695

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR-E 69
            E  RERE++RE  RDR R R+R+ E+ +DR+RER RDR  D ER ++R R+ E+ ++R E
Sbjct: 696  E--REREKERELERDRARERERERERDKDRDRERDRDRDHDREREREREREKEREREREE 753

Query: 68   RDRDGEKERDRDRDHHHRDRHR 3
            R+R+ E+ERDR+R+   R+R R
Sbjct: 754  RERERERERDRERE---RERER 772

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 56/181 (30%), Positives = 86/181 (47%), Gaps = 47/181 (25%)
 Frame = -2

Query: 404  RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSK--------------------------- 306
            R  Q +G      ++DS     +  D D  DS+                           
Sbjct: 582  RGSQVDGHSSSGNYHDSWESRSSYPDRDRYDSRDQARDSSFERRHGERDRRDNRERDQRA 641

Query: 305  --------------------SNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSR 186
                                   V R +DR   ++RE++RE  RER+R+RE+ RDR+R R
Sbjct: 642  SSPVRHQGRSDDLERDERRDERRVDRSDDRRDERARERERE--RERDRERERERDRERER 699

Query: 185  DRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
            +++ E  RDR RER R+R RD +R ++R RD +  ++RER+R+ EKER+R+R+   R+R 
Sbjct: 700  EKERELERDRARERERERERDKDRDRERDRDRDHDREREREREREKEREREREERERERE 759

Query: 5    R 3
            R
Sbjct: 760  R 760

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 49/138 (35%), Positives = 74/138 (53%), Gaps = 1/138 (0%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R  + E E E     D + +     + D    +     RD+DRE  + RE+++E  R
Sbjct: 690  ERERDREREREKERELERDRARERERERERDKDRDRERDRDRDHDREREREREREKERER 749

Query: 233  ERE-RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            ERE R+RE+ R+RDR R+R+ E+ RDR++ER R R  D    KD+GR+  + + RE  R+
Sbjct: 750  EREERERERERERDRERERERERGRDRDKERERQRDWD---DKDKGREDRRDR-REDIRE 805

Query: 56   GEKERDRDRDHHHRDRHR 3
                RD   +   + RHR
Sbjct: 806  ERSSRDVHEERKSKKRHR 823

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 51/145 (35%), Positives = 71/145 (48%), Gaps = 10/145 (6%)
 Frame = -2

Query: 428  EYEFEEERRYEQP---EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRE-SSKS 261
            E E E+ER  E+    E E E     D   +     D D    +     ++ +RE   + 
Sbjct: 696  EREREKERELERDRARERERERERDKDRDRERDRDRDHDREREREREREKEREREREERE 755

Query: 260  REKDRENGRERERKREKGRDRDRSRDRDSE-KSRDRERERSRDRVRD--GERSKDRGRDG 90
            RE++RE  RERER+RE+GRDRD+ R+R  +   +D+ RE  RDR  D   ERS     + 
Sbjct: 756  RERERERDRERERERERGRDRDKERERQRDWDDKDKGREDRRDRREDIREERSSRDVHEE 815

Query: 89   EKSKDRERDRDGEKERD---RDRDH 24
             KSK R R+      R    R R+H
Sbjct: 816  RKSKKRHRNESSPSPRQSPKRRREH 840

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 48/141 (34%), Positives = 73/141 (51%), Gaps = 5/141 (3%)
 Frame = -2

Query: 416  EEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN 240
            + E++   P  GE +         +P  +   D  DS+S H SR +  ES +       +
Sbjct: 1157 DREKKNNSPMTGERKSIIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGS 1215

Query: 239  GRERERKREKGR-DRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
               RER +E+ R D DR RDRD  + R R+ +R RD  +D  RS++R R  E+ ++RE+ 
Sbjct: 1216 FDSRERLQERDRHDHDRERDRDRREGRQRDWDRDRDVDKDWPRSRERERLREREREREKR 1275

Query: 62   RDGEKERDR---DRDHHHRDR 9
            R+ ++ERDR   D     RDR
Sbjct: 1276 RELDRERDRQLPDAAERERDR 1296

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D D  + +     RD D +    R ++RE  RERER+REK R+ DR RDR    + +RER
Sbjct: 1235 DRDRREGRQRDWDRDRDVDKDWPRSRERERLREREREREKRRELDRERDRQLPDAAERER 1294

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERD 39
            +R+ D            ++  K  + + DRD EKE D
Sbjct: 1295 DRTLD--------TSSQKESTKHSETKLDRDHEKEFD 1323

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 28/100 (28%), Positives = 54/100 (54%)
 Frame = -2

Query: 326  EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE 147
            E L +   +   R+ DR+  + R++D +  R+ ++   + R+R+R R+R+ E+ + RE +
Sbjct: 1220 ERLQERDRHDHDRERDRDRREGRQRDWDRDRDVDKDWPRSRERERLREREREREKRRELD 1279

Query: 146  RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
            R RDR       ++R R  + S  +E  +  E + DRD +
Sbjct: 1280 RERDRQLPDAAERERDRTLDTSSQKESTKHSETKLDRDHE 1319

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 44/120 (36%), Positives = 61/120 (50%), Gaps = 14/120 (11%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D T S+S+    D   E+   REK+RE   +R+  +E+   RD   DR+S   RDR  
Sbjct: 405 DRDRT-SQSHDRRHDRRDETRGKREKERETRDDRDYDQEQSTSRDHRDDRESRDGRDRRD 463

Query: 149 ER-SRDR--------VRDGERSKDRGRDGEKSKDRERD----RDGEKERDRD-RDHHHRD 12
            R +RDR         RD   ++D  RD + S+D +RD    RD    RDR+ RD H +D
Sbjct: 464 TRDNRDRRETRESRDTRDSRDTRDYSRDNKDSRD-QRDSRSTRDSHDYRDRESRDAHKKD 522

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 37/116 (31%), Positives = 49/116 (42%), Gaps = 1/116 (0%)
 Frame = -2

Query: 356 SSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRD 177
           SSP PP ++            S    R  S+ R   RE GR    +  +  DR   R  +
Sbjct: 374 SSPYPPRSSS-----------SPQRKRSPSRHRSPGREKGRHDRDRTSQSHDRRHDRRDE 422

Query: 176 SEKSRDRERERSRDRVRDGERSKDRG-RDGEKSKDRERDRDGEKERDRDRDHHHRD 12
           +   R++ERE   DR  D E+S  R  RD  +S+D    RD    RDR      RD
Sbjct: 423 TRGKREKERETRDDRDYDQEQSTSRDHRDDRESRDGRDRRDTRDNRDRRETRESRD 478

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 36/148 (24%), Positives = 67/148 (45%), Gaps = 6/148 (4%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  ++      D  H+    +      E   + +     R+ +R+  + RE++
Sbjct: 712  ERERERERDKDRDRERDRDRDHDREREREREREKEREREREERERERERERDRERERERE 771

Query: 248  RENGRERERKREKG-RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R   R++ER+R++   D+D+ R+   ++  D   ERS   V +  +SK R R+ E S   
Sbjct: 772  RGRDRDKERERQRDWDDKDKGREDRRDRREDIREERSSRDVHEERKSKKRHRN-ESSPSP 830

Query: 71   ERDRDGEKERDRDRDHHH-----RDRHR 3
             +     +E   D D ++      ++HR
Sbjct: 831  RQSPKRRREHSPDSDAYNSGDDKNEKHR 858

[50][TOP]
>UniRef100_A9XLE6 Putative uncharacterized protein n=1 Tax=Capsicum frutescens
           RepID=A9XLE6_CAPFR
          Length = 551

 Score =  109 bits (272), Expect = 1e-22
 Identities = 63/140 (45%), Positives = 88/140 (62%), Gaps = 8/140 (5%)
 Frame = -2

Query: 398 EQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRE--SSKSREKDRENGRE- 231
           E+ EG GEDN +N D++   P       +DSKS H SRD ++E  SS+SREK+RE GR+ 
Sbjct: 2   EEYEGNGEDNNNNIDNNVSSP------YSDSKSQHTSRDPEKERGSSRSREKERERGRDK 55

Query: 230 ---RERKREKGRDRDRSRDRDSEKSRDRER-ERSRDRVRDGERSKDRGRDGEKSKDRERD 63
              R R R++G++RD+ RDRD EK +DR+R  R R R R   R ++R RD ++  D  R 
Sbjct: 56  DRDRNRDRDRGKERDKDRDRDREKEKDRDRHHRDRHRDRSDRRERERTRDRDED-DLHRT 114

Query: 62  RDGEKERDRDRDHHHRDRHR 3
           RD ++ RD D+D   R RH+
Sbjct: 115 RDYDRRRDNDKDREDRQRHK 134

[51][TOP]
>UniRef100_UPI00006A207B UPI00006A207B related cluster n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI00006A207B
          Length = 704

 Score =  108 bits (271), Expect = 1e-22
 Identities = 57/139 (41%), Positives = 85/139 (61%)
 Frame = -2

Query: 419 FEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN 240
           FEE RR   PEG+ +     + +       D++    KSN  SRD D    K+R++D   
Sbjct: 553 FEERRREGDPEGQRDRERGRNWNRDRERNWDKNRDWQKSNESSRDWD----KNRDRDANK 608

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
            +E ER R++ R+++R R+RD E+ R RERER RDR RD  RS+DR +D E+ +DR+RDR
Sbjct: 609 EKELERNRDRDREKERERERDRERDRVRERERDRDRQRDRSRSRDRDKDRERDRDRDRDR 668

Query: 59  DGEKERDRDRDHHHRDRHR 3
             ++ER +DRD   ++ +R
Sbjct: 669 TRDRERGKDRDSKSKESNR 687

 Score =  102 bits (253), Expect = 2e-20
 Identities = 50/142 (35%), Positives = 84/142 (59%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           +++  E  + +  +G G +    +  P+     +     ++    + D +R+  KS E  
Sbjct: 536 KFDQSEPHQPDNMQGRGFEERRREGDPEGQRDRERGRNWNRDRERNWDKNRDWQKSNESS 595

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R+  + R+R   K ++ +R+RDRD EK R+RER+R RDRVR+ ER +DR RD  +S+DR+
Sbjct: 596 RDWDKNRDRDANKEKELERNRDRDREKERERERDRERDRVRERERDRDRQRDRSRSRDRD 655

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
           +DR+ +++RDRDR    RDR R
Sbjct: 656 KDRERDRDRDRDRT---RDRER 674

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 30/89 (33%), Positives = 50/89 (56%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
           E E E N   D   +     D +    +     RD  R+ S+SR++D++  R+R+R R++
Sbjct: 609 EKELERNRDRDREKERERERDRERDRVRERERDRDRQRDRSRSRDRDKDRERDRDRDRDR 668

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRD 123
            RDR+R +DRDS KS++  R+   D+ +D
Sbjct: 669 TRDRERGKDRDS-KSKESNRDSKSDKSKD 696

[52][TOP]
>UniRef100_UPI0000D9E69D PREDICTED: zinc finger CCCH-type containing 13 n=1 Tax=Macaca
           mulatta RepID=UPI0000D9E69D
          Length = 1696

 Score =  108 bits (270), Expect = 2e-22
 Identities = 47/102 (46%), Positives = 74/102 (72%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           +   V R +DR   ++RE+DRE  R+RER+RE+ R+RDR R+++ E  R+R RER R+R 
Sbjct: 689 EERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERARERERERE 748

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ++ +R +DR RD ++ ++RER+RD EKER+R+R+   R+R R
Sbjct: 749 KERDRERDRDRDHDRERERERERDREKEREREREERERERER 790

 Score =  102 bits (254), Expect = 1e-20
 Identities = 50/145 (34%), Positives = 85/145 (58%), Gaps = 5/145 (3%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E E + R E+   +  D+  ++ + +     + D    +     RD +RE  +  E++R 
Sbjct: 681  ELERDERREERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERA 740

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDR-----VRDGERSKDRGRDGEKSK 78
              RERER++E+ R+RDR RD D E+ R+RER+R ++R      R+ ER ++R R+ E+ +
Sbjct: 741  REREREREKERDRERDRDRDHDRERERERERDREKEREREREERERERERERERERERER 800

Query: 77   DRERDRDGEKERDRDRDHHHRDRHR 3
            +RER R+ +KER+R RD   +D+ R
Sbjct: 801  ERERARERDKERERQRDWEDKDKGR 825

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 47/126 (37%), Positives = 79/126 (62%), Gaps = 13/126 (10%)
 Frame = -2

Query: 341  PAAADEDLTDSKSN----HVSRDNDRESSKSREKDR---------ENGRERERKREKGRD 201
            PA   E + D + +    H  R+++ E  + RE+ R         E  RER+R+RE+ R+
Sbjct: 657  PAGGTEKIRDQRPSSPIRHQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRE 716

Query: 200  RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHH 21
            R+R R+R+ ++ R++ERE  R+R R+ ER +++ RD E+ +DR+ DR+ E+ER+RDR+  
Sbjct: 717  RERERERERDREREKERELERERAREREREREKERDRERDRDRDHDRERERERERDRE-K 775

Query: 20   HRDRHR 3
             R+R R
Sbjct: 776  ERERER 781

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 53/145 (36%), Positives = 81/145 (55%), Gaps = 3/145 (2%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  ++ E E E     + + +     +++    +     RD+DRE  + RE+D
Sbjct: 716  ERERERERERDR-EREKERELERERAREREREREKERDRERDR--DRDHDRERERERERD 772

Query: 248  RENGRERERK---REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            RE  RERER+   RE+ R+R+R R+R+ E+ R RER++ R+R RD E  KD+GRD  + K
Sbjct: 773  REKEREREREERERERERERERERERERERERARERDKERERQRDWE-DKDKGRDDRREK 831

Query: 77   DRERDRDGEKERDRDRDHHHRDRHR 3
             RE  R+    RD   +   + R+R
Sbjct: 832  -REEIREDRNPRDGHDERKSKKRYR 855

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 62/204 (30%), Positives = 89/204 (43%), Gaps = 58/204 (28%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
            P + E      R  +        NYH DS     +  + D    + N   RD  R+SS  
Sbjct: 568  PELPEKGSRSSRGSQIDSHSSNSNYH-DSWETRSSYPERDRYPERDN---RDQARDSSFE 623

Query: 260  R---EKDRENGRER---------------------------------------------- 228
            R   E+DR + RER                                              
Sbjct: 624  RRHGERDRRDNRERAPMFYTSCCPYPLPPVFSGPAGGTEKIRDQRPSSPIRHQGRNDELE 683

Query: 227  --ERKREKGRDR------DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
              ER+ E+  DR      +R+R+RD E+ RDRERER R+R RD ER K+R  + E++++R
Sbjct: 684  RDERREERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERARER 743

Query: 71   ERDRDGEKERDRDRDH-HHRDRHR 3
            ER+R+ E++R+RDRD  H R+R R
Sbjct: 744  EREREKERDRERDRDRDHDRERER 767

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 47/135 (34%), Positives = 71/135 (52%), Gaps = 15/135 (11%)
 Frame = -2

Query: 386  GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS--------------REKD 249
            GE +         +P  +   D  DS+S H SR +  ES +               +E+D
Sbjct: 1273 GERKSRIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGSFDSRDRLQERD 1331

Query: 248  R-ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            R E+ RERER+R   R R+  RD D +  R+R+R+R R+R R  ER +D+ RD ++ ++R
Sbjct: 1332 RYEHDRERERERRDTRQREWDRDADKDWPRNRDRDRLRERER--ERERDKRRDLDRERER 1389

Query: 71   ERDRDGEKERDRDRD 27
                  E++RDRDRD
Sbjct: 1390 LISDSVERDRDRDRD 1404

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 47/144 (32%), Positives = 71/144 (49%), Gaps = 9/144 (6%)
 Frame = -2

Query: 428  EYEFEEER-----RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK 264
            E E E ER     R  + E + E +   D   +     + D  + +      + +RE  +
Sbjct: 732  ERELERERAREREREREKERDRERDRDRDHDRERERERERD-REKEREREREERERERER 790

Query: 263  SREKDRENGRERERKREKGRDRDRSRD-RDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
             RE++RE  RERER RE+ ++R+R RD  D +K RD  RE+ R+ +R+    +D G D  
Sbjct: 791  ERERERERERERERARERDKERERQRDWEDKDKGRDDRREK-REEIREDRNPRD-GHDER 848

Query: 86   KSKDRERDRDGEKERD---RDRDH 24
            KSK R R+      R    R R+H
Sbjct: 849  KSKKRYRNEGSPSPRQSPKRRREH 872

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 3/127 (2%)
 Frame = -2

Query: 374  DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRD 195
            D Y +D         + +  D++     RD D++  ++R++DR   RERER+R+K RD D
Sbjct: 1331 DRYEHDRE------RERERRDTRQREWDRDADKDWPRNRDRDRLRERERERERDKRRDLD 1384

Query: 194  RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRD---RDH 24
            R R+R    S +R+R+R RDR  +  +        E  K  E   +GE ERD +   RD 
Sbjct: 1385 RERERLISDSVERDRDRDRDRTFESSQI-------ESVKRCEAKLEGEHERDLESTSRDS 1437

Query: 23   HHRDRHR 3
               D+ R
Sbjct: 1438 VAVDKER 1444

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/91 (38%), Positives = 52/91 (57%)
 Frame = -2

Query: 314  DSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD 135
            DS+     RD   E  + RE++R + R+RE  R+  +D  R+RDRD  + R+RERER + 
Sbjct: 1322 DSRDRLQERDR-YEHDRERERERRDTRQREWDRDADKDWPRNRDRDRLRERERERERDKR 1380

Query: 134  RVRDGERSKDRGRDGEKSKDRERDRDGEKER 42
            R  D ER +      E+ +DR+RDR  E  +
Sbjct: 1381 RDLDRERERLISDSVERDRDRDRDRTFESSQ 1411

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 42/142 (29%), Positives = 66/142 (46%), Gaps = 21/142 (14%)
 Frame = -2

Query: 365 HNDSSPQ----PPAAAD-------EDLTDSKSNHVSRDNDRESSKS-REKDRENGRERER 222
           H+ SSPQ    PP            D   +  +H  R   RE ++  R++++++  ERE 
Sbjct: 377 HSLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREDTRGKRDREKDSREEREY 436

Query: 221 KREKGRDRDRSRDRDSEKSRDRERER-SRDR--------VRDGERSKDRGRDGEKSKDRE 69
           ++++   RD   DR+    RDR   R +RDR        +RD    +D  RD ++S+D  
Sbjct: 437 EQDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDIRDSREMRDYSRDTKESRD-P 495

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
           RD    ++    RD   RD HR
Sbjct: 496 RDSRSTRDAHDYRDREGRDTHR 517

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 38/117 (32%), Positives = 52/117 (44%), Gaps = 12/117 (10%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRD-------RDRSRDRDSEK 168
           E  + S      R  D    + REKD    RE E+ +   RD       RD    RD+  
Sbjct: 404 ERTSQSHDRRHERREDTRGKRDREKDSREEREYEQDQSSSRDHRDDREPRDGRDRRDARD 463

Query: 167 SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD----RDGEKERDRD-RDHHHRD 12
           +RDR   R    +RD    +D  RD ++S+D  RD    RD    RDR+ RD H ++
Sbjct: 464 TRDRRELRDSRDIRDSREMRDYSRDTKESRD-PRDSRSTRDAHDYRDREGRDTHRKE 519

[53][TOP]
>UniRef100_Q6NVT1 RNA binding motif protein 25 n=2 Tax=Xenopus (Silurana) tropicalis
           RepID=Q6NVT1_XENTR
          Length = 769

 Score =  108 bits (270), Expect = 2e-22
 Identities = 49/94 (52%), Positives = 71/94 (75%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  K REK++E  R+RER +++ RDRDR RDRD +K RDR R+ S+DR R  E+S
Sbjct: 267 REREREREKEREKEKERERDRERNKDRDRDRDRDRDRDRDKDRDRARDHSKDRSRSREKS 326

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           +DR RD ++ +DRER+R+ ++ERDR++D   RDR
Sbjct: 327 RDRDRDRDRERDRERERERDRERDREKD-KKRDR 359

 Score =  100 bits (250), Expect = 4e-20
 Identities = 49/139 (35%), Positives = 78/139 (56%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E                      +     R+ +RE  K RE+DRE
Sbjct: 250 EIEKERRERERERERE---------------------RREREREREKEREKEKERERDRE 288

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             ++R+R R++ RDRDR +DRD  +   ++R RSR++ RD +R +DR RD E+ ++R+R+
Sbjct: 289 RNKDRDRDRDRDRDRDRDKDRDRARDHSKDRSRSREKSRDRDRDRDRERDRERERERDRE 348

Query: 62  RDGEKERDRDRDHHHRDRH 6
           RD EK++ RDR+    + +
Sbjct: 349 RDREKDKKRDREEDEEEAY 367

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 49/97 (50%), Positives = 72/97 (74%), Gaps = 5/97 (5%)
 Frame = -2

Query: 278 RESSKSREKDR-ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER---- 114
           RE  + RE++R E  RERE++REK ++R+R R+R+ ++ RDR+R+R RDR +D +R    
Sbjct: 256 RERERERERERREREREREKEREKEKERERDRERNKDRDRDRDRDRDRDRDKDRDRARDH 315

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           SKDR R  EKS+DR+RDRD E++R+R+R+   RDR R
Sbjct: 316 SKDRSRSREKSRDRDRDRDRERDRERERE---RDRER 349

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 48/134 (35%), Positives = 71/134 (52%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E ER  E+   E E     +   +     D +    +     RD DR+  K R++ R++ 
Sbjct: 257 ERERERERERREREREREKEREKEKERERDRERNKDRDRDRDRDRDRDRDKDRDRARDHS 316

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           ++R R REK RDRDR RDR+    RDRERER RDR RD E+ K R R+ ++ +  ER + 
Sbjct: 317 KDRSRSREKSRDRDRDRDRE----RDRERERERDRERDREKDKKRDREEDEEEAYERRKL 372

Query: 56  GEKERDRDRDHHHR 15
             K R+++  +  R
Sbjct: 373 ERKLREKEAAYQER 386

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 53/127 (41%), Positives = 75/127 (59%), Gaps = 18/127 (14%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDND-----RESSKSREKDREN----GRERERKREKGRDRDRSRDRD 177
           +ED  D  S  +S+  D      E    +EK+R+      RERER+RE+ R R+R R+R+
Sbjct: 216 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERER-RERERERE 274

Query: 176 SEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD--------GEKERDRDRDH- 24
            E+ +++ERER R+R +D +R +DR RD ++ KDR+R RD         EK RDRDRD  
Sbjct: 275 KEREKEKERERDRERNKDRDRDRDRDRDRDRDKDRDRARDHSKDRSRSREKSRDRDRDRD 334

Query: 23  HHRDRHR 3
             RDR R
Sbjct: 335 RERDRER 341

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 50/158 (31%), Positives = 73/158 (46%), Gaps = 24/158 (15%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +         D D    +     RD DR+ ++   KD
Sbjct: 259 ERERERERREREREREKEREKEKERERDRERNKDRDRDRDRDRDRDRDKDRDRARDHSKD 318

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD-------- 93
           R   R RE+ R++ RDRDR RDR+ E+ RDRER+R +D+ RD E  ++   +        
Sbjct: 319 RS--RSREKSRDRDRDRDRERDRERERERDRERDREKDKKRDREEDEEEAYERRKLERKL 376

Query: 92  ----------------GEKSKDRERDRDGEKERDRDRD 27
                            E+ K RE ++D E+E +R R+
Sbjct: 377 REKEAAYQERLKNWEIRERKKAREYEKDAEREEERRRE 414

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 45/139 (32%), Positives = 74/139 (53%), Gaps = 10/139 (7%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVS---------RDNDRESSKSREKDRENG 237
           E   E N  +  S   P    +D  +  SN V           + D+    SRE  +   
Sbjct: 173 EYSSELNAPSQDSDSHPRKKKKDKKEEMSNSVQLQEDINAIEMEEDKRDLISREISKFRD 232

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDR-VRDGERSKDRGRDGEKSKDRERDR 60
             ++ + EKG+ +++ R    ++ R+RERER R+R  R+ ER K+R ++ E+ +DRER++
Sbjct: 233 THKKLEEEKGK-KEKERQEIEKERRERERERERERREREREREKEREKEKERERDRERNK 291

Query: 59  DGEKERDRDRDHHHRDRHR 3
           D +++RDRDRD   RD+ R
Sbjct: 292 DRDRDRDRDRD-RDRDKDR 309

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 42/144 (29%), Positives = 73/144 (50%), Gaps = 11/144 (7%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHN---DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           E E E ER  E+ +    D   +   D       A D     S+S   SRD DR+  + R
Sbjct: 278 EKEKERERDRERNKDRDRDRDRDRDRDRDKDRDRARDHSKDRSRSREKSRDRDRDRDRER 337

Query: 257 ------EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE-RSKDR 102
                 E+DRE  RE+++KR++  D + + +R   + + RE+E + ++R+++ E R + +
Sbjct: 338 DRERERERDRERDREKDKKRDREEDEEEAYERRKLERKLREKEAAYQERLKNWEIRERKK 397

Query: 101 GRDGEKSKDRERDRDGEKERDRDR 30
            R+ EK  +RE +R  E  ++  R
Sbjct: 398 AREYEKDAEREEERRRETAKEAKR 421

[54][TOP]
>UniRef100_C3KH81 Negative elongation factor E n=1 Tax=Anoplopoma fimbria
           RepID=C3KH81_9PERC
          Length = 376

 Score =  108 bits (269), Expect = 2e-22
 Identities = 49/101 (48%), Positives = 72/101 (71%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           DE+   S S+    D DRE  + RE DRE  ++R+R R++ RDR+R R+R+ E+ RD++R
Sbjct: 145 DEEEGGSMSSSREVDRDRERDRDREMDREREKDRDRDRDQDRDRERDRERERERDRDKDR 204

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           +R RDR RD ER ++R RD E+ +DR RDRD E++R+RDR+
Sbjct: 205 DRDRDRDRDRERDRERDRDRERDRDRSRDRDRERDRERDRE 245

 Score =  106 bits (265), Expect = 7e-22
 Identities = 49/95 (51%), Positives = 69/95 (72%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RD DRE  + REKDR+  R+++R RE+ R+R+R RDRD  K RDR+R+R RDR RD ER 
Sbjct: 164 RDRDREMDREREKDRDRDRDQDRDRERDRERERERDRD--KDRDRDRDRDRDRERDRERD 221

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
           +DR RD ++S+DR+R+RD E++R+RD      D +
Sbjct: 222 RDRERDRDRSRDRDRERDRERDRERDAPFRRSDSY 256

 Score =  105 bits (262), Expect = 2e-21
 Identities = 49/109 (44%), Positives = 71/109 (65%), Gaps = 1/109 (0%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE 147
           E    S   +   +     S SRE DR+  R+R+R+ ++ R++DR RDRD ++ R+R+RE
Sbjct: 134 ESFVSSNDRYRDEEEGGSMSSSREVDRDRERDRDREMDREREKDRDRDRDQDRDRERDRE 193

Query: 146 RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-HHRDRHR 3
           R R+R RD +R +DR RD ++ +DRERDRD E++RDR RD    RDR R
Sbjct: 194 RERERDRDKDRDRDRDRDRDRERDRERDRDRERDRDRSRDRDRERDRER 242

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 47/109 (43%), Positives = 70/109 (64%)
 Frame = -2

Query: 365 HNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSR 186
           + D       ++  ++   +     R+ DRE  K R++DR+  R+RER RE+ R+RDR +
Sbjct: 143 YRDEEEGGSMSSSREVDRDRERDRDREMDREREKDRDRDRDQDRDRERDRERERERDRDK 202

Query: 185 DRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERD 39
           DRD ++ RDR+RER R+R RD ER +DR RD    +DRERDR+ ++ERD
Sbjct: 203 DRDRDRDRDRDRERDRERDRDRERDRDRSRD----RDRERDRERDRERD 247

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 39/95 (41%), Positives = 70/95 (73%)
 Frame = -2

Query: 311 SKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDR 132
           S S  V RD +R+  +  +++RE  R+R+R +++ R+RDR R+R+ ++ +DR+R+R RDR
Sbjct: 153 SSSREVDRDRERDRDREMDREREKDRDRDRDQDRDRERDRERERERDRDKDRDRDRDRDR 212

Query: 131 VRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
            R+ +R +DR R+ ++ + R+RDR+ ++ERDR+RD
Sbjct: 213 DRERDRERDRDRERDRDRSRDRDRERDRERDRERD 247

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 48/109 (44%), Positives = 71/109 (65%), Gaps = 1/109 (0%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE 147
           + L +S  +   R  D E   S    RE  R+RER R++  DR+R +DRD ++ +DR+RE
Sbjct: 130 KSLYESFVSSNDRYRDEEEGGSMSSSREVDRDRERDRDREMDREREKDRDRDRDQDRDRE 189

Query: 146 RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-HHRDRHR 3
           R R+R R+ +R KDR RD ++ +DRERDR+ +++R+RDRD    RDR R
Sbjct: 190 RDRERERERDRDKDRDRDRDRDRDRERDRERDRDRERDRDRSRDRDRER 238

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 50/117 (42%), Positives = 66/117 (56%), Gaps = 2/117 (1%)
 Frame = -2

Query: 347 QPPAAADEDLTDS--KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDS 174
           Q   + DE L +S  +++  S      SS  R +D E G      RE   DRDR RDRD 
Sbjct: 111 QRSVSTDEALPESGKRAHRKSLYESFVSSNDRYRDEEEGGSMSSSREV--DRDRERDRDR 168

Query: 173 EKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           E  R+RE++R RDR        D+ RD E+ ++RER+RD +K+RDRDRD   RDR R
Sbjct: 169 EMDREREKDRDRDR--------DQDRDRERDRERERERDRDKDRDRDRD-RDRDRER 216

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 35/104 (33%), Positives = 57/104 (54%)
 Frame = -2

Query: 425 YEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
           Y  EEE        E + +   D   +     ++D    +     R+ DRE  + R++D+
Sbjct: 143 YRDEEEGGSMSSSREVDRDRERDRDREMDREREKDRDRDRDQDRDRERDRERERERDRDK 202

Query: 245 ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           +  R+R+R R++ RDR+R RDR+ ++ R R+R+R RDR RD ER
Sbjct: 203 DRDRDRDRDRDRERDRERDRDRERDRDRSRDRDRERDRERDRER 246

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 32/77 (41%), Positives = 46/77 (59%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D    +     RD D++  + R++DR+  R+RER R++ RDRDRSRDRD E+ R+R+R
Sbjct: 185 DRDRERDRERERERDRDKDRDRDRDRDRDRERDRERDRDRERDRDRSRDRDRERDRERDR 244

Query: 149 ERSRDRVRDGERSKDRG 99
           ER     R     + RG
Sbjct: 245 ERDAPFRRSDSYPERRG 261

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 32/91 (35%), Positives = 46/91 (50%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E  R  + + E E +   D         D +    +     RD DR+  + RE+DRE  R
Sbjct: 163 ERDRDREMDREREKDRDRDRDQDRDRERDRERERERDRDKDRDRDRDRDRDRERDRERDR 222

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERS 141
           +RER R++ RDRDR RDR+ ++ RD    RS
Sbjct: 223 DRERDRDRSRDRDRERDRERDRERDAPFRRS 253

[55][TOP]
>UniRef100_C1GNA8 Predicted protein n=1 Tax=Paracoccidioides brasiliensis Pb01
            RepID=C1GNA8_PARBA
          Length = 1115

 Score =  108 bits (269), Expect = 2e-22
 Identities = 55/128 (42%), Positives = 80/128 (62%), Gaps = 9/128 (7%)
 Frame = -2

Query: 359  DSSPQPPAAADE-DLTDSKSNHVSRDN--------DRESSKSREKDRENGRERERKREKG 207
            D + +PP++ ++ DL    S+H S  +         R+  + R++DR+  R+R+R R++ 
Sbjct: 866  DPNIKPPSSEEKLDLAIRNSDHRSNKDRSGIEGKPSRQRDRDRDRDRDRDRDRDRDRDRD 925

Query: 206  RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
            RDRDR RDRD ++ RDR+R+R RDR RD +R KDR R  E+   RERD+D E+E DRDRD
Sbjct: 926  RDRDRDRDRDKDRDRDRDRDRDRDRDRDRDRDKDRERVRERDPKRERDKDREREHDRDRD 985

Query: 26   HHHRDRHR 3
                 R R
Sbjct: 986  RKRSRRDR 993

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 39/96 (40%), Positives = 60/96 (62%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
            RD DR+  + R++DR+  R+R++ R++ RDRDR RDRD ++ RD++RER R+R    ER 
Sbjct: 914  RDRDRDRDRDRDRDRDRDRDRDKDRDRDRDRDRDRDRDRDRDRDKDRERVRERDPKRERD 973

Query: 110  KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            KDR R+ ++ +DR+R R        D +   R   R
Sbjct: 974  KDREREHDRDRDRKRSRRDRSVSREDTEISRRHARR 1009

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/111 (36%), Positives = 62/111 (55%)
 Frame = -2

Query: 347  QPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK 168
            +P    D D    +     RD DR+  + R++DR+  ++R+R R++ RDRDR RDRD +K
Sbjct: 899  KPSRQRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDKDRDRDRDRDRDRDRDRDRDRDK 958

Query: 167  SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHR 15
             R+R RER   R RD +R ++  RD ++ + R RDR   +E       H R
Sbjct: 959  DRERVRERDPKRERDKDREREHDRDRDRKRSR-RDRSVSREDTEISRRHAR 1008

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 43/138 (31%), Positives = 67/138 (48%), Gaps = 13/138 (9%)
 Frame = -2

Query: 383  EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR 204
            EG+ +   D         D D    +     RD DR+  K R++DR+  R+R+R R++ R
Sbjct: 897  EGKPSRQRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDKDRDRDRDRDRDRDRDRDRDR 956

Query: 203  DRDRSR--DRDSEKSRDRERERSRDRVRDGERS-KDRG----------RDGEKSKDRERD 63
            D+DR R  +RD ++ RD++RER  DR RD +RS +DR           R   + K  E +
Sbjct: 957  DKDRERVRERDPKRERDKDREREHDRDRDRKRSRRDRSVSREDTEISRRHARRLKRNEAE 1016

Query: 62   RDGEKERDRDRDHHHRDR 9
                 +R++    H   R
Sbjct: 1017 EQKAIDREKKSTEHRESR 1034

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 36/109 (33%), Positives = 55/109 (50%), Gaps = 1/109 (0%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDR-E 153
            D D    +     RD DR+  + R+KDRE  RER+ KRE+ +DR+R  DRD ++ R R +
Sbjct: 933  DRDKDRDRDRDRDRDRDRDRDRDRDKDRERVRERDPKRERDKDREREHDRDRDRKRSRRD 992

Query: 152  RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
            R  SR+      R   R +  E  + +  DR+ +    R+     +D H
Sbjct: 993  RSVSREDTEISRRHARRLKRNEAEEQKAIDREKKSTEHRESRLQEKDPH 1041

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 38/108 (35%), Positives = 57/108 (52%), Gaps = 1/108 (0%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D D    +     RD DRE  + R+  RE  ++RER+ ++ RDR RSR RD   SR+ + 
Sbjct: 943  DRDRDRDRDRDRDRDKDRERVRERDPKRERDKDREREHDRDRDRKRSR-RDRSVSRE-DT 1000

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE-RDRDRDHHHRDR 9
            E SR   R   R K    + +K+ DRE+     +E R +++D H  +R
Sbjct: 1001 EISR---RHARRLKRNEAEEQKAIDREKKSTEHRESRLQEKDPHTLER 1045

[56][TOP]
>UniRef100_UPI0000F2B21F PREDICTED: similar to obscurin-MLCK n=1 Tax=Monodelphis domestica
           RepID=UPI0000F2B21F
          Length = 840

 Score =  107 bits (268), Expect = 3e-22
 Identities = 52/132 (39%), Positives = 82/132 (62%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E     +   +     + +    +     RD DR+ +K R++DR+
Sbjct: 303 EIEKERRERERERERERE-RREREREREREREREKEKERERERERDRDRDRTKERDRDRD 361

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R RE+  DR++ R R  EKSRDRERER R+R R+ ER ++R R+ E+ ++RER+
Sbjct: 362 RERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERERE 421

Query: 62  RDGEKERDRDRD 27
           R+ +K+RDR+ D
Sbjct: 422 REKDKKRDREED 433

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 49/129 (37%), Positives = 72/129 (55%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     RD +R+  + RE+ 
Sbjct: 314 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERS 373

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            +  ++R R REK RDR+R R+R+ E+ R+RERER R+R R+ ER ++R +D  K +DRE
Sbjct: 374 SDRNKDRSRSREKSRDREREREREREREREREREREREREREREREREREKD--KKRDRE 431

Query: 68  RDRDGEKER 42
            D +   ER
Sbjct: 432 EDEEDAYER 440

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/105 (51%), Positives = 71/105 (67%), Gaps = 13/105 (12%)
 Frame = -2

Query: 278 RESSKSREKDRENG-RERERKR--------EKGRDRDRSRDRDSEKSRDRERERSRDRVR 126
           RE  + RE++RE   RERER+R        E+ R+R+R RDRD  K RDR+R+R RDR R
Sbjct: 309 RERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDR 368

Query: 125 DGERS----KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ERS    KDR R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 369 DRERSSDRNKDRSRSREKSRDRERERERERERERERE-RERERER 412

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/97 (46%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR R  ER
Sbjct: 297 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 356

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR R+ ++ +DRER  D  K+R R R+   RDR R
Sbjct: 357 DRDRDRERDRDRDRERSSDRNKDRSRSRE-KSRDRER 392

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/101 (43%), Positives = 67/101 (66%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRV----R 126
           ++      + RE++RE  RERER+ RE+ R+R+R R+++ E+ R+RER+R RDR     R
Sbjct: 299 KERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDR 358

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +R +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 359 DRDRERDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 398

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/115 (38%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK-SRDRE 153
           +ED  D  S  +S+  D       EK ++    +E ++E+ R+R+R R+R+ E+  R+RE
Sbjct: 269 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKER-RERERERERERERRERERE 327

Query: 152 RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           RER R+R ++ ER ++R RD ++ + +ERDRD ++ERDRDRD       ++DR R
Sbjct: 328 REREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSR 382

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 50/159 (31%), Positives = 81/159 (50%), Gaps = 25/159 (15%)
 Frame = -2

Query: 428 EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E+  E E E +   D + +     D +    +    S D +++ S+SREK
Sbjct: 327 EREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREK 386

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD------- 93
            R+  RERER+RE+ R+R+R R+R+ E+ R+RERER +D+ RD E  ++   +       
Sbjct: 387 SRDREREREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERK 446

Query: 92  -----------------GEKSKDRERDRDGEKERDRDRD 27
                             E+ K RE +++ E+E +R R+
Sbjct: 447 LREKEAAYQERLKNWEIRERKKTREYEKEAEREEERRRE 485

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/113 (38%), Positives = 64/113 (56%), Gaps = 7/113 (6%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 258 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 317

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDHHHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDRD   RDR R
Sbjct: 318 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRD-RERDRDR 368

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 32/130 (24%), Positives = 66/130 (50%), Gaps = 2/130 (1%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E  R    E   + N     S +     + +    +     R+ +RE  + RE++RE  R
Sbjct: 363 ERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERERER 422

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE-RSKDRGRDGEKSKDRERDR 60
           E+++KR++  D + + +R   + + RE+E + ++R+++ E R + + R+ EK  +RE +R
Sbjct: 423 EKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEER 482

Query: 59  DGEKERDRDR 30
             E  ++  R
Sbjct: 483 RREMAKEAKR 492

[57][TOP]
>UniRef100_Q1ZXD7 RmlC-like cupin family protein n=1 Tax=Dictyostelium discoideum
           RepID=Q1ZXD7_DICDI
          Length = 834

 Score =  107 bits (267), Expect = 4e-22
 Identities = 46/87 (52%), Positives = 70/87 (80%)
 Frame = -2

Query: 281 DRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR 102
           +RE  K REK++E  +E+E+++EK +DRDR RDRD ++ RDR+R+R RDR R+ ER ++R
Sbjct: 577 EREKEKEREKEKEKEKEKEKEKEKEKDRDRERDRDRDRDRDRDRDRDRDRDRERERERER 636

Query: 101 GRDGEKSKDRERDRDGEKERDRDRDHH 21
            R+ EK K+RE++R+ EKERDR+RD++
Sbjct: 637 EREKEKEKEREKEREREKERDRERDNN 663

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 38/85 (44%), Positives = 64/85 (75%), Gaps = 3/85 (3%)
 Frame = -2

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           RE  +E+ER++EK +++++ ++++ EK RDRER+R RDR RD +R +DR RD E+ ++RE
Sbjct: 576 REREKEKEREKEKEKEKEKEKEKEKEKDRDRERDRDRDRDRDRDRDRDRDRDRERERERE 635

Query: 68  RDRDGEKERDRDRDHH---HRDRHR 3
           R+R+ EKE++R+++      RDR R
Sbjct: 636 REREKEKEKEREKEREREKERDRER 660

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 30/81 (37%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = -2

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
           N   RER++EK R++++ ++++ EK +++E++R R+R RD +R +DR RD ++ +DRER+
Sbjct: 572 NSTYREREKEKEREKEKEKEKEKEKEKEKEKDRDRERDRDRDRDRDRDRDRDRDRDRERE 631

Query: 62  RDGEKERDRDRD-HHHRDRHR 3
           R+ E+ER+++++    ++R R
Sbjct: 632 REREREREKEKEKEREKERER 652

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 29/76 (38%), Positives = 52/76 (68%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           K     ++ ++E  + RE+DR+  R+R+R R++ RDRDR R+R+ E+ R++E+E+ R++ 
Sbjct: 590 KEKEKEKEKEKEKDRDRERDRDRDRDRDRDRDRDRDRDREREREREREREKEKEKEREKE 649

Query: 128 RDGERSKDRGRDGEKS 81
           R+ E+ +DR RD   S
Sbjct: 650 REREKERDRERDNNSS 665

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 29/83 (34%), Positives = 51/83 (61%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           +++    K     +D DRE  + R++DR+  R+R+R R++ R+R+R R+R+ EK ++RE+
Sbjct: 589 EKEKEKEKEKEKEKDRDRERDRDRDRDRDRDRDRDRDRDREREREREREREKEKEKEREK 648

Query: 149 ERSRDRVRDGERSKDRGRDGEKS 81
           ER R++ RD ER  +       S
Sbjct: 649 EREREKERDRERDNNSSNSNSSS 671

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 30/88 (34%), Positives = 50/88 (56%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           R  + E E E     +   +     ++D    +     RD DR+  + R++DRE  RERE
Sbjct: 576 REREKEKEREKEKEKEKEKEKEKEKEKDRDRERDRDRDRDRDRDRDRDRDRDRERERERE 635

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERS 141
           R+REK ++++R ++R+ EK RDRER+ +
Sbjct: 636 REREKEKEKEREKEREREKERDRERDNN 663

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 28/91 (30%), Positives = 52/91 (57%)
 Frame = -2

Query: 383 EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR 204
           E E     +   +     +++    K     RD DR+  + R++DR+  R+RER+RE+ R
Sbjct: 577 EREKEKEREKEKEKEKEKEKEKEKEKDRDRERDRDRDRDRDRDRDRDRDRDRERERERER 636

Query: 203 DRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           +R++ ++++ EK R+RE+ER R+R  +   S
Sbjct: 637 EREKEKEKEREKEREREKERDRERDNNSSNS 667

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 26/85 (30%), Positives = 50/85 (58%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
           E E E     +   +     +++    +     RD DR+  + R++DR+  RERER+RE+
Sbjct: 577 EREKEKEREKEKEKEKEKEKEKEKEKDRDRERDRDRDRDRDRDRDRDRDRDRERERERER 636

Query: 209 GRDRDRSRDRDSEKSRDRERERSRD 135
            R++++ ++R+ E+ R++ER+R RD
Sbjct: 637 EREKEKEKEREKEREREKERDRERD 661

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 30/97 (30%), Positives = 51/97 (52%)
 Frame = -2

Query: 401 YEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERER 222
           Y + E E E     +   +     +++    +     RD DR+  + R++DR+  RERER
Sbjct: 575 YREREKEKEREKEKEKEKEKEKEKEKEKDRDRERDRDRDRDRDRDRDRDRDRDRERERER 634

Query: 221 KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           +RE      R ++++ E+ ++RERE+ RDR RD   S
Sbjct: 635 ERE------REKEKEKEREKEREREKERDRERDNNSS 665

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 27/58 (46%), Positives = 42/58 (72%)
 Frame = -2

Query: 176 SEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           S  S  RERE+ ++R ++ E+ K++ ++ EK KDR+R+RD +++RDRDRD   RDR R
Sbjct: 570 STNSTYREREKEKEREKEKEKEKEKEKEKEKEKDRDRERDRDRDRDRDRD-RDRDRDR 626

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 25/103 (24%), Positives = 49/103 (47%)
 Frame = -2

Query: 437 TMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           T   Y   E+ +  + E E E     +   +     + D    +     RD DR+  + R
Sbjct: 571 TNSTYREREKEKEREKEKEKEKEKEKEKEKEKDRDRERDRDRDRDRDRDRDRDRDRDRER 630

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           E++RE  RE+E+++E+ ++R+R ++RD E+  +     S   +
Sbjct: 631 EREREREREKEKEKEREKEREREKERDRERDNNSSNSNSSSTI 673

[58][TOP]
>UniRef100_A9XLF0 Putative uncharacterized protein n=1 Tax=Petunia integrifolia
           subsp. inflata RepID=A9XLF0_PETIN
          Length = 557

 Score =  107 bits (266), Expect = 5e-22
 Identities = 61/149 (40%), Positives = 88/149 (59%), Gaps = 17/149 (11%)
 Frame = -2

Query: 398 EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRE--SSKSREKDRENGRERE 225
           E+ EG GED  +  +SP          +DSKS H SRD+++E  SS+SREK+RE GR+++
Sbjct: 2   EEYEGNGEDLNNYGTSPY---------SDSKSQHPSRDHEKERDSSRSREKEREKGRDKD 52

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
           R R++ RDRDR RDR  E+ RDR+R+R R++ RD    +DR RD    ++RER RD +++
Sbjct: 53  RDRDRNRDRDRDRDRGKERDRDRDRDREREKDRD-RHHRDRHRDRSDRRERERTRDRDED 111

Query: 44  ---------------RDRDRDHHHRDRHR 3
                          +DR+  H HR   R
Sbjct: 112 DLSRSRDYDRRRDTDKDREDRHRHRPSSR 140

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 41/126 (32%), Positives = 54/126 (42%), Gaps = 11/126 (8%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESS-----K 264
           E E +  R  E+   +G D    D         D D    +     RD +RE       +
Sbjct: 32  EKERDSSRSREKEREKGRDK-DRDRDRNRDRDRDRDRGKERDRDRDRDREREKDRDRHHR 90

Query: 263 SREKDRENGRERERKREK-----GRDRDRSRDRDSEKSR-DRERERSRDRVRDGERSKDR 102
            R +DR + RERER R++      R RD  R RD++K R DR R R   R R   RS+ R
Sbjct: 91  DRHRDRSDRRERERTRDRDEDDLSRSRDYDRRRDTDKDREDRHRHRPSSRSRSEHRSRSR 150

Query: 101 GRDGEK 84
            R   K
Sbjct: 151 SRSPSK 156

[59][TOP]
>UniRef100_Q54F78 Putative uncharacterized protein thoc2 n=1 Tax=Dictyostelium
            discoideum RepID=Q54F78_DICDI
          Length = 2110

 Score =  107 bits (266), Expect = 5e-22
 Identities = 48/128 (37%), Positives = 85/128 (66%), Gaps = 3/128 (2%)
 Frame = -2

Query: 377  EDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR 198
            E+N +N+ S +     + +    K     ++ +RE  K REK++E  RERER+RE+ R++
Sbjct: 1413 ENNNNNNKSKEKEKEREREKEREKEKEREKEREREREKEREKEKEKEREREREREREREK 1472

Query: 197  DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHH- 21
            +R R+R+ E+ R+RERER R+R R+ E+ K++ ++ E+ ++RER+R+ E+ER+R+R+   
Sbjct: 1473 ERDREREKEREREREREREREREREREKEKEKEKEREREREREREREREREREREREREK 1532

Query: 20   --HRDRHR 3
               RDR +
Sbjct: 1533 EKERDREQ 1540

 Score =  104 bits (259), Expect = 3e-21
 Identities = 49/137 (35%), Positives = 86/137 (62%), Gaps = 1/137 (0%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            + + + ++ E E E     +   +     +++    K     R+ +RE  + +E+DRE  
Sbjct: 1420 KSKEKEKEREREKEREKEKEREKEREREREKEREKEKEKEREREREREREREKERDRERE 1479

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            +ERER+RE+ R+R+R R+R+ EK +++ERER R+R R+ ER ++R R+ E+ K++ERDR+
Sbjct: 1480 KEREREREREREREREREREKEKEKEKEREREREREREREREREREREREREKEKERDRE 1539

Query: 56   -GEKERDRDRDHHHRDR 9
              EKER+R++    RDR
Sbjct: 1540 QREKEREREQREKERDR 1556

 Score =  103 bits (257), Expect = 6e-21
 Identities = 42/107 (39%), Positives = 80/107 (74%)
 Frame = -2

Query: 323  DLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER 144
            D+ D  +N+ ++  ++E  + REK+RE  +ERE++RE+ R+++R ++++ E+ R+RERER
Sbjct: 1409 DINDENNNNNNKSKEKEKEREREKEREKEKEREKEREREREKEREKEKEKERERERERER 1468

Query: 143  SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             R++ RD ER K+R R+ E+ ++RER+R+ EKE++++++   R+R R
Sbjct: 1469 EREKERDREREKEREREREREREREREREREKEKEKEKE-RERERER 1514

 Score =  102 bits (254), Expect = 1e-20
 Identities = 43/113 (38%), Positives = 85/113 (75%), Gaps = 1/113 (0%)
 Frame = -2

Query: 362  NDSSPQPPAAADED-LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSR 186
            + S+P   ++++ D + D+    ++ +N+  ++KS+EK++E  RE+ER++EK R+++R R
Sbjct: 1387 SSSTPTTTSSSNRDSIKDADMIDINDENNNNNNKSKEKEKEREREKEREKEKEREKERER 1446

Query: 185  DRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
            +R+ E+ +++E+ER R+R R+ ER K+R R+ EK ++RER+R+ E+ER+R+R+
Sbjct: 1447 EREKEREKEKEKEREREREREREREKERDREREKERERERERERERERERERE 1499

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 47/144 (32%), Positives = 85/144 (59%), Gaps = 3/144 (2%)
 Frame = -2

Query: 428  EYEFEEERRYE---QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
            E E E+ER  E   + E E E     +   +     + +    +     R+ ++E  + R
Sbjct: 1427 EREREKEREKEKEREKEREREREKEREKEKEKEREREREREREREKERDREREKERERER 1486

Query: 257  EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            E++RE  RERER++EK ++++R R+R+ E+ R+RERER R+R R+ E+ +DR    ++ K
Sbjct: 1487 EREREREREREREKEKEKEKEREREREREREREREREREREREREKEKERDR---EQREK 1543

Query: 77   DRERDRDGEKERDRDRDHHHRDRH 6
            +RER+   ++E++RDR   + D++
Sbjct: 1544 ERERE---QREKERDRSDRNSDKN 1564

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 43/127 (33%), Positives = 75/127 (59%), Gaps = 2/127 (1%)
 Frame = -2

Query: 428  EYEFEEERRYE-QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E E E+ER  E + E E E     +   +     +++    +     R+ +RE  K +EK
Sbjct: 1445 EREREKEREKEKEKEREREREREREREKERDREREKEREREREREREREREREREKEKEK 1504

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERE-RSRDRVRDGERSKDRGRDGEKSKD 75
            ++E  RERER+RE+ R+R+R R+R+ EK ++R+RE R ++R R+ +R K+R R  +++ D
Sbjct: 1505 EKEREREREREREREREREREREREREKEKERDREQREKERERE-QREKERDR-SDRNSD 1562

Query: 74   RERDRDG 54
            +  + DG
Sbjct: 1563 KNNNNDG 1569

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 40/131 (30%), Positives = 65/131 (49%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  E+ + E E     +   +     + +    K     R+ +RE  + RE++
Sbjct: 1463 EREREREREKER-DREREKEREREREREREREREREREKEKEKEKERERERERERERERE 1521

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            RE  RERER++EK RDR++       + R++ER+RS DR  D   + D G  G    D+ 
Sbjct: 1522 REREREREREKEKERDREQREKEREREQREKERDRS-DRNSDKNNNNDGGGSGSSRSDKS 1580

Query: 68   RDRDGEKERDR 36
              +D   ++D+
Sbjct: 1581 SSKDSGSKKDQ 1591

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/159 (22%), Positives = 72/159 (45%), Gaps = 13/159 (8%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAA------------ADEDLTDSKSNH 297
            P     + ++++  ++ +   +DN +NDS  Q                 ++D  +++ N+
Sbjct: 1675 PQQRRQQQQQQQERDRNDIRNQDNNNNDSQQQQQQQQRRQQDNDRRDRGNQDNINNRDNN 1734

Query: 296  VSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE 117
             +  ND    +  + +R+N      + E+    D SR+R   ++   ER  SR+R    +
Sbjct: 1735 SNNRNDNRERQPNQDNRDNNNNNSNRNERNDRNDSSRERQDNRN---ERNDSRERQDTRD 1791

Query: 116  RSKDRGRDGEKSKDRERDRDGE-KERDRDRDHHHRDRHR 3
              KD+ RD +KS   +R+RD +   R+    H+   +H+
Sbjct: 1792 NRKDQQRDNDKSNQVQRNRDSQPSSRNSSPPHNQPQQHQ 1830

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 35/123 (28%), Positives = 71/123 (57%), Gaps = 17/123 (13%)
 Frame = -2

Query: 326  EDLTDSKSNHVSRDNDRESSKSRE---KDRENGRERERKREKGRDRDR-SRDRDSEKSRD 159
            E++ DS+SN    DN++  S SRE   +D+E  +E+E++ ++ RD+DR +R+RD+   RD
Sbjct: 1605 ENIRDSRSN----DNNQSLSSSREIRERDKEL-KEKEQREKEQRDKDRENRERDNRDVRD 1659

Query: 158  RERERSRDRVRDGERSKDRGRDGEKSKDRERD-------------RDGEKERDRDRDHHH 18
               ++  ++ RDG   + R +  ++ ++R+R+             +  ++++ R +D+  
Sbjct: 1660 SRNDQRGNQERDGGEPQQRRQQQQQQQERDRNDIRNQDNNNNDSQQQQQQQQRRQQDNDR 1719

Query: 17   RDR 9
            RDR
Sbjct: 1720 RDR 1722

[60][TOP]
>UniRef100_C0SBJ3 Putative uncharacterized protein n=1 Tax=Paracoccidioides
            brasiliensis Pb03 RepID=C0SBJ3_PARBP
          Length = 1089

 Score =  106 bits (265), Expect = 7e-22
 Identities = 54/127 (42%), Positives = 79/127 (62%), Gaps = 8/127 (6%)
 Frame = -2

Query: 359  DSSPQPPAAADEDLTDSKSNHVSRDN--------DRESSKSREKDRENGRERERKREKGR 204
            D +  P +    DL    S+H S            R+  + R++DR+  R+R+R R++ R
Sbjct: 839  DPNKLPSSEEKLDLAIRSSDHRSNKGRSGIEGKPSRQRDRDRDRDRDRDRDRDRDRDRDR 898

Query: 203  DRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH 24
            DRDR RDRD ++ RDR+R+R RDR RD +R +DR RD +K ++R R+RD ++ERD+DRD 
Sbjct: 899  DRDRDRDRDRDRDRDRDRDRDRDRDRDKDRDRDRDRDKDKDRERVRERDPKRERDKDRD- 957

Query: 23   HHRDRHR 3
              RDR R
Sbjct: 958  --RDRKR 962

 Score =  105 bits (261), Expect = 2e-21
 Identities = 44/95 (46%), Positives = 69/95 (72%)
 Frame = -2

Query: 293  SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
            SR  DR+  + R++DR+  R+R+R R++ RDRDR RDRD ++ RDR+R+R RD+ RD +R
Sbjct: 873  SRQRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDKDRDRDR 932

Query: 113  SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
             +D+ +D E+ ++R+  R+ +K+RDRDR    RDR
Sbjct: 933  DRDKDKDRERVRERDPKRERDKDRDRDRKRSRRDR 967

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/135 (35%), Positives = 72/135 (53%)
 Frame = -2

Query: 407  RRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRER 228
            R  +    +G        S Q     D D    +     RD DR+  + R++DR+  R+R
Sbjct: 855  RSSDHRSNKGRSGIEGKPSRQRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDR 914

Query: 227  ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
            +R R++ RDRD+ RDRD ++ +D++RER R+R    ER KDR RD ++S+   RDR G +
Sbjct: 915  DRDRDRDRDRDKDRDRDRDRDKDKDRERVRERDPKRERDKDRDRDRKRSR---RDRSGSR 971

Query: 47   ERDRDRDHHHRDRHR 3
            E   D +H  R   R
Sbjct: 972  E---DTEHSRRHARR 983

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 45/138 (32%), Positives = 74/138 (53%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            ++ER+ ++        + + +    P   D +L D +   V  +    S +  +    + 
Sbjct: 798  DKERKSDRKTTSTHWPHRHRTRSLSPRHRDHELGDGEIVGVDPNKLPSSEEKLDLAIRSS 857

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
              R  K   G +   SR RD ++ RDR+R+R RDR RD +R +DR RD ++ +DR+RDRD
Sbjct: 858  DHRSNKGRSGIEGKPSRQRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRD 917

Query: 56   GEKERDRDRDHHHRDRHR 3
             +++RDRD+D   RDR R
Sbjct: 918  RDRDRDRDKD-RDRDRDR 934

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 38/119 (31%), Positives = 65/119 (54%), Gaps = 11/119 (9%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D D    +     RD DR+  + R++DR+  R+R+R R+K +DR+R R+RD ++ RD++R
Sbjct: 897  DRDRDRDRDRDRDRDRDRDRDRDRDRDRDKDRDRDRDRDKDKDRERVRERDPKRERDKDR 956

Query: 149  ERSRDRVR--------DGERSKDRGRDGEKSKDRER---DRDGEKERDRDRDHHHRDRH 6
            +R R R R        D E S+   R  ++++  E+   DR+ +    R+   H +D H
Sbjct: 957  DRDRKRSRRDRSGSREDTEHSRRHARRLKRNEAEEQMAIDREKKSTEHRESRLHEKDPH 1015

[61][TOP]
>UniRef100_Q9FYW5 BAC19.11 n=1 Tax=Solanum lycopersicum RepID=Q9FYW5_SOLLC
          Length = 532

 Score =  106 bits (264), Expect = 9e-22
 Identities = 62/144 (43%), Positives = 87/144 (60%), Gaps = 12/144 (8%)
 Frame = -2

Query: 398 EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRE--SSKSREKDRENGRERE 225
           ++ EG GED  +N SSP          +DSKS H SRD ++E  SS+SREK+RE GR+++
Sbjct: 2   QEYEGNGEDIENNGSSPY---------SDSKSQHTSRDPEKERGSSRSREKEREKGRDKD 52

Query: 224 RKREKGRDRDR----------SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           R R++ RDRDR           RDRD E+ +DR+R   RDR RD    ++R RD ++  D
Sbjct: 53  RDRDRNRDRDRDRDRGKERDKDRDRDREREKDRDRHH-RDRHRDRSDRRERIRDRDED-D 110

Query: 74  RERDRDGEKERDRDRDHHHRDRHR 3
            +R RD ++ RD D+D   R RH+
Sbjct: 111 LQRTRDYDRRRDNDKDREDRQRHK 134

[62][TOP]
>UniRef100_Q54JM6 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum
           RepID=Q54JM6_DICDI
          Length = 1447

 Score =  106 bits (264), Expect = 9e-22
 Identities = 52/139 (37%), Positives = 83/139 (59%), Gaps = 10/139 (7%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESS----------K 264
           ++R Y++ + + ++   +  S       D D    +     RD DR+            K
Sbjct: 496 KDRDYKEKDRDYKEKDRDYKSIDRDRDRDRDRDRDRDRDRDRDRDRDRDYKDYKDYKDYK 555

Query: 263 SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
             EKD+E  R+R+R R++ RDRDR RDRD ++ RDRER+R RDR RD +R KDR ++ +K
Sbjct: 556 LSEKDKERDRDRDRDRDRDRDRDRDRDRDRDRDRDRERDRDRDRDRDRDREKDREKERDK 615

Query: 83  SKDRERDRDGEKERDRDRD 27
            +D+++D++ EKE+D+DRD
Sbjct: 616 ERDKDKDKEKEKEKDKDRD 634

 Score =  106 bits (264), Expect = 9e-22
 Identities = 43/94 (45%), Positives = 70/94 (74%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           K     RD DR+  + R++DR+  R+R+R RE+ RDRDR RDRD EK R++ER++ RD+ 
Sbjct: 561 KERDRDRDRDRDRDRDRDRDRDRDRDRDRDRERDRDRDRDRDRDREKDREKERDKERDKD 620

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           +D E+ K++ +D +K K++E+D++ EKE+D+D+D
Sbjct: 621 KDKEKEKEKDKDRDKEKEKEKDKEKEKEKDKDKD 654

 Score =  104 bits (260), Expect = 3e-21
 Identities = 44/101 (43%), Positives = 75/101 (74%), Gaps = 1/101 (0%)
 Frame = -2

Query: 326 EDLTDSKSNHVS-RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           +D  D K   +S +D +R+  + R++DR+  R+R+R R++ RDRDR RDRD ++ RDR+R
Sbjct: 546 KDYKDYKDYKLSEKDKERDRDRDRDRDRDRDRDRDRDRDRDRDRDRERDRDRDRDRDRDR 605

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           E+ R++ RD ER KD+ ++ EK KD++RD++ EKE+D++++
Sbjct: 606 EKDREKERDKERDKDKDKEKEKEKDKDRDKEKEKEKDKEKE 646

 Score =  102 bits (253), Expect = 2e-20
 Identities = 39/102 (38%), Positives = 74/102 (72%)
 Frame = -2

Query: 332 ADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRE 153
           +++D    +     RD DR+  + R++DR+  R+RER R++ RDRDR R++D EK RD+E
Sbjct: 557 SEKDKERDRDRDRDRDRDRDRDRDRDRDRDRDRDRERDRDRDRDRDRDREKDREKERDKE 616

Query: 152 RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           R++ +D+ ++ E+ KDR ++ EK KD+E++++ +K++D+++D
Sbjct: 617 RDKDKDKEKEKEKDKDRDKEKEKEKDKEKEKEKDKDKDKEKD 658

 Score =  101 bits (252), Expect = 2e-20
 Identities = 51/149 (34%), Positives = 88/149 (59%), Gaps = 12/149 (8%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD----- 249
           ++R Y+  + + +D  + +   +   + D D    +     RD DR+  + R++D     
Sbjct: 491 KDRDYKDRDYKEKDRDYKEKD-RDYKSIDRDRDRDRDRDRDRDRDRDRDRDRDRDYKDYK 549

Query: 248 -------RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG 90
                   E  +ER+R R++ RDRDR RDRD ++ RDR+R+R RDR RD +R +DR +D 
Sbjct: 550 DYKDYKLSEKDKERDRDRDRDRDRDRDRDRDRDRDRDRDRDRERDRDRDRDRDRDREKDR 609

Query: 89  EKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           EK +D+ERD+D +KE+++++D   RD+ +
Sbjct: 610 EKERDKERDKDKDKEKEKEKD-KDRDKEK 637

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 39/101 (38%), Positives = 73/101 (72%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D  D K     + ++++  + R++DR+  R+R+R R++ RDRDR RDR+ ++ RDR+R
Sbjct: 542 DRDYKDYKDYKDYKLSEKDKERDRDRDRDRDRDRDRDRDRDRDRDRDRDRERDRDRDRDR 601

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           +R R++ R+ ER K+R +D +K K++E+D+D +KE+++++D
Sbjct: 602 DRDREKDREKERDKERDKDKDKEKEKEKDKDRDKEKEKEKD 642

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 57/143 (39%), Positives = 80/143 (55%), Gaps = 15/143 (10%)
 Frame = -2

Query: 386 GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN---GRERERKR 216
           G  +D Y  D       + D      +S    RD  R+ S+SR +DR+     R+R+R R
Sbjct: 266 GGKDDKYMRDRDRSRDRSRDRIRDRDRSRDRIRDRVRDRSRSRSRDRDRYYRDRDRDRDR 325

Query: 215 EKGRDRDRSRD------------RDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           ++ RDRDR RD            RD ++ RDR+R+R RD  RD  RS+DR RD  +S+DR
Sbjct: 326 DRDRDRDRERDIGRSGGSSGGLDRDRDRDRDRDRDRRRD--RDRSRSRDRSRD--RSRDR 381

Query: 71  ERDRDGEKERDRDRDHHHRDRHR 3
           +RDR   +ERDRDRD   +DR++
Sbjct: 382 DRDRSRSRERDRDRD-RGKDRNK 403

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 51/125 (40%), Positives = 73/125 (58%), Gaps = 16/125 (12%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDR-- 156
           D D  D   ++  RD   +    +EKDR+  +  +R R++ RDRDR RDRD ++ RDR  
Sbjct: 487 DRDYKDR--DYKDRDYKEKDRDYKEKDRDY-KSIDRDRDRDRDRDRDRDRDRDRDRDRDR 543

Query: 155 --------------ERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHH 18
                         E+++ RDR RD +R +DR RD ++ +DR+RDRD E++RDRDRD   
Sbjct: 544 DYKDYKDYKDYKLSEKDKERDRDRDRDRDRDRDRDRDRDRDRDRDRDRERDRDRDRD--- 600

Query: 17  RDRHR 3
           RDR R
Sbjct: 601 RDRDR 605

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 34/94 (36%), Positives = 64/94 (68%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D    +     RD DR+  + RE+DR+  R+R+R REK R+++R ++RD +K +++E+
Sbjct: 568 DRDRDRDRDRDRDRDRDRDRDRDRERDRDRDRDRDRDREKDREKERDKERDKDKDKEKEK 627

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
           E+ +DR ++ E+ KD+ ++ EK KD+++++D  K
Sbjct: 628 EKDKDRDKEKEKEKDKEKEKEKDKDKDKEKDKPK 661

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 50/117 (42%), Positives = 71/117 (60%), Gaps = 14/117 (11%)
 Frame = -2

Query: 311 SKSNHVSRDNDRESSKSREKDRENGRERERKREKGRD-RDRSRDRDS-EKSRDRERERSR 138
           S S  VS  +D++      KDR+  ++R+ K EK RD +++ RD  S ++ RDR+R+R R
Sbjct: 472 SSSIGVSGKSDKDYKDRDYKDRDY-KDRDYK-EKDRDYKEKDRDYKSIDRDRDRDRDRDR 529

Query: 137 DRVRDGERSKDRGRD------------GEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           DR RD +R +DR RD             EK K+R+RDRD +++RDRDRD   RDR R
Sbjct: 530 DRDRDRDRDRDRDRDYKDYKDYKDYKLSEKDKERDRDRDRDRDRDRDRD-RDRDRDR 585

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 49/139 (35%), Positives = 76/139 (54%), Gaps = 16/139 (11%)
 Frame = -2

Query: 371 NYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKRE-KGRDRD 195
           N    SS  P ++  +  + S       D D +    +++D ++   +E+ R+ K +DRD
Sbjct: 454 NVSTSSSSIPTSSLIKKSSSSIGVSGKSDKDYKDRDYKDRDYKDRDYKEKDRDYKEKDRD 513

Query: 194 -RSRDRDSEKSRDRERERSRDRVRDGERSKDRG--------------RDGEKSKDRERDR 60
            +S DRD  + RDR+R+R RDR RD +R +DR               +D E+ +DR+RDR
Sbjct: 514 YKSIDRD--RDRDRDRDRDRDRDRDRDRDRDRDYKDYKDYKDYKLSEKDKERDRDRDRDR 571

Query: 59  DGEKERDRDRDHHHRDRHR 3
           D +++RDRDRD   RDR R
Sbjct: 572 DRDRDRDRDRD-RDRDRDR 589

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 29/109 (26%), Positives = 61/109 (55%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           +Y+  E+ +    + + + +   D         D D    +     RD DR+  K REK+
Sbjct: 553 DYKLSEKDKERDRDRDRDRDRDRDRDRDRDRDRDRDRDRERDRDRDRDRDRDREKDREKE 612

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR 102
           R+  R++++ +EK +++D+ RD++ EK +D+E+E+ +D+ +D E+ K +
Sbjct: 613 RDKERDKDKDKEKEKEKDKDRDKEKEKEKDKEKEKEKDKDKDKEKDKPK 661

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 34/100 (34%), Positives = 51/100 (51%)
 Frame = -2

Query: 374 DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRD 195
           D Y+ D         D D    +   + R         R++DR+  R+R+R+R++ R R 
Sbjct: 313 DRYYRDRDRDRDRDRDRDR--DRERDIGRSGGSSGGLDRDRDRDRDRDRDRRRDRDRSRS 370

Query: 194 RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           R R RD  + RDR+R RSR+R RD +R KDR +    S +
Sbjct: 371 RDRSRDRSRDRDRDRSRSRERDRDRDRGKDRNKLSSSSSN 410

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 48/109 (44%), Positives = 62/109 (56%), Gaps = 5/109 (4%)
 Frame = -2

Query: 362 NDSSPQPPAAADEDLTDSKSNHVSRDNDRES-SKSREKD--RENGRERERKREKGRD-RD 195
           + +SPQ   +    L  SK N  S      S S S +KD  +EN +         RD RD
Sbjct: 46  SSNSPQTFVSQQHALNRSKDNTSSFQISSSSFSSSLKKDQLKENNKSNITSLSSSRDSRD 105

Query: 194 RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS-KDRERDRDGE 51
           RSRDR  ++SRDR R+RSRDR RD  RS+DR RD  +  KDR++ RDG+
Sbjct: 106 RSRDRSRDRSRDRARDRSRDRARD--RSRDRSRDRSRDRKDRDKFRDGK 152

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 41/119 (34%), Positives = 63/119 (52%), Gaps = 3/119 (2%)
 Frame = -2

Query: 350 PQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE---NGRERERKREKGRDRDRSRDR 180
           P PP ++    ++S    VS+ +    SK      +   +      K+++ ++ ++S   
Sbjct: 36  PPPPTSSSSSSSNSPQTFVSQQHALNRSKDNTSSFQISSSSFSSSLKKDQLKENNKSNIT 95

Query: 179 DSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
               SRD  R+RSRDR RD  RS+DR RD  +S+DR RDR  ++ RDR RD   RD+ R
Sbjct: 96  SLSSSRD-SRDRSRDRSRD--RSRDRARD--RSRDRARDRSRDRSRDRSRDRKDRDKFR 149

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/83 (42%), Positives = 50/83 (60%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D+   ++KSN  S  + R+S       R+  R+R R R + R RDRSRDR  ++SRDR R
Sbjct: 84  DQLKENNKSNITSLSSSRDS-------RDRSRDRSRDRSRDRARDRSRDRARDRSRDRSR 136

Query: 149 ERSRDRVRDGERSKDRGRDGEKS 81
           +RSRDR     + +D+ RDG+ S
Sbjct: 137 DRSRDR-----KDRDKFRDGKSS 154

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 48/139 (34%), Positives = 71/139 (51%), Gaps = 21/139 (15%)
 Frame = -2

Query: 356 SSPQPPAAADEDLTDSKSNHVSRDNDRESSKS---REKDRENGRERERKREKGRDRD-RS 189
           S    P  +  +++ S S+  +    ++SS S     K  ++ ++R+ K    +DRD + 
Sbjct: 443 SERSSPILSTSNVSTSSSSIPTSSLIKKSSSSIGVSGKSDKDYKDRDYKDRDYKDRDYKE 502

Query: 188 RDRD-SEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD--------------- 57
           +DRD  EK RD    +S DR RD +R +DR RD  + +DR+RDRD               
Sbjct: 503 KDRDYKEKDRDY---KSIDRDRDRDRDRDRDRD--RDRDRDRDRDRDYKDYKDYKDYKLS 557

Query: 56  -GEKERDRDRDHHHRDRHR 3
             +KERDRDRD   RDR R
Sbjct: 558 EKDKERDRDRD-RDRDRDR 575

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 26/98 (26%), Positives = 46/98 (46%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D    +     R  DR+ S+SR++ R+  R+R+R R + R+RDR RDR  ++++    
Sbjct: 348 DRDRDRDRDRDRDRRRDRDRSRSRDRSRDRSRDRDRDRSRSRERDRDRDRGKDRNKLSSS 407

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDR 36
             +   V +   S      G  +K+       E + +R
Sbjct: 408 SSNTSAVSNISSSSSSINSGSNTKNLSSPTSSESKSER 445

[63][TOP]
>UniRef100_B2RY56-2 Isoform 2 of RNA-binding protein 25 n=1 Tax=Mus musculus
           RepID=B2RY56-2
          Length = 838

 Score =  106 bits (264), Expect = 9e-22
 Identities = 54/132 (40%), Positives = 83/132 (62%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E     +   +     + +    +     RD DR+ +K R++DRE
Sbjct: 303 EIEKERRERERERERERE-RREREREREREREREKEKERERERERDRDRDRTKERDRDRE 361

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R+R   R++DRSR R  EKSRDRERER R+R R+ ER ++R R+ E+ ++RER+
Sbjct: 362 RDRDRDRERSSDRNKDRSRSR--EKSRDRERERERERERERERERERERERERERERERE 419

Query: 62  RDGEKERDRDRD 27
           R+ +K+RDR+ D
Sbjct: 420 REKDKKRDREED 431

 Score =  105 bits (263), Expect = 1e-21
 Identities = 47/96 (48%), Positives = 73/96 (76%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  + RE+++E  RERER+R++ RDR + RDRD E+ RDR+RERS DR +D  RS
Sbjct: 322 REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSRS 381

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +++ RD E+ ++RER+R+ E+ER+R+R+   R+R R
Sbjct: 382 REKSRDRERERERERERERERERERERE-RERERER 416

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 52/103 (50%), Positives = 70/103 (67%), Gaps = 11/103 (10%)
 Frame = -2

Query: 278 RESSKSREKDRENG-RERERK----------REKGRDRDRSRDRDSEKSRDRERERSRDR 132
           RE  + RE++RE   RERER+          RE+ R+RDR RDR  E+ RDRER+R RDR
Sbjct: 309 RERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDR 368

Query: 131 VRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R  +R+KDR R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 369 ERSSDRNKDRSRSREKSRDRERERERERERERERE-RERERER 410

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 48/129 (37%), Positives = 73/129 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     RD DRE  + R+++
Sbjct: 314 ERERERERREREREREREREREKEKERERERERDRDRDRTKE----RDRDRERDRDRDRE 369

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R + R ++R R + + RDR R+R+ E+ R+RERER R+R R+ ER ++R R+ +K +DRE
Sbjct: 370 RSSDRNKDRSRSREKSRDREREREREREREREREREREREREREREREREREKDKKRDRE 429

Query: 68  RDRDGEKER 42
            D +   ER
Sbjct: 430 EDEEDAYER 438

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 46/101 (45%), Positives = 68/101 (67%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDR----VR 126
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR     R
Sbjct: 297 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 356

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +R +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 357 DRDRERDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 396

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 44/140 (31%), Positives = 79/140 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E   R  + E E E     +   +     D D T  +     RD DR+  +S +++
Sbjct: 316 ERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDRN 375

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           ++  R RE+ R++ R+R+R R+R+ E+ R+RERER R+R R+ ER KD+ RD E+ ++  
Sbjct: 376 KDRSRSREKSRDREREREREREREREREREREREREREREREREREKDKKRDREEDEEDA 435

Query: 68  RDRDGEKERDRDRDHHHRDR 9
            +R   + + R+++  +++R
Sbjct: 436 YERRKLERKLREKEAAYQER 455

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 46/115 (40%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDND-----RESSKSREKDRENGRERERKREKGRDRDRSR-DRDSEK 168
           +ED  D  S  +S+  D      E    +EK+R+   +  R+RE+ R+R+R R +R+ E+
Sbjct: 269 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 328

Query: 167 SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R+RERE+ ++R R+ ER +DR R  E+ +DRERDRD ++ER  DR   ++DR R
Sbjct: 329 EREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDR---NKDRSR 380

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 43/147 (29%), Positives = 75/147 (51%), Gaps = 13/147 (8%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNY-HNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E+ER  E+      D     D   +     D + +  ++   SR  ++   + RE+
Sbjct: 333 EREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERER 392

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS--- 81
           +RE  RERER+RE+ R+R+R R+R+ E+ +D++R+R  D     ER K   +  EK    
Sbjct: 393 EREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAY 452

Query: 80  ---------KDRERDRDGEKERDRDRD 27
                    ++R++ R+ EKE +R+ +
Sbjct: 453 QERLKNWEIRERKKTREYEKEAEREEE 479

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 43/114 (37%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 258 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 317

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDH-HHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDR+    RDR R
Sbjct: 318 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRER 370

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 32/130 (24%), Positives = 66/130 (50%), Gaps = 2/130 (1%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E  R    E   + N     S +     + +    +     R+ +RE  + RE++RE  R
Sbjct: 361 ERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERERER 420

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE-RSKDRGRDGEKSKDRERDR 60
           E+++KR++  D + + +R   + + RE+E + ++R+++ E R + + R+ EK  +RE +R
Sbjct: 421 EKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEER 480

Query: 59  DGEKERDRDR 30
             E  ++  R
Sbjct: 481 RREMAKEAKR 490

[64][TOP]
>UniRef100_B2RY56 RNA-binding protein 25 n=1 Tax=Mus musculus RepID=RBM25_MOUSE
          Length = 841

 Score =  106 bits (264), Expect = 9e-22
 Identities = 54/132 (40%), Positives = 83/132 (62%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E     +   +     + +    +     RD DR+ +K R++DRE
Sbjct: 306 EIEKERRERERERERERE-RREREREREREREREKEKERERERERDRDRDRTKERDRDRE 364

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R+R   R++DRSR R  EKSRDRERER R+R R+ ER ++R R+ E+ ++RER+
Sbjct: 365 RDRDRDRERSSDRNKDRSRSR--EKSRDRERERERERERERERERERERERERERERERE 422

Query: 62  RDGEKERDRDRD 27
           R+ +K+RDR+ D
Sbjct: 423 REKDKKRDREED 434

 Score =  105 bits (263), Expect = 1e-21
 Identities = 47/96 (48%), Positives = 73/96 (76%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  + RE+++E  RERER+R++ RDR + RDRD E+ RDR+RERS DR +D  RS
Sbjct: 325 REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSRS 384

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +++ RD E+ ++RER+R+ E+ER+R+R+   R+R R
Sbjct: 385 REKSRDRERERERERERERERERERERE-RERERER 419

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 52/103 (50%), Positives = 70/103 (67%), Gaps = 11/103 (10%)
 Frame = -2

Query: 278 RESSKSREKDRENG-RERERK----------REKGRDRDRSRDRDSEKSRDRERERSRDR 132
           RE  + RE++RE   RERER+          RE+ R+RDR RDR  E+ RDRER+R RDR
Sbjct: 312 RERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDR 371

Query: 131 VRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R  +R+KDR R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 372 ERSSDRNKDRSRSREKSRDRERERERERERERERE-RERERER 413

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 48/129 (37%), Positives = 73/129 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     RD DRE  + R+++
Sbjct: 317 ERERERERREREREREREREREKEKERERERERDRDRDRTKE----RDRDRERDRDRDRE 372

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R + R ++R R + + RDR R+R+ E+ R+RERER R+R R+ ER ++R R+ +K +DRE
Sbjct: 373 RSSDRNKDRSRSREKSRDREREREREREREREREREREREREREREREREREKDKKRDRE 432

Query: 68  RDRDGEKER 42
            D +   ER
Sbjct: 433 EDEEDAYER 441

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 46/101 (45%), Positives = 68/101 (67%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDR----VR 126
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR     R
Sbjct: 300 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 359

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +R +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 360 DRDRERDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 399

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 44/140 (31%), Positives = 79/140 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E   R  + E E E     +   +     D D T  +     RD DR+  +S +++
Sbjct: 319 ERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDRN 378

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           ++  R RE+ R++ R+R+R R+R+ E+ R+RERER R+R R+ ER KD+ RD E+ ++  
Sbjct: 379 KDRSRSREKSRDREREREREREREREREREREREREREREREREREKDKKRDREEDEEDA 438

Query: 68  RDRDGEKERDRDRDHHHRDR 9
            +R   + + R+++  +++R
Sbjct: 439 YERRKLERKLREKEAAYQER 458

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 46/115 (40%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDND-----RESSKSREKDRENGRERERKREKGRDRDRSR-DRDSEK 168
           +ED  D  S  +S+  D      E    +EK+R+   +  R+RE+ R+R+R R +R+ E+
Sbjct: 272 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 331

Query: 167 SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R+RERE+ ++R R+ ER +DR R  E+ +DRERDRD ++ER  DR   ++DR R
Sbjct: 332 EREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDR---NKDRSR 383

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 43/147 (29%), Positives = 75/147 (51%), Gaps = 13/147 (8%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNY-HNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E+ER  E+      D     D   +     D + +  ++   SR  ++   + RE+
Sbjct: 336 EREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERER 395

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS--- 81
           +RE  RERER+RE+ R+R+R R+R+ E+ +D++R+R  D     ER K   +  EK    
Sbjct: 396 EREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAY 455

Query: 80  ---------KDRERDRDGEKERDRDRD 27
                    ++R++ R+ EKE +R+ +
Sbjct: 456 QERLKNWEIRERKKTREYEKEAEREEE 482

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 43/114 (37%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 261 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 320

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDH-HHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDR+    RDR R
Sbjct: 321 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRER 373

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 32/130 (24%), Positives = 66/130 (50%), Gaps = 2/130 (1%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E  R    E   + N     S +     + +    +     R+ +RE  + RE++RE  R
Sbjct: 364 ERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERERER 423

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE-RSKDRGRDGEKSKDRERDR 60
           E+++KR++  D + + +R   + + RE+E + ++R+++ E R + + R+ EK  +RE +R
Sbjct: 424 EKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEER 483

Query: 59  DGEKERDRDR 30
             E  ++  R
Sbjct: 484 RREMAKEAKR 493

[65][TOP]
>UniRef100_UPI0001554CCA PREDICTED: similar to advanced glycosylation end product-specific
            receptor n=1 Tax=Ornithorhynchus anatinus
            RepID=UPI0001554CCA
          Length = 2472

 Score =  105 bits (263), Expect = 1e-21
 Identities = 56/143 (39%), Positives = 86/143 (60%), Gaps = 4/143 (2%)
 Frame = -2

Query: 419  FEEERR---YEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            FEE RR   + +P E +   N+  +         D +    K  +   D ++E + +++K
Sbjct: 2207 FEERRRDRDHSKPWERDRSRNWSREKERDWERNRDWERHREKDTNREWDKNKERNPNKDK 2266

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            +RE+ R ++ +R + R+RDR R+RD ++ RDR+R RSRDR RD  RS+DR  D  + +DR
Sbjct: 2267 ERESERNKDWERNRSRNRDRDRERDRDRRRDRDRSRSRDRDRDRSRSRDRDWDRARDRDR 2326

Query: 71   ERDRDGEKERDRDRDHHHRDRHR 3
            ERDRD EK+RDRDR    +DR +
Sbjct: 2327 ERDRDREKDRDRDRGKDRKDRSK 2349

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 46/132 (34%), Positives = 77/132 (58%), Gaps = 2/132 (1%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E ++E  R +E+   E + N   D + +     D++    ++    R+  R   + RE+D
Sbjct: 2233 ERDWERNRDWERHR-EKDTNREWDKNKERNPNKDKERESERNKDWERNRSRNRDRDRERD 2291

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD-GEKSKDR 72
            R+  R+R+R R + RDRDRSR RD +  R R+R+R RDR R+ +R +DRG+D  ++SK +
Sbjct: 2292 RDRRRDRDRSRSRDRDRDRSRSRDRDWDRARDRDRERDRDREKDRDRDRGKDRKDRSKSK 2351

Query: 71   E-RDRDGEKERD 39
            E RD   E+ ++
Sbjct: 2352 EIRDLKPEEPKE 2363

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 53/146 (36%), Positives = 82/146 (56%), Gaps = 10/146 (6%)
 Frame = -2

Query: 410  ERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRD-----NDRESSKSREKDR 246
            E R +  E    D +   S  +P    DE  T +  N  SR       DR+ SK  E+DR
Sbjct: 2168 EFRNQNFEARPRDRFEGGSKEKP---LDEPETQASENRQSRGFEERRRDRDHSKPWERDR 2224

Query: 245  ENG--RERERKREKGRDRDRSRDRDSEKSRDRERERS--RDRVRDGERSKDRGRDGEKSK 78
                 RE+ER  E+ RD +R R++D+ +  D+ +ER+  +D+ R+ ER+KD  R+  +S+
Sbjct: 2225 SRNWSREKERDWERNRDWERHREKDTNREWDKNKERNPNKDKERESERNKDWERN--RSR 2282

Query: 77   DRERDRDGEKERDRDRDH-HHRDRHR 3
            +R+RDR+ +++R RDRD    RDR R
Sbjct: 2283 NRDRDRERDRDRRRDRDRSRSRDRDR 2308

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 45/137 (32%), Positives = 77/137 (56%), Gaps = 2/137 (1%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            +E+  ++PE +  +N  +    +     D       S    RD  R  S+ +E+D E  R
Sbjct: 2187 KEKPLDEPETQASENRQSRGFEERRRDRDH------SKPWERDRSRNWSREKERDWERNR 2240

Query: 233  ERERKREKGRDR--DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
            + ER REK  +R  D++++R+  K ++RE ER++D  R+  R++DR R+ ++ + R+RDR
Sbjct: 2241 DWERHREKDTNREWDKNKERNPNKDKERESERNKDWERNRSRNRDRDRERDRDRRRDRDR 2300

Query: 59   DGEKERDRDRDHHHRDR 9
               ++RDRDR    RDR
Sbjct: 2301 SRSRDRDRDRS-RSRDR 2316

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 39/117 (33%), Positives = 64/117 (54%), Gaps = 4/117 (3%)
 Frame = -2

Query: 377  EDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR 198
            E N + D   +     D +   S++    R+ DR+  + R++ R   R+R+R R + RD 
Sbjct: 2259 ERNPNKDKERESERNKDWERNRSRNRDRDRERDRDRRRDRDRSRSRDRDRDRSRSRDRDW 2318

Query: 197  DRSRDRDSEKSRDRE----RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERD 39
            DR+RDRD E+ RDRE    R+R +DR +D  +SK+  RD +  + +E  +  E  +D
Sbjct: 2319 DRARDRDRERDRDREKDRDRDRGKDR-KDRSKSKEI-RDLKPEEPKEIKKTAEPGKD 2373

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 44/142 (30%), Positives = 73/142 (51%), Gaps = 7/142 (4%)
 Frame = -2

Query: 437  TMGEYEFEEER---RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESS 267
            T  E++  +ER   + ++ E E   ++  + S       + D    +    SR  DR+  
Sbjct: 2250 TNREWDKNKERNPNKDKERESERNKDWERNRSRNRDRDRERDRDRRRDRDRSRSRDRDRD 2309

Query: 266  KSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD--GERSKDRGRD 93
            +SR +DR+  R R+R RE+ RDR++ RDRD  K R ++R +S++ +RD   E  K+  + 
Sbjct: 2310 RSRSRDRDWDRARDRDRERDRDREKDRDRDRGKDR-KDRSKSKE-IRDLKPEEPKEIKKT 2367

Query: 92   GEKSKD--RERDRDGEKERDRD 33
             E  KD      R+G K R R+
Sbjct: 2368 AEPGKDSLSGSKREGGKGRLRN 2389

[66][TOP]
>UniRef100_UPI000154E56B RNA binding motif protein 25 n=1 Tax=Rattus norvegicus
           RepID=UPI000154E56B
          Length = 484

 Score =  105 bits (263), Expect = 1e-21
 Identities = 47/96 (48%), Positives = 73/96 (76%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  + RE+++E  RERER+R++ RDR + RDRD E+ RDR+RERS DR +D  RS
Sbjct: 322 REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSRS 381

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +++ RD E+ ++RER+R+ E+ER+R+R+   R+R R
Sbjct: 382 REKSRDRERERERERERERERERERERE-RERERER 416

 Score =  102 bits (255), Expect = 1e-20
 Identities = 52/138 (37%), Positives = 84/138 (60%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E     +   +     + +    +     RD DR+ +K R++DRE
Sbjct: 303 EIEKERRERERERERERE-RREREREREREREREKEKERERERERDRDRDRTKERDRDRE 361

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R+R   R++DRSR R  EKSRDRERER R+R R+ ER ++R R+ E+ ++RER+
Sbjct: 362 RDRDRDRERSSDRNKDRSRSR--EKSRDRERERERERERERERERERERERERERERERE 419

Query: 62  RDGEKERDRDRDHHHRDR 9
           +D +++R+ D +  +  R
Sbjct: 420 KDKKRDREEDEEDAYERR 437

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 52/103 (50%), Positives = 70/103 (67%), Gaps = 11/103 (10%)
 Frame = -2

Query: 278 RESSKSREKDRENG-RERERK----------REKGRDRDRSRDRDSEKSRDRERERSRDR 132
           RE  + RE++RE   RERER+          RE+ R+RDR RDR  E+ RDRER+R RDR
Sbjct: 309 RERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDR 368

Query: 131 VRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R  +R+KDR R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 369 ERSSDRNKDRSRSREKSRDRERERERERERERERE-RERERER 410

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 46/140 (32%), Positives = 77/140 (55%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     R+ DR+  + R  D
Sbjct: 314 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSD 373

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R   R R R++ + R+R+R R+R+ E+ R+RERER R+R R+ ER KD+ RD E+ ++  
Sbjct: 374 RNKDRSRSREKSRDREREREREREREREREREREREREREREREREKDKKRDREEDEEDA 433

Query: 68  RDRDGEKERDRDRDHHHRDR 9
            +R   + + R+++  +++R
Sbjct: 434 YERRKLERKLREKEAAYQER 453

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 46/101 (45%), Positives = 68/101 (67%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDR----VR 126
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR     R
Sbjct: 297 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 356

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +R +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 357 DRDRERDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 396

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 46/115 (40%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDND-----RESSKSREKDRENGRERERKREKGRDRDRSR-DRDSEK 168
           +ED  D  S  +S+  D      E    +EK+R+   +  R+RE+ R+R+R R +R+ E+
Sbjct: 269 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 328

Query: 167 SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R+RERE+ ++R R+ ER +DR R  E+ +DRERDRD ++ER  DR   ++DR R
Sbjct: 329 EREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDR---NKDRSR 380

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 46/146 (31%), Positives = 73/146 (50%), Gaps = 12/146 (8%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+ER  E+      D    +         D D   S   +  R   RE S+ RE++
Sbjct: 333 EREKEKERERERERDRDRDRT-KERDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERE 391

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS---- 81
           RE  RERER+RE+ R+R+R R+R+ E+ +D++R+R  D     ER K   +  EK     
Sbjct: 392 REREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQ 451

Query: 80  --------KDRERDRDGEKERDRDRD 27
                   ++R++ R+ EKE +R+ +
Sbjct: 452 ERLKNWEIRERKKTREYEKEAEREEE 477

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 43/114 (37%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 258 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 317

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDH-HHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDR+    RDR R
Sbjct: 318 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRER 370

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 31/123 (25%), Positives = 65/123 (52%), Gaps = 2/123 (1%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +  R    + E   + + D S     + D +    +     R+ +RE  + RE++RE  R
Sbjct: 359 DRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERER 418

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE-RSKDRGRDGEKSKDRERDR 60
           E+++KR++  D + + +R   + + RE+E + ++R+++ E R + + R+ EK  +RE +R
Sbjct: 419 EKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEER 478

Query: 59  DGE 51
             E
Sbjct: 479 RRE 481

[67][TOP]
>UniRef100_B3L1H1 Protein kinase, putative n=1 Tax=Plasmodium knowlesi strain H
            RepID=B3L1H1_PLAKH
          Length = 1367

 Score =  105 bits (262), Expect = 2e-21
 Identities = 48/97 (49%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
            RD DRE  + RE+DRE  R+RER++E+ R+++R R+R  EK R+RER R ++R R+ ER 
Sbjct: 1235 RDRDRERERERERDRERERDREREKEREREKERERERYREKDRERERNREKERERERERE 1294

Query: 110  KDRGRDGEKSKDRERDRDGEKERDRDRD-HHHRDRHR 3
            +DR RD ++ KDR+R R  ++ERDR+RD H  R+ H+
Sbjct: 1295 RDRDRDRDRDKDRDRKRYRDQERDRERDRHREREPHK 1331

 Score =  103 bits (258), Expect = 5e-21
 Identities = 48/104 (46%), Positives = 71/104 (68%), Gaps = 11/104 (10%)
 Frame = -2

Query: 281  DRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR 102
            DRE  +  E DR+  R+RER+RE+ RDR+R RDR+ EK R+RE+ER R+R R+ +R ++R
Sbjct: 1222 DRERKERNEWDRDRDRDRERERERERDRERERDREREKEREREKERERERYREKDRERER 1281

Query: 101  GRDGEKSKDRERDRDGEKERDRDRDH-----------HHRDRHR 3
             R+ E+ ++RER+RD +++RDRD+D              RDRHR
Sbjct: 1282 NREKERERERERERDRDRDRDRDKDRDRKRYRDQERDRERDRHR 1325

 Score =  101 bits (251), Expect = 3e-20
 Identities = 52/98 (53%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRENGRERERKR--EKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE 117
            RD +RE    R+K R+ GR+RERK   E  RDRDR R+R+ E+ RDRERER R+R ++ E
Sbjct: 1203 RDREREREWERDKRRDMGRDRERKERNEWDRDRDRDRERERERERDRERERDREREKERE 1262

Query: 116  RSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R K+R R+  + KDRER+R+ EKER+R+R+   RDR R
Sbjct: 1263 REKERERERYREKDRERERNREKERERERE-RERDRDR 1299

 Score =  100 bits (248), Expect = 7e-20
 Identities = 54/140 (38%), Positives = 84/140 (60%), Gaps = 4/140 (2%)
 Frame = -2

Query: 416  EEERRYEQPEGE--GEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E ER +E+ +    G D    + +       D D    +     RD +RE  + REK+RE
Sbjct: 1206 EREREWERDKRRDMGRDRERKERNEWD---RDRDRDRERERERERDRERERDREREKERE 1262

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
              +ERER+R + +DR+R R+R+ E+ R+RERER RDR RD ++ +DR R  ++ +DRERD
Sbjct: 1263 REKERERERYREKDRERERNREKERERERERERDRDRDRDRDKDRDRKRYRDQERDRERD 1322

Query: 62   RDGEKE--RDRDRDHHHRDR 9
            R  E+E  + R RD+ +R++
Sbjct: 1323 RHREREPHKRRSRDNSNRNQ 1342

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 41/99 (41%), Positives = 69/99 (69%), Gaps = 3/99 (3%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
            RD  RE  + R+++RE   ER+++R+ GRDR+R    + ++ RDR+RER R+R RD ER 
Sbjct: 1193 RDMGRERDRKRDREREREWERDKRRDMGRDRERKERNEWDRDRDRDRERERERERDRERE 1252

Query: 110  KDRGRDGEKSKDRERDRDGEKERDRDRDHH---HRDRHR 3
            +DR R+ E+ +++ER+R+  +E+DR+R+ +    R+R R
Sbjct: 1253 RDREREKEREREKERERERYREKDRERERNREKERERER 1291

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 49/156 (31%), Positives = 85/156 (54%), Gaps = 11/156 (7%)
 Frame = -2

Query: 437  TMGEYEFEEERRYEQPEGEGEDN---------YHNDSSPQPPAAADEDLTDSKSNHVSRD 285
            T  +  F  + R+ + E  G            YH +S         +  + ++ +   R 
Sbjct: 1119 TQRDGSFRGDSRWRREESSGRSRHSSTREGGGYHTNSYRGRVGRIRDSSSRAERSMHDRS 1178

Query: 284  NDRESSKS--REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
             +RE  K    E+ R+ GRER+RKR++ R+R+  RD+  +  RDRER+   +  RD +R 
Sbjct: 1179 REREWYKRDYAERGRDMGRERDRKRDREREREWERDKRRDMGRDRERKERNEWDRDRDRD 1238

Query: 110  KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            ++R R+ E+ ++RERDR+ EKER+R+++   R+R+R
Sbjct: 1239 RERERERERDRERERDREREKEREREKE-RERERYR 1273

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 40/134 (29%), Positives = 74/134 (55%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            +  R E+ E + + +   +   +     + +    +     R+ +RE  + REKDRE  R
Sbjct: 1222 DRERKERNEWDRDRDRDRERERERERDRERERDREREKEREREKERERERYREKDRERER 1281

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
             RE++RE+ R+R+R RDRD ++ +DR+R+R RD+ RD ER + R R+  K + R+     
Sbjct: 1282 NREKERERERERERDRDRDRDRDKDRDRKRYRDQERDRERDRHREREPHKRRSRDNSNRN 1341

Query: 53   EKERDRDRDHHHRD 12
            ++ + +++  H  D
Sbjct: 1342 QEHQLKEQKKHKLD 1355

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 39/102 (38%), Positives = 66/102 (64%)
 Frame = -2

Query: 308  KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
            K ++  R  D    + R++DRE  RE ER + +   RDR R   +E  RDR+R+R R+R 
Sbjct: 1185 KRDYAERGRDMGRERDRKRDREREREWERDKRRDMGRDRERKERNEWDRDRDRDRERERE 1244

Query: 128  RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R+ +R ++R R+ EK ++RE++R+ E+ R++DR+   R+R+R
Sbjct: 1245 RERDRERERDREREKEREREKERERERYREKDRE---RERNR 1283

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 42/96 (43%), Positives = 63/96 (65%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
            R+ DRE  ++REK+RE  RERER+R++ RDRDR +DRD ++ RD+ER+R RDR R+ E  
Sbjct: 1273 REKDRERERNREKERE--RERERERDRDRDRDRDKDRDRKRYRDQERDRERDRHREREPH 1330

Query: 110  KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            K R RD   ++++E     +K+   D    +R+  R
Sbjct: 1331 KRRSRD-NSNRNQEHQLKEQKKHKLDSQDANRELKR 1365

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 39/135 (28%), Positives = 71/135 (52%), Gaps = 1/135 (0%)
 Frame = -2

Query: 428  EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E++ + +R R  + E E +     D   +     +++    +     R+ +R   K RE+
Sbjct: 1230 EWDRDRDRDRERERERERDRERERDREREKEREREKERERERYREKDRERERNREKERER 1289

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            +RE  R+R+R R++ +DRDR R RD E  RDRER+R R+R     RS+D     ++ + +
Sbjct: 1290 ERERERDRDRDRDRDKDRDRKRYRDQE--RDRERDRHREREPHKRRSRDNSNRNQEHQLK 1347

Query: 71   ERDRDGEKERDRDRD 27
            E+ +     +D +R+
Sbjct: 1348 EQKKHKLDSQDANRE 1362

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 29/121 (23%), Positives = 57/121 (47%), Gaps = 1/121 (0%)
 Frame = -2

Query: 428  EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E + E ER R  + E E E     +   +     + +    +     R+ DR+  + R+K
Sbjct: 1246 ERDRERERDREREKEREREKERERERYREKDRERERNREKERERERERERDRDRDRDRDK 1305

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            DR+  R R+++R++ RDR R R+    +SRD        ++++ ++ K   +D  +   R
Sbjct: 1306 DRDRKRYRDQERDRERDRHREREPHKRRSRDNSNRNQEHQLKEQKKHKLDSQDANRELKR 1365

Query: 71   E 69
            +
Sbjct: 1366 K 1366

[68][TOP]
>UniRef100_Q5CSS0 Transcription factor E2F n=1 Tax=Cryptosporidium parvum Iowa II
           RepID=Q5CSS0_CRYPV
          Length = 582

 Score =  105 bits (261), Expect = 2e-21
 Identities = 55/145 (37%), Positives = 85/145 (58%), Gaps = 8/145 (5%)
 Frame = -2

Query: 431 GEYEFEEE--RRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDS------KSNHVSRDNDR 276
           G YE+E+   RR    EG  + ++ ++   +       D          +++   R  D 
Sbjct: 17  GNYEWEDNDRRRVADNEGRRDRDFDSERGRRREHYGGRDRRRDFRRRSVENSRGGRHRDD 76

Query: 275 ESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR 96
           E+    + D +N  + ER+REK RDRDR RDR+ ++ RDR+R+R RDR R+ +R +DR R
Sbjct: 77  ENMDKGKNDDQNNSQWEREREKERDRDRERDRERDRDRDRDRDRDRDRDRERDRERDRER 136

Query: 95  DGEKSKDRERDRDGEKERDRDRDHH 21
           D E+ +DRERDRD E++R+RDRD +
Sbjct: 137 DRERDRDRERDRDRERDRERDRDRY 161

 Score =  105 bits (261), Expect = 2e-21
 Identities = 47/94 (50%), Positives = 69/94 (73%)
 Frame = -2

Query: 284 NDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKD 105
           ND +++   E++RE  R+R+R+R++ RDRDR RDRD ++ RDRER+R RDR RD ER +D
Sbjct: 84  NDDQNNSQWEREREKERDRDRERDRERDRDRDRDRDRDRDRDRERDRERDRERDRERDRD 143

Query: 104 RGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R RD ++ +DRERDRD  KE+ +DR +  + R +
Sbjct: 144 RERDRDRERDRERDRDRYKEKIKDRGYMEKKRSK 177

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 41/137 (29%), Positives = 76/137 (55%), Gaps = 3/137 (2%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           R ++   +G+++  N+S  +     + D    +     RD DR+  + R++DRE  RER+
Sbjct: 74  RDDENMDKGKNDDQNNSQWEREREKERDRDRERDRERDRDRDRDRDRDRDRDRERDRERD 133

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG---ERSKDRGRDGEKSKDRERDRDG 54
           R+R++ RDRDR RDRD E+ R+R+R+R +++++D    E+ + +G   ++        D 
Sbjct: 134 RERDRERDRDRERDRDRERDRERDRDRYKEKIKDRGYMEKKRSKGYRSKRRSSSVSSDDS 193

Query: 53  EKERDRDRDHHHRDRHR 3
           +    R R+   R+R R
Sbjct: 194 DLPPRRYREFKSRNRRR 210

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 41/138 (29%), Positives = 70/138 (50%), Gaps = 1/138 (0%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           ++   ++ + + ++N   +   +     D +    +     RD DR+  + RE+DRE  R
Sbjct: 75  DDENMDKGKNDDQNNSQWEREREKERDRDRERDRERDRDRDRDRDRDRDRDRERDRERDR 134

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDR-VRDGERSKDRGRDGEKSKDRERDRD 57
           ER+R+R++ R+RDR R+RD E+ RDR +E+ +DR   + +RSK        S     D D
Sbjct: 135 ERDRERDRDRERDRDRERDRERDRDRYKEKIKDRGYMEKKRSKGYRSKRRSSSVSSDDSD 194

Query: 56  GEKERDRDRDHHHRDRHR 3
               R R+    +R R R
Sbjct: 195 LPPRRYREFKSRNRRRRR 212

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 46/161 (28%), Positives = 66/161 (40%), Gaps = 23/161 (14%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
           ++E ER  E+      D   + D         D D    +     RD +R+  + R++DR
Sbjct: 91  QWEREREKERDRDRERDRERDRDRDRDRDRDRDRDRERDRERDRERDRERDRDRERDRDR 150

Query: 245 ENGRERERKREKGRDRDR---------------------SRDRDSEKSRDRE-RERSRDR 132
           E  RER+R R K + +DR                     S D D    R RE + R+R R
Sbjct: 151 ERDRERDRDRYKEKIKDRGYMEKKRSKGYRSKRRSSSVSSDDSDLPPRRYREFKSRNRRR 210

Query: 131 VRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
            R    S+        S+   RDR+ E+ R RDRD + R R
Sbjct: 211 RRSVSSSRSSSEVSSSSEYERRDRNYERGRGRDRDRYKRSR 251

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 40/114 (35%), Positives = 60/114 (52%), Gaps = 7/114 (6%)
 Frame = -2

Query: 323 DLTDSKSNHVSRDNDRESSKSRE--KDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D    + N+   DNDR      E  +DR+   ER R+RE    RDR RD      R R  
Sbjct: 11  DTDRHRGNYEWEDNDRRRVADNEGRRDRDFDSERGRRREHYGGRDRRRD-----FRRRSV 65

Query: 149 ERSRDRVRDGERSKDRGRDGEKS-----KDRERDRDGEKERDRDRDHHHRDRHR 3
           E SR      + + D+G++ +++     ++RE++RD ++ERDR+RD   RDR R
Sbjct: 66  ENSRGGRHRDDENMDKGKNDDQNNSQWEREREKERDRDRERDRERD-RDRDRDR 118

[69][TOP]
>UniRef100_Q8IE99 Splicing factor, putative n=1 Tax=Plasmodium falciparum 3D7
           RepID=Q8IE99_PLAF7
          Length = 864

 Score =  104 bits (260), Expect = 3e-21
 Identities = 50/125 (40%), Positives = 81/125 (64%)
 Frame = -2

Query: 377 EDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR 198
           E N   D+  +  + + E+   SK + + R   R+  + R++DR+  R+R+R R++ RDR
Sbjct: 335 ESNSSTDNDKRGTSRSSEEKVYSKYDKMKR---RDRERERDRDRDRDRDRDRDRDRDRDR 391

Query: 197 DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHH 18
           DR RDRD E+ +D++R+R  DR RD ER + R R+ E+ KDRER+R+ E+E++R R  + 
Sbjct: 392 DRDRDRDREREKDKDRDRDHDRYRDRERDRYRDRERERRKDREREREREREKERIRRENE 451

Query: 17  RDRHR 3
           R+R R
Sbjct: 452 RERLR 456

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 58/168 (34%), Positives = 84/168 (50%), Gaps = 30/168 (17%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDN-----------YHNDSSPQPPAAADEDLTDSKSNH--------- 297
           EEER   + +    DN           Y + SS    A+ +   +D + +H         
Sbjct: 265 EEERTKSRKKKHKNDNSDKKNENRVVDYSSSSSSSSDASNEYSSSDEERDHKKRKIRKTN 324

Query: 296 ----VSRDNDRESSKSREKDRENGRERERK------REKGRDRDRSRDRDSEKSRDRERE 147
               +SR +   +S +    R   R  E K      + K RDR+R RDRD ++ RDR+R+
Sbjct: 325 RSRRISRSSSESNSSTDNDKRGTSRSSEEKVYSKYDKMKRRDRERERDRDRDRDRDRDRD 384

Query: 146 RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R RDR RD    +DR RD E+ KD++RDRD ++ RDR+RD  +RDR R
Sbjct: 385 RDRDRDRD----RDRDRDREREKDKDRDRDHDRYRDRERD-RYRDRER 427

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 48/140 (34%), Positives = 76/140 (54%), Gaps = 5/140 (3%)
 Frame = -2

Query: 407 RRYEQPEGEGEDNYHNDS-----SPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           RR  +   E   +  ND      S +    +  D    +     RD DR+  + R++DR+
Sbjct: 327 RRISRSSSESNSSTDNDKRGTSRSSEEKVYSKYDKMKRRDRERERDRDRDRDRDRDRDRD 386

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R R++ R+R++ +DRD +  R R+RER R R R+ ER KDR R+ E+ +++ER 
Sbjct: 387 RDRDRDRDRDRDREREKDKDRDRDHDRYRDRERDRYRDRERERRKDREREREREREKERI 446

Query: 62  RDGEKERDRDRDHHHRDRHR 3
           R  E ER+R R     +R R
Sbjct: 447 R-RENERERLRKERELERER 465

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/98 (41%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RD DR+  + R++DR+  R+R+R+REK +DRDR  DR  ++ RDR R+R R+R +D ER 
Sbjct: 377 RDRDRDRDRDRDRDRDRDRDRDREREKDKDRDRDHDRYRDRERDRYRDRERERRKDRERE 436

Query: 110 KDRGRDGEK-SKDRERDR-DGEKERDRDRDHHHRDRHR 3
           ++R R+ E+  ++ ER+R   E+E +R+R    R+  R
Sbjct: 437 REREREKERIRRENERERLRKERELERERREKIREERR 474

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 36/100 (36%), Positives = 59/100 (59%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D    +     RD DR+  + RE++++  R+R+  R + R+RDR RDR+ E+ +DRER
Sbjct: 376 DRDRDRDRDRDRDRDRDRDRDRDREREKDKDRDRDHDRYRDRERDRYRDRERERRKDRER 435

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           ER R+R ++  R ++      K ++ ER+R  EK R+  R
Sbjct: 436 EREREREKERIRRENERERLRKERELERER-REKIREERR 474

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 51/165 (30%), Positives = 79/165 (47%), Gaps = 29/165 (17%)
 Frame = -2

Query: 410 ERRYEQPEGEGEDNYHNDSSPQPPAAADE-----DLTDSKSNHVSRDNDRESSKSREKDR 246
           ++RY     E + N  N SS +    + +     D +D K+ +   D    SS S +   
Sbjct: 245 KKRYHTSSDENDRNNDNTSSEEERTKSRKKKHKNDNSDKKNENRVVDYSSSSSSSSDASN 304

Query: 245 E---NGRERERKREKGRDRDRSR-----DRDSEKSRDRERE----RSRDRV--------- 129
           E   +  ER+ K+ K R  +RSR       +S  S D ++      S ++V         
Sbjct: 305 EYSSSDEERDHKKRKIRKTNRSRRISRSSSESNSSTDNDKRGTSRSSEEKVYSKYDKMKR 364

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHH---RDRHR 3
           RD ER +DR RD ++ +DR+RDRD +++RDRDRD      +DR R
Sbjct: 365 RDRERERDRDRDRDRDRDRDRDRDRDRDRDRDRDREREKDKDRDR 409

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 38/104 (36%), Positives = 60/104 (57%), Gaps = 5/104 (4%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D    +     RD +RE  K R++D +  R+RER R + R+R+R +DR+ E+ R+RE+
Sbjct: 384 DRDRDRDRDRDRDRDREREKDKDRDRDHDRYRDRERDRYRDRERERRKDREREREREREK 443

Query: 149 ER-----SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRD 33
           ER      R+R+R  ER  +R R  EK ++  R ++  +E  RD
Sbjct: 444 ERIRRENERERLRK-ERELERER-REKIREERRLKEEMEEAKRD 485

[70][TOP]
>UniRef100_UPI0000E80629 PREDICTED: hypothetical protein n=1 Tax=Gallus gallus
           RepID=UPI0000E80629
          Length = 835

 Score =  104 bits (259), Expect = 3e-21
 Identities = 47/92 (51%), Positives = 70/92 (76%)
 Frame = -2

Query: 278 RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
           RE  + RE++RE  +E+ER+RE+ RDRDR R +D ++ R+R+R+R RDR R  +R+KDR 
Sbjct: 323 REREREREREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDRS 382

Query: 98  RDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 383 RSREKSRDRERERERERERERERE-RERERER 413

 Score =  102 bits (255), Expect = 1e-20
 Identities = 46/96 (47%), Positives = 72/96 (75%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  + REK++E  RERER R++ R +DR RDR+ ++ RDR+RERS DR +D  RS
Sbjct: 325 REREREREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDRSRS 384

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +++ RD E+ ++RER+R+ E+ER+R+R+   R+R R
Sbjct: 385 REKSRDRERERERERERERERERERERE---RERER 417

 Score =  100 bits (250), Expect = 4e-20
 Identities = 49/139 (35%), Positives = 79/139 (56%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E               + +    +     ++ +RE  + R++DR 
Sbjct: 304 EIEKERRERERERERERERRE---------REREREREREREKEKERERERERDRDRDRT 354

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R+R++ RDRDR R  D  K R R RE+SRDR R+ ER ++R R+ E+ ++RER+
Sbjct: 355 KDRDRDRERDRDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERE 414

Query: 62  RDGEKERDRDRDHHHRDRH 6
           R+ EK++ RDR+    D +
Sbjct: 415 REREKDKKRDREEDEEDAY 433

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/97 (46%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR R  +R
Sbjct: 298 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKDR 357

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR RD ++ +DRER  D  K+R R R+   RDR R
Sbjct: 358 DRDRERDRDRDRDRERSSDRNKDRSRSRE-KSRDRER 393

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 47/138 (34%), Positives = 74/138 (53%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     R+ DR+  + RE+ 
Sbjct: 315 ERERERERREREREREREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERS 374

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            +  ++R R REK RDR+R R+R+ E+ R+RERER R+R R+ E+ K R R+ ++    E
Sbjct: 375 SDRNKDRSRSREKSRDREREREREREREREREREREREREREREKDKKRDREEDEEDAYE 434

Query: 68  RDRDGEKERDRDRDHHHR 15
           R +   K R+++  +  R
Sbjct: 435 RRKLERKLREKEAAYQER 452

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 45/101 (44%), Positives = 67/101 (66%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRV----R 126
           ++      + RE++RE  RERER+ RE+ R+R+R R+++ E+ R+RER+R RDR     R
Sbjct: 300 KERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKDRDR 359

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ER +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 360 DRERDRDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 399

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 43/115 (37%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK-SRDRE 153
           +ED  D  S  +S+  D       EK ++    +E ++E+ R+R+R R+R+ E+  R+RE
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKER-RERERERERERERRERERE 328

Query: 152 RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           RER R+R ++ ER ++R RD ++ + ++RDRD E++RDRDRD       ++DR R
Sbjct: 329 REREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDRSR 383

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 40/135 (29%), Positives = 75/135 (55%), Gaps = 1/135 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E +R  ++ +    D   + D       ++D +   S+S   SRD +RE  + RE+
Sbjct: 342 ERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDRSRSREKSRDRERERERERER 401

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           +RE  RERER+RE+ R++D+ RDR+ ++    ER +   ++R+ E +        + ++R
Sbjct: 402 EREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRER 461

Query: 71  ERDRDGEKERDRDRD 27
           ++ R+ EKE +R+ +
Sbjct: 462 KKSREYEKEAEREEE 476

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 38/107 (35%), Positives = 64/107 (59%), Gaps = 1/107 (0%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 259 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 318

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R+R R+ ER ++R R+ EK K+RER+R+ +++RDR +D   RDR R
Sbjct: 319 ERER-REREREREREREREKEKERERERERDRDRDRTKD-RDRDRER 363

[71][TOP]
>UniRef100_UPI0000ECB9CD Probable RNA-binding protein 25 (RNA-binding motif protein 25)
           (RNA- binding region-containing protein 7) (Protein
           S164). n=1 Tax=Gallus gallus RepID=UPI0000ECB9CD
          Length = 782

 Score =  104 bits (259), Expect = 3e-21
 Identities = 47/92 (51%), Positives = 70/92 (76%)
 Frame = -2

Query: 278 RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
           RE  + RE++RE  +E+ER+RE+ RDRDR R +D ++ R+R+R+R RDR R  +R+KDR 
Sbjct: 270 REREREREREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDRS 329

Query: 98  RDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 330 RSREKSRDRERERERERERERERE-RERERER 360

 Score =  102 bits (255), Expect = 1e-20
 Identities = 46/96 (47%), Positives = 72/96 (75%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  + REK++E  RERER R++ R +DR RDR+ ++ RDR+RERS DR +D  RS
Sbjct: 272 REREREREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDRSRS 331

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +++ RD E+ ++RER+R+ E+ER+R+R+   R+R R
Sbjct: 332 REKSRDRERERERERERERERERERERE---RERER 364

 Score =  100 bits (250), Expect = 4e-20
 Identities = 49/139 (35%), Positives = 79/139 (56%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E               + +    +     ++ +RE  + R++DR 
Sbjct: 251 EIEKERRERERERERERERRE---------REREREREREREKEKERERERERDRDRDRT 301

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R+R++ RDRDR R  D  K R R RE+SRDR R+ ER ++R R+ E+ ++RER+
Sbjct: 302 KDRDRDRERDRDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERE 361

Query: 62  RDGEKERDRDRDHHHRDRH 6
           R+ EK++ RDR+    D +
Sbjct: 362 REREKDKKRDREEDEEDAY 380

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/97 (46%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR R  +R
Sbjct: 245 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKDR 304

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR RD ++ +DRER  D  K+R R R+   RDR R
Sbjct: 305 DRDRERDRDRDRDRERSSDRNKDRSRSRE-KSRDRER 340

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 47/138 (34%), Positives = 74/138 (53%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     R+ DR+  + RE+ 
Sbjct: 262 ERERERERREREREREREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERS 321

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            +  ++R R REK RDR+R R+R+ E+ R+RERER R+R R+ E+ K R R+ ++    E
Sbjct: 322 SDRNKDRSRSREKSRDREREREREREREREREREREREREREREKDKKRDREEDEEDAYE 381

Query: 68  RDRDGEKERDRDRDHHHR 15
           R +   K R+++  +  R
Sbjct: 382 RRKLERKLREKEAAYQER 399

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 45/101 (44%), Positives = 67/101 (66%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRV----R 126
           ++      + RE++RE  RERER+ RE+ R+R+R R+++ E+ R+RER+R RDR     R
Sbjct: 247 KERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKDRDR 306

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ER +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 307 DRERDRDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 346

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/147 (32%), Positives = 84/147 (57%), Gaps = 9/147 (6%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAA---DEDLTDSKSNHVSRDNDRESSKSREKDR 246
           E +    + + E +++Y    S +    A   +ED  D  S  +S+  D       EK +
Sbjct: 185 ESDSHPRKKKKEKKEDYETSLSIEEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGK 244

Query: 245 ENGRERERKREKGRDRDRSRDRDSEK-SRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           +    +E ++E+ R+R+R R+R+ E+  R+RERER R+R ++ ER ++R RD ++ + ++
Sbjct: 245 KEKERQEIEKER-RERERERERERERREREREREREREREKEKERERERERDRDRDRTKD 303

Query: 68  RDRDGEKERDRDRDH-----HHRDRHR 3
           RDRD E++RDRDRD       ++DR R
Sbjct: 304 RDRDRERDRDRDRDRERSSDRNKDRSR 330

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 40/135 (29%), Positives = 75/135 (55%), Gaps = 1/135 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E +R  ++ +    D   + D       ++D +   S+S   SRD +RE  + RE+
Sbjct: 289 ERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDRSRSREKSRDRERERERERER 348

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           +RE  RERER+RE+ R++D+ RDR+ ++    ER +   ++R+ E +        + ++R
Sbjct: 349 EREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRER 408

Query: 71  ERDRDGEKERDRDRD 27
           ++ R+ EKE +R+ +
Sbjct: 409 KKSREYEKEAEREEE 423

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 40/142 (28%), Positives = 71/142 (50%), Gaps = 4/142 (2%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           EE +R +Q      D    + S +  A + E  +  +     +  D E+S S E+D  N 
Sbjct: 155 EETKRRDQIIKGAIDVLIREYSSELNAPSQESDSHPRKKKKEKKEDYETSLSIEEDI-NA 213

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRER---ERSRDRVRDGERSKDRGRDGEKSKDRER 66
            E E  +     R+ S+ RD+ K  + E+   E+ R  +    R ++R R+ E+ + RER
Sbjct: 214 IEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERER-RER 272

Query: 65  DRDGEKERDRDRD-HHHRDRHR 3
           +R+ E+ER+R+++    R+R R
Sbjct: 273 EREREREREREKEKERERERER 294

[72][TOP]
>UniRef100_UPI0000F2BEEE PREDICTED: similar to mitochondrial trans-2-enoyl-CoA reductase
           isoform 1 n=1 Tax=Monodelphis domestica
           RepID=UPI0000F2BEEE
          Length = 400

 Score =  103 bits (258), Expect = 5e-21
 Identities = 51/119 (42%), Positives = 74/119 (62%)
 Frame = -2

Query: 383 EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR 204
           +GE++        PP + D    +      S    R    SR +DR + R R+R R+K R
Sbjct: 149 DGEESEGPGGGDGPPRSFDWGFEERSGPPSSASPPR----SRSRDRSHERNRDRDRDKDR 204

Query: 203 DRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           DRDR RDRD ++ RDRER+R R+R RD +R +DR RD ++ +DR+RDRD +++RDRDR+
Sbjct: 205 DRDRDRDRDKDRDRDRERDRDRERDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRE 263

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 39/89 (43%), Positives = 61/89 (68%)
 Frame = -2

Query: 356 SSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRD 177
           SS  PP +   D +  ++    RD DR+  + R++DR+  R+R+R+R++ R+RDR RDRD
Sbjct: 178 SSASPPRSRSRDRSHERNRDRDRDKDRD--RDRDRDRDKDRDRDRERDRDRERDRDRDRD 235

Query: 176 SEKSRDRERERSRDRVRDGERSKDRGRDG 90
            ++ RDR+R+R RDR RD +R +DR R+G
Sbjct: 236 RDRDRDRDRDRDRDRDRDRDRDRDRDREG 264

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 32/73 (43%), Positives = 46/73 (63%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D    +     RD D++  + RE+DR+  R+R+R R++ RDRDR RDRD ++ RDR+R
Sbjct: 197 DRDRDKDRDRDRDRDRDKDRDRDRERDRDRERDRDRDRDRDRDRDRDRDRDRDRDRDRDR 256

Query: 149 ERSRDRVRDGERS 111
           +R RDR     RS
Sbjct: 257 DRDRDREGPFRRS 269

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 38/98 (38%), Positives = 52/98 (53%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           EER           +   D S +     D D    +     RD DR+  + R++DRE  R
Sbjct: 171 EERSGPPSSASPPRSRSRDRSHERNRDRDRDKDRDRDRDRDRDKDRDRDRERDRDRERDR 230

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG 120
           +R+R R++ RDRDR RDRD    RDR+R+R RDR R+G
Sbjct: 231 DRDRDRDRDRDRDRDRDRD----RDRDRDRDRDRDREG 264

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 40/118 (33%), Positives = 57/118 (48%), Gaps = 3/118 (2%)
 Frame = -2

Query: 347 QPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRD--RSRDRDS 174
           Q   +AD+DL +S      +        S ++ RE G + E     G      RS D   
Sbjct: 111 QRSISADDDLQESSRRPQRKSLYESFVSSSDRLRELGPDGEESEGPGGGDGPPRSFDWGF 170

Query: 173 EKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHH-RDRHR 3
           E+        S  R R  +RS +R RD ++ KDR+RDRD ++++DRDRD    RDR R
Sbjct: 171 EERSGPPSSASPPRSRSRDRSHERNRDRDRDKDRDRDRDRDRDKDRDRDRERDRDRER 228

[73][TOP]
>UniRef100_Q8L716 Splicing factor U2af large subunit B n=1 Tax=Arabidopsis thaliana
           RepID=U2A2B_ARATH
          Length = 589

 Score =  103 bits (258), Expect = 5e-21
 Identities = 60/107 (56%), Positives = 70/107 (65%), Gaps = 3/107 (2%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD 135
           DSKS   S D  ++SSK  EKD ENGR+    ++  +DRDR +DRD EKSRDR+RE+SRD
Sbjct: 33  DSKSRE-SHDLKKDSSKISEKDNENGRD----KDGNKDRDREKDRDREKSRDRDREKSRD 87

Query: 134 RVRDGERSKDRGRDGEKSKDRERDRD---GEKERDRDRDHHHRDRHR 3
           R RD ERSKDR RD    +DR RDR     EK  D D DHH R R R
Sbjct: 88  RDRDRERSKDRQRD-RHHRDRHRDRSRERSEKRDDLDDDHHRRSRDR 133

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 53/125 (42%), Positives = 69/125 (55%), Gaps = 3/125 (2%)
 Frame = -2

Query: 368 YHNDSSPQPPAAADEDLT--DSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRD 195
           +H DS  +      +D +    K N   RD D    + REKDR+  + R+R REK RDRD
Sbjct: 30  FHEDSKSRESHDLKKDSSKISEKDNENGRDKDGNKDRDREKDRDREKSRDRDREKSRDRD 89

Query: 194 RSRDRDSEKSRDR-ERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHH 18
           R R+R  ++ RDR  R+R RDR R  ERS+ R    +    R RDRD  + RDRDR+  H
Sbjct: 90  RDRERSKDRQRDRHHRDRHRDRSR--ERSEKRDDLDDDHHRRSRDRDRRRSRDRDREVRH 147

Query: 17  RDRHR 3
           R R R
Sbjct: 148 RRRSR 152

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 42/122 (34%), Positives = 63/122 (51%), Gaps = 2/122 (1%)
 Frame = -2

Query: 362 NDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKRE-KGRDRDRSR 186
           N++        D D    +    SRD DRE S+ R++DRE  ++R+R R  + R RDRSR
Sbjct: 54  NENGRDKDGNKDRDREKDRDREKSRDRDREKSRDRDRDRERSKDRQRDRHHRDRHRDRSR 113

Query: 185 DRDSEKSRDRERERSRDRVRDGERSKDRGRD-GEKSKDRERDRDGEKERDRDRDHHHRDR 9
           +R  ++    +    R R RD  RS+DR R+   + + R R R   + R R  +H H+  
Sbjct: 114 ERSEKRDDLDDDHHRRSRDRDRRRSRDRDREVRHRRRSRSRSRSRSERRSRS-EHRHKSE 172

Query: 8   HR 3
           HR
Sbjct: 173 HR 174

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 43/136 (31%), Positives = 60/136 (44%), Gaps = 16/136 (11%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE-----NGRERE 225
           E + E+    D +       D D   S+     +  DR+  + R KDR+       R R+
Sbjct: 51  EKDNENGRDKDGNKDRDREKDRDREKSRDRDREKSRDRDRDRERSKDRQRDRHHRDRHRD 110

Query: 224 RKREKGRDRD--------RSRDRDSEKSRDRERE---RSRDRVRDGERSKDRGRDGEKSK 78
           R RE+   RD        RSRDRD  +SRDR+RE   R R R R   RS+ R R   + K
Sbjct: 111 RSRERSEKRDDLDDDHHRRSRDRDRRRSRDRDREVRHRRRSRSRSRSRSERRSRSEHRHK 170

Query: 77  DRERDRDGEKERDRDR 30
              R R   + R + +
Sbjct: 171 SEHRSRSRSRSRSKSK 186

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 33/109 (30%), Positives = 47/109 (43%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           + +R  E+ +    D +H D          E   D   +H  R  DR+  +SR++DRE  
Sbjct: 87  DRDRDRERSKDRQRDRHHRDRHRDRSRERSEKRDDLDDDHHRRSRDRDRRRSRDRDRE-- 144

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG 90
               R R + R R RSR     +S  R +   R R R   RSK + R G
Sbjct: 145 ---VRHRRRSRSRSRSRSERRSRSEHRHKSEHRSRSRSRSRSKSKRRSG 190

[74][TOP]
>UniRef100_UPI000186DF31 conserved hypothetical protein n=1 Tax=Pediculus humanus corporis
           RepID=UPI000186DF31
          Length = 470

 Score =  103 bits (257), Expect = 6e-21
 Identities = 55/128 (42%), Positives = 78/128 (60%)
 Frame = -2

Query: 386 GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKG 207
           GE +D   N  +  P      DLTD      +   DR+  K R++DR+  R+R+R R+K 
Sbjct: 322 GEDQDPVQNGLALVPKEDLVRDLTDPVLGLKAHPLDRD--KERDRDRDRDRDRDRDRDKD 379

Query: 206 RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           RDR+R RDRD EK RDR+R+R RDR RD +R K      EK +DR+RD+D EKER++D++
Sbjct: 380 RDRERDRDRDKEKDRDRDRDRDRDRDRDRDREK------EKERDRDRDKDREKEREKDKE 433

Query: 26  HHHRDRHR 3
              + + R
Sbjct: 434 KRTKIKER 441

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 29/96 (30%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRE- 153
           D D    +     RD +++  + R++DR+  R+R+R++EK RDRDR +DR+ E+ +D+E 
Sbjct: 375 DRDKDRDRERDRDRDKEKDRDRDRDRDRDRDRDRDREKEKERDRDRDKDREKEREKDKEK 434

Query: 152 RERSRDRVRDGERSKDRGRDGE-KSKDRERDRDGEK 48
           R + ++R+++ E  ++   + E + +  + D+  EK
Sbjct: 435 RTKIKERIKEEEEKEEADLEQETEPEPMDEDKMDEK 470

[75][TOP]
>UniRef100_UPI0000DA3509 PREDICTED: similar to RNA binding motif protein 25 n=1 Tax=Rattus
           norvegicus RepID=UPI0000DA3509
          Length = 816

 Score =  103 bits (257), Expect = 6e-21
 Identities = 44/88 (50%), Positives = 68/88 (77%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  + RE+++E  RERER+R++ RDR + RDRD E+ RDR+RERS DR +D  RS
Sbjct: 322 REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSRS 381

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRD 27
           +++ RD E+ ++RER+R+ +K+RDR+ D
Sbjct: 382 REKSRDREREREREREREKDKKRDREED 409

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 51/102 (50%), Positives = 68/102 (66%), Gaps = 12/102 (11%)
 Frame = -2

Query: 278 RESSKSREKDRENGRERERK------------REKGRDRDRSRDRDSEKSRDRERERSRD 135
           RE  + RE++RE  RERER+            RE+ R+RDR RDR  E+ RDRER+R RD
Sbjct: 309 RERERERERERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRD 367

Query: 134 RVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           R R  +R+KDR R  EKS+DRER+R+ E+ER++D+    RDR
Sbjct: 368 RERSSDRNKDRSRSREKSRDREREREREREREKDK---KRDR 406

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 47/131 (35%), Positives = 74/131 (56%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E                      +     R+ +RE  K RE++RE
Sbjct: 303 EIEKERRERERERERERERRE-----------------REREREREREREKEKERERERE 345

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R +E+ RDR+R RDRD E+S DR ++RSR R +  +R ++R R+ E+ KD++RD
Sbjct: 346 RDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSRSREKSRDREREREREREREKDKKRD 405

Query: 62  RDGEKERDRDR 30
           R+ ++E   +R
Sbjct: 406 REEDEEDAYER 416

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 46/101 (45%), Positives = 68/101 (67%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDR----VR 126
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR     R
Sbjct: 297 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 356

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +R +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 357 DRDRERDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 396

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 46/115 (40%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDND-----RESSKSREKDRENGRERERKREKGRDRDRSR-DRDSEK 168
           +ED  D  S  +S+  D      E    +EK+R+   +  R+RE+ R+R+R R +R+ E+
Sbjct: 269 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 328

Query: 167 SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R+RERE+ ++R R+ ER +DR R  E+ +DRERDRD ++ER  DR   ++DR R
Sbjct: 329 EREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDR---NKDRSR 380

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 44/146 (30%), Positives = 72/146 (49%), Gaps = 12/146 (8%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     RD +R+  + RE+ 
Sbjct: 314 ERERERERREREREREREREREKEKERERERERDRDRDRTKER--DRDRERDRDRDRERS 371

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS---- 81
            +  ++R R REK RDR+R R+R+ E+ +D++R+R  D     ER K   +  EK     
Sbjct: 372 SDRNKDRSRSREKSRDREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQ 431

Query: 80  --------KDRERDRDGEKERDRDRD 27
                   ++R++ R+ EKE +R+ +
Sbjct: 432 ERLKNWEIRERKKTREYEKEAEREEE 457

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 43/114 (37%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 258 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 317

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDH-HHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDR+    RDR R
Sbjct: 318 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRER 370

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/134 (30%), Positives = 67/134 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+ER  E+      D        +     D D    +S+  ++D  R   KSR+++
Sbjct: 333 EREKEKERERERERDRDRDRTKERDRDRE---RDRDRDRERSSDRNKDRSRSREKSRDRE 389

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           RE  RERER+++K RDR+   + D+ + R  ER+         ER K+     E+ K RE
Sbjct: 390 REREREREREKDKKRDREED-EEDAYERRKLERKLREKEAAYQERLKN-WEIRERKKTRE 447

Query: 68  RDRDGEKERDRDRD 27
            +++ E+E +R R+
Sbjct: 448 YEKEAEREEERRRE 461

[76][TOP]
>UniRef100_UPI0000DA3329 PREDICTED: similar to RNA binding motif protein 25 n=1 Tax=Rattus
           norvegicus RepID=UPI0000DA3329
          Length = 676

 Score =  103 bits (257), Expect = 6e-21
 Identities = 44/88 (50%), Positives = 68/88 (77%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  + RE+++E  RERER+R++ RDR + RDRD E+ RDR+RERS DR +D  RS
Sbjct: 322 REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSRS 381

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRD 27
           +++ RD E+ ++RER+R+ +K+RDR+ D
Sbjct: 382 REKSRDREREREREREREKDKKRDREED 409

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 51/102 (50%), Positives = 68/102 (66%), Gaps = 12/102 (11%)
 Frame = -2

Query: 278 RESSKSREKDRENGRERERK------------REKGRDRDRSRDRDSEKSRDRERERSRD 135
           RE  + RE++RE  RERER+            RE+ R+RDR RDR  E+ RDRER+R RD
Sbjct: 309 RERERERERERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRD 367

Query: 134 RVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           R R  +R+KDR R  EKS+DRER+R+ E+ER++D+    RDR
Sbjct: 368 RERSSDRNKDRSRSREKSRDREREREREREREKDK---KRDR 406

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 47/131 (35%), Positives = 74/131 (56%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E                      +     R+ +RE  K RE++RE
Sbjct: 303 EIEKERRERERERERERERRE-----------------REREREREREREKEKERERERE 345

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R +E+ RDR+R RDRD E+S DR ++RSR R +  +R ++R R+ E+ KD++RD
Sbjct: 346 RDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSRSREKSRDREREREREREREKDKKRD 405

Query: 62  RDGEKERDRDR 30
           R+ ++E   +R
Sbjct: 406 REEDEEDAYER 416

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 46/101 (45%), Positives = 68/101 (67%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDR----VR 126
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR     R
Sbjct: 297 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 356

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +R +DR RD E+S DR +DR   +E+ RDR+   R+R R
Sbjct: 357 DRDRERDRDRDRERSSDRNKDRSRSREKSRDRE-RERERER 396

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 46/115 (40%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDND-----RESSKSREKDRENGRERERKREKGRDRDRSR-DRDSEK 168
           +ED  D  S  +S+  D      E    +EK+R+   +  R+RE+ R+R+R R +R+ E+
Sbjct: 269 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 328

Query: 167 SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R+RERE+ ++R R+ ER +DR R  E+ +DRERDRD ++ER  DR   ++DR R
Sbjct: 329 EREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDR---NKDRSR 380

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 44/146 (30%), Positives = 72/146 (49%), Gaps = 12/146 (8%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     RD +R+  + RE+ 
Sbjct: 314 ERERERERREREREREREREREKEKERERERERDRDRDRTKER--DRDRERDRDRDRERS 371

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS---- 81
            +  ++R R REK RDR+R R+R+ E+ +D++R+R  D     ER K   +  EK     
Sbjct: 372 SDRNKDRSRSREKSRDREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQ 431

Query: 80  --------KDRERDRDGEKERDRDRD 27
                   ++R++ R+ EKE +R+ +
Sbjct: 432 ERLKNWEIRERKKTREYEKEAEREEE 457

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 43/114 (37%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 258 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 317

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDH-HHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDR+    RDR R
Sbjct: 318 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRER 370

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/134 (30%), Positives = 67/134 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+ER  E+      D        +     D D    +S+  ++D  R   KSR+++
Sbjct: 333 EREKEKERERERERDRDRDRTKERDRDRE---RDRDRDRERSSDRNKDRSRSREKSRDRE 389

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           RE  RERER+++K RDR+   + D+ + R  ER+         ER K+     E+ K RE
Sbjct: 390 REREREREREKDKKRDREED-EEDAYERRKLERKLREKEAAYQERLKN-WEIRERKKTRE 447

Query: 68  RDRDGEKERDRDRD 27
            +++ E+E +R R+
Sbjct: 448 YEKEAEREEERRRE 461

[77][TOP]
>UniRef100_UPI000179E4C3 LOC540258 protein n=1 Tax=Bos taurus RepID=UPI000179E4C3
          Length = 826

 Score =  102 bits (255), Expect = 1e-20
 Identities = 47/96 (48%), Positives = 72/96 (75%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  + REK++E  RERER R++ R ++R RDRD E+ RDR+RERS DR +D  RS
Sbjct: 316 REREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRS 375

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ++R R+ E+ ++RER+R+ E+ER+R+R+   R+R R
Sbjct: 376 RERERERERERERERERERERERERERE---RERER 408

 Score =  101 bits (251), Expect = 3e-20
 Identities = 45/92 (48%), Positives = 69/92 (75%)
 Frame = -2

Query: 278 RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
           RE  + RE++RE  +E+ER+RE+ RDRDR R ++ ++ RDRER+R RDR R  +R+KDR 
Sbjct: 314 REREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRS 373

Query: 98  RDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R  E+ ++RER+R+ E+ER+R+R+   R+R R
Sbjct: 374 RSRERERERERERERERERERERE-RERERER 404

 Score =  100 bits (249), Expect = 5e-20
 Identities = 48/132 (36%), Positives = 81/132 (61%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E               + +    +     R+ +RE  + R++ +E
Sbjct: 295 EIEKERRERERERERERERRERER-------EREREREREKEKERERERERDRDRDRTKE 347

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+R+R+R++ RDR+RS DR+ ++SR RERER R+R R+ ER ++R R+ E+ ++RER+
Sbjct: 348 RDRDRDRERDRDRDRERSSDRNKDRSRSRERERERERERERERERERERERERERERERE 407

Query: 62  RDGEKERDRDRD 27
           R+ +K+RDR+ D
Sbjct: 408 REKDKKRDREED 419

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 50/101 (49%), Positives = 70/101 (69%), Gaps = 9/101 (8%)
 Frame = -2

Query: 278 RESSKSREKDRENG-RERERKR--------EKGRDRDRSRDRDSEKSRDRERERSRDRVR 126
           RE  + RE++RE   RERER+R        E+ R+R+R RDRD  K RDR+R+R RDR R
Sbjct: 301 RERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDR 360

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ERS DR +D  +S++RER+R+ E+ER+R+R+   R+R R
Sbjct: 361 DRERSSDRNKDRSRSRERERERERERERERERE-RERERER 400

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 44/97 (45%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR R  ER
Sbjct: 289 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 348

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR R+ ++ +DRER  D  K+R R R+   R+R R
Sbjct: 349 DRDRDRERDRDRDRERSSDRNKDRSRSRE-RERERER 384

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 47/140 (33%), Positives = 80/140 (57%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D   +K     RD DRE  + R+++
Sbjct: 306 ERERERERREREREREREREREKEKERERERERDRDRDRTKER--DRDRDRERDRDRDRE 363

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R + R ++R R + R+R+R R+R+ E+ R+RERER R+R R+ ER KD+ RD E+ ++  
Sbjct: 364 RSSDRNKDRSRSREREREREREREREREREREREREREREREREREKDKKRDREEDEEDA 423

Query: 68  RDRDGEKERDRDRDHHHRDR 9
            +R   + + R+++  +++R
Sbjct: 424 YERRKLERKLREKEAAYQER 443

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 44/101 (43%), Positives = 68/101 (67%), Gaps = 5/101 (4%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRV----R 126
           ++      + RE++RE  RERER+ RE+ R+R+R R+++ E+ R+RER+R RDR     R
Sbjct: 291 KERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDR 350

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +R +DR RD E+S DR +DR   +ER+R+R+   R+R R
Sbjct: 351 DRDRERDRDRDRERSSDRNKDRSRSRERERERE-RERERER 390

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 47/148 (31%), Positives = 84/148 (56%), Gaps = 6/148 (4%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E +    ++ ++ + +GE + +           +ED  D  S  +S+  D       EK 
Sbjct: 228 ESDSHPRKKKKEKKEDGESSVNILEEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKG 287

Query: 248 RENGRERERKREKGRDRDRSRDRDSEK-SRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           ++    +E ++E+ R+R+R R+R+ E+  R+RERER R+R ++ ER ++R RD ++ + +
Sbjct: 288 KKEKERQEIEKER-RERERERERERERREREREREREREREKEKERERERERDRDRDRTK 346

Query: 71  ERDRDGEKERDRDRDH-----HHRDRHR 3
           ERDRD ++ERDRDRD       ++DR R
Sbjct: 347 ERDRDRDRERDRDRDRERSSDRNKDRSR 374

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 40/137 (29%), Positives = 74/137 (54%), Gaps = 3/137 (2%)
 Frame = -2

Query: 428 EYEFEEER---RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           E E E ER   R    E + + +   D       ++D +   S+S    R+ +RE  + R
Sbjct: 331 ERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSRERERERERERERER 390

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           E++RE  RERER+RE+ R++D+ RDR+ ++    ER +   ++R+ E +        + +
Sbjct: 391 EREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIR 450

Query: 77  DRERDRDGEKERDRDRD 27
           +R++ R+ EKE +R+ +
Sbjct: 451 ERKKTREYEKEAEREEE 467

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 27/89 (30%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE- 117
           R+ +RE  + RE++RE  RE+++KR++  D + + +R   + + RE+E + ++R+++ E 
Sbjct: 390 REREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEI 449

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           R + + R+ EK  +RE +R  E  ++  R
Sbjct: 450 RERKKTREYEKEAEREEERRREMAKEAKR 478

[78][TOP]
>UniRef100_UPI0000E469DC PREDICTED: similar to CG7564-PA n=1 Tax=Strongylocentrotus
           purpuratus RepID=UPI0000E469DC
          Length = 472

 Score =  102 bits (253), Expect = 2e-20
 Identities = 58/163 (35%), Positives = 85/163 (52%), Gaps = 25/163 (15%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E++R   + E E +D     SS     ++  D  D       R+ DR+  + R++DR+  
Sbjct: 214 EQQREQRRMERERDDEEEPKSS-----SSYRDRRDRGDRDKEREKDRDKERDRDRDRDRD 268

Query: 236 RERERKREKGRDRDRSRDRDSEK---SRDRERERSRDRVRDGERSKDRGRDGE------- 87
           R+R+R R++ RDRDR RDRD E+   SR+R+R+R+RDR RD +R +DR RD E       
Sbjct: 269 RDRDRDRDRDRDRDRDRDRDRERESSSRNRDRDRNRDRDRDQDRDRDRDRDRERDRRRSR 328

Query: 86  ---------------KSKDRERDRDGEKERDRDRDHHHRDRHR 3
                          K + ++RDR   + RD DRD  HR R R
Sbjct: 329 SKSRSNRHRRSRSRDKKRSKDRDRKSNRSRDPDRDRRHRSRSR 371

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 56/155 (36%), Positives = 77/155 (49%), Gaps = 13/155 (8%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E +    Y      G+ +   +         D D    +     RD DR+  + R++D
Sbjct: 229 EEEPKSSSSYRDRRDRGDRDKEREKDRDKERDRDRDRDRDRDRDRDRDRDRDRDRDRDRD 288

Query: 248 REN-----GRERERKREKGRDRDRSRDRDSEKSRDRERERS--------RDRVRDGERSK 108
           RE       R+R+R R++ RD+DR RDRD ++ RDR R RS        R R RD +RSK
Sbjct: 289 RERESSSRNRDRDRNRDRDRDQDRDRDRDRDRERDRRRSRSKSRSNRHRRSRSRDKKRSK 348

Query: 107 DRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           DR R   +S+D +RDR   + R RDRD H   RHR
Sbjct: 349 DRDRKSNRSRDPDRDR-RHRSRSRDRDRHCDRRHR 382

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 32/125 (25%), Positives = 54/125 (43%), Gaps = 5/125 (4%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           + ER       + + N   D         D D    +    S+       +SR +D++  
Sbjct: 288 DRERESSSRNRDRDRNRDRDRDQDRDRDRDRDRERDRRRSRSKSRSNRHRRSRSRDKKRS 347

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRE-----RERSRDRVRDGERSKDRGRDGEKSKDR 72
           ++R+RK  + RD DR R R   +SRDR+     R RSR R R    S+    +  ++K+ 
Sbjct: 348 KDRDRKSNRSRDPDRDR-RHRSRSRDRDRHCDRRHRSRSRERSSRHSRSHSHESGETKEE 406

Query: 71  ERDRD 57
            R ++
Sbjct: 407 PRVKE 411

[79][TOP]
>UniRef100_UPI000021E63C UPI000021E63C related cluster n=1 Tax=Rattus norvegicus
           RepID=UPI000021E63C
          Length = 157

 Score =  102 bits (253), Expect = 2e-20
 Identities = 53/146 (36%), Positives = 85/146 (58%), Gaps = 4/146 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQP---EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           E E E ER+ E+    E E E +   +   +     + +          R+ +RE+ + R
Sbjct: 5   ERETERERQRERERDRERETERDRERERQRETERERERERQRETERERQRERERETERDR 64

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           E+ RE  RERE +R++ R R+R R R++E+ R RE ER R+R R+ +R + R RD E+ +
Sbjct: 65  ERQRERDRERETERDRERQRERERQRETERERQRETERERERDRERDRERQRERDRERQR 124

Query: 77  DRERDRDGEKERDRDRD-HHHRDRHR 3
           +R+R+RD E++R+RDR+    RDR R
Sbjct: 125 ERQRERDRERQRERDRERQRERDRER 150

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 44/129 (34%), Positives = 77/129 (59%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E  R  + E E E     ++  +     + +    +     RD +RE+ + RE+ RE  R
Sbjct: 29  ERERQRETERERERERQRETERERQRERERETERDRERQRERDRERETERDRERQRERER 88

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           +RE +RE+ R+ +R R+RD E+ R+R+RER R+R R+ +R +DR R  E+ ++R+R+RD 
Sbjct: 89  QRETERERQRETERERERDRERDRERQRERDRERQRERQRERDRERQRERDRERQRERDR 148

Query: 53  EKERDRDRD 27
           E+E +R+ +
Sbjct: 149 ERETERETE 157

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 46/140 (32%), Positives = 78/140 (55%), Gaps = 3/140 (2%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E  R  + E + E     +   +     +      +     R  + E  + RE++RE  R
Sbjct: 3   ERERETERERQRERERDRERETERDRERERQRETERERERERQRETERERQRERERETER 62

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           +RER+RE+ R+R+  RDR+ ++ R+R+RE  R+R R+ ER ++R R+ ++ + RERDR+ 
Sbjct: 63  DRERQRERDRERETERDRERQRERERQRETERERQRETERERERDRERDRERQRERDRER 122

Query: 53  EKERDRDRD---HHHRDRHR 3
           ++ER R+RD      RDR R
Sbjct: 123 QRERQRERDRERQRERDRER 142

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 40/97 (41%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE+ + R+++RE  RERE +R++ R+R R  +R+ E+ R RE ER R R R+ E  
Sbjct: 2   RERERETERERQRERERDRERETERDRERERQRETERERERERQRETERERQRERERETE 61

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHH-HRDRHR 3
           +DR R  E+ ++RE +RD E++R+R+R     R+R R
Sbjct: 62  RDRERQRERDRERETERDRERQRERERQRETERERQR 98

[80][TOP]
>UniRef100_Q7ZX66 RNPC7 protein (Fragment) n=1 Tax=Xenopus laevis RepID=Q7ZX66_XENLA
          Length = 447

 Score =  102 bits (253), Expect = 2e-20
 Identities = 48/97 (49%), Positives = 70/97 (72%), Gaps = 3/97 (3%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  K REK++E  R+RER  E+ +DRDR RDR+ ++ RD++R+R +D ++D  RS
Sbjct: 308 REREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSRS 367

Query: 110 --KDRGRDGEKSKDRERDRDGEKERDRDRD-HHHRDR 9
             K R RD ++ +DRER+R+ E+ERDRDRD    RDR
Sbjct: 368 REKSRDRDRDRERDRERERERERERDRDRDKDKKRDR 404

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 47/144 (32%), Positives = 80/144 (55%), Gaps = 8/144 (5%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +  ++ E+ +G+ E         +     + +  + +     R+ +RE  K RE+DRE  
Sbjct: 273 DTHKKLEEEKGKKEKERQEIEKDRKDRERERE-RERREREREREKEREKEKERERDRERN 331

Query: 236 RERERKREKGRDRDRSRDRDSE--------KSRDRERERSRDRVRDGERSKDRGRDGEKS 81
            ER + R++ RDR+R RDRD +        K R R RE+SRDR RD ER ++R R+ E+ 
Sbjct: 332 SERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSRSREKSRDRDRDRERDRERERERERE 391

Query: 80  KDRERDRDGEKERDRDRDHHHRDR 9
           +DR+RD+D +++R+ D +  +  R
Sbjct: 392 RDRDRDKDKKRDREEDEEEAYERR 415

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 47/135 (34%), Positives = 76/135 (56%), Gaps = 6/135 (4%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E + ++E+  ++ E + +D        +     + +    K     RD +R S +++++D
Sbjct: 280 EEKGKKEKERQEIEKDRKDRERERERERREREREREKEREKEKERERDRERNSERNKDRD 339

Query: 248 RENGRERERKREKGRDR------DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
           R+  RER+R R+K RDR      DRSR R+  + RDR+RER R+R R+ ER +DR RD +
Sbjct: 340 RDRDRERDRDRDKDRDRVQDHIKDRSRSREKSRDRDRDRERDRERERERERERDRDRDKD 399

Query: 86  KSKDRERDRDGEKER 42
           K +DRE D +   ER
Sbjct: 400 KKRDREEDEEEAYER 414

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 43/136 (31%), Positives = 77/136 (56%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           + ER  E+   E E     +   +     D +    ++    RD DRE  + R+KDR+  
Sbjct: 298 DRERERERERREREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRD-- 355

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           R ++  +++ R R++SRDRD ++ RDRERER R+R RD +R KD+ RD E+ ++   +R 
Sbjct: 356 RVQDHIKDRSRSREKSRDRDRDRERDRERERERERERDRDRDKDKKRDREEDEEEAYERR 415

Query: 56  GEKERDRDRDHHHRDR 9
             + + R+++  +++R
Sbjct: 416 KLERKLREKEAAYQER 431

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/113 (38%), Positives = 76/113 (67%), Gaps = 6/113 (5%)
 Frame = -2

Query: 323 DLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR-DRSRDRDSEKSRDRERE 147
           ++ + K + +SR+  +     ++ + E G++ + ++E  +DR DR R+R+ E+ R+RERE
Sbjct: 255 EMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKDRKDRERERERER-RERERE 313

Query: 146 RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           R ++R ++ ER +DR R+ E++KDR+RDRD E++RDRD+D      H +DR R
Sbjct: 314 REKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSR 366

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/122 (32%), Positives = 60/122 (49%), Gaps = 2/122 (1%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E  E  R  + E E E     D         D D    +     RD DR+  +   KD
Sbjct: 304 ERERREREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRDRVQDHIKD 363

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRER--ERSRDRVRDGERSKDRGRDGEKSKD 75
           R   RE+ R R++ R+RDR R+R+ E+ RDR+R  ++ RDR  D E + +R +   K ++
Sbjct: 364 RSRSREKSRDRDRDRERDRERERERERERDRDRDKDKKRDREEDEEEAYERRKLERKLRE 423

Query: 74  RE 69
           +E
Sbjct: 424 KE 425

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 39/101 (38%), Positives = 60/101 (59%), Gaps = 1/101 (0%)
 Frame = -2

Query: 302 NHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERERSRDRVR 126
           N +  + D+    SRE  +     ++ + EKG+ +++R       K R+RERER R R R
Sbjct: 252 NAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKDRKDRERERERER-RER 310

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           + ER K+R ++ E+ +DRER+ +  K+RDRDRD   RDR R
Sbjct: 311 EREREKEREKEKERERDRERNSERNKDRDRDRD-RERDRDR 350

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 45/133 (33%), Positives = 67/133 (50%), Gaps = 5/133 (3%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLT-DSKSNHVS-RDNDRESSKSRE 255
           E E E+ER  ++ E   E N   D         D D   D   +H+  R   RE S+ R+
Sbjct: 317 EREKEKERERDR-ERNSERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSRSREKSRDRD 375

Query: 254 KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           +DRE  RERER+RE+ RDRDR +D+  ++  D E    R ++    R K+     E+ K+
Sbjct: 376 RDRERDRERERERERERDRDRDKDKKRDREEDEEEAYERRKLERKLREKEAAYQ-ERLKN 434

Query: 74  ---RERDRDGEKE 45
              RER +  +K+
Sbjct: 435 WEIRERKKTKKKK 447

[81][TOP]
>UniRef100_Q3KPK7 RNPC7 protein (Fragment) n=1 Tax=Xenopus laevis RepID=Q3KPK7_XENLA
          Length = 465

 Score =  102 bits (253), Expect = 2e-20
 Identities = 48/97 (49%), Positives = 70/97 (72%), Gaps = 3/97 (3%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  K REK++E  R+RER  E+ +DRDR RDR+ ++ RD++R+R +D ++D  RS
Sbjct: 308 REREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSRS 367

Query: 110 --KDRGRDGEKSKDRERDRDGEKERDRDRD-HHHRDR 9
             K R RD ++ +DRER+R+ E+ERDRDRD    RDR
Sbjct: 368 REKSRDRDRDRERDRERERERERERDRDRDKDKKRDR 404

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 47/144 (32%), Positives = 80/144 (55%), Gaps = 8/144 (5%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +  ++ E+ +G+ E         +     + +  + +     R+ +RE  K RE+DRE  
Sbjct: 273 DTHKKLEEEKGKKEKERQEIEKDRKDRERERE-RERREREREREKEREKEKERERDRERN 331

Query: 236 RERERKREKGRDRDRSRDRDSE--------KSRDRERERSRDRVRDGERSKDRGRDGEKS 81
            ER + R++ RDR+R RDRD +        K R R RE+SRDR RD ER ++R R+ E+ 
Sbjct: 332 SERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSRSREKSRDRDRDRERDRERERERERE 391

Query: 80  KDRERDRDGEKERDRDRDHHHRDR 9
           +DR+RD+D +++R+ D +  +  R
Sbjct: 392 RDRDRDKDKKRDREEDEEEAYERR 415

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 47/135 (34%), Positives = 76/135 (56%), Gaps = 6/135 (4%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E + ++E+  ++ E + +D        +     + +    K     RD +R S +++++D
Sbjct: 280 EEKGKKEKERQEIEKDRKDRERERERERREREREREKEREKEKERERDRERNSERNKDRD 339

Query: 248 RENGRERERKREKGRDR------DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
           R+  RER+R R+K RDR      DRSR R+  + RDR+RER R+R R+ ER +DR RD +
Sbjct: 340 RDRDRERDRDRDKDRDRVQDHIKDRSRSREKSRDRDRDRERDRERERERERERDRDRDKD 399

Query: 86  KSKDRERDRDGEKER 42
           K +DRE D +   ER
Sbjct: 400 KKRDREEDEEEAYER 414

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 43/136 (31%), Positives = 77/136 (56%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           + ER  E+   E E     +   +     D +    ++    RD DRE  + R+KDR+  
Sbjct: 298 DRERERERERREREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRD-- 355

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           R ++  +++ R R++SRDRD ++ RDRERER R+R RD +R KD+ RD E+ ++   +R 
Sbjct: 356 RVQDHIKDRSRSREKSRDRDRDRERDRERERERERERDRDRDKDKKRDREEDEEEAYERR 415

Query: 56  GEKERDRDRDHHHRDR 9
             + + R+++  +++R
Sbjct: 416 KLERKLREKEAAYQER 431

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/113 (38%), Positives = 76/113 (67%), Gaps = 6/113 (5%)
 Frame = -2

Query: 323 DLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR-DRSRDRDSEKSRDRERE 147
           ++ + K + +SR+  +     ++ + E G++ + ++E  +DR DR R+R+ E+ R+RERE
Sbjct: 255 EMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKDRKDRERERERER-RERERE 313

Query: 146 RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           R ++R ++ ER +DR R+ E++KDR+RDRD E++RDRD+D      H +DR R
Sbjct: 314 REKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSR 366

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 48/156 (30%), Positives = 70/156 (44%), Gaps = 22/156 (14%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E  E  R  + E E E     D         D D    +     RD DR+  +   KD
Sbjct: 304 ERERREREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRDRVQDHIKD 363

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRER--ERSRDRVRDGERSKDRGR------- 96
           R   RE+ R R++ R+RDR R+R+ E+ RDR+R  ++ RDR  D E + +R +       
Sbjct: 364 RSRSREKSRDRDRDRERDRERERERERERDRDRDKDKKRDREEDEEEAYERRKLERKLRE 423

Query: 95  -------------DGEKSKDRERDRDGEKERDRDRD 27
                          E+ K RE ++D E+E +R RD
Sbjct: 424 KEAAYQERLKNWEIRERKKTREYEKDAEREEERRRD 459

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 39/101 (38%), Positives = 60/101 (59%), Gaps = 1/101 (0%)
 Frame = -2

Query: 302 NHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERERSRDRVR 126
           N +  + D+    SRE  +     ++ + EKG+ +++R       K R+RERER R R R
Sbjct: 252 NAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKDRKDRERERERER-RER 310

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           + ER K+R ++ E+ +DRER+ +  K+RDRDRD   RDR R
Sbjct: 311 EREREKEREKEKERERDRERNSERNKDRDRDRD-RERDRDR 350

[82][TOP]
>UniRef100_Q08B25 RNPC7 protein n=1 Tax=Xenopus laevis RepID=Q08B25_XENLA
          Length = 814

 Score =  102 bits (253), Expect = 2e-20
 Identities = 48/97 (49%), Positives = 70/97 (72%), Gaps = 3/97 (3%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  K REK++E  R+RER  E+ +DRDR RDR+ ++ RD++R+R +D ++D  RS
Sbjct: 308 REREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSRS 367

Query: 110 --KDRGRDGEKSKDRERDRDGEKERDRDRD-HHHRDR 9
             K R RD ++ +DRER+R+ E+ERDRDRD    RDR
Sbjct: 368 REKSRDRDRDRERDRERERERERERDRDRDKDKKRDR 404

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 47/144 (32%), Positives = 80/144 (55%), Gaps = 8/144 (5%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +  ++ E+ +G+ E         +     + +  + +     R+ +RE  K RE+DRE  
Sbjct: 273 DTHKKLEEEKGKKEKERQEIEKDRKDRERERE-RERREREREREKEREKEKERERDRERN 331

Query: 236 RERERKREKGRDRDRSRDRDSE--------KSRDRERERSRDRVRDGERSKDRGRDGEKS 81
            ER + R++ RDR+R RDRD +        K R R RE+SRDR RD ER ++R R+ E+ 
Sbjct: 332 SERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSRSREKSRDRDRDRERDRERERERERE 391

Query: 80  KDRERDRDGEKERDRDRDHHHRDR 9
           +DR+RD+D +++R+ D +  +  R
Sbjct: 392 RDRDRDKDKKRDREEDEEEAYERR 415

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 47/135 (34%), Positives = 76/135 (56%), Gaps = 6/135 (4%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E + ++E+  ++ E + +D        +     + +    K     RD +R S +++++D
Sbjct: 280 EEKGKKEKERQEIEKDRKDRERERERERREREREREKEREKEKERERDRERNSERNKDRD 339

Query: 248 RENGRERERKREKGRDR------DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
           R+  RER+R R+K RDR      DRSR R+  + RDR+RER R+R R+ ER +DR RD +
Sbjct: 340 RDRDRERDRDRDKDRDRVQDHIKDRSRSREKSRDRDRDRERDRERERERERERDRDRDKD 399

Query: 86  KSKDRERDRDGEKER 42
           K +DRE D +   ER
Sbjct: 400 KKRDREEDEEEAYER 414

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 43/136 (31%), Positives = 77/136 (56%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           + ER  E+   E E     +   +     D +    ++    RD DRE  + R+KDR+  
Sbjct: 298 DRERERERERREREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRD-- 355

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           R ++  +++ R R++SRDRD ++ RDRERER R+R RD +R KD+ RD E+ ++   +R 
Sbjct: 356 RVQDHIKDRSRSREKSRDRDRDRERDRERERERERERDRDRDKDKKRDREEDEEEAYERR 415

Query: 56  GEKERDRDRDHHHRDR 9
             + + R+++  +++R
Sbjct: 416 KLERKLREKEAAYQER 431

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/113 (38%), Positives = 76/113 (67%), Gaps = 6/113 (5%)
 Frame = -2

Query: 323 DLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR-DRSRDRDSEKSRDRERE 147
           ++ + K + +SR+  +     ++ + E G++ + ++E  +DR DR R+R+ E+ R+RERE
Sbjct: 255 EMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKDRKDRERERERER-RERERE 313

Query: 146 RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           R ++R ++ ER +DR R+ E++KDR+RDRD E++RDRD+D      H +DR R
Sbjct: 314 REKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSR 366

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 48/156 (30%), Positives = 70/156 (44%), Gaps = 22/156 (14%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E  E  R  + E E E     D         D D    +     RD DR+  +   KD
Sbjct: 304 ERERREREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRDRVQDHIKD 363

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRER--ERSRDRVRDGERSKDRGR------- 96
           R   RE+ R R++ R+RDR R+R+ E+ RDR+R  ++ RDR  D E + +R +       
Sbjct: 364 RSRSREKSRDRDRDRERDRERERERERERDRDRDKDKKRDREEDEEEAYERRKLERKLRE 423

Query: 95  -------------DGEKSKDRERDRDGEKERDRDRD 27
                          E+ K RE ++D E+E +R RD
Sbjct: 424 KEAAYQERLKNWEIRERKKTREYEKDAEREEERRRD 459

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 39/101 (38%), Positives = 60/101 (59%), Gaps = 1/101 (0%)
 Frame = -2

Query: 302 NHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERERSRDRVR 126
           N +  + D+    SRE  +     ++ + EKG+ +++R       K R+RERER R R R
Sbjct: 252 NAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKDRKDRERERERER-RER 310

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           + ER K+R ++ E+ +DRER+ +  K+RDRDRD   RDR R
Sbjct: 311 EREREKEREKEKERERDRERNSERNKDRDRDRD-RERDRDR 350

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 59/198 (29%), Positives = 81/198 (40%), Gaps = 56/198 (28%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLT-DSKSNHVS-RDNDRESSKSRE 255
           E E E+ER  ++ E   E N   D         D D   D   +H+  R   RE S+ R+
Sbjct: 317 EREKEKERERDR-ERNSERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSRSREKSRDRD 375

Query: 254 KDRENGRERERKREKGRDRDRSRD------------------------------------ 183
           +DRE  RERER+RE+ RDRDR +D                                    
Sbjct: 376 RDRERDRERERERERERDRDRDKDKKRDREEDEEEAYERRKLERKLREKEAAYQERLKNW 435

Query: 182 --------RDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD----------RERDRD 57
                   R+ EK  +RE ER RD  ++G+R K+   D +  +D          ++R RD
Sbjct: 436 EIRERKKTREYEKDAEREEERRRDTTKEGKRLKEFLEDYDDDRDDPKYYRGSALQKRLRD 495

Query: 56  GEKERDRDRDHHHRDRHR 3
            EKE + D     RDR R
Sbjct: 496 REKELEAD----DRDRKR 509

[83][TOP]
>UniRef100_UPI000186E167 eukaryotic translation initiation factor 3 subunit, putative n=1
            Tax=Pediculus humanus corporis RepID=UPI000186E167
          Length = 1189

 Score =  101 bits (252), Expect = 2e-20
 Identities = 58/159 (36%), Positives = 91/159 (57%), Gaps = 13/159 (8%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSK---SNHVSRDNDRES 270
            P   E +  E  R       G +N + D   +P   ++   + S+   S+  +RD  R+ 
Sbjct: 951  PLKDEPKKVESWRPPALRNRGAENRNMDRESKPADISENWRSGSRAEPSDRFNRDRMRDR 1010

Query: 269  SKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD----------RVRDG 120
             + R++DR+  R+R+R R++ RDRDR RDRD ++ RDR+R+R+R+          R ++G
Sbjct: 1011 DRDRDRDRDWDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRNRNGRDSGPPMSWRNKEG 1070

Query: 119  ERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
                DR RD ++ +DR+RDRD ++ERDRDRD   RDR R
Sbjct: 1071 PDRGDRDRDWDRDRDRDRDRDRDRERDRDRD---RDRDR 1106

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 49/155 (31%), Positives = 78/155 (50%), Gaps = 24/155 (15%)
 Frame = -2

Query: 398  EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERK 219
            E    +  +N+ + S  +P    + D    +     RD D +  + R++DR+  R+R+R 
Sbjct: 980  ESKPADISENWRSGSRAEPSDRFNRDRMRDRDRDRDRDRDWDRDRDRDRDRDRDRDRDRD 1039

Query: 218  REKGRDRDRSRDR------------------------DSEKSRDRERERSRDRVRDGERS 111
            R++ RDRDR RDR                        D +  RDR+R+R RDR R+ +R 
Sbjct: 1040 RDRDRDRDRDRDRNRNGRDSGPPMSWRNKEGPDRGDRDRDWDRDRDRDRDRDRDRERDRD 1099

Query: 110  KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
            +DR RD E  ++R+RDRD +++R  +R    RD H
Sbjct: 1100 RDRDRDREIGRERDRDRDRDRDRGGERGPMRRDDH 1134

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 50/143 (34%), Positives = 74/143 (51%), Gaps = 18/143 (12%)
 Frame = -2

Query: 383  EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK-G 207
            E  D ++ D         D D    +     RD DR+  + R++DR+  R+R+R R + G
Sbjct: 997  EPSDRFNRDRMRDRDRDRDRDRDWDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRNRNG 1056

Query: 206  RD-----------------RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            RD                 RDR  DRD ++ RDR+R+R RDR RD +R ++ GR+ ++ +
Sbjct: 1057 RDSGPPMSWRNKEGPDRGDRDRDWDRDRDRDRDRDRDRERDRDRDRDRDREIGRERDRDR 1116

Query: 77   DRERDRDGEKERDRDRDHHHRDR 9
            DR+RDR GE+   R  DH   DR
Sbjct: 1117 DRDRDRGGERGPMRRDDHMRHDR 1139

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 54/162 (33%), Positives = 82/162 (50%), Gaps = 25/162 (15%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSR-----DNDRESSKSREKD 249
            ++  + +  G  +D      S +PPA  +    +   +  S+     +N R  S++   D
Sbjct: 941  DDMNWRRGGGPLKDEPKKVESWRPPALRNRGAENRNMDRESKPADISENWRSGSRAEPSD 1000

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR- 72
            R N     R R + RDRDR RDRD ++ RDR+R+R RDR RD +R +DR RD ++ ++R 
Sbjct: 1001 RFN-----RDRMRDRDRDRDRDRDWDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRNRN 1055

Query: 71   -------------------ERDRDGEKERDRDRDHHHRDRHR 3
                               +RDRD +++RDRDRD   RDR R
Sbjct: 1056 GRDSGPPMSWRNKEGPDRGDRDRDWDRDRDRDRD-RDRDRER 1096

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 42/120 (35%), Positives = 65/120 (54%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            EEERR ++ E E ++        +      E          +R+ + E  +  E+ +   
Sbjct: 818  EEERRKQREEEEKQEKLRKMREDELYRKEKEKKDHQAEIQRAREEEAERKRLEEEKKFKD 877

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
             E  R  ++ R RD  RDRD +++RDRERER RDR RD +R +DR RD ++ +D++RDRD
Sbjct: 878  YEPWRSEKEPRFRDDRRDRDPDRNRDRERERDRDRDRDRDRDRDRDRDRDRDRDKDRDRD 937

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 53/188 (28%), Positives = 85/188 (45%), Gaps = 52/188 (27%)
 Frame = -2

Query: 416  EEERR---YEQPEGEGEDNYHNDSSPQPP-------AAADEDLTDSKSNHVSRDNDRESS 267
            EEE++   YE    E E  + +D   + P          D D    +     RD DR+  
Sbjct: 870  EEEKKFKDYEPWRSEKEPRFRDDRRDRDPDRNRDRERERDRDRDRDRDRDRDRDRDRDRD 929

Query: 266  KSREKDRENGRERERKREKG------------------RDR---DRSRDRDSE------- 171
            + +++DR++G +    R  G                  R+R   +R+ DR+S+       
Sbjct: 930  RDKDRDRDDGNDDMNWRRGGGPLKDEPKKVESWRPPALRNRGAENRNMDRESKPADISEN 989

Query: 170  --------------KSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRD 33
                          + R R+R+R RDR RD +R +DR RD ++ +DR+RDRD +++RDRD
Sbjct: 990  WRSGSRAEPSDRFNRDRMRDRDRDRDRDRDWDRDRDRDRDRDRDRDRDRDRDRDRDRDRD 1049

Query: 32   RDHHHRDR 9
            RD +   R
Sbjct: 1050 RDRNRNGR 1057

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 53/196 (27%), Positives = 81/196 (41%), Gaps = 54/196 (27%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E  F ++RR   P+                                R+ DRE  + R++D
Sbjct: 886  EPRFRDDRRDRDPD--------------------------------RNRDRERERDRDRD 913

Query: 248  RENGRERERKREKGRDRDRSRDRD---------------------------------SEK 168
            R+  R+R+R R++ RDRD+ RDRD                                   +
Sbjct: 914  RDRDRDRDRDRDRDRDRDKDRDRDDGNDDMNWRRGGGPLKDEPKKVESWRPPALRNRGAE 973

Query: 167  SRDRERER---------------------SRDRVRDGERSKDRGRDGEKSKDRERDRDGE 51
            +R+ +RE                      +RDR+RD +R +DR RD ++ +DR+RDRD +
Sbjct: 974  NRNMDRESKPADISENWRSGSRAEPSDRFNRDRMRDRDRDRDRDRDWDRDRDRDRDRDRD 1033

Query: 50   KERDRDRDHHHRDRHR 3
            ++RDRDRD   RDR R
Sbjct: 1034 RDRDRDRD-RDRDRDR 1048

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 38/95 (40%), Positives = 53/95 (55%), Gaps = 1/95 (1%)
 Frame = -2

Query: 293  SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
            +++      + R+ DR+  R+R+R R++ RDRDR RDRD E  R+R+R+R RDR R GER
Sbjct: 1067 NKEGPDRGDRDRDWDRDRDRDRDRDRDRERDRDRDRDRDREIGRERDRDRDRDRDRGGER 1126

Query: 113  SKDRGRDGEKSKDRERD-RDGEKERDRDRDHHHRD 12
               R RD     DR  D R   ++  R      RD
Sbjct: 1127 GPMR-RDDHMRHDRRDDWRSSARDEPRGTPTKSRD 1160

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 42/124 (33%), Positives = 63/124 (50%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            EEE + E+     ED  +     +    A+  +  ++     R    E  K ++ +    
Sbjct: 826  EEEEKQEKLRKMREDELYRKEKEKKDHQAE--IQRAREEEAERKRLEEEKKFKDYEPWRS 883

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
             +  R R+  RDRD  R+RD E+ RDR+R+R RDR RD +R +DR RD    KDR+RD D
Sbjct: 884  EKEPRFRDDRRDRDPDRNRDRERERDRDRDRDRDRDRDRDRDRDRDRD----KDRDRD-D 938

Query: 56   GEKE 45
            G  +
Sbjct: 939  GNDD 942

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 43/139 (30%), Positives = 71/139 (51%), Gaps = 1/139 (0%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDN-DRESSKSREKDREN 240
            +EERR +Q   E +     +   Q     +E+    K   +  D   R+  + ++   E 
Sbjct: 801  KEERREKQAAAEKKRLEEEERRKQ----REEEEKQEKLRKMREDELYRKEKEKKDHQAEI 856

Query: 239  GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
             R RE + E+ R  +  + +D E  R  +  R RD  RD +  ++R R+ E+ +DR+RDR
Sbjct: 857  QRAREEEAERKRLEEEKKFKDYEPWRSEKEPRFRDDRRDRDPDRNRDRERERDRDRDRDR 916

Query: 59   DGEKERDRDRDHHHRDRHR 3
            D +++RDRDRD   RD+ R
Sbjct: 917  DRDRDRDRDRD-RDRDKDR 934

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 46/152 (30%), Positives = 65/152 (42%), Gaps = 14/152 (9%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSP-------QPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
            + +R  ++      +    DS P       + P   D D    +     RD DR+  + R
Sbjct: 1039 DRDRDRDRDRDRDRNRNGRDSGPPMSWRNKEGPDRGDRDRDWDRDRDRDRDRDRDRERDR 1098

Query: 257  EKDRENGRE--RERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG----- 99
            ++DR+  RE  RER R++ RDRDR  +R   +  D  R   RD  R   R + RG     
Sbjct: 1099 DRDRDRDREIGRERDRDRDRDRDRGGERGPMRRDDHMRHDRRDDWRSSARDEPRGTPTKS 1158

Query: 98   RDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            RDG   KD  R       RD  RDH  R+  +
Sbjct: 1159 RDGGGYKDDSRGMG----RDGPRDHSQREEKK 1186

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 40/142 (28%), Positives = 67/142 (47%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E   +EER+    E         +   +  AAA++   + +     R+ + +  K R K 
Sbjct: 782  EKRLDEERKKRLAERRQR---RKEERREKQAAAEKKRLEEEERRKQREEEEKQEKLR-KM 837

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            RE+   R+ K +K    +  R R+ E  R R  E  + +  +  RS+   R  +  +DR+
Sbjct: 838  REDELYRKEKEKKDHQAEIQRAREEEAERKRLEEEKKFKDYEPWRSEKEPRFRDDRRDRD 897

Query: 68   RDRDGEKERDRDRDHHHRDRHR 3
             DR+ ++ER+RDRD   RDR R
Sbjct: 898  PDRNRDRERERDRD-RDRDRDR 918

[84][TOP]
>UniRef100_B6UFH0 ATP-dependent RNA helicase DDX23 n=1 Tax=Zea mays
           RepID=B6UFH0_MAIZE
          Length = 758

 Score =  101 bits (252), Expect = 2e-20
 Identities = 52/115 (45%), Positives = 72/115 (62%), Gaps = 1/115 (0%)
 Frame = -2

Query: 350 PQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSE 171
           P PP+ A      S SN   RD+      S ++DR+  R+R+R R++ RDR+R RD DS 
Sbjct: 54  PPPPSGAPP----SGSNPAPRDSSNSHRDSSDRDRDRDRDRDRDRDRDRDRERRRDDDSR 109

Query: 170 KSRDRERERSRDRVRDGERSKDRGRDGEKS-KDRERDRDGEKERDRDRDHHHRDR 9
           + RDR+R+R RDR RD + S  R RD ++  +DR+RDRD + ER+RDRD    DR
Sbjct: 110 RDRDRDRDRDRDRDRDRDDSSRRDRDRDRDRRDRDRDRDRDMERERDRDRERGDR 164

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 51/123 (41%), Positives = 77/123 (62%), Gaps = 6/123 (4%)
 Frame = -2

Query: 353 SPQPPAAADEDLTDSKSNHV-SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRD 177
           S  PP+ ++    DS ++H  S D DR+  + R++DR+  R+RER+R+    RDR RDRD
Sbjct: 58  SGAPPSGSNPAPRDSSNSHRDSSDRDRDRDRDRDRDRDRDRDRERRRDDDSRRDRDRDRD 117

Query: 176 SEKSRDRERE----RSRDRVRD-GERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
            ++ RDR+R+    R RDR RD  +R +DR RD E+ +DR+R+R    +R+RDR     +
Sbjct: 118 RDRDRDRDRDDSSRRDRDRDRDRRDRDRDRDRDMERERDRDRERGDRGDRERDRLEKMAE 177

Query: 11  RHR 3
           R R
Sbjct: 178 RER 180

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 50/125 (40%), Positives = 68/125 (54%), Gaps = 3/125 (2%)
 Frame = -2

Query: 392 PEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKRE 213
           P      N H DSS +     D D    +     RD DRE  +  +  R+  R+R+R R+
Sbjct: 67  PAPRDSSNSHRDSSDR-----DRDRDRDRDRDRDRDRDRERRRDDDSRRDRDRDRDRDRD 121

Query: 212 KGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR---DGEKER 42
           + RDRD S  RD ++ RDR R+R RDR RD ER +DR R+     DRERDR     E+ER
Sbjct: 122 RDRDRDDSSRRDRDRDRDR-RDRDRDRDRDMERERDRDRERGDRGDRERDRLEKMAERER 180

Query: 41  DRDRD 27
           +++ D
Sbjct: 181 EKELD 185

[85][TOP]
>UniRef100_B6AGW7 Putative uncharacterized protein n=1 Tax=Cryptosporidium muris RN66
           RepID=B6AGW7_9CRYT
          Length = 582

 Score =  101 bits (252), Expect = 2e-20
 Identities = 57/154 (37%), Positives = 86/154 (55%), Gaps = 23/154 (14%)
 Frame = -2

Query: 416 EEERR---YEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESS------- 267
           + ERR   YE    +G D Y  D S       D      K   V R+ +R+S+       
Sbjct: 38  DNERRDSGYELDNEKGRD-YGRDKSRDYEYERDRYREGKKYRDVVRNRNRDSNYGFNERT 96

Query: 266 -------------KSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVR 126
                        K R+K+R+ GR++ER RE+ R+RDR RDR+ ++ RD+ R+R RDR R
Sbjct: 97  REDNNWEREYNKAKGRDKERDKGRDKERDRERDRERDRERDRERDRERDKGRDRERDRER 156

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH 24
           D ER ++R R+ ++ +DRERDR+ ++ER RDR++
Sbjct: 157 DRERDRERDRERDRERDRERDRERDRERGRDREY 190

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 51/130 (39%), Positives = 80/130 (61%), Gaps = 1/130 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQPE-GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           +YE+E +R  E  +  +   N + DS+        ED    +  + ++  D+E  K R+K
Sbjct: 63  DYEYERDRYREGKKYRDVVRNRNRDSNYGFNERTREDNNWEREYNKAKGRDKERDKGRDK 122

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           +R+  R+RER RE+ R+RDR RD+  ++ RDRER+R RDR RD ER ++R R+ ++ +DR
Sbjct: 123 ERDRERDRERDRERDRERDRERDKGRDRERDRERDRERDRERDRERDRERDRERDRERDR 182

Query: 71  ERDRDGEKER 42
           ER RD E +R
Sbjct: 183 ERGRDREYDR 192

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 46/94 (48%), Positives = 62/94 (65%), Gaps = 2/94 (2%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR--DRSRDRDSEKSRDRERERSRD 135
           K     RD +R+  + RE+DRE  RER+R+R+KGRDR  DR RDR+ ++ RDRER+R RD
Sbjct: 114 KERDKGRDKERDRERDRERDRERDRERDRERDKGRDRERDRERDRERDRERDRERDRERD 173

Query: 134 RVRDGERSKDRGRDGEKSKDRERDRDGEKERDRD 33
           R RD ER ++RGRD E  +     R G + R R+
Sbjct: 174 RERDRERDRERGRDREYDRYSLGYRRGREYRSRN 207

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 42/124 (33%), Positives = 64/124 (51%)
 Frame = -2

Query: 410 ERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRE 231
           ER Y + +G  ++              D+     +     R+ DRE  + R+++R+ GR+
Sbjct: 103 EREYNKAKGRDKER-------------DKGRDKERDRERDRERDRERDRERDRERDKGRD 149

Query: 230 RERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGE 51
           RER RE+ R+RDR RDR+ ++ RDRER+R RDR R  +R  DR   G +     R R+  
Sbjct: 150 RERDRERDRERDRERDRERDRERDRERDRERDRERGRDREYDRYSLGYRRGREYRSRNCR 209

Query: 50  KERD 39
              D
Sbjct: 210 SSSD 213

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/118 (35%), Positives = 61/118 (51%)
 Frame = -2

Query: 425 YEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
           Y F E  R E    E E N       +     D++    +     R+ DRE  + R+K R
Sbjct: 90  YGFNERTR-EDNNWEREYNKAKGRDKERDKGRDKERDRERDRERDRERDRERDRERDKGR 148

Query: 245 ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           +  R+RER RE+ R+RDR RDR+ ++ RDRER+R R R R+ +R     R G + + R
Sbjct: 149 DRERDRERDRERDRERDRERDRERDRERDRERDRERGRDREYDRYSLGYRRGREYRSR 206

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 45/120 (37%), Positives = 65/120 (54%), Gaps = 16/120 (13%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD 135
           D      SRDN+R  S   E D E GR+  R + +  + +R R R+ +K RD  R R+RD
Sbjct: 29  DDDRRRPSRDNERRDS-GYELDNEKGRDYGRDKSRDYEYERDRYREGKKYRDVVRNRNRD 87

Query: 134 -------RVRDG-----ERSKDRGRDGEKSK----DRERDRDGEKERDRDRDHHHRDRHR 3
                  R R+      E +K +GRD E+ K    +R+R+RD E++R+RDR+   RDR R
Sbjct: 88  SNYGFNERTREDNNWEREYNKAKGRDKERDKGRDKERDRERDRERDRERDRE---RDRER 144

[86][TOP]
>UniRef100_Q1DL06 Putative uncharacterized protein n=1 Tax=Coccidioides immitis
           RepID=Q1DL06_COCIM
          Length = 737

 Score =  101 bits (252), Expect = 2e-20
 Identities = 56/142 (39%), Positives = 82/142 (57%), Gaps = 7/142 (4%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQ--PPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN 240
           E+ RY   + +  D+   D       P+    D  D +S+   R   R  +  R++DR +
Sbjct: 434 EDDRYRWRDSDRRDSERRDREMDLYRPSRERHD-RDDRSDTRRRSRVRSRTPIRDRDRGD 492

Query: 239 G-----RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           G     RE ER+++  RD +R RDRD E+ RD+ERER R+R  D ++ K+RGRD ++ +D
Sbjct: 493 GYRPHDREGEREKDSDRDFNRDRDRDRERDRDKERERERERENDRDQDKERGRDRDRDRD 552

Query: 74  RERDRDGEKERDRDRDHHHRDR 9
           RERDRD  ++RDRDRD    DR
Sbjct: 553 RERDRDRNRDRDRDRDWDRSDR 574

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 40/96 (41%), Positives = 62/96 (64%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R +DRE  + ++ DR+  R+R+R RE+ RD++R R+R+ E  RD+++ER RDR RD +R 
Sbjct: 495 RPHDREGEREKDSDRDFNRDRDRDRERDRDKERERERERENDRDQDKERGRDRDRDRDRE 554

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +DR R+ ++ +DR+ DR     R R    H R R R
Sbjct: 555 RDRDRNRDRDRDRDWDRSDRSYRPRAYS-HSRSRSR 589

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 41/96 (42%), Positives = 61/96 (63%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           +D+DR+ ++ R++DRE  R++ER+RE  R+R+  RD+D E+ RDR+R+R R+R RD  R 
Sbjct: 505 KDSDRDFNRDRDRDRERDRDKERERE--RERENDRDQDKERGRDRDRDRDRERDRDRNRD 562

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +DR RD ++S    R R     R R R    R R R
Sbjct: 563 RDRDRDWDRSDRSYRPRAYSHSRSRSRSRRRRSRSR 598

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 42/114 (36%), Positives = 59/114 (51%), Gaps = 19/114 (16%)
 Frame = -2

Query: 293 SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           +RD DR+  + R+K+RE  RERE  R++ ++R R RDRD ++ RDR+R R RDR RD +R
Sbjct: 512 NRDRDRDRERDRDKERERERERENDRDQDKERGRDRDRDRDRERDRDRNRDRDRDRDWDR 571

Query: 113 S-------------------KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           S                   + R R   +S+ R   R G +ERDR        R
Sbjct: 572 SDRSYRPRAYSHSRSRSRSRRRRSRSRVRSRSRSLTRRGREERDRSESRRRLSR 625

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 39/104 (37%), Positives = 58/104 (55%), Gaps = 1/104 (0%)
 Frame = -2

Query: 311 SKSNHVSRDNDRESSKS-REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD 135
           +K+    R   RE  +  +E +R+   ERE KR   R++ R  +R  E+ R++ERE  R 
Sbjct: 194 AKAEAEERQRQRELRRQQKEAERKEREEREEKRRVEREKRREEERKLEEQREKEREERRR 253

Query: 134 RVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R  + ER     R  E+ ++RER+R+ E+E DR RD   RDR R
Sbjct: 254 RRDEEEREHRERRREEREREREREREREREDDRRRDERDRDRGR 297

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 45/145 (31%), Positives = 68/145 (46%), Gaps = 5/145 (3%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDS--SPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE 255
           E E +++   E+ + E E+          Q  A   E     +   V R+  RE  +  E
Sbjct: 182 ELEMKKKLEEERAKAEAEERQRQRELRRQQKEAERKEREEREEKRRVEREKRREEERKLE 241

Query: 254 KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD---GERSKDRGRDGEK 84
           + RE  RE  R+R    +R+    R  E+ R+RERER R+R  D    ER +DRGRD   
Sbjct: 242 EQREKEREERRRRRDEEEREHRERRREEREREREREREREREDDRRRDERDRDRGRD--- 298

Query: 83  SKDRERDRDGEKERDRDRDHHHRDR 9
            +DR+ +RD + ER   ++     R
Sbjct: 299 -RDRDWNRDVKSERTPKKERSDTPR 322

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 54/195 (27%), Positives = 73/195 (37%), Gaps = 70/195 (35%)
 Frame = -2

Query: 389  EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
            EGE E +   D +       + D    +     R+NDR+  K R +DR+  R+RER R++
Sbjct: 500  EGEREKDSDRDFNRDRDRDRERDRDKERERERERENDRDQDKERGRDRDRDRDRERDRDR 559

Query: 209  GRDRDRSRDRDSE---------------------KSRDRERERSRD-------------- 135
             RDRDR RD D                       +SR R R RSR               
Sbjct: 560  NRDRDRDRDWDRSDRSYRPRAYSHSRSRSRSRRRRSRSRVRSRSRSLTRRGREERDRSES 619

Query: 134  --------------------------------RVRDGERSK---DRGRDGEKSKDRERDR 60
                                            RVR  ER +   DR R  ++S+DR+RD 
Sbjct: 620  RRRLSRRSRSPNQLDIDRYVPPTSTRSRSPKRRVRSPERDRTWSDRDRVRDRSRDRDRDW 679

Query: 59   DGEKERDRDRDHHHR 15
            D ++ERD DR    R
Sbjct: 680  DRDRERDHDRSRIDR 694

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 42/136 (30%), Positives = 71/136 (52%), Gaps = 7/136 (5%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E +R E+ E   ++        +  A A+ +  + +     R   +E+ +   ++RE  R
Sbjct: 169 EAKRQEREEARLKELEMKKKLEEERAKAEAE--ERQRQRELRRQQKEAERKEREEREEKR 226

Query: 233 --ERERKREKGRDRDRSRDRDSEKSRDR----ERERSRDRVRDGERSKDRGRDGEKSKDR 72
             ERE++RE+ R  +  R+++ E+ R R    ERE    R  + ER ++R R+ E+  DR
Sbjct: 227 RVEREKRREEERKLEEQREKEREERRRRRDEEEREHRERRREEREREREREREREREDDR 286

Query: 71  ERD-RDGEKERDRDRD 27
            RD RD ++ RDRDRD
Sbjct: 287 RRDERDRDRGRDRDRD 302

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 2/106 (1%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSR 138
           +++     R+  R+  ++  K+RE   E+ R +REK R+ +R  +   EK R+  R R  
Sbjct: 197 EAEERQRQRELRRQQKEAERKEREEREEKRRVEREKRREEERKLEEQREKEREERRRRRD 256

Query: 137 DRVRDGERSKDRGRDGEKSKDRERDRDGEKERD-RDRDHHHRDRHR 3
           +  R+    +   R+ E+ ++RER+R+ ++ RD RDRD   RDR R
Sbjct: 257 EEEREHRERRREEREREREREREREREDDRRRDERDRD-RGRDRDR 301

[87][TOP]
>UniRef100_B0DMQ1 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82
           RepID=B0DMQ1_LACBS
          Length = 680

 Score =  101 bits (252), Expect = 2e-20
 Identities = 60/156 (38%), Positives = 82/156 (52%), Gaps = 17/156 (10%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDS--SPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           G  E + ERRY++ +  G D    D     +     D D    K     R  D E  + R
Sbjct: 465 GYDERDRERRYDERDMRGHDGRERDKYRGYRSDRDRDRDRERDKDRERERPRDPERERDR 524

Query: 257 EKDRENGRERERKREKGRDRDRSRDRD-SEKSRDRERERSRDRV-RDGERSKDRGRDGEK 84
           ++DRE GR+R++ R + RDRDR R+R+  EK RDRER+R R R  RD ++ +DR RD E+
Sbjct: 525 DRDREKGRDRDKDRGRDRDRDREREREWPEKERDRERDRDRGREDRDRDKGRDRNRDRER 584

Query: 83  SK-------------DRERDRDGEKERDRDRDHHHR 15
            K             DRE++RD E+ R  DR HH R
Sbjct: 585 DKAREGGGDRKREEGDREKERDRERARYDDRSHHRR 620

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 63/167 (37%), Positives = 84/167 (50%), Gaps = 25/167 (14%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEG------------EGEDNYHNDSSPQPPAAADE-------DLTDSK 306
           EY+ E+ER Y    G             G D    D         DE       D  D +
Sbjct: 422 EYDREKEREYRSRRGYESGRERDRERERGYDGRERDKDRDMDRGYDERDRERRYDERDMR 481

Query: 305 SNHVSRDNDRESSKSREKDRENGRERERKREKGRDRD----RSRDRDSEKSRDRERERSR 138
             H  R+ D+      ++DR+  RER++ RE+ R RD    R RDRD EK RDR+++R R
Sbjct: 482 G-HDGRERDKYRGYRSDRDRDRDRERDKDRERERPRDPERERDRDRDREKGRDRDKDRGR 540

Query: 137 DRVRDGERSKDRGRDGEKSKDRERDRD-GEKERDRDRDH-HHRDRHR 3
           DR RD ER ++     EK +DRERDRD G ++RDRD+    +RDR R
Sbjct: 541 DRDRDREREREW---PEKERDRERDRDRGREDRDRDKGRDRNRDRER 584

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 46/157 (29%), Positives = 72/157 (45%), Gaps = 41/157 (26%)
 Frame = -2

Query: 350 PQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERK-----REKGRDRDRSR 186
           P P     ++      +   R+ +RE    R  +    R+RER+     RE+ +DRD  R
Sbjct: 405 PPPTTMRRKEREARYRDEYDREKEREYRSRRGYESGRERDRERERGYDGRERDKDRDMDR 464

Query: 185 --------------------------------DRDSEKSRDRERERSRDRVRDGERSKDR 102
                                           DRD ++ R+R+++R R+R RD ER +DR
Sbjct: 465 GYDERDRERRYDERDMRGHDGRERDKYRGYRSDRDRDRDRERDKDRERERPRDPERERDR 524

Query: 101 GRDGEKSKDRERDRDGEKERDRDRDHH----HRDRHR 3
            RD EK +DR++DR  +++RDR+R+       RDR R
Sbjct: 525 DRDREKGRDRDKDRGRDRDRDREREREWPEKERDRER 561

[88][TOP]
>UniRef100_UPI00005A1804 PREDICTED: similar to RNA binding motif protein 25 isoform 10 n=1
           Tax=Canis lupus familiaris RepID=UPI00005A1804
          Length = 809

 Score =  101 bits (251), Expect = 3e-20
 Identities = 46/88 (52%), Positives = 68/88 (77%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  + RE++RE  RERE+++E+ R+R+R RDRD  K RDR+R+R RDR RD ERS
Sbjct: 316 RERERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERS 374

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRD 27
            DR +D  +S++RER+R+ +K+RDR+ D
Sbjct: 375 SDRNKDRSRSREREREREKDKKRDREED 402

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 42/85 (49%), Positives = 60/85 (70%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  + REK++E  RERER R++ R ++R RDRD E+ RDR+RERS DR +D  RS
Sbjct: 325 REREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRS 384

Query: 110 KDRGRDGEKSKDRERDRDGEKERDR 36
           ++R R+ EK K R+R+ D E   +R
Sbjct: 385 REREREREKDKKRDREEDEEDAYER 409

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 44/97 (45%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR R  ER
Sbjct: 298 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 357

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR R+ ++ +DRER  D  K+R R R+   R+R R
Sbjct: 358 DRDRDRERDRDRDRERSSDRNKDRSRSRE---RERER 391

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 44/100 (44%), Positives = 67/100 (67%), Gaps = 6/100 (6%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRV----R 126
           ++      + RE++RE  RERER+ RE+ R+R+R R+++ E+ R+RER+R RDR     R
Sbjct: 300 KERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDR 359

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRD-HHHRDR 9
           D +R +DR RD E+S DR +DR   +ER+R+R+    RDR
Sbjct: 360 DRDRERDRDRDRERSSDRNKDRSRSREREREREKDKKRDR 399

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/115 (38%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK-SRDRE 153
           +ED  D  S  +S+  D       EK ++    +E ++E+ R+R+R R+R+ E+  R+RE
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKER-RERERERERERERRERERE 328

Query: 152 RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           RER R+R ++ ER ++R RD ++ + +ERDRD ++ERDRDRD       ++DR R
Sbjct: 329 REREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSR 383

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/140 (34%), Positives = 76/140 (54%), Gaps = 2/140 (1%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E                      +     R+ +RE  K RE++RE
Sbjct: 304 EIEKERRERERERERERERRE-----------------REREREREREREKEKERERERE 346

Query: 242 NGRERERKREKGRDRDR--SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
             R+R+R +E+ RDRDR   RDRD E+S DR ++RSR R R+ ER KD+ RD E+ ++  
Sbjct: 347 RDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREREREREKDKKRDREEDEEDA 406

Query: 68  RDRDGEKERDRDRDHHHRDR 9
            +R   + + R+++  +++R
Sbjct: 407 YERRKLERKLREKEAAYQER 426

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 44/113 (38%), Positives = 64/113 (56%), Gaps = 7/113 (6%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 259 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 318

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDHHHRDRHR 3
            R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDRD   RDR R
Sbjct: 319 ERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRD-RERDRDR 369

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 39/136 (28%), Positives = 69/136 (50%), Gaps = 2/136 (1%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK- 252
           E E E ERR  + E E E     +   +     D D   +K     RD +R+  + RE+ 
Sbjct: 315 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERS 374

Query: 251 -DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
            DR   R R R+RE+ R++D+ RDR+ ++    ER +   ++R+ E +        + ++
Sbjct: 375 SDRNKDRSRSREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRE 434

Query: 74  RERDRDGEKERDRDRD 27
           R++ R+ EKE +R+ +
Sbjct: 435 RKKTREYEKEAEREEE 450

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 39/136 (28%), Positives = 70/136 (51%), Gaps = 3/136 (2%)
 Frame = -2

Query: 428 EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER R ++ E E E     D         D D    +     R +DR   +SR +
Sbjct: 326 EREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSR 385

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE-RSKDRGRDGEKSK 78
           +RE  RE+++KR++  D + + +R   + + RE+E + ++R+++ E R + + R+ EK  
Sbjct: 386 EREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEA 445

Query: 77  DRERDRDGEKERDRDR 30
           +RE +R  E  ++  R
Sbjct: 446 EREEERRREMAKEAKR 461

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 42/167 (25%), Positives = 74/167 (44%), Gaps = 27/167 (16%)
 Frame = -2

Query: 428 EYEFEEER---RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           E E E ER   R    E + + +   D       ++D +   S+S    R+ +++  + R
Sbjct: 340 ERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREREREREKDKKRDR 399

Query: 257 EKDRENGRERERKREKGRD--------------RDRSRDRDSEKSRDRERERSRDRVRDG 120
           E+D E+  ER +   K R+              R+R + R+ EK  +RE ER R+  ++ 
Sbjct: 400 EEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEA 459

Query: 119 ERSKDRGRDGEKSKD----------RERDRDGEKERDRDRDHHHRDR 9
           +R K+   D +  +D          ++R RD EKE + D     R++
Sbjct: 460 KRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREK 506

[89][TOP]
>UniRef100_A9XLG6 Putative uncharacterized protein n=1 Tax=Solanum bulbocastanum
           RepID=A9XLG6_SOLBU
          Length = 558

 Score =  101 bits (251), Expect = 3e-20
 Identities = 59/140 (42%), Positives = 85/140 (60%), Gaps = 11/140 (7%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRE--SSKSREKDRENGRERERKR 216
           EG GED  +N SSP          +DSK+   SRD ++E  SS+SREK+RE GR+++R R
Sbjct: 5   EGNGEDVENNGSSPY---------SDSKTQRTSRDPEKERGSSRSREKEREKGRDKDRDR 55

Query: 215 EKGRDRDRSRDR------DSEKSRDRERERS---RDRVRDGERSKDRGRDGEKSKDRERD 63
           ++  DRDR RDR      D ++ R+RE++R    RDR RD    ++R RD ++  D +R 
Sbjct: 56  DRNIDRDRDRDRVKERDKDRDRDREREKDRDRHHRDRHRDRSDRRERTRDRDED-DLQRT 114

Query: 62  RDGEKERDRDRDHHHRDRHR 3
           RD ++ RD D+D   R RH+
Sbjct: 115 RDYDRRRDNDKDREDRQRHK 134

[90][TOP]
>UniRef100_C1EGB6 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EGB6_9CHLO
          Length = 424

 Score =  100 bits (250), Expect = 4e-20
 Identities = 51/129 (39%), Positives = 80/129 (62%), Gaps = 1/129 (0%)
 Frame = -2

Query: 386 GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKG 207
           G G+       S  P +A ++     +     RD DR+  + R++DR+  R+R+R+R+  
Sbjct: 262 GHGDARGWGRDSRPPFSARNQGRGMDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRRRDGS 321

Query: 206 RD-RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           RD RDRSRDR  ++ RDR+R+R RD+ RD +R KDR +D ++++DR+RD D +++R R R
Sbjct: 322 RDRRDRSRDRRRDRDRDRDRDRDRDKDRDRDRDKDRDKDRDRNRDRDRDEDYDRDRKRRR 381

Query: 29  DHHHRDRHR 3
           D   R R R
Sbjct: 382 D-RSRSRSR 389

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 51/121 (42%), Positives = 71/121 (58%), Gaps = 6/121 (4%)
 Frame = -2

Query: 347 QPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK 168
           +PP     D    +  H         S+     R  GR  +R R+  RDRDR RDRD ++
Sbjct: 247 RPPVPQGYDRGPGRGGHGDARGWGRDSRPPFSARNQGRGMDRDRD--RDRDRDRDRDRDR 304

Query: 167 SRDRERERSRDRVRDG-----ERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-HHRDRH 6
            RDR+R+R RDR RDG     +RS+DR RD ++ +DR+RDRD +++RDRD+D    RDR+
Sbjct: 305 DRDRDRDRDRDRRRDGSRDRRDRSRDRRRDRDRDRDRDRDRDKDRDRDRDKDRDKDRDRN 364

Query: 5   R 3
           R
Sbjct: 365 R 365

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 46/114 (40%), Positives = 64/114 (56%), Gaps = 5/114 (4%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREK-----DRENGRERERKREKGRDRDRSRDRDSEKS 165
           D D    +     RD DR    SR++     DR   R+R+R R++ RD+DR RDRD ++ 
Sbjct: 299 DRDRDRDRDRDRDRDRDRRRDGSRDRRDRSRDRRRDRDRDRDRDRDRDKDRDRDRDKDRD 358

Query: 164 RDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +DR+R R RDR  D +R + R RD  +S+ R R R   K+  R+RD   RDR R
Sbjct: 359 KDRDRNRDRDRDEDYDRDRKRRRDRSRSRSRSRSRSPRKKDRRERDKEDRDRDR 412

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 36/96 (37%), Positives = 57/96 (59%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RD DR+  + +++DR+  ++R++ R++ RDRDR  D D ++ R R+R RS        RS
Sbjct: 337 RDRDRDRDRDKDRDRDRDKDRDKDRDRNRDRDRDEDYDRDRKRRRDRSRS--------RS 388

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           + R R   K   RERD++ +++RDR R    RD  R
Sbjct: 389 RSRSRSPRKKDRRERDKE-DRDRDRRRSPDPRDSRR 423

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 1/76 (1%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRD-SEKSRDRE 153
           D D    +     +D D++  ++R++DR+   +R+RKR + R R RSR R  S + +DR 
Sbjct: 342 DRDRDKDRDRDRDKDRDKDRDRNRDRDRDEDYDRDRKRRRDRSRSRSRSRSRSPRKKDRR 401

Query: 152 RERSRDRVRDGERSKD 105
                DR RD  RS D
Sbjct: 402 ERDKEDRDRDRRRSPD 417

[91][TOP]
>UniRef100_B3MZ35 GF21909 n=1 Tax=Drosophila ananassae RepID=B3MZ35_DROAN
          Length = 608

 Score =  100 bits (250), Expect = 4e-20
 Identities = 60/153 (39%), Positives = 84/153 (54%), Gaps = 30/153 (19%)
 Frame = -2

Query: 371 NYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR 192
           ++ + SS       DED   S+     RD DRE  + R+++R+  RER+R R++ RDRDR
Sbjct: 109 HHRSSSSCSSRIRIDEDSHPSRPRQ-ERDRDRERDRDRDRERDRDRERDRDRDRDRDRDR 167

Query: 191 SRDRDSEKSRDRERERSRDRV-RDGERSKDR----------------------------- 102
            RDRD ++ R+RER+R R+R  RD ERS+DR                             
Sbjct: 168 DRDRDRDRERERERDRDREREKRDLERSRDREHNKSDHRHYRTKESSSNSGHRERERERG 227

Query: 101 GRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            RD E+ +DR+R+RD E++RDRDRD   RDR R
Sbjct: 228 DRDRERERDRDRERDRERDRDRDRD---RDRRR 257

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 54/153 (35%), Positives = 87/153 (56%), Gaps = 12/153 (7%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSR------DNDRESS 267
           ++    +++ EQ E   ++  + +++  P     +  + S+S    +       + R SS
Sbjct: 55  QHHQHHQQQQEQHEKSLQNQQYRNNNNSPLLTTSQSQSQSQSQSQLQLQLQLHQHHRSSS 114

Query: 266 K--SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD 93
              SR +  E+      ++E+ RDR+R RDRD E+ RDRER+R RDR RD +R +DR RD
Sbjct: 115 SCSSRIRIDEDSHPSRPRQERDRDRERDRDRDRERDRDRERDRDRDRDRDRDRDRDRDRD 174

Query: 92  GEKSKDRERDRDGEK---ERDRDRDHHHRD-RH 6
            E+ ++R+RDR+ EK   ER RDR+H+  D RH
Sbjct: 175 RERERERDRDREREKRDLERSRDREHNKSDHRH 207

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/147 (36%), Positives = 79/147 (53%), Gaps = 28/147 (19%)
 Frame = -2

Query: 359 DSSP-QPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRD 183
           DS P +P    D D    +     RD DRE  + R++DR+  R+R+R R++ R+R+R RD
Sbjct: 125 DSHPSRPRQERDRDRERDRDRDRERDRDRERDRDRDRDRDRDRDRDRDRDRERERERDRD 184

Query: 182 RDSEK-----SRDRE--------------------RERSRDRV-RDGERSKDRGRDGEKS 81
           R+ EK     SRDRE                    RER R+R  RD ER +DR R+ ++ 
Sbjct: 185 REREKRDLERSRDREHNKSDHRHYRTKESSSNSGHRERERERGDRDRERERDRDRERDRE 244

Query: 80  KDRERDRDGEKER-DRDRDHHHRDRHR 3
           +DR+RDRD ++ R D+   HHH  + +
Sbjct: 245 RDRDRDRDRDRRRSDKSSRHHHSGKDK 271

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 48/128 (37%), Positives = 60/128 (46%), Gaps = 19/128 (14%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSK---SREKDRE----------------NGRERERKREKG 207
           D D    +     RD DRE  K    R +DRE                N   RER+RE+G
Sbjct: 168 DRDRDRDRERERERDRDREREKRDLERSRDREHNKSDHRHYRTKESSSNSGHRERERERG 227

Query: 206 RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
            DRDR R+RD ++ RDRER+R RDR RD  RS    R     KD+E+ ++     DR R 
Sbjct: 228 -DRDRERERDRDRERDRERDRDRDRDRDRRRSDKSSRHHHSGKDKEQRKEHHHNHDRSRR 286

Query: 26  HHHRDRHR 3
                R R
Sbjct: 287 RRGDSRSR 294

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 47/147 (31%), Positives = 73/147 (49%), Gaps = 7/147 (4%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGE-GEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E + +R  E+ + E   D  HN S  +     +     S SN   R+ +RE    R++
Sbjct: 178 ERERDRDREREKRDLERSRDREHNKSDHRHYRTKE-----SSSNSGHRERERERG-DRDR 231

Query: 251 DRENGRERERKREKGRDRDRSRD-RDSEKS-----RDRERERSRDRVRDGERSKDRGRDG 90
           +RE  R+RER RE+ RDRDR RD R S+KS       +++E+ ++   + +RS+ R R  
Sbjct: 232 ERERDRDRERDRERDRDRDRDRDRRRSDKSSRHHHSGKDKEQRKEHHHNHDRSR-RRRGD 290

Query: 89  EKSKDRERDRDGEKERDRDRDHHHRDR 9
            +S+   R R         R  H+R R
Sbjct: 291 SRSRSGSRSRSANDTPPASRRRHYRSR 317

[92][TOP]
>UniRef100_A2G2N0 Eukaryotic translation initiation factor 3 subunit 1, putative n=1
           Tax=Trichomonas vaginalis G3 RepID=A2G2N0_TRIVA
          Length = 535

 Score =  100 bits (250), Expect = 4e-20
 Identities = 60/151 (39%), Positives = 87/151 (57%), Gaps = 6/151 (3%)
 Frame = -2

Query: 437 TMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           T  E E    R  E+     ED   +      P + ++D    +     RD DR+  + R
Sbjct: 386 TRDEDERVRTRDDERVRTRDEDRVRSRDEDDKPRSRNDDRDRDRDRDRDRDRDRDRDRDR 445

Query: 257 EKDRENGRERERKREKG--RDRDRSRDRDSEKSRDR---ERERSRDRVRDG-ERSKDRGR 96
           E+ R++ R+RER+R+    RDRDR RDRD ++ RDR   +R+R RDR RD  +R +DR R
Sbjct: 446 ERRRDD-RDRERRRDDDDDRDRDRDRDRDRDRGRDRHRDDRDRDRDRDRDRKDRDRDRDR 504

Query: 95  DGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ++ +DR+RDRD  ++RDRDR   +RDR R
Sbjct: 505 DRDRDRDRDRDRDRGRDRDRDRG-RNRDRRR 534

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 46/111 (41%), Positives = 70/111 (63%), Gaps = 1/111 (0%)
 Frame = -2

Query: 332 ADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDR 156
           +DE +     +   R  D E  ++R++DR   R+ + K R +  DRDR RDRD ++ RDR
Sbjct: 380 SDERVRTRDEDERVRTRDDERVRTRDEDRVRSRDEDDKPRSRNDDRDRDRDRDRDRDRDR 439

Query: 155 ERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +R+R R+R RD +R ++R RD +  +DR+RDRD +++R RDR    RDR R
Sbjct: 440 DRDRDRERRRD-DRDRERRRDDDDDRDRDRDRDRDRDRGRDRHRDDRDRDR 489

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 45/113 (39%), Positives = 71/113 (62%), Gaps = 4/113 (3%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRD-RSRDRDSEKSRDRE 153
           D+++  ++S+   R  D E  + R +D E  R R+  R + RD D + R R+ ++ RDR+
Sbjct: 372 DDEMVRTRSDERVRTRD-EDERVRTRDDERVRTRDEDRVRSRDEDDKPRSRNDDRDRDRD 430

Query: 152 RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHH---RDRHR 3
           R+R RDR RD +R ++R RD ++ ++R RD D +++RDRDRD      RDRHR
Sbjct: 431 RDRDRDRDRDRDRDRERRRD-DRDRERRRDDDDDRDRDRDRDRDRDRGRDRHR 482

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 54/187 (28%), Positives = 78/187 (41%), Gaps = 47/187 (25%)
 Frame = -2

Query: 422 EFEEERRYEQPEGE-GEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
           +  E+ R EQ E     +       P  PA  ++   D      +RD+   S   RE+ R
Sbjct: 274 KMSEQNRDEQHERSVHHEEVQEFKIPDKPATGEQRHRDDTPR--TRDDRPRSRDDRERSR 331

Query: 245 ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD----------------------- 135
           ++  E  R R+   +R R+RD D  ++RD ER R+RD                       
Sbjct: 332 DDPVEPRRNRD---ERVRTRD-DRVRTRDDERVRTRDDERVRTRDDEMVRTRSDERVRTR 387

Query: 134 ------RVRDGER---------------SKDRGRDGEKSKDRERDRDGEKERDRDRDHHH 18
                 R RD ER                K R R+ ++ +DR+RDRD +++RDRDRD   
Sbjct: 388 DEDERVRTRDDERVRTRDEDRVRSRDEDDKPRSRNDDRDRDRDRDRDRDRDRDRDRDRER 447

Query: 17  R--DRHR 3
           R  DR R
Sbjct: 448 RRDDRDR 454

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 32/92 (34%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDL-TDSKSNHVSRDNDRESS-KSREKDRE 243
           + ERR +  + E   +  +D         D D   D   +   RD DR+   K R++DR+
Sbjct: 444 DRERRRDDRDRERRRDDDDDRDRDRDRDRDRDRGRDRHRDDRDRDRDRDRDRKDRDRDRD 503

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERE 147
             R+R+R R++ RDR R RDRD  ++RDR R+
Sbjct: 504 RDRDRDRDRDRDRDRGRDRDRDRGRNRDRRRK 535

[93][TOP]
>UniRef100_A0CS16 Chromosome undetermined scaffold_26, whole genome shotgun sequence
           n=1 Tax=Paramecium tetraurelia RepID=A0CS16_PARTE
          Length = 768

 Score =  100 bits (250), Expect = 4e-20
 Identities = 48/134 (35%), Positives = 83/134 (61%), Gaps = 2/134 (1%)
 Frame = -2

Query: 398 EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVS--RDNDRESSKSREKDRENGRERE 225
           E+  G  E +   DSS    + +D      K N     R  D    K + K++E G+++E
Sbjct: 559 EEDSGSDESDSSEDSSSDDSSDSDSSKDKQKKNQQDKKRKEDEVPVKEKPKEKERGKQKE 618

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
           ++++K +DR+R ++R+ EK R+RE+E+ R+R R+ ER K+R R+ E+ +++ER+R+ EKE
Sbjct: 619 KEKQKEKDREREKEREKEKDREREKEKEREREREKEREKEREREREREREKEREREREKE 678

Query: 44  RDRDRDHHHRDRHR 3
           R+R++    RDR R
Sbjct: 679 REREK---QRDRER 689

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 38/130 (29%), Positives = 82/130 (63%)
 Frame = -2

Query: 398 EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERK 219
           +Q + + +     D  P      +++    K     ++ DRE  K REK+++  RE+E++
Sbjct: 587 KQKKNQQDKKRKEDEVPVKEKPKEKERGKQKEKEKQKEKDREREKEREKEKDREREKEKE 646

Query: 218 REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERD 39
           RE+ R+++R ++R+ E+ R+RE+ER R+R ++ ER K R R+ +K K+++R+++ E+ER+
Sbjct: 647 REREREKEREKEREREREREREKEREREREKEREREKQRDRERQKEKEKKREKERERERE 706

Query: 38  RDRDHHHRDR 9
           +++    +++
Sbjct: 707 KEKKQKEKEK 716

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 41/139 (29%), Positives = 83/139 (59%), Gaps = 3/139 (2%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAA---DEDLTDSKSNHVSRDNDRESSKSREKDR 246
            +++++ +Q +   ED       P+        +++    K     ++ ++E  + REK++
Sbjct: 586  DKQKKNQQDKKRKEDEVPVKEKPKEKERGKQKEKEKQKEKDREREKEREKEKDREREKEK 645

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
            E  RERE++REK R+R+R R+R+ E+ R+RE+ER R++ RD ER K++ +  EK ++RER
Sbjct: 646  EREREREKEREKEREREREREREKEREREREKEREREKQRDRERQKEKEKKREKERERER 705

Query: 65   DRDGEKERDRDRDHHHRDR 9
            +++ +++    RD   + +
Sbjct: 706  EKEKKQKEKEKRDQKKKQK 724

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 43/151 (28%), Positives = 91/151 (60%), Gaps = 13/151 (8%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHV---SRDNDRESSKSREKDR 246
           EE R+  + + + E  +  ++  Q   +A+ED    +S+     S D+  +S  S++K +
Sbjct: 530 EELRQIYEQQNKIEFQHAQEALKQFGTSAEEDSGSDESDSSEDSSSDDSSDSDSSKDKQK 589

Query: 245 ENGRERERK----------REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR 96
           +N ++++RK          +EK R + + +++  EK R+RE+ER +++ R+ E+ K+R R
Sbjct: 590 KNQQDKKRKEDEVPVKEKPKEKERGKQKEKEKQKEKDREREKEREKEKDREREKEKERER 649

Query: 95  DGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           + EK +++ER+R+ E+ER+++R+   R++ R
Sbjct: 650 EREKEREKEREREREREREKERE-REREKER 679

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 38/136 (27%), Positives = 71/136 (52%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            +E+ R +Q E E +     +   +     D +    K     R+ +RE  + RE++RE  
Sbjct: 609  KEKERGKQKEKEKQKEKDREREKEREKEKDREREKEKEREREREKEREKERERERERERE 668

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            +ERER+REK R+R++ RDR+ +K ++++RE+ R+R R+ E+ +      ++ K ++    
Sbjct: 669  KEREREREKEREREKQRDRERQKEKEKKREKEREREREKEKKQKEKEKRDQKKKQKSPTP 728

Query: 56   GEKERDRDRDHHHRDR 9
             + E   D     R R
Sbjct: 729  SQSESLSDSRSRSRSR 744

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 35/134 (26%), Positives = 69/134 (51%)
 Frame = -2

Query: 431  GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            G+ + +E+++ +  E E E     D   +     + +    +     R+ +RE  K RE+
Sbjct: 614  GKQKEKEKQKEKDREREKEREKEKDREREKEKEREREREKEREKEREREREREREKERER 673

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            +RE    +ER+REK RDR+R ++++ ++ ++RERER +++ +  E+ K   +  +KS   
Sbjct: 674  ERE----KEREREKQRDRERQKEKEKKREKEREREREKEK-KQKEKEKRDQKKKQKSPTP 728

Query: 71   ERDRDGEKERDRDR 30
             +       R R R
Sbjct: 729  SQSESLSDSRSRSR 742

[94][TOP]
>UniRef100_C0IXK1 U2 snRNP auxiliary factor large subunit n=2 Tax=Solanum melongena
           RepID=C0IXK1_SOLME
          Length = 554

 Score =  100 bits (249), Expect = 5e-20
 Identities = 60/144 (41%), Positives = 85/144 (59%), Gaps = 12/144 (8%)
 Frame = -2

Query: 398 EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRD--NDRESSKSREKDRENGRERE 225
           ++ EG GED  +N+ S           +DSKS   S D   DR+SS+SREK+RE GRE++
Sbjct: 3   QENEGNGEDIENNNRS--------SPYSDSKSQRTSHDPEKDRDSSRSREKEREKGREKD 54

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG-ERSKDRGRDGEKSKDRERD----- 63
             R++ RDRDR R ++ +K RDRERER +DR R   +R +DR    E+S+DR+ D     
Sbjct: 55  HDRDRNRDRDRDRVKERDKDRDREREREKDRDRHHRDRHRDRSDRRERSRDRDEDDLPRT 114

Query: 62  RDGEKER----DRDRDHHHRDRHR 3
           RD ++ R    DR+  H H+   R
Sbjct: 115 RDYDRRRNNDKDREDRHRHKPSSR 138

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 36/131 (27%), Positives = 64/131 (48%), Gaps = 6/131 (4%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           + +R    PE + + +   +   +     D D   ++     R  +R+  + RE++RE  
Sbjct: 25  KSQRTSHDPEKDRDSSRSREKEREKGREKDHDRDRNRDRDRDRVKERDKDRDREREREKD 84

Query: 236 RE---RERKREKGRDRDRSRDRDSE---KSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           R+   R+R R++   R+RSRDRD +   ++RD +R R+ D+ R+     DR R    S+ 
Sbjct: 85  RDRHHRDRHRDRSDRRERSRDRDEDDLPRTRDYDRRRNNDKDRE-----DRHRHKPSSRA 139

Query: 74  RERDRDGEKER 42
           R R R   K +
Sbjct: 140 RSRSRSPSKSK 150

[95][TOP]
>UniRef100_A5JZU1 Eukaryotic translation initiation factor 3 subunit 10, putative n=1
            Tax=Plasmodium vivax RepID=A5JZU1_PLAVI
          Length = 1285

 Score =  100 bits (249), Expect = 5e-20
 Identities = 57/151 (37%), Positives = 86/151 (56%), Gaps = 12/151 (7%)
 Frame = -2

Query: 419  FEEERRYEQPEGEGEDNYHNDSS-PQPPAAADEDLTDSKSNHVSRD---NDRESSKSREK 252
            +E++  +++   +    Y  D++  +   A D    D       RD    D+E  + RE+
Sbjct: 1007 YEDDFSWKRGGDKAGSQYDEDNNYKRLDEAQDSSYRDRSDRREKRDWPGRDKERDRDRER 1066

Query: 251  DRENGRERERKREKGRDRDRSRDRDSE----KSRDRERERSRDRVRDGERSKDRGRDGEK 84
            DRE  R+R+R+R++ +DRDR   +D E    +S+DRERERSRDR R+  + KD  RD EK
Sbjct: 1067 DRERDRDRDRERDRDKDRDRKYRKDKEYRRDRSKDRERERSRDRDREYRKDKDYRRDREK 1126

Query: 83   SKDRE----RDRDGEKERDRDRDHHHRDRHR 3
             +DR+    RDRD +  RDRDRD+   D +R
Sbjct: 1127 ERDRDRDYRRDRDRDYRRDRDRDYRRDDDYR 1157

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 46/142 (32%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            +++E+  Y++ + E +D+ + D S +            +     RD +R+  + RE+DR+
Sbjct: 1023 QYDEDNNYKRLD-EAQDSSYRDRSDRREKRDWPGRDKERDRDRERDRERDRDRDRERDRD 1081

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRERE--RSRDRVRDGERSKDRGRDGEKSKDRE 69
              R+R+ +++K   RDRS+DR+ E+SRDR+RE  + +D  RD E+ +DR RD  + +DR+
Sbjct: 1082 KDRDRKYRKDKEYRRDRSKDRERERSRDRDREYRKDKDYRRDREKERDRDRDYRRDRDRD 1141

Query: 68   RDRDGEKERDRDRDHHHRDRHR 3
              RD +++  RD D+   D +R
Sbjct: 1142 YRRDRDRDYRRDDDYRREDDYR 1163

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 9/143 (6%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            ++ R    E + E +   D         D      K     R  DRE  +SR++DRE  +
Sbjct: 1057 DKERDRDRERDRERDRDRDRERDRDKDRDRKYRKDKEYRRDRSKDRERERSRDRDREYRK 1116

Query: 233  E----RERKREKGRDRDRSRDRDSEKSRDRERERSRD----RVRDGERSKDRGRDGEKSK 78
            +    R+R++E+ RDRD  RDRD +  RDR+R+  RD    R  D  R  D  RD +  +
Sbjct: 1117 DKDYRRDREKERDRDRDYRRDRDRDYRRDRDRDYRRDDDYRREDDYRRDDDYRRDDDYRR 1176

Query: 77   DRERD-RDGEKERDRDRDHHHRD 12
            DR+RD + GE+ RDRD + + R+
Sbjct: 1177 DRDRDYKKGERRRDRDEEEYERN 1199

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 32/95 (33%), Positives = 49/95 (51%)
 Frame = -2

Query: 293  SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
            SR+ D+   KS  +D  + +    K     D D +  R  E      R+RS  R +    
Sbjct: 995  SRNGDKYYRKSSYEDDFSWKRGGDKAGSQYDEDNNYKRLDEAQDSSYRDRSDRREKRDWP 1054

Query: 113  SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
             +D+ RD ++ +DRERDRD ++ERDRD+D   + R
Sbjct: 1055 GRDKERDRDRERDRERDRDRDRERDRDKDRDRKYR 1089

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 36/140 (25%), Positives = 57/140 (40%), Gaps = 3/140 (2%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R    E   + +Y  D   +     D D    +     RD DR+  +  +  RE+  
Sbjct: 1105 ERSRDRDREYRKDKDYRRDREKERDR--DRDYRRDRDRDYRRDRDRDYRRDDDYRREDDY 1162

Query: 233  ERERKREKGRDRDRSRDRD---SEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+    +  D  R RDRD    E+ RDR+ E       D  ++ D G + +  K  E+D
Sbjct: 1163 RRDDDYRRDDDYRRDRDRDYKKGERRRDRDEEEYERNESDVRKNHDVGDEDDNGK-MEKD 1221

Query: 62   RDGEKERDRDRDHHHRDRHR 3
            +    + D D  +HH  + R
Sbjct: 1222 KGSNSDNDSDGGNHHHAKER 1241

[96][TOP]
>UniRef100_A6R1E4 Predicted protein n=1 Tax=Ajellomyces capsulatus NAm1
           RepID=A6R1E4_AJECN
          Length = 693

 Score =  100 bits (249), Expect = 5e-20
 Identities = 53/108 (49%), Positives = 69/108 (63%), Gaps = 8/108 (7%)
 Frame = -2

Query: 302 NHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD 123
           NH SR   R +++SRE  R   R+RER RE+ R+RDR RDR+ EK RDRER+R RDR RD
Sbjct: 475 NH-SRSRSRSTARSREIVRHRERDRERDRERDRERDRERDREREKERDRERDRERDRERD 533

Query: 122 GERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHH--------RDRHR 3
            ER ++R RD ++ + R+RDRD +  R R RD+          R RHR
Sbjct: 534 RERDRERDRDRDRDRGRDRDRDRDDRRYRPRDYSRGRTRSQSARRRHR 581

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 46/89 (51%), Positives = 64/89 (71%)
 Frame = -2

Query: 293 SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           S+++ R  S+S  + RE  R RER RE+ R+RDR RDR+    RDRERE+ RDR RD ER
Sbjct: 473 SKNHSRSRSRSTARSREIVRHRERDRERDRERDRERDRE----RDREREKERDRERDRER 528

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRD 27
            ++R R+ ++ +DR+RDRD  ++RDRDRD
Sbjct: 529 DRERDRERDRERDRDRDRDRGRDRDRDRD 557

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 42/119 (35%), Positives = 68/119 (57%), Gaps = 16/119 (13%)
 Frame = -2

Query: 335 AADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDR 156
           A   ++   +     RD +R+  + RE+DRE  +ER+R+R++ RDR+R R+RD E+ RDR
Sbjct: 485 ARSREIVRHRERDRERDRERDRERDRERDREREKERDRERDRERDRERDRERDRERDRDR 544

Query: 155 ERERSRDRVRDGERSKDRGRDGEKSKDR----------------ERDRDGEKERDRDRD 27
           +R+R RDR RD +  + R RD  + + R                 RD DG ++R+R+R+
Sbjct: 545 DRDRGRDRDRDRDDRRYRPRDYSRGRTRSQSARRRHRSRSGSRNHRDTDGGRDRERERE 603

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 57/156 (36%), Positives = 81/156 (51%), Gaps = 36/156 (23%)
 Frame = -2

Query: 362 NDSSPQP-PAAADEDLTDSKSNHVSRDNDRESSKSREKDR---ENGRERERKREKGRDRD 195
           N+ SP P P+ +   L+D + +   RD DR+  + R++DR   E  R R  +  +  DRD
Sbjct: 391 NEVSPPPEPSKSSVKLSDDRRDK-DRDRDRDRDRGRDRDRHKDERSRSRTWRSSRYDDRD 449

Query: 194 R----------------------------SRDRDSEKSRD----RERERSRDRVRDGERS 111
           R                            SR R + +SR+    RER+R RDR RD ER 
Sbjct: 450 REMDLYRPSTRSKLERDMHSCGGSKNHSRSRSRSTARSREIVRHRERDRERDRERDRERD 509

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ++R R+ EK +DRERDR+ ++ERDR+RD   RDR R
Sbjct: 510 RERDREREKERDRERDRERDRERDRERD-RERDRDR 544

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 49/164 (29%), Positives = 67/164 (40%), Gaps = 67/164 (40%)
 Frame = -2

Query: 299 HVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG 120
           H  RD +R+  + RE+DRE  RERE++R++ RDR+R R+RD E+ R+R+R+R RDR RD 
Sbjct: 493 HRERDRERDRERDRERDRERDREREKERDRERDRERDRERDRERDRERDRDRDRDRGRDR 552

Query: 119 ERSKD----------------------------------------RGRDGEKSKDR---- 72
           +R +D                                        R R+ EKS  R    
Sbjct: 553 DRDRDDRRYRPRDYSRGRTRSQSARRRHRSRSGSRNHRDTDGGRDREREREKSFSRTGRR 612

Query: 71  -----------------------ERDRDGEKERDRDRDHHHRDR 9
                                   R R    +RDRDRD    DR
Sbjct: 613 SRSRSPPDIDRYVPPTSNRSRTPTRRRARTPDRDRDRDREKEDR 656

[97][TOP]
>UniRef100_Q0GNL2 Putative uncharacterized protein n=1 Tax=uncultured organism
           RepID=Q0GNL2_9ZZZZ
          Length = 107

 Score =  100 bits (248), Expect = 7e-20
 Identities = 44/96 (45%), Positives = 74/96 (77%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ ++E  + REK+R+  RE+ERKR++ R+++R R+R+ EK R+RERER R+R R+ ER 
Sbjct: 12  REREKERKREREKERKREREKERKRKREREKERKREREREKERERERERERERERERERE 71

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ++R R+ E+ ++RER+R+ E+ER+R+R+   R+R R
Sbjct: 72  RERERERERERERERERERERERERERE---RERER 104

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 39/88 (44%), Positives = 69/88 (78%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R  +RE  + RE+++E  R+RER++E+ R+R+R ++R+ E+ R+RERER R+R R+ ER 
Sbjct: 18  RKREREKERKREREKERKRKREREKERKREREREKERERERERERERERERERERERERE 77

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRD 27
           ++R R+ E+ ++RER+R+ E+ER+R+R+
Sbjct: 78  RERERERERERERERERERERERERERE 105

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 40/94 (42%), Positives = 69/94 (73%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           K     R+ +R+  + +E+ RE  +ER+RKRE+ ++R R R+R+ E+ R+RERER R+R 
Sbjct: 8   KEREREREKERKREREKERKREREKERKRKREREKERKREREREKERERERERERERERE 67

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           R+ ER ++R R+ E+ ++RER+R+ E+ER+R+R+
Sbjct: 68  RERERERERERERERERERERERERERERERERE 101

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 38/88 (43%), Positives = 69/88 (78%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ ++E  + REK+R+  RERE++R++ R+R++ R+R+ E+ R+RERER R+R R+ ER 
Sbjct: 20  REREKERKREREKERKRKREREKERKREREREKERERERERERERERERERERERERERE 79

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRD 27
           ++R R+ E+ ++RER+R+ E+ER+R+ +
Sbjct: 80  REREREREREREREREREREREREREXE 107

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 41/98 (41%), Positives = 71/98 (72%)
 Frame = -2

Query: 296 VSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE 117
           + R  +RE  + +E+ RE  +ER+R+REK R R R R+++ ++ R+RE+ER R+R R+ E
Sbjct: 4   IMRQKEREREREKERKREREKERKREREKERKRKREREKERKREREREKERERERERERE 63

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R ++R R+ E+ ++RER+R+ E+ER+R+R+   R+R R
Sbjct: 64  RERERERERERERERERERERERERERERE-RERERER 100

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 38/92 (41%), Positives = 67/92 (72%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           K     R+ +R+  + +E+ R+  RE+ERKRE+ R+++R R+R+ E+ R+RERER R+R 
Sbjct: 16  KERKREREKERKREREKERKRKREREKERKREREREKERERERERERERERERERERERE 75

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRD 33
           R+ ER ++R R+ E+ ++RER+R+ E+ER+ +
Sbjct: 76  REREREREREREREREREREREREREREREXE 107

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 37/92 (40%), Positives = 69/92 (75%)
 Frame = -2

Query: 278 RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
           R+  + +E++RE  +ER+R+REK R R+R ++R  ++ R++ER+R R+R ++ ER ++R 
Sbjct: 2   RKIMRQKEREREREKERKREREKERKREREKERKRKREREKERKREREREKERERERERE 61

Query: 98  RDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R+ E+ ++RER+R+ E+ER+R+R+   R+R R
Sbjct: 62  RERERERERERERERERERERERE-RERERER 92

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 36/100 (36%), Positives = 59/100 (59%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           R ++ E E E     +   +     +++    +     R  +RE  K RE++RE  RERE
Sbjct: 6   RQKEREREREKERKREREKERKREREKERKRKREREKERKREREREKERERERERERERE 65

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKD 105
           R+RE+ R+R+R R+R+ E+ R+RERER R+R R+ ER ++
Sbjct: 66  RERERERERERERERERERERERERERERERERERERERE 105

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 34/100 (34%), Positives = 55/100 (55%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +E  R  + E + E         +       +    +     R+ +RE  + RE++RE  
Sbjct: 8   KEREREREKERKREREKERKREREKERKRKREREKERKREREREKERERERERERERERE 67

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE 117
           RERER+RE+ R+R+R R+R+ E+ R+RERER R+R R+ E
Sbjct: 68  REREREREREREREREREREREREREREREREREREREXE 107

[98][TOP]
>UniRef100_B9S6I9 U1 small nuclear ribonucleoprotein 70 kDa, putative n=1 Tax=Ricinus
           communis RepID=B9S6I9_RICCO
          Length = 506

 Score =  100 bits (248), Expect = 7e-20
 Identities = 54/109 (49%), Positives = 72/109 (66%), Gaps = 6/109 (5%)
 Frame = -2

Query: 311 SKSNHVSRDNDRESSKSREKDRENGRERERKREKGRD--RDRSRDRDSEKSR-DRERERS 141
           S+S       DR + + REK RE GR+RE++REK R+   +R RDRD ++ R  R+R+R 
Sbjct: 257 SRSEEPRPREDRYNERDREKSRERGRDREKEREKSREHSHERPRDRDHKEDRHHRDRDRE 316

Query: 140 RDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD---HHHRDRHR 3
           RDR RD ER +DR RD ++++DR RDR  + ERDRDRD    H RDR R
Sbjct: 317 RDRERDRERGRDRDRDRDRARDRGRDRGRDYERDRDRDRGREHDRDRPR 365

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 55/135 (40%), Positives = 78/135 (57%), Gaps = 9/135 (6%)
 Frame = -2

Query: 380 GEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKR----E 213
           GE+    +S  +   +     ++       R N+R+  KSRE+ R+  +ERE+ R    E
Sbjct: 238 GEEVNQRNSGRELQQSGGSSRSEEPRPREDRYNERDREKSRERGRDREKEREKSREHSHE 297

Query: 212 KGRDRDRS-----RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
           + RDRD       RDRD E+ R+R+RER RDR RD +R++DRGRD  +  +R+RDRD  +
Sbjct: 298 RPRDRDHKEDRHHRDRDRERDRERDRERGRDRDRDRDRARDRGRDRGRDYERDRDRDRGR 357

Query: 47  ERDRDRDHHHRDRHR 3
           E DRDR    RDR R
Sbjct: 358 EHDRDRP---RDRER 369

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 51/117 (43%), Positives = 71/117 (60%), Gaps = 9/117 (7%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKRE-------KGRDRDRSRDRDSEK 168
           ED  + +    SR+  R+  K REK RE+  ER R R+       + RDR+R R+RD E+
Sbjct: 266 EDRYNERDREKSRERGRDREKEREKSREHSHERPRDRDHKEDRHHRDRDRERDRERDRER 325

Query: 167 SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR--DGEKERDRDRDHHHRDRHR 3
            RDR+R+  RDR RD  R +DRGRD E+ +DR+R R  D ++ RDR+RD+   D  R
Sbjct: 326 GRDRDRD--RDRARD--RGRDRGRDYERDRDRDRGREHDRDRPRDRERDYEVGDHDR 378

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 54/138 (39%), Positives = 69/138 (50%), Gaps = 24/138 (17%)
 Frame = -2

Query: 350 PQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERK---------REKGRDR 198
           P+P      +    KS    RD ++E  KSRE   E  R+R+ K         RE+ R+R
Sbjct: 262 PRPREDRYNERDREKSRERGRDREKEREKSREHSHERPRDRDHKEDRHHRDRDRERDRER 321

Query: 197 DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE---RDRDRD 27
           DR R RD ++ RDR R+R RDR RD ER +DR R  E  +DR RDR+ + E    DR R 
Sbjct: 322 DRERGRDRDRDRDRARDRGRDRGRDYERDRDRDRGREHDRDRPRDRERDYEVGDHDRGRS 381

Query: 26  H------------HHRDR 9
           H            H RDR
Sbjct: 382 HDRESDYDRVESKHERDR 399

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 47/143 (32%), Positives = 74/143 (51%), Gaps = 4/143 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEG--EDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE 255
           E E   E  +E+P      ED +H D   +                  RD +R+  + R+
Sbjct: 287 EREKSREHSHERPRDRDHKEDRHHRDRDRE------------------RDRERDRERGRD 328

Query: 254 KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE-RSKDRGRDGEKSK 78
           +DR+  R R+R R++GRD +R RDRD  + R+ +R+R RDR RD E    DRGR  ++  
Sbjct: 329 RDRDRDRARDRGRDRGRDYERDRDRD--RGREHDRDRPRDRERDYEVGDHDRGRSHDRES 386

Query: 77  DRER-DRDGEKERDRDRDHHHRD 12
           D +R +   E++R  +RD+ H +
Sbjct: 387 DYDRVESKHERDRRAERDYEHAE 409

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 35/82 (42%), Positives = 47/82 (57%), Gaps = 3/82 (3%)
 Frame = -2

Query: 239 GRERERKREKGRDRDRSRDRD-SEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
           G E   +R  GR+  +S     SE+ R RE    R   RD E+S++RGRD EK +++ R+
Sbjct: 237 GGEEVNQRNSGRELQQSGGSSRSEEPRPRE---DRYNERDREKSRERGRDREKEREKSRE 293

Query: 62  RDGEKERDRDR--DHHHRDRHR 3
              E+ RDRD   D HHRDR R
Sbjct: 294 HSHERPRDRDHKEDRHHRDRDR 315

[99][TOP]
>UniRef100_B6CB10 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Cryptosporidium
           hominis RepID=B6CB10_CRYHO
          Length = 161

 Score =  100 bits (248), Expect = 7e-20
 Identities = 50/127 (39%), Positives = 85/127 (66%), Gaps = 1/127 (0%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           RY + + + +DN  +D         D+D  + +     R+ +RE  + RE++RE  RERE
Sbjct: 16  RYLEQKEKDQDNNPDDD--------DDDNDNERERERERERERERERERERERERERERE 67

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERE-RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
           R+RE+ R+R+R R+R+ E+ R+RERE R R+R R+ ER ++R R+ E+ ++RER++D E+
Sbjct: 68  REREE-REREREREREKEREREREREEREREREREKEREREREREKEREREREREKDRER 126

Query: 47  ERDRDRD 27
           ER+R+R+
Sbjct: 127 ERERERE 133

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 49/104 (47%), Positives = 76/104 (73%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD 135
           D+  +    DND E  + RE++RE  RERER+RE+ R+R+R R+R+ E+ R+RERER ++
Sbjct: 26  DNNPDDDDDDNDNERERERERERERERERERERERERERERERERE-EREREREREREKE 84

Query: 134 RVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R R+ ER ++R R+ E+ K+RER+R+ EKER+R+R+   +DR R
Sbjct: 85  RERERER-EEREREREREKEREREREREKERERERE-REKDRER 126

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 51/131 (38%), Positives = 81/131 (61%), Gaps = 2/131 (1%)
 Frame = -2

Query: 407 RRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRER 228
           R  EQ E + ++N  +D         D +    +     R+ +RE  + RE++RE  RER
Sbjct: 16  RYLEQKEKDQDNNPDDDDDDN-----DNERERERERERERERERERERERERERERERER 70

Query: 227 -ERKREKGRDRDRSRDRDSEK-SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
            ER+RE+ R+R++ R+R+ E+  R+RERER ++R R+ ER K+R R+ E+ KDRER+R+ 
Sbjct: 71  EEREREREREREKEREREREREEREREREREKEREREREREKEREREREREKDRERERER 130

Query: 53  EKERDRDRDHH 21
           E+ER+ D   H
Sbjct: 131 EREREMDGKKH 141

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 46/124 (37%), Positives = 77/124 (62%), Gaps = 2/124 (1%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE-KDRENG 237
           E++  +Q     +D+  ND+  +     + +    +     R+ +RE  + RE ++RE  
Sbjct: 19  EQKEKDQDNNPDDDDDDNDNEREREREREREREREREREREREREREREREREERERERE 78

Query: 236 RERERKREKGRDRD-RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
           RERE++RE+ R+R+ R R+R+ EK R+RERER ++R R+ ER KDR R  E+ ++RER+ 
Sbjct: 79  REREKEREREREREEREREREREKEREREREREKEREREREREKDRER--EREREREREM 136

Query: 59  DGEK 48
           DG+K
Sbjct: 137 DGKK 140

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 42/117 (35%), Positives = 65/117 (55%), Gaps = 1/117 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE-K 252
           E E E ER  E+ E E E     +   +     +E     +     R+ +RE  + RE +
Sbjct: 39  ERERERERERER-EREREREREREREREREREREER---EREREREREKEREREREREER 94

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           +RE  RE+ER+RE+ R+++R R+R+ EK R+RERER R+R  DG++     + GE S
Sbjct: 95  EREREREKEREREREREKEREREREREKDREREREREREREMDGKKHGLPRKTGEGS 151

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 32/82 (39%), Positives = 54/82 (65%), Gaps = 5/82 (6%)
 Frame = -2

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK-----SKDRE 69
           ++E+ ++   D D   D D++  R+RERER R+R R+ ER ++R R+ E+      ++RE
Sbjct: 20  QKEKDQDNNPDDD---DDDNDNEREREREREREREREREREREREREREREREREERERE 76

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
           R+R+ EKER+R+R+   R+R R
Sbjct: 77  REREREKEREREREREERERER 98

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 33/106 (31%), Positives = 53/106 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E     +   +     +E           R+ +RE  K RE++
Sbjct: 59  EREREREREREREEREREREREREKEREREREREE-----------REREREREKERERE 107

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RE  +ERER+RE+ +DR+R R+R+ E+  D ++     +  +G  S
Sbjct: 108 REREKEREREREREKDREREREREREREMDGKKHGLPRKTGEGSSS 153

[100][TOP]
>UniRef100_A1BYA8 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Cryptosporidium
           hominis RepID=A1BYA8_CRYHO
          Length = 158

 Score =  100 bits (248), Expect = 7e-20
 Identities = 47/102 (46%), Positives = 75/102 (73%), Gaps = 1/102 (0%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D+D  D   N   R+ +RE  + RE++RE  RERER+RE+ R+R+R R+R+ E+ R+RER
Sbjct: 30  DDDDDDDDDNEREREREREREREREREREREREREREREE-REREREREREKERERERER 88

Query: 149 E-RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           E R R+R R+ ER ++R R+ E+ ++RER++D E+ER+R+R+
Sbjct: 89  EEREREREREKEREREREREKEREREREREKDRERERERERE 130

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 51/130 (39%), Positives = 83/130 (63%), Gaps = 2/130 (1%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           RY + + + +DN  +D         D+D  + +     R+ +RE  + RE++RE  RERE
Sbjct: 16  RYLEQKEKDQDNNPDDDD-------DDDDDNERERERERERERERERERERERERERERE 68

Query: 224 -RKREKGRDRDRSRDRDSEKS-RDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGE 51
            R+RE+ R+R++ R+R+ E+  R+RERER ++R R+ ER K+R R+ E+ KDRER+R+ E
Sbjct: 69  EREREREREREKEREREREREEREREREREKEREREREREKEREREREREKDRERERERE 128

Query: 50  KERDRDRDHH 21
           +ER+ D   H
Sbjct: 129 REREMDGKKH 138

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 47/109 (43%), Positives = 74/109 (67%), Gaps = 1/109 (0%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDS-EKSRDRER 150
           E     + N+   D+D +    RE++RE  RERER+RE+ R+R+R R+R+  E+ R+RER
Sbjct: 19  EQKEKDQDNNPDDDDDDDDDNEREREREREREREREREREREREREREREERERERERER 78

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           E+ R+R R+ E   +R R+ E+ K+RER+R+ EKER+R+R+   +DR R
Sbjct: 79  EKERERERERE---EREREREREKEREREREREKERERERE-REKDRER 123

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 47/124 (37%), Positives = 75/124 (60%), Gaps = 4/124 (3%)
 Frame = -2

Query: 407 RRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD---RENG 237
           R  EQ E + ++N  +D         + +    +     R+ +RE  + RE++   RE  
Sbjct: 16  RYLEQKEKDQDNNPDDDDDDDDDNEREREREREREREREREREREREREREREERERERE 75

Query: 236 RERERKREKGRDRD-RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
           RERE++RE+ R+R+ R R+R+ EK R+RERER ++R R+ ER KDR R  E+ ++RER+ 
Sbjct: 76  REREKEREREREREEREREREREKEREREREREKEREREREREKDRER--EREREREREM 133

Query: 59  DGEK 48
           DG+K
Sbjct: 134 DGKK 137

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 32/71 (45%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = -2

Query: 290 RDNDRESSKSRE-KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           R+ +RE  + RE ++RE  RE+ER+RE+ R+++R R+R+ EK R+RERER R+R  DG++
Sbjct: 78  REKEREREREREEREREREREKEREREREREKEREREREREKDREREREREREREMDGKK 137

Query: 113 SKDRGRDGEKS 81
                + GE S
Sbjct: 138 HGLPRKTGEGS 148

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 37/103 (35%), Positives = 53/103 (51%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E     +   +      E   + +        +RE  + REK+
Sbjct: 42  ERERERERERER-EREREREREREREREEREREREREREKEREREREREEREREREREKE 100

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG 120
           RE    RER+REK R+R+R R++D E+ R+RERER  D  + G
Sbjct: 101 RE----REREREKEREREREREKDREREREREREREMDGKKHG 139

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 33/106 (31%), Positives = 53/106 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E     +   +     +E           R+ +RE  K RE++
Sbjct: 56  EREREREREREREEREREREREREKEREREREREE-----------REREREREKERERE 104

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RE  +ERER+RE+ +DR+R R+R+ E+  D ++     +  +G  S
Sbjct: 105 REREKEREREREREKDREREREREREREMDGKKHGLPRKTGEGSSS 150

[101][TOP]
>UniRef100_C1EIV9 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EIV9_9CHLO
          Length = 554

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 52/113 (46%), Positives = 70/113 (61%), Gaps = 2/113 (1%)
 Frame = -2

Query: 335 AADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDR 156
           A + +  + +     RD DRE  + R +DR    ++ER R + RDRDR RDRD  + RDR
Sbjct: 7   AKEREDAERERRERDRDRDRERDRDRRRDRSRDGDKERDRSRSRDRDRGRDRDRGRDRDR 66

Query: 155 --ERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
              R RSR R R   R +DRGR G++ +DR+RDRD +++RDRDRD   RDR R
Sbjct: 67  RESRSRSRSRSRSRSRRRDRGR-GDRDRDRDRDRDRDRDRDRDRD-RDRDRDR 117

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 54/138 (39%), Positives = 78/138 (56%), Gaps = 3/138 (2%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E+   E+ E + + +   D   +   + D D    +S    RD  R+  + R++DR   R
Sbjct: 11  EDAERERRERDRDRDRERDRDRRRDRSRDGDKERDRSRSRDRDRGRDRDRGRDRDRRESR 70

Query: 233 ERERKREKG--RDRDRSR-DRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
            R R R +   R RDR R DRD ++ RDR+R+R RDR RD +R +DR RD    +DR+RD
Sbjct: 71  SRSRSRSRSRSRRRDRGRGDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRD----RDRDRD 126

Query: 62  RDGEKERDRDRDHHHRDR 9
           RD +++RDRDRD   R R
Sbjct: 127 RDRDRDRDRDRDREPRAR 144

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 51/141 (36%), Positives = 74/141 (52%), Gaps = 1/141 (0%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E + +R  E+      D    D   +   +   D    +     RD DR  S+SR + R 
Sbjct: 19  ERDRDRDRERDRDRRRDR-SRDGDKERDRSRSRDRDRGRDRDRGRDRDRRESRSRSRSRS 77

Query: 242 NGRERERKREKG-RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
             R R R R +G RDRDR RDRD ++ RDR+R+R RDR RD +R +DR RD ++ +DR+R
Sbjct: 78  RSRSRRRDRGRGDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDR 137

Query: 65  DRDGEKERDRDRDHHHRDRHR 3
           DR+    +  D  +    R+R
Sbjct: 138 DREPRARKPPDFSNRRPLRNR 158

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 47/123 (38%), Positives = 70/123 (56%), Gaps = 25/123 (20%)
 Frame = -2

Query: 296 VSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD-- 123
           ++++ +    + RE+DR+  RER+R R + R RD  ++RD  +SRDR+R R RDR RD  
Sbjct: 6   LAKEREDAERERRERDRDRDRERDRDRRRDRSRDGDKERDRSRSRDRDRGRDRDRGRDRD 65

Query: 122 -----------------------GERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
                                  G+R +DR RD ++ +DR+RDRD +++RDRDRD   RD
Sbjct: 66  RRESRSRSRSRSRSRSRRRDRGRGDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRD-RDRD 124

Query: 11  RHR 3
           R R
Sbjct: 125 RDR 127

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 26/78 (33%), Positives = 39/78 (50%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D    +     RD DR+  + R++DR+  R+R+R R++ RDRDR RDR+    +  + 
Sbjct: 90  DRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDREPRARKPPDF 149

Query: 149 ERSRDRVRDGERSKDRGR 96
              R     G R    GR
Sbjct: 150 SNRRPLRNRGARKAHVGR 167

[102][TOP]
>UniRef100_Q54XF1 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum
           RepID=Q54XF1_DICDI
          Length = 775

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 58/133 (43%), Positives = 77/133 (57%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           ++ E+++ +Q +  G   Y  + + +      E  T S     SRD DR+  + REKDR+
Sbjct: 544 QYYEQQQQQQQQYYGRGGYTKEYNNENKDRKYESNTKSDYKDGSRDRDRDRDRDREKDRD 603

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             RERE          R RDRD + SRDR+R+R RD  RD  R KDR RD  K +DRERD
Sbjct: 604 RERERE----------RDRDRDYKDSRDRDRDRDRD--RDSNREKDRDRD-YKDRDRERD 650

Query: 62  RDGEKERDRDRDH 24
           RD E+ERDRDRD+
Sbjct: 651 RDRERERDRDRDY 663

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/147 (36%), Positives = 76/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQP------PAAAD--EDLTDSKSNHVSRDNDRESSKS 261
           ++++  +   G  + NYH + +         P A    E     +  +  R    +   +
Sbjct: 509 QQQQHLKYYNGNVDPNYHYNGAAATQYPYYDPYAQQYYEQQQQQQQQYYGRGGYTKEYNN 568

Query: 260 REKDRE-NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
             KDR+     +   ++  RDRDR RDRD EK RDRERER RDR RD + S+DR RD   
Sbjct: 569 ENKDRKYESNTKSDYKDGSRDRDRDRDRDREKDRDRERERERDRDRDYKDSRDRDRD--- 625

Query: 83  SKDRERDRDGEKERDRDRDHHHRDRHR 3
              R+RDRD  +E+DRDRD+  RDR R
Sbjct: 626 ---RDRDRDSNREKDRDRDYKDRDRER 649

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 49/142 (34%), Positives = 73/142 (51%), Gaps = 2/142 (1%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           +YE   +  Y+    + + +   D         + +    +    SRD DR+    R++D
Sbjct: 574 KYESNTKSDYKDGSRDRDRDRDRDREKDRDRERERERDRDRDYKDSRDRDRD----RDRD 629

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG-ERSKDR-GRDGEKSKD 75
           R++ RE++R R+  +DRDR RDRD E+ RDR+R+      R G +R  DR  RDG  SKD
Sbjct: 630 RDSNREKDRDRDY-KDRDRERDRDRERERDRDRDYKDSSSRSGRDRENDRDSRDGRDSKD 688

Query: 74  RERDRDGEKERDRDRDHHHRDR 9
             RDRD +  R RD +    DR
Sbjct: 689 -NRDRDSKDNRSRDSNRSSSDR 709

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 45/110 (40%), Positives = 65/110 (59%), Gaps = 3/110 (2%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRE-NGRERERKREKGRDRDRSRD-RDSEKSRDR 156
           D D  DS+     RD DR+S++ +++DR+   R+RER R++ R+RDR RD +DS     R
Sbjct: 613 DRDYKDSRDRDRDRDRDRDSNREKDRDRDYKDRDRERDRDRERERDRDRDYKDSSSRSGR 672

Query: 155 ERERSRDRVRDGERSKD-RGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           +RE  RD  RDG  SKD R RD + ++ R+ +R    +RD  R     DR
Sbjct: 673 DRENDRDS-RDGRDSKDNRDRDSKDNRSRDSNR-SSSDRDSGRSRGSSDR 720

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 46/144 (31%), Positives = 72/144 (50%), Gaps = 10/144 (6%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRE-SSKSREKDREN 240
            E++R  E+      D  + DS  +     D D    + ++  +D DR+   + RE+DR+ 
Sbjct: 599  EKDRDRERERERDRDRDYKDSRDR-----DRDRDRDRDSNREKDRDRDYKDRDRERDRDR 653

Query: 239  GRERERKRE-------KGRDRDRSRD-RDSEKSRD-RERERSRDRVRDGERSKDRGRDGE 87
             RER+R R+        GRDR+  RD RD   S+D R+R+   +R RD  RS    RD  
Sbjct: 654  ERERDRDRDYKDSSSRSGRDRENDRDSRDGRDSKDNRDRDSKDNRSRDSNRSSS-DRDSG 712

Query: 86   KSKDRERDRDGEKERDRDRDHHHR 15
            +S+    DRD +    ++RD  +R
Sbjct: 713  RSRG-SSDRDYKDSNGKERDSSYR 735

[103][TOP]
>UniRef100_B3LCU9 Putative uncharacterized protein n=1 Tax=Plasmodium knowlesi strain
           H RepID=B3LCU9_PLAKH
          Length = 585

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 48/128 (37%), Positives = 77/128 (60%), Gaps = 1/128 (0%)
 Frame = -2

Query: 410 ERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRE-SSKSREKDRENGR 234
           ER+Y + +     ++H D         + +    +  H  +D +R    + REKD+++ R
Sbjct: 398 ERKYRKMDR----HHHRDRKSDREKEKEREKEKEREKHRLKDKERSRKERGREKDKDSER 453

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           ER+R R+K RDRDR RDRD +K RDR+R+R RDR RD +R +DR R+ +K KDR + ++ 
Sbjct: 454 ERDRDRDKDRDRDRDRDRDRDKDRDRDRDRDRDRDRDRDRERDRERERDKGKDRTKTKER 513

Query: 53  EKERDRDR 30
           EK + + +
Sbjct: 514 EKAKSKHK 521

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 46/131 (35%), Positives = 76/131 (58%), Gaps = 15/131 (11%)
 Frame = -2

Query: 374 DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN--------------- 240
           +NY   SS +        +   + +H  R +DRE  K REK++E                
Sbjct: 386 ENYRKRSSDESRERKYRKM--DRHHHRDRKSDREKEKEREKEKEREKHRLKDKERSRKER 443

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
           GRE+++  E+ RDRDR +DRD ++ RDR+R++ RDR RD +R +DR RD E+ ++RERD+
Sbjct: 444 GREKDKDSERERDRDRDKDRDRDRDRDRDRDKDRDRDRDRDRDRDRDRDRERDRERERDK 503

Query: 59  DGEKERDRDRD 27
             ++ + ++R+
Sbjct: 504 GKDRTKTKERE 514

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 36/87 (41%), Positives = 64/87 (73%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ D++S + R++DR+  R+R+R R++ RD+DR RDRD ++ RDR+R+R RDR    ER 
Sbjct: 445 REKDKDSERERDRDRDKDRDRDRDRDRDRDKDRDRDRDRDRDRDRDRDRERDR----ERE 500

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDR 30
           +D+G+D  K+K+RE+ +   K +++++
Sbjct: 501 RDKGKDRTKTKEREKAKSKHKSKNKEK 527

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 38/90 (42%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           +D++RE  + R+KDR+  R+R+R R+K RDRDR RDRD ++ RDRER+R R+R +  +R+
Sbjct: 449 KDSERERDRDRDKDRDRDRDRDRDRDKDRDRDRDRDRDRDRDRDRERDRERERDKGKDRT 508

Query: 110 KDRGRDGEKSKDRERDRD-GEKERDRDRDH 24
           K + R+  KSK + ++++ G+ +  RD ++
Sbjct: 509 KTKEREKAKSKHKSKNKEKGKSKGKRDENY 538

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 42/137 (30%), Positives = 77/137 (56%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E+ +  + E E E +   D          E   DS+     RD DR+  + R++DR+  R
Sbjct: 417 EKEKEREKEKEREKHRLKDKERSRKERGREKDKDSERE---RDRDRDKDRDRDRDRDRDR 473

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           +++R R++ RDRDR RDRD E+ R+RER++ +DR +  ER K + +   K+K++ + + G
Sbjct: 474 DKDRDRDRDRDRDRDRDRDRERDRERERDKGKDRTKTKEREKAKSKHKSKNKEKGKSK-G 532

Query: 53  EKERDRDRDHHHRDRHR 3
           +++ + D  ++   + R
Sbjct: 533 KRDENYDSSNYSEPKRR 549

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 41/143 (28%), Positives = 73/143 (51%), Gaps = 5/143 (3%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E+E+  E+ +   +    +    +     ++D    +     RD DR+  + R++DR+  
Sbjct: 417 EKEKEREKEKEREKHRLKDKERSRKERGREKDKDSERERDRDRDKDRDRDRDRDRDRDKD 476

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK-----DR 72
           R+R+R R++ RDRDR R+RD E+ RD+ ++R++ + R+  +SK + ++ EK K     D 
Sbjct: 477 RDRDRDRDRDRDRDRDRERDRERERDKGKDRTKTKEREKAKSKHKSKNKEKGKSKGKRDE 536

Query: 71  ERDRDGEKERDRDRDHHHRDRHR 3
             D     E  R     H D HR
Sbjct: 537 NYDSSNYSEPKRRSTKDHGDDHR 559

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/142 (25%), Positives = 77/142 (54%), Gaps = 3/142 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+E+  E+   + ++    +   +    ++ +    +     RD DR+  + +++D
Sbjct: 419 EKEREKEKEREKHRLKDKERSRKERGREKDKDSERERDRDRDKDRDRDRDRDRDRDKDRD 478

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD-GEKSKDR 72
           R+  R+R+R R++ R+RDR R+RD  K R + +ER + + +   ++K++G+  G++ ++ 
Sbjct: 479 RDRDRDRDRDRDRDRERDRERERDKGKDRTKTKEREKAKSKHKSKNKEKGKSKGKRDENY 538

Query: 71  ERDRDGEKERDRDRDH--HHRD 12
           +     E +R   +DH   HRD
Sbjct: 539 DSSNYSEPKRRSTKDHGDDHRD 560

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 47/136 (34%), Positives = 64/136 (47%), Gaps = 32/136 (23%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR------DRSRDRDSEKSRDRE 153
           D+ SN   RD + ES       R +   RERK     D       +  R R S++SR+R+
Sbjct: 343 DTHSN--IRDEEEESGWREGYKRSDSHLRERKSNPDDDTRTYYNGENYRKRSSDESRERK 400

Query: 152 ---------RERSRDRVRDGERS-----------------KDRGRDGEKSKDRERDRDGE 51
                    R+R  DR ++ ER                  K+RGR+ +K  +RERDRD +
Sbjct: 401 YRKMDRHHHRDRKSDREKEKEREKEKEREKHRLKDKERSRKERGREKDKDSERERDRDRD 460

Query: 50  KERDRDRDHHHRDRHR 3
           K+RDRDRD   RDR R
Sbjct: 461 KDRDRDRD---RDRDR 473

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 40/158 (25%), Positives = 71/158 (44%), Gaps = 13/158 (8%)
 Frame = -2

Query: 437 TMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAAD-EDLTDSKSNHVSRDNDRESSKS 261
           T G+Y    E R++         ++N S  +  + ++ ED   +   +     D   S  
Sbjct: 291 TYGKYT--TEHRHDTYSSRNTSPHNNPSDSRKVSQSNYEDNHRAGERYSKYRQDDTHSNI 348

Query: 260 REKDRENGRERERKREKGRDRDRSRDRDSE------------KSRDRERERSRDRVRDGE 117
           R+++ E+G     KR     R+R  + D +            +S D  RER + R  D  
Sbjct: 349 RDEEEESGWREGYKRSDSHLRERKSNPDDDTRTYYNGENYRKRSSDESRER-KYRKMDRH 407

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             +DR  D EK K+RE++++ EK R +D++   ++R R
Sbjct: 408 HHRDRKSDREKEKEREKEKEREKHRLKDKERSRKERGR 445

[104][TOP]
>UniRef100_A1BYB0 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Cryptosporidium
           hominis RepID=A1BYB0_CRYHO
          Length = 161

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 50/127 (39%), Positives = 85/127 (66%), Gaps = 1/127 (0%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           RY + + + +DN  +D         D+D  + +     R+ +RE  + RE++RE  RERE
Sbjct: 16  RYLEQKEKDQDNNPDDD--------DDDDDNERERERERERERERERERERERERERERE 67

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERE-RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
           R+RE+ R+R+R R+R+ E+ R+RERE R R+R R+ ER ++R R+ E+ ++RER++D E+
Sbjct: 68  REREE-REREREREREKEREREREREEREREREREKEREREREREKEREREREREKDRER 126

Query: 47  ERDRDRD 27
           ER+R+R+
Sbjct: 127 ERERERE 133

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 50/118 (42%), Positives = 82/118 (69%), Gaps = 1/118 (0%)
 Frame = -2

Query: 353 SPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRD- 177
           SP+     ++   D  +N    D+D ++ + RE++RE  RERER+RE+ R+R+R R+R+ 
Sbjct: 11  SPKLLRYLEQKEKDQDNNPDDDDDDDDNERERERERERERERERERERERERERERERER 70

Query: 176 SEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            E+ R+RERER ++R R+ ER ++R R+ E+ K+RER+R+ EKER+R+R+   +DR R
Sbjct: 71  EEREREREREREKERERERER-EEREREREREKEREREREREKERERERE-REKDRER 126

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 44/136 (32%), Positives = 78/136 (57%), Gaps = 5/136 (3%)
 Frame = -2

Query: 440 PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
           P +  Y  ++E+  +    + +D+  N+   +     + +    +     R+ +RE  + 
Sbjct: 12  PKLLRYLEQKEKDQDNNPDDDDDDDDNERERERERERERERERERERERERERERERERE 71

Query: 260 -----REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR 96
                RE++RE  RERER+RE+ R+R+R R+++ E+ R+RE+ER R+R    ER KDR R
Sbjct: 72  EREREREREREKEREREREREE-REREREREKEREREREREKERERER----EREKDRER 126

Query: 95  DGEKSKDRERDRDGEK 48
             E+ ++RER+ DG+K
Sbjct: 127 --EREREREREMDGKK 140

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 42/117 (35%), Positives = 65/117 (55%), Gaps = 1/117 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE-K 252
           E E E ER  E+ E E E     +   +     +E     +     R+ +RE  + RE +
Sbjct: 39  ERERERERERER-EREREREREREREREREREREER---EREREREREKEREREREREER 94

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           +RE  RE+ER+RE+ R+++R R+R+ EK R+RERER R+R  DG++     + GE S
Sbjct: 95  EREREREKEREREREREKEREREREREKDREREREREREREMDGKKHGLPRKTGEGS 151

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 33/106 (31%), Positives = 53/106 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E     +   +     +E           R+ +RE  K RE++
Sbjct: 59  EREREREREREREEREREREREREKEREREREREE-----------REREREREKERERE 107

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RE  +ERER+RE+ +DR+R R+R+ E+  D ++     +  +G  S
Sbjct: 108 REREKEREREREREKDREREREREREREMDGKKHGLPRKTGEGSSS 153

[105][TOP]
>UniRef100_A0E4N3 Chromosome undetermined scaffold_78, whole genome shotgun sequence
           n=1 Tax=Paramecium tetraurelia RepID=A0E4N3_PARTE
          Length = 842

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 40/130 (30%), Positives = 83/130 (63%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +++ + +  + E +               +++    +     R+ +RE  K RE++RE  
Sbjct: 377 DKKEKIKDKDNEKDREKEKQREKDKEREKEKEKEKEREKEKEREREREKEKEREREREKE 436

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           +ERER+REK ++R++ R+R+ EK ++RERE+ R+R+++ E+ ++R R+ EK K++E++R+
Sbjct: 437 KEREREREKEKEREKEREREKEKQKEREREKERERLKEKEKEREREREREKEKEKEKERE 496

Query: 56  GEKERDRDRD 27
            EKER+++R+
Sbjct: 497 REKEREKERE 506

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 47/143 (32%), Positives = 88/143 (61%), Gaps = 1/143 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+E+  E+ E E E     +   +     +++    +     R+ +RE  K ++K+
Sbjct: 404 EKEKEKEKEREK-EKEREREREKEKEREREREKEKEREREREKEKEREKEREREKEKQKE 462

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           RE  +ERER +EK ++R+R R+R+ EK +++ERER ++R ++ ER K++ R+ EK K++E
Sbjct: 463 REREKERERLKEKEKEREREREREKEKEKEKEREREKEREKEREREKEKEREKEKEKEKE 522

Query: 68  RDRDGEKERDRDRD-HHHRDRHR 3
           ++R  EKE++ +R+    R++ R
Sbjct: 523 KERQREKEKEIEREKEKEREKER 545

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 46/143 (32%), Positives = 88/143 (61%), Gaps = 1/143 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E+  E E E     +   +     +++    K     R+ ++E  + +EK
Sbjct: 416 EKEREREREKEKEREREREKEKEREREREKEKEREKEREREKEKQKEREREKERERLKEK 475

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           ++E  RERER++EK ++++R R+++ EK R+RE+E+ R++ ++ E+ K+R R+ EK  +R
Sbjct: 476 EKEREREREREKEKEKEKEREREKEREKEREREKEKEREKEKEKEKEKERQREKEKEIER 535

Query: 71  ERDRDGEKERDRDRDHHHRDRHR 3
           E++++ EKER R ++   +D++R
Sbjct: 536 EKEKEREKERQRQKE---KDKYR 555

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 40/130 (30%), Positives = 83/130 (63%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +E+ + +  E + E     +   +     +++    K     R+ ++E  + RE+++E  
Sbjct: 379 KEKIKDKDNEKDREKEKQREKDKEREKEKEKEKEREKEKEREREREKEKEREREREKEKE 438

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           RERER++EK R+++R R+++ +K R+RE+ER R + ++ ER ++R R+ EK K++ER+R+
Sbjct: 439 REREREKEKEREKEREREKEKQKEREREKERERLKEKEKEREREREREKEKEKEKERERE 498

Query: 56  GEKERDRDRD 27
            E+E++R+R+
Sbjct: 499 KEREKERERE 508

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 53/164 (32%), Positives = 94/164 (57%), Gaps = 22/164 (13%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDN------YHNDSSPQPPAAADED-----------LTDSKSN 300
           E +  E+R  E+ +G+ E          N+ +P+     D D           L D K  
Sbjct: 322 EKQQREQRERERAKGQREQRDRELLKMKNNINPKQTTDWDRDDRIEDEQEPIKLKDKKEK 381

Query: 299 HVSRDN--DRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVR 126
              +DN  DRE  K REKD+E  RE+E+++EK R++++ R+R+ EK ++RERER +++ R
Sbjct: 382 IKDKDNEKDREKEKQREKDKE--REKEKEKEKEREKEKEREREREKEKEREREREKEKER 439

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDR---DHHHRDRHR 3
           + ER K++ R+ E+ +++E+ ++ E+E++R+R       R+R R
Sbjct: 440 EREREKEKEREKEREREKEKQKEREREKERERLKEKEKERERER 483

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 39/137 (28%), Positives = 85/137 (62%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E+ +  + + E E     +   +     + +    K     R+ ++E  + REK++E  +
Sbjct: 392 EKEKQREKDKEREKEKEKEKEREKEKEREREREKEKEREREREKEKEREREREKEKEREK 451

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           ERER++EK ++R+R ++R+  K +++ERER R+R ++ E+ K+R R+ E+ K+RER+++ 
Sbjct: 452 EREREKEKQKEREREKERERLKEKEKEREREREREKEKEKEKEREREKEREKEREREKEK 511

Query: 53  EKERDRDRDHHHRDRHR 3
           E+E++++++   ++R R
Sbjct: 512 EREKEKEKE-KEKERQR 527

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 46/135 (34%), Positives = 83/135 (61%), Gaps = 1/135 (0%)
 Frame = -2

Query: 428 EYEFEEERRYE-QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E+ER  E + E E E     +   Q     +++    K     R+ +RE  K +EK
Sbjct: 432 EREKEKEREREREKEKEREKEREREKEKQKEREREKERERLKEKEKEREREREREKEKEK 491

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           ++E  RERE++REK R+R++ ++R+ EK +++E+ER R++ ++ ER K++ R+ E+ + +
Sbjct: 492 EKE--REREKEREKEREREKEKEREKEKEKEKEKERQREKEKEIEREKEKEREKERQRQK 549

Query: 71  ERDRDGEKERDRDRD 27
           E+D+  EK++DR  D
Sbjct: 550 EKDKYREKDQDRQND 564

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 37/130 (28%), Positives = 83/130 (63%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +E++R +  E E E     +   +     + +    +     ++ +RE  + +EK+RE  
Sbjct: 393 KEKQREKDKEREKEKEKEKEREKEKEREREREKEKEREREREKEKEREREREKEKEREKE 452

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           RERE++++K R+R++ R+R  EK ++RERER R++ ++ E+ ++R ++ EK ++RE++++
Sbjct: 453 REREKEKQKEREREKERERLKEKEKEREREREREKEKEKEKEREREKEREKEREREKEKE 512

Query: 56  GEKERDRDRD 27
            EKE++++++
Sbjct: 513 REKEKEKEKE 522

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 48/137 (35%), Positives = 79/137 (57%), Gaps = 3/137 (2%)
 Frame = -2

Query: 428 EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER R ++ E E E     +   +     + +    K     R+ +RE  K +EK
Sbjct: 434 EKEKEREREREKEKEREKEREREKEKQKEREREKERERLKEKEKEREREREREKEKEKEK 493

Query: 251 DREN--GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           +RE    RE+ER+REK ++R++ ++++ EK R RE+E+  +R ++ ER K+R R  EK K
Sbjct: 494 EREREKEREKEREREKEKEREKEKEKEKEKERQREKEKEIEREKEKEREKERQRQKEKDK 553

Query: 77  DRERDRDGEKERDRDRD 27
            RE+D+D + ++DR  D
Sbjct: 554 YREKDQDRQNDKDRQND 570

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 37/130 (28%), Positives = 81/130 (62%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +E  + ++ E E E     +   +     + +    K     R+ ++E  K RE+++E  
Sbjct: 401 KEREKEKEKEKEREKEKEREREREKEKEREREREKEKEREREREKEKEREKEREREKEKQ 460

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           +ERER++E+ R +++ ++R+ E+ R++E+E+ ++R R+ ER K+R R+ EK +++E++++
Sbjct: 461 KEREREKERERLKEKEKEREREREREKEKEKEKEREREKEREKEREREKEKEREKEKEKE 520

Query: 56  GEKERDRDRD 27
            EKER R+++
Sbjct: 521 KEKERQREKE 530

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 35/130 (26%), Positives = 82/130 (63%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +++ R ++ E E E     +   +     + +    K     R+ ++E  + +E++RE  
Sbjct: 399 KDKEREKEKEKEKEREKEKEREREREKEKEREREREKEKEREREREKEKEREKEREREKE 458

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           +++ER+REK R+R + ++++ E+ R+RE+E+ +++ R+ E+ +++ R+ EK K+RE++++
Sbjct: 459 KQKEREREKERERLKEKEKEREREREREKEKEKEKEREREKEREKEREREKEKEREKEKE 518

Query: 56  GEKERDRDRD 27
            EKE++R R+
Sbjct: 519 KEKEKERQRE 528

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 45/145 (31%), Positives = 83/145 (57%), Gaps = 6/145 (4%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+E+  E+ E E E     +   +     + +    K     R+ +RE  K +EK+
Sbjct: 420 EREREKEKERER-EREKEKEREREREKEKEREKEREREKEKQKEREREKERERLKEKEKE 478

Query: 248 RENGRERERKREKGRDRDRS------RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
           RE  RERE+++EK ++R+R       R+R+ EK R++E+E+ +++ R  E+ K+  R+ E
Sbjct: 479 REREREREKEKEKEKEREREKEREKEREREKEKEREKEKEKEKEKERQREKEKEIEREKE 538

Query: 86  KSKDRERDRDGEKERDRDRDHHHRD 12
           K +++ER R  EK++ R++D   ++
Sbjct: 539 KEREKERQRQKEKDKYREKDQDRQN 563

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 39/139 (28%), Positives = 78/139 (56%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+ER  E+ E + E     +         + +    +     ++ +RE  K REK+
Sbjct: 446 EKEREKEREREK-EKQKEREREKERERLKEKEKEREREREREKEKEKEKEREREKEREKE 504

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           RE  +E+ER++EK +++++ R R+ EK  +RE+E+ R++ R  ++ KD+ R+ ++ +  +
Sbjct: 505 REREKEKEREKEKEKEKEKERQREKEKEIEREKEKEREKERQRQKEKDKYREKDQDRQND 564

Query: 68  RDRDGEKERDRDRDHHHRD 12
           +DR  +KE+ R   +  +D
Sbjct: 565 KDRQNDKEKYRSNRYEKKD 583

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 39/144 (27%), Positives = 82/144 (56%), Gaps = 2/144 (1%)
 Frame = -2

Query: 428 EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E+ER R ++ E E E     +   +     + +    K     R+ ++E  + +EK
Sbjct: 462 EREREKERERLKEKEKEREREREREKEKEKEKERERE----KEREKEREREKEKEREKEK 517

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           ++E  +ER+R++EK  +R++ ++R+ E+ R +E+++ R++ +D +  KDR  D EK +  
Sbjct: 518 EKEKEKERQREKEKEIEREKEKEREKERQRQKEKDKYREKDQDRQNDKDRQNDKEKYRSN 577

Query: 71  ERDRDGEKERDRDRD-HHHRDRHR 3
             ++  E+ + +D++ HH+ D+ R
Sbjct: 578 RYEKKDERYQQKDKNVHHYEDKRR 601

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 39/148 (26%), Positives = 75/148 (50%), Gaps = 6/148 (4%)
 Frame = -2

Query: 428 EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER R ++ E E E     +   +     +++    K     ++  RE  K  E+
Sbjct: 476 EKEREREREREKEKEKEKEREREKEREKEREREKEKEREKEKEKEKEKERQREKEKEIER 535

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           ++E  RE+ER+R+K +D+ R +D+D +  +DR+ ++ + R    E+  +R +  +K+   
Sbjct: 536 EKEKEREKERQRQKEKDKYREKDQDRQNDKDRQNDKEKYRSNRYEKKDERYQQKDKNVHH 595

Query: 71  ERDRDGEKERDRDRD-----HHHRDRHR 3
             D+  ++ RDR R+     +  RDR +
Sbjct: 596 YEDKRRKRSRDRSREKPNYSNDRRDREK 623

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 38/142 (26%), Positives = 64/142 (45%), Gaps = 7/142 (4%)
 Frame = -2

Query: 428 EYEFEEERRYE-QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E + E E E     +   +     +      K     ++ +RE  + R+K
Sbjct: 490 EKEKEREREKEREKEREREKEKEREKEKEKEKEKERQREKEKEIEREKEKEREKERQRQK 549

Query: 251 DRENGRERERKREKGRDR--DRSRDRDSEKSRDRERERSRDR----VRDGERSKDRGRDG 90
           +++  RE+++ R+  +DR  D+ + R +   +  ER + +D+      D  R + R R  
Sbjct: 550 EKDKYREKDQDRQNDKDRQNDKEKYRSNRYEKKDERYQQKDKNVHHYEDKRRKRSRDRSR 609

Query: 89  EKSKDRERDRDGEKERDRDRDH 24
           EK       RD EK  D+DR H
Sbjct: 610 EKPNYSNDRRDREKRNDKDRKH 631

[106][TOP]
>UniRef100_Q54WE5 Serine/threonine-protein kinase prpf4B n=1 Tax=Dictyostelium
           discoideum RepID=PRP4B_DICDI
          Length = 811

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 57/144 (39%), Positives = 84/144 (58%)
 Frame = -2

Query: 440 PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
           P+ G+ + E +     P    E +     SP    ++    +   SN+  R  D   S S
Sbjct: 32  PSSGKEDGEVDEVTSSPASR-ETSSSKLMSPSKNQSSSSSRSYHDSNNGYRRKDERYSSS 90

Query: 260 REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           R  DR N R+R+  R+  R+RDR R+RD  + RDR+R+R RDR RD ER +DR RD ++ 
Sbjct: 91  RSYDR-NYRDRDISRDGDRERDRDRERD--RDRDRDRDRDRDRDRDRERDRDRDRDRDRD 147

Query: 80  KDRERDRDGEKERDRDRDHHHRDR 9
           +DR+RDRD E+ER+RDRD + ++R
Sbjct: 148 RDRDRDRDRERERERDRDRNSQER 171

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 48/91 (52%), Positives = 60/91 (65%)
 Frame = -2

Query: 284 NDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKD 105
           N R+   SR+ DRE  R+RER R++ RDRDR RDRD    RDRER+R RDR RD +R +D
Sbjct: 96  NYRDRDISRDGDRERDRDRERDRDRDRDRDRDRDRD----RDRERDRDRDRDRDRDRDRD 151

Query: 104 RGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
           R RD E  ++RERDRD   +    R+ H RD
Sbjct: 152 RDRDRE--RERERDRDRNSQERGSRNSHERD 180

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/117 (37%), Positives = 66/117 (56%), Gaps = 4/117 (3%)
 Frame = -2

Query: 377 EDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR 198
           +D  ++ S        D D++        RD +R+  + R++DR+  R+R+R+R++ RDR
Sbjct: 83  KDERYSSSRSYDRNYRDRDISRDGDRERDRDRERDRDRDRDRDRDRDRDRDRERDRDRDR 142

Query: 197 DRSRDRDSEKSRDRERERSRDRVRDGERSKDRG---RDGEKSKDRERD-RDGEKERD 39
           DR RDRD ++ RDRERER RDR R+ +    R    RD   ++D  RD RD    RD
Sbjct: 143 DRDRDRDRDRDRDRERERERDRDRNSQERGSRNSHERDYRDNRDYSRDSRDNMDSRD 199

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 44/97 (45%), Positives = 60/97 (61%), Gaps = 3/97 (3%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR--DRSRDRDSEKSRDRERERSRD 135
           +   +SRD DRE  + RE+DR+  R+R+R R++ RDR  DR RDRD    RDR+R+R RD
Sbjct: 98  RDRDISRDGDRERDRDRERDRDRDRDRDRDRDRDRDRERDRDRDRD----RDRDRDRDRD 153

Query: 134 RVRDGERSKDRGRDG-EKSKDRERDRDGEKERDRDRD 27
           R R+ ER +DR R+  E+      +RD    RD  RD
Sbjct: 154 RDRERERERDRDRNSQERGSRNSHERDYRDNRDYSRD 190

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 35/124 (28%), Positives = 62/124 (50%), Gaps = 1/124 (0%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           ++ RY        +    D S       D D    +     RD DR+  + RE+DR+  R
Sbjct: 83  KDERYSSSRSYDRNYRDRDISRDGDRERDRDRERDRDRDRDRDRDRDRDRDRERDRDRDR 142

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRD-RVRDGERSKDRGRDGEKSKDRERDRD 57
           +R+R R++ RDRDR R+R+ ++ R+ +   SR+   RD   ++D  RD   + D   +++
Sbjct: 143 DRDRDRDRDRDRDRERERERDRDRNSQERGSRNSHERDYRDNRDYSRDSRDNMDSRDNKN 202

Query: 56  GEKE 45
           G ++
Sbjct: 203 GSRQ 206

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 34/128 (26%), Positives = 60/128 (46%), Gaps = 2/128 (1%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
           +G+ E +   +         D D    +     RD DR+  + R++DR+  RERER+R++
Sbjct: 105 DGDRERDRDRERDRDRDRDRDRDRDRDRDRERDRDRDRDRDRDRDRDRDRDRERERERDR 164

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR--GRDGEKSKDRERDRDGEKERDR 36
            R+   S++R S  S +R+   +RD  RD   + D    ++G +          EK+ DR
Sbjct: 165 DRN---SQERGSRNSHERDYRDNRDYSRDSRDNMDSRDNKNGSRQSINNNTLSYEKQADR 221

Query: 35  DRDHHHRD 12
             +   +D
Sbjct: 222 KDEVRVKD 229

[107][TOP]
>UniRef100_A9TSN9 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9TSN9_PHYPA
          Length = 1072

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 57/171 (33%), Positives = 91/171 (53%), Gaps = 29/171 (16%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDN---DRESSKSR 258
           E E ++ER++ + E  G+ +   +   +  +  D+D  + K     RD    +R+    +
Sbjct: 20  ERERDKERKHREREKRGDRDLEKERDERKRSRRDDDGVEVKDKEKERDRKGGERDREGKK 79

Query: 257 EKDRENGRERE--------------------------RKREKGRDRDRSRDRDSEKSRDR 156
           E+DRE  RERE                           +RE+ R+++R R+R+ E+ R+ 
Sbjct: 80  ERDREREREREAEEERDRKRRKKDEDESREREEIREKEEREREREKERLREREKERDREE 139

Query: 155 ERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ERE+SR+R R+ E+S+DR +D EK KDRE+ RD  +ER RD+D   RDR R
Sbjct: 140 EREKSREREREREKSRDRDKDKEKEKDREKGRDKHRERTRDKD---RDRER 187

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 54/139 (38%), Positives = 80/139 (57%), Gaps = 1/139 (0%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD-REN 240
           E+ER  +  E + E     D   +    A+E+  D K      D  RE  + REK+ RE 
Sbjct: 63  EKERDRKGGERDREGKKERDREREREREAEEE-RDRKRRKKDEDESREREEIREKEERER 121

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
            RE+ER RE+ ++RDR  +R+  + R+RERE+SRDR +D E+ KDR +  +K ++R RD+
Sbjct: 122 EREKERLREREKERDREEEREKSREREREREKSRDRDKDKEKEKDREKGRDKHRERTRDK 181

Query: 59  DGEKERDRDRDHHHRDRHR 3
           D ++ERD       RDR R
Sbjct: 182 DRDRERDLRSGEGDRDRDR 200

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 50/141 (35%), Positives = 82/141 (58%), Gaps = 1/141 (0%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           G+ E + ER  E+ E E E +       +  +   E++ + +     R+ ++E  + REK
Sbjct: 77  GKKERDRERERER-EAEEERDRKRRKKDEDESREREEIREKEERE--REREKERLREREK 133

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           +R+   ERE+ RE+ R+R++SRDRD +K ++++RE+ RD+ R+  R KDR        DR
Sbjct: 134 ERDREEEREKSREREREREKSRDRDKDKEKEKDREKGRDKHRERTRDKDR--------DR 185

Query: 71  ERD-RDGEKERDRDRDHHHRD 12
           ERD R GE +RDRDR    ++
Sbjct: 186 ERDLRSGEGDRDRDRKRRRKE 206

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 47/134 (35%), Positives = 78/134 (58%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E EEER  ++ + + +++   +   +     + +    K     R+ +R+  + REK 
Sbjct: 88  EREAEEERDRKRRKKDEDESREREEIREKE---EREREREKERLREREKERDREEEREKS 144

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           RE  RERER++ + RD+D+ +++D EK RD+ RER+RD+ RD ER   R  +G++ +DR+
Sbjct: 145 RE--REREREKSRDRDKDKEKEKDREKGRDKHRERTRDKDRDRERDL-RSGEGDRDRDRK 201

Query: 68  RDRDGEKERDRDRD 27
           R R   KE D  RD
Sbjct: 202 RRR---KEEDAARD 212

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 48/144 (33%), Positives = 71/144 (49%), Gaps = 4/144 (2%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E EE R  E+ E E E     +   +     + + +  +     +  DR+  K +EKDRE
Sbjct: 109 EREEIREKEEREREREKERLREREKERDREEEREKSREREREREKSRDRDKDKEKEKDRE 168

Query: 242 NGRERERKREKGRDRDRSRDRD---SEKSRDRERERSRDRVRDGERSKDRGRDGEK-SKD 75
            GR++ R+R   RD+DR R+RD    E  RDR+R+R R       + +D  RD  K  KD
Sbjct: 169 KGRDKHRERT--RDKDRDRERDLRSGEGDRDRDRKRRR-------KEEDAARDDLKVKKD 219

Query: 74  RERDRDGEKERDRDRDHHHRDRHR 3
            E D D E+E+ R  +   + R R
Sbjct: 220 PENDEDPEEEQKRLDEEIDKRRRR 243

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 39/101 (38%), Positives = 58/101 (57%), Gaps = 12/101 (11%)
 Frame = -2

Query: 278 RESSKSREKDRENGRERERKRE---KGRDRDRSRDRDSEKSRDRERERSRD----RVRDG 120
           R+  + REKD  +    ER+R+   K R+R++  DRD EK RD  +   RD     V+D 
Sbjct: 3   RDKYRDREKDYGDKEHWERERDKERKHREREKRGDRDLEKERDERKRSRRDDDGVEVKDK 62

Query: 119 ERSKD-----RGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
           E+ +D     R R+G+K +DRER+R+ E E +RDR    +D
Sbjct: 63  EKERDRKGGERDREGKKERDREREREREAEEERDRKRRKKD 103

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 40/119 (33%), Positives = 67/119 (56%), Gaps = 10/119 (8%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D +       H  R+ D+E  K RE+++   R+ E++R++ R R R RD D  + +D+E+
Sbjct: 8   DREKDYGDKEHWERERDKER-KHREREKRGDRDLEKERDE-RKRSR-RDDDGVEVKDKEK 64

Query: 149 ERSR---DRVRDGERSKDRGRDGEKSKDRERDR-------DGEKERDRDRDHHHRDRHR 3
           ER R   +R R+G++ +DR R+ E+  + ERDR       D  +ER+  R+   R+R R
Sbjct: 65  ERDRKGGERDREGKKERDREREREREAEEERDRKRRKKDEDESREREEIREKEERERER 123

[108][TOP]
>UniRef100_Q23LR2 Putative uncharacterized protein n=1 Tax=Tetrahymena thermophila
           SB210 RepID=Q23LR2_TETTH
          Length = 215

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 46/138 (33%), Positives = 85/138 (61%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           +  +ER+ E+ +   ++        +      E   + K     ++  +E  K R+K+R+
Sbjct: 43  QLNQERKKERKKERKKERKKERKKERKKERKKERKKERKKER-KKERKKERKKERKKERK 101

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R++ERKRE+ R+R+R R+R+ E+ R+RERER R+R R+ ER ++R R+ E+ ++RER+
Sbjct: 102 KERKKERKRERERERERERERERERERERERERERERERERERERERERERERERERERE 161

Query: 62  RDGEKERDRDRDHHHRDR 9
           R+ E+ER+R+R+   R +
Sbjct: 162 RERERERERERERRRRKK 179

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 41/96 (42%), Positives = 71/96 (73%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           ++  +E  K R+K+R+  R++ERK+E+ R+R+R R+R+ E+ R+RERER R+R R+ ER 
Sbjct: 82  KERKKERKKERKKERKKERKKERKKERKRERERERERERERERERERERERERERERERE 141

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ++R R+ E+ ++RER+R+ E+ER+R+R+     R R
Sbjct: 142 RERERERERERERERERERERERERERERERERRRR 177

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 41/102 (40%), Positives = 72/102 (70%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           K     R  +R+  + +E+ +E  +ER+++R+K R R+R R+R+ E+ R+RERER R+R 
Sbjct: 74  KERKKERKKERKKERKKERKKERKKERKKERKKERKRERERERERERERERERERERERE 133

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R+ ER ++R R+ E+ ++RER+R+ E+ER+R+R+   R+R R
Sbjct: 134 RERERERERERERERERERERERERERERERERE-RERERER 174

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 40/100 (40%), Positives = 68/100 (68%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           K     R  +R+  + +E+ +E  RERER+RE+ R+R+R R+R+ E+ R+RERER R+R 
Sbjct: 86  KERKKERKKERKKERKKERKKERKRERERERERERERERERERERERERERERERERERE 145

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           R+ ER ++R R+ E+ ++RER+R+ E+ER R +    + +
Sbjct: 146 RERERERERERERERERERERERERERERRRRKKQSEQQK 185

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 38/94 (40%), Positives = 64/94 (68%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           K     R  +R+  + RE++RE  RERER+RE+ R+R+R R+R+ E+ R+RERER R+R 
Sbjct: 94  KERKKERKKERKKERKRERERERERERERERERERERERERERERERERERERERERERE 153

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           R+ ER ++R R+ E+ ++RER R  ++   + ++
Sbjct: 154 RERERERERERERERERERERRRRKKQSEQQKKE 187

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 37/100 (37%), Positives = 71/100 (71%)
 Frame = -2

Query: 302 NHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD 123
           N ++++  +E  K R+K+R+  R++ERK+E+ ++R + R ++ +K R +ER++ R + R 
Sbjct: 42  NQLNQERKKERKKERKKERKKERKKERKKERKKERKKERKKERKKERKKERKKERKKERK 101

Query: 122 GERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            ER K+R R+ E+ ++RER+R+ E+ER+R+R+   R+R R
Sbjct: 102 KERKKERKRERERERERERERERERERERERE-RERERER 140

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 39/134 (29%), Positives = 82/134 (61%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           R  Q  G+ +    ++ + +     +++    +     ++  +E  K R+K+R+  R++E
Sbjct: 20  RQVQQSGKKKATNQSNKNLKSKNQLNQERKKERKKERKKERKKERKKERKKERKKERKKE 79

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
           RK+E+ ++R + R ++ +K R +ER++ R R R+ ER ++R R+ E+ ++RER+R+ E+E
Sbjct: 80  RKKERKKERKKERKKERKKERKKERKKERKRERERERERERERERERERERERERERERE 139

Query: 44  RDRDRDHHHRDRHR 3
           R+R+R+   R+R R
Sbjct: 140 RERERE-RERERER 152

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 40/127 (31%), Positives = 72/127 (56%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E ++ER+ E+ +   ++        +      E   + K     R+ +RE  + RE++RE
Sbjct: 71  ERKKERKKERKKERKKERKKERKKERKKERKKERKKERKRER-ERERERERERERERERE 129

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             RERER+RE+ R+R+R R+R+ E+ R+RERER R+R R+ ER + R +   + + +E  
Sbjct: 130 RERERERERERERERERERERERERERERERERERERERERERERRRRKKQSEQQKKEIQ 189

Query: 62  RDGEKER 42
            + + +R
Sbjct: 190 SNNKIKR 196

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 27/109 (24%), Positives = 68/109 (62%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           +  +  S     +  +++      + ++E  +ER+++R+K R ++R ++R  E+ ++R++
Sbjct: 19  ERQVQQSGKKKATNQSNKNLKSKNQLNQERKKERKKERKKERKKERKKERKKERKKERKK 78

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ER ++R ++ ++ + + R  E+ K+R+++R  E+ER+R+R+   R+R R
Sbjct: 79  ERKKERKKERKKERKKERKKERKKERKKERKRERERERERE-RERERER 126

[109][TOP]
>UniRef100_C7YQY7 Putative uncharacterized protein n=1 Tax=Nectria haematococca mpVI
           77-13-4 RepID=C7YQY7_NECH7
          Length = 782

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 46/119 (38%), Positives = 73/119 (61%), Gaps = 1/119 (0%)
 Frame = -2

Query: 362 NDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRD 183
           N S  + P + D    DS      R+ DR+  + R++D    R+R+  R+   + DR  D
Sbjct: 3   NGSRSRDPDSRDPRDADSPERDRDRERDRDRDRDRDRDLNRDRDRDLDRDSDTELDRDYD 62

Query: 182 RDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD-HHHRDR 9
           RD ++ RD +R+R+RDR RD +R +DR  D ++ +DR+R+RD +++RDRDRD H  +DR
Sbjct: 63  RDHDRDRDHDRDRNRDRDRDRDRDRDRDMDRDRDRDRDRNRDRDRDRDRDRDRHREKDR 121

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 44/102 (43%), Positives = 62/102 (60%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D DL   +   + RD+D E    R+ DR++ R+R+  R++ RDRDR RDRD ++  DR+R
Sbjct: 38  DRDLNRDRDRDLDRDSDTELD--RDYDRDHDRDRDHDRDRNRDRDRDRDRDRDRDMDRDR 95

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH 24
           +R RDR RD +R +DR RD  + KDR   R+      R RDH
Sbjct: 96  DRDRDRNRDRDRDRDRDRDRHREKDRVIPRE-----PRVRDH 132

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 43/106 (40%), Positives = 64/106 (60%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D    +   ++RD DR+    R+ D E  R+ +R  ++ RD DR R+RD ++ RDR+R
Sbjct: 30  DRDRDRDRDRDLNRDRDRDLD--RDSDTELDRDYDRDHDRDRDHDRDRNRDRDRDRDRDR 87

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
           +R  DR RD  R +DR RD ++ +DR+RDR  EK+R   R+   RD
Sbjct: 88  DRDMDRDRD--RDRDRNRDRDRDRDRDRDRHREKDRVIPREPRVRD 131

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/72 (51%), Positives = 45/72 (62%), Gaps = 8/72 (11%)
 Frame = -2

Query: 194 RSRDRDSEKSRDRER-ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDR--DRDH 24
           RSRD DS   RD +  ER RDR RD +R +DR RD  + +DR+ DRD + E DR  DRDH
Sbjct: 6   RSRDPDSRDPRDADSPERDRDRERDRDRDRDRDRDLNRDRDRDLDRDSDTELDRDYDRDH 65

Query: 23  -----HHRDRHR 3
                H RDR+R
Sbjct: 66  DRDRDHDRDRNR 77

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 32/85 (37%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = -2

Query: 359 DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDR 180
           DS  +     D D    + +   R+ DR+  + R++DR+  R+R+R R++ RDRDR RDR
Sbjct: 52  DSDTELDRDYDRDHDRDRDHDRDRNRDRDRDRDRDRDRDMDRDRDRDRDRNRDRDRDRDR 111

Query: 179 DSEKSRDRERERSRD-RVRDGERSK 108
           D ++ R+++R   R+ RVRD   SK
Sbjct: 112 DRDRHREKDRVIPREPRVRDHPPSK 136

[110][TOP]
>UniRef100_A4R8X8 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea
            RepID=A4R8X8_MAGGR
          Length = 1011

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 51/146 (34%), Positives = 83/146 (56%), Gaps = 11/146 (7%)
 Frame = -2

Query: 407  RRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRER 228
            RR+ +      D+      P+  + +       +S H S   +R+S + R+KDR+  R+R
Sbjct: 745  RRHSRKNSINGDDEPRSVRPESRSRSASPDESRRSGHRSSRRERDSERRRDKDRDRERDR 804

Query: 227  ERKREKGRDRDRS-----------RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
            +R R++ +D+D             RD+D E+ +D+ R+R +DR +D +R KDR RD ++ 
Sbjct: 805  DRDRDRAKDKDDDEHRRKSSHKSRRDKDHERDKDKGRDRGKDRGKDRDRGKDRERDRDRD 864

Query: 80   KDRERDRDGEKERDRDRDHHHRDRHR 3
            +DRERDRD +++R RDRD   RDR R
Sbjct: 865  RDRERDRDRDRDRQRDRD---RDRRR 887

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 42/138 (30%), Positives = 73/138 (52%), Gaps = 15/138 (10%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAA----DEDLTDSKSNHVSRDNDRESSKSREKD 249
            ++E R  +PE        ++S      ++    D +    K     RD DR+  ++++KD
Sbjct: 756  DDEPRSVRPESRSRSASPDESRRSGHRSSRRERDSERRRDKDRDRERDRDRDRDRAKDKD 815

Query: 248  RENGRER-----------ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR 102
             +  R +           ER ++KGRDR + R +D ++ +DRER+R RDR R+ +R +DR
Sbjct: 816  DDEHRRKSSHKSRRDKDHERDKDKGRDRGKDRGKDRDRGKDRERDRDRDRDRERDRDRDR 875

Query: 101  GRDGEKSKDRERDRDGEK 48
             R  ++ +DR R RDG++
Sbjct: 876  DRQRDRDRDRRRPRDGKE 893

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 41/113 (36%), Positives = 67/113 (59%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E + ERR ++      D    D         D+D    KS+H SR  D++  + ++K R+
Sbjct: 787  ERDSERRRDKDRDRERDR---DRDRDRAKDKDDDEHRRKSSHKSR-RDKDHERDKDKGRD 842

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
             G++R + R++G+DR+R RDRD  + R+R+R+R RDR RD +R + R RDG++
Sbjct: 843  RGKDRGKDRDRGKDRERDRDRD--RDRERDRDRDRDRQRDRDRDRRRPRDGKE 893

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 55/177 (31%), Positives = 76/177 (42%), Gaps = 47/177 (26%)
 Frame = -2

Query: 392  PEGEGEDNY----HNDSSPQPPAAADEDLT-DSKSNHVS--RDNDRESSKSREKDRENGR 234
            P  E +D +    H   SP     ADE    D +  HVS  R + R++S + + +  + R
Sbjct: 709  PSRERKDGHRRRRHRSESP-----ADEGRDEDRRQGHVSSSRRHSRKNSINGDDEPRSVR 763

Query: 233  ERERKREKGRDRDR-SRDRDSEKSRDRERERSRDRVRD---------------------- 123
               R R    D  R S  R S + RD ER R +DR R+                      
Sbjct: 764  PESRSRSASPDESRRSGHRSSRRERDSERRRDKDRDRERDRDRDRDRAKDKDDDEHRRKS 823

Query: 122  -----------------GERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
                              +R KDRG+D ++ KDRERDRD +++R+RDRD   RDR R
Sbjct: 824  SHKSRRDKDHERDKDKGRDRGKDRGKDRDRGKDRERDRDRDRDRERDRD-RDRDRQR 879

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 2/96 (2%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDN--DRESSKSREKD 249
            E + +R  ++ + + +D +   SS +     D +    K     +D   DR+  K RE+D
Sbjct: 801  ERDRDRDRDRAKDKDDDEHRRKSSHKSRRDKDHERDKDKGRDRGKDRGKDRDRGKDRERD 860

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERS 141
            R+  R+RER R++ RDR R RDRD  + RD +   S
Sbjct: 861  RDRDRDRERDRDRDRDRQRDRDRDRRRPRDGKEPSS 896

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/101 (34%), Positives = 48/101 (47%)
 Frame = -2

Query: 305 SNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVR 126
           S HVS   D+ +     + R N  + + + +K RDR R RD    +  DR R+R RD   
Sbjct: 631 SRHVSPAADKPA-----RSRSNSVDSKPRHDKYRDRSRDRDHRKSRDADRPRDRERDHGI 685

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D ER + R RD       +  R   +ER   +D H R RHR
Sbjct: 686 DAERDRHRERDNRGRSVSQSSRSPSRER---KDGHRRRRHR 723

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 37/127 (29%), Positives = 56/127 (44%), Gaps = 1/127 (0%)
 Frame = -2

Query: 395 QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKR 216
           QP      + H   +   PA +  +  DSK  H     D+   +SR++D    R+ +R R
Sbjct: 623 QPNQLLNGSRHVSPAADKPARSRSNSVDSKPRH-----DKYRDRSRDRDHRKSRDADRPR 677

Query: 215 EKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR-DGEKSKDRERDRDGEKERD 39
               DR+R    D+E+ R RER+     V    RS  R R DG + +    +   ++ RD
Sbjct: 678 ----DRERDHGIDAERDRHRERDNRGRSVSQSSRSPSRERKDGHRRRRHRSESPADEGRD 733

Query: 38  RDRDHHH 18
            DR   H
Sbjct: 734 EDRRQGH 740

[111][TOP]
>UniRef100_UPI00005BD86E PREDICTED: similar to RNA binding motif protein 25 isoform 2 n=1
           Tax=Macaca mulatta RepID=UPI00005BD86E
          Length = 795

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 42/84 (50%), Positives = 64/84 (76%)
 Frame = -2

Query: 278 RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
           RE  + RE++RE  +E+ER+RE+ RDRDR R ++ ++ RDRER+R RDR R  +R+KDR 
Sbjct: 305 REREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRS 364

Query: 98  RDGEKSKDRERDRDGEKERDRDRD 27
           R  E+ ++RER+R+ +K+RDR+ D
Sbjct: 365 RSREREREREREREKDKKRDREED 388

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 46/89 (51%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -2

Query: 290 RDNDRES-SKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           R+ +RE   + RE++RE  RE+E++RE+ R+RDR RDR  E+ RDR+RER RD  RD ER
Sbjct: 298 RERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRD--RDRER 355

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           S DR +D  +S++RER+R+ E+E+D+ RD
Sbjct: 356 SSDRNKDRSRSREREREREREREKDKKRD 384

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 44/97 (45%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           ++ +R+  +   ++RE  RERER +RE+ R+R+R R+R+ EK R+RERER RDR R  ER
Sbjct: 280 KEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKER 339

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR R+ ++ +DRER  D  K+R R R+   R+R R
Sbjct: 340 DRDRDRERDRDRDRERSSDRNKDRSRSRE-RERERER 375

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 43/102 (42%), Positives = 68/102 (66%), Gaps = 6/102 (5%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRV----R 126
           ++      + RE++RE  RERER+ RE+ R+R+R R+++ E+ R+RER+R RDR     R
Sbjct: 282 KERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDR 341

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRD-HHHRDRHR 3
           D +R +DR RD E+S DR +DR   +ER+R+R+    +D+ R
Sbjct: 342 DRDRERDRDRDRERSSDRNKDRSRSREREREREREREKDKKR 383

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/115 (38%), Positives = 72/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK-SRDRE 153
           +ED  D  S  +S+  D       EK ++    +E ++E+ R+R+R R+R+ E+  R+RE
Sbjct: 252 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKER-RERERERERERERRERERE 310

Query: 152 RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-----HHRDRHR 3
           RER R+R ++ ER ++R RD ++ + +ERDRD ++ERDRDRD       ++DR R
Sbjct: 311 REREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSR 365

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 44/140 (31%), Positives = 70/140 (50%), Gaps = 6/140 (4%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSN------HVSRDNDRESS 267
           E E E ERR  + E E E     +   +     D D   +K           RD DRE S
Sbjct: 297 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERS 356

Query: 266 KSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
             R KDR   RERER+RE+ R++D+ RDR+ ++    ER +   ++R+ E +        
Sbjct: 357 SDRNKDRSRSREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNW 416

Query: 86  KSKDRERDRDGEKERDRDRD 27
           + ++R++ R+ EKE +R+ +
Sbjct: 417 EIRERKKTREYEKEAEREEE 436

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 47/126 (37%), Positives = 67/126 (53%), Gaps = 7/126 (5%)
 Frame = -2

Query: 359 DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRD 183
           +S   P     E   D   N +  + D+    SRE  +     ++ + EKG+ +++R   
Sbjct: 228 ESDSHPRKKKKEKKEDEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEI 287

Query: 182 RDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE------RDRDGEKERDRDRDHH 21
               + R+RERER R+R R+ ER ++R R+ EK K+RE      RDRD  KERDRDRD  
Sbjct: 288 EKERRERERERERERER-REREREREREREREKEKERERERERDRDRDRTKERDRDRD-R 345

Query: 20  HRDRHR 3
            RDR R
Sbjct: 346 ERDRDR 351

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 43/135 (31%), Positives = 66/135 (48%), Gaps = 1/135 (0%)
 Frame = -2

Query: 428 EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER R ++ E E E     D         D D    +     R +DR   +SR +
Sbjct: 308 EREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSR 367

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           +RE  RERER+++K RDR+   + D+ + R  ER+         ER K+     E+ K R
Sbjct: 368 EREREREREREKDKKRDREED-EEDAYERRKLERKLREKEAAYQERLKN-WEIRERKKTR 425

Query: 71  ERDRDGEKERDRDRD 27
           E +++ E+E +R R+
Sbjct: 426 EYEKEAEREEERRRE 440

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 45/171 (26%), Positives = 74/171 (43%), Gaps = 31/171 (18%)
 Frame = -2

Query: 428 EYEFEEER---RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS- 261
           E E E ER   R    E + + +   D       ++D +   S+S    R+ +RE  K  
Sbjct: 322 ERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREREREREREREKDK 381

Query: 260 ---REKDRENGRERERKREKGRD--------------RDRSRDRDSEKSRDRERERSRDR 132
              RE+D E+  ER +   K R+              R+R + R+ EK  +RE ER R+ 
Sbjct: 382 KRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREM 441

Query: 131 VRDGERSKDRGRDGEKSKD----------RERDRDGEKERDRDRDHHHRDR 9
            ++ +R K+   D +  +D          ++R RD EKE + D     R++
Sbjct: 442 AKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREK 492

[112][TOP]
>UniRef100_Q7Q155 AGAP009961-PA (Fragment) n=1 Tax=Anopheles gambiae
           RepID=Q7Q155_ANOGA
          Length = 635

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 54/95 (56%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RD+  E     EKDRE  RERER RE+ RDR+R RDR+ E+ R+RERER RDR RD ER 
Sbjct: 385 RDHRLERESEWEKDREKERERERDRERERDRERERDRERERDRERERERERDRDRDRERD 444

Query: 110 KDRGRDGEKSKDRERDRDGEKERDR-DRDHHHRDR 9
           ++R RD    +DRERDRD    R+R DRDH  +DR
Sbjct: 445 RERERD----RDRERDRD---HRERIDRDHREKDR 472

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 39/83 (46%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = -2

Query: 287 DNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSK 108
           + DRE  + RE+DRE  R+RER+R++ R+RDR R+R+ E+ RDR+RER R+R RD +R +
Sbjct: 396 EKDREKERERERDRERERDRERERDRERERDRERERERERDRDRDRERDRERERDRDRER 455

Query: 107 DRGRDGEKSKD-RERDRDGEKER 42
           DR       +D RE+DRD ++ +
Sbjct: 456 DRDHRERIDRDHREKDRDNKERK 478

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 49/147 (33%), Positives = 68/147 (46%), Gaps = 10/147 (6%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E   ER+      E E  +  D   +     D +          R+ DRE  + RE++
Sbjct: 375 EKEASLERQQRDHRLERESEWEKDREKERERERDRE----------RERDRERERDRERE 424

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGERSKDRGRDGEK---- 84
           R+  RERER+R+  RDRDR RDR+ E+ RDRER+R  R+R+    R KDR     K    
Sbjct: 425 RDRERERERERD--RDRDRERDRERERDRDRERDRDHRERIDRDHREKDRDNKERKMVAS 482

Query: 83  -----SKDRERDRDGEKERDRDRDHHH 18
                S +    R     R+RD   H+
Sbjct: 483 DSLSGSGNENEKRSSSLRRERDSPSHN 509

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 34/139 (24%), Positives = 61/139 (43%), Gaps = 1/139 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E +  + R   + E E +     +         D +    +     R+ +RE  + R++D
Sbjct: 381 ERQQRDHRLERESEWEKDREKERERERDRERERDRERERDRERERDRERERERERDRDRD 440

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK-SKDR 72
           RE  RERER R++ RDRD  R+R     R+++R+    ++   +     G + EK S   
Sbjct: 441 RERDRERERDRDRERDRDH-RERIDRDHREKDRDNKERKMVASDSLSGSGNENEKRSSSL 499

Query: 71  ERDRDGEKERDRDRDHHHR 15
            R+RD     +   + + R
Sbjct: 500 RRERDSPSHNNTSSNGNSR 518

[113][TOP]
>UniRef100_A5K0A9 Negative elongation factor E, putative n=1 Tax=Plasmodium vivax
           RepID=A5K0A9_PLAVI
          Length = 595

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 46/131 (35%), Positives = 78/131 (59%), Gaps = 2/131 (1%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN 240
           +E  R    E   E  Y   D        AD +    K     ++ ++E  K REK++  
Sbjct: 375 DENYRKRSSEESRERKYRKLDRHHHRDRKADREREKEKEREKEKEREKEREKEREKEKHK 434

Query: 239 GRERERKR-EKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
            +++ER R E+GR++D+ +DRD +K +D+++++ RD+ +D E  +DR RD +K +DRE+D
Sbjct: 435 LKDKERSRKERGREKDKDKDRDKDKDKDKDKDKDRDKDKDRESERDRDRDRDKERDREKD 494

Query: 62  RDGEKERDRDR 30
           RD ++ERDRD+
Sbjct: 495 RDKDRERDRDK 505

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/143 (29%), Positives = 78/143 (54%), Gaps = 9/143 (6%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E   ER+Y + +     ++H D         +++    K     R+ +RE  K + KD+E
Sbjct: 384 EESRERKYRKLDR----HHHRDRKADREREKEKEREKEKEREKEREKEREKEKHKLKDKE 439

Query: 242 NGR---------ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG 90
             R         +++R ++K +D+D+ +DRD +K R+ ER+R RDR ++ +R KDR +D 
Sbjct: 440 RSRKERGREKDKDKDRDKDKDKDKDKDKDRDKDKDRESERDRDRDRDKERDREKDRDKDR 499

Query: 89  EKSKDRERDRDGEKERDRDRDHH 21
           E+ +D+ ++R   KER++ +  H
Sbjct: 500 ERDRDKAKERAKTKEREKAKSRH 522

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 46/139 (33%), Positives = 84/139 (60%), Gaps = 6/139 (4%)
 Frame = -2

Query: 401 YEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERER 222
           Y++ +    +  HN          DE+    +S+  SR+      K R+ DR + R+R+ 
Sbjct: 351 YKRSDSHLRERKHNPEDDTRTFYNDENYR-KRSSEESRER-----KYRKLDRHHHRDRKA 404

Query: 221 KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS-KDRGRDGEKSKDRERDRDGEKE 45
            RE+ ++++R ++++ EK R++ERE+ + +++D ERS K+RGR+ +K KDR++D+D +K+
Sbjct: 405 DREREKEKEREKEKEREKEREKEREKEKHKLKDKERSRKERGREKDKDKDRDKDKDKDKD 464

Query: 44  RDRDRD-----HHHRDRHR 3
           +D+DRD        RDR R
Sbjct: 465 KDKDRDKDKDRESERDRDR 483

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 43/142 (30%), Positives = 71/142 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+ER  E+ + + ++    +   +     D D    K     +D D++  +  E+D
Sbjct: 421 EKEREKEREKEKHKLKDKERSRKERGREKDKDKDRDKDKDKDKDKDKDRDKDKDRESERD 480

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R+  R++ER REK RD+DR RDRD  K R + +ER + + R   ++K++G+ G+  +D  
Sbjct: 481 RDRDRDKERDREKDRDKDRERDRDKAKERAKTKEREKAKSRHKSKNKEKGK-GKGKRDEN 539

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
            D     E  R     H D  R
Sbjct: 540 YDSSNYSEPKRRATKDHGDDRR 561

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 43/135 (31%), Positives = 76/135 (56%), Gaps = 2/135 (1%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+ER  E+ E E E   H              L D + +   R  +++  K R+KD
Sbjct: 413 EREKEKEREKER-EKEREKEKHK-------------LKDKERSRKERGREKDKDKDRDKD 458

Query: 248 RENGRERERKREKGRDRD--RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           ++  +++++ R+K +DR+  R RDRD +K RDRE++R +DR RD +++K+R +  E+ K 
Sbjct: 459 KDKDKDKDKDRDKDKDRESERDRDRDRDKERDREKDRDKDRERDRDKAKERAKTKEREKA 518

Query: 74  RERDRDGEKERDRDR 30
           + R +   KE+ + +
Sbjct: 519 KSRHKSKNKEKGKGK 533

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 45/142 (31%), Positives = 79/142 (55%), Gaps = 3/142 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLT-DSKSNHVSRDNDRESSKSREK 252
           E E E+ER  E+   E E     +   +     D++ +   +     +D DR+  K ++K
Sbjct: 407 EREKEKEREKEK---EREKEREKEREKEKHKLKDKERSRKERGREKDKDKDRDKDKDKDK 463

Query: 251 DRENGRERERKREKGRDRDRSRD--RDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           D++  R++++ RE  RDRDR RD  RD EK RD++RER RD+ ++  ++K+R    EK+K
Sbjct: 464 DKDKDRDKDKDRESERDRDRDRDKERDREKDRDKDRERDRDKAKERAKTKER----EKAK 519

Query: 77  DRERDRDGEKERDRDRDHHHRD 12
            R + ++ EK + + +   + D
Sbjct: 520 SRHKSKNKEKGKGKGKRDENYD 541

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 33/136 (24%), Positives = 67/136 (49%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           ++ER  ++   E + +   D         D+D    K     RD DR+  K R+++++  
Sbjct: 437 DKERSRKERGREKDKDKDRDKDKDKDKDKDKDRDKDKDRESERDRDRDRDKERDREKDRD 496

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           ++RER R+K ++R ++++R+  KSR + + + + +   G+  +D   D     + +R   
Sbjct: 497 KDRERDRDKAKERAKTKEREKAKSRHKSKNKEKGK---GKGKRDENYDSSNYSEPKRRAT 553

Query: 56  GEKERDRDRDHHHRDR 9
            +   DR RDH   D+
Sbjct: 554 KDHGDDR-RDHSRADK 568

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 33/115 (28%), Positives = 58/115 (50%), Gaps = 16/115 (13%)
 Frame = -2

Query: 299 HVSRDNDRESSKSREK-DRENGRERERKREKGRDR------DRSRDRDSEKSRDRE---- 153
           H +  +D E    RE   R +   RERK     D       +  R R SE+SR+R+    
Sbjct: 335 HTNFHDDEEEDAWREGYKRSDSHLRERKHNPEDDTRTFYNDENYRKRSSEESRERKYRKL 394

Query: 152 -----RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
                R+R  DR R+ E+ +++ ++ EK +++ER+++  K +D++R    R R +
Sbjct: 395 DRHHHRDRKADREREKEKEREKEKEREKEREKEREKEKHKLKDKERSRKERGREK 449

[114][TOP]
>UniRef100_UPI000186D81D coiled-coil domain-containing protein, putative n=1 Tax=Pediculus
           humanus corporis RepID=UPI000186D81D
          Length = 560

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 48/100 (48%), Positives = 70/100 (70%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           K +H     DR+   +R+++RE  RERER++E+ R+RDR RDRD  + RDRERER RDR 
Sbjct: 253 KRSHSPDRKDRDRDYARDRERERDREREREKERDRNRDRERDRD--RDRDRERERDRDRD 310

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           RD E+ KD+    EK K++E++++ EKE+++DRD    DR
Sbjct: 311 RDREKDKDK----EKEKEKEKEKEKEKEKEKDRDRRSSDR 346

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 48/135 (35%), Positives = 72/135 (53%), Gaps = 1/135 (0%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKS-NHVSRDNDRESSKSREKDREN 240
           E  R  ++      + Y +D         D     S S +   RD D    + RE+DRE 
Sbjct: 220 ERYRDNDRDRRRDGEKYRDDKERDRFPTRDHGRKRSHSPDRKDRDRDYARDRERERDRER 279

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
            RE+ER R + R+RDR RDRD E+ RDR+R+R R++ +D E+ K++ ++ EK K++E+DR
Sbjct: 280 EREKERDRNRDRERDRDRDRDRERERDRDRDRDREKDKDKEKEKEKEKEKEKEKEKEKDR 339

Query: 59  DGEKERDRDRDHHHR 15
           D      R   H  R
Sbjct: 340 DRRSSDRRSPKHSRR 354

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 37/112 (33%), Positives = 61/112 (54%)
 Frame = -2

Query: 365 HNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSR 186
           H       P   D D   ++     RD +RE  K R+++R+  R+R+R R++ R+RDR R
Sbjct: 250 HGRKRSHSPDRKDRDRDYARDRERERDREREREKERDRNRDRERDRDRDRDRERERDRDR 309

Query: 185 DRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           DRD EK +D+E+E+ +++ ++ E+ K++ RD   S  R         R  DR
Sbjct: 310 DRDREKDKDKEKEKEKEKEKEKEKEKEKDRDRRSSDRRSPKHSRRSSRSPDR 361

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/131 (27%), Positives = 66/131 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           +Y  ++ER        G    H+            D    +     R+ +R+ ++ RE+D
Sbjct: 235 KYRDDKERDRFPTRDHGRKRSHSPDRKDRDRDYARDRERERDREREREKERDRNRDRERD 294

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R+  R+RER+R++ RDRDR +D+D EK +++E+E+ +++    E+ KDR R     +  +
Sbjct: 295 RDRDRDRERERDRDRDRDREKDKDKEKEKEKEKEKEKEK----EKEKDRDRRSSDRRSPK 350

Query: 68  RDRDGEKERDR 36
             R   +  DR
Sbjct: 351 HSRRSSRSPDR 361

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 54/170 (31%), Positives = 87/170 (51%), Gaps = 26/170 (15%)
 Frame = -2

Query: 434 MGEYEFEEERRYEQPEGEGEDNYHND--------SSPQPPAAADEDLTDSKSNHVSRDND 279
           +GEY+     +       G D++  D        S+ +     D+D+  S++++ + D  
Sbjct: 127 VGEYKQNYLHKNFTKGTNGGDSFKKDLDGTELKNSNEEKCTMNDKDVYLSENDNFNFDGH 186

Query: 278 RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD-------RVRDG 120
           + S   R + REN R+R+  R K  DRD  R RD E+ RD +R+R RD       + RD 
Sbjct: 187 K-SKDDRMRQRENDRKRDDYRRK-EDRDGGRRRDDERYRDNDRDRRRDGEKYRDDKERDR 244

Query: 119 ERSKDRG-----------RDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             ++D G           RD + ++DRER+RD E+ER+++RD  +RDR R
Sbjct: 245 FPTRDHGRKRSHSPDRKDRDRDYARDRERERDREREREKERD-RNRDRER 293

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 44/142 (30%), Positives = 64/142 (45%), Gaps = 10/142 (7%)
 Frame = -2

Query: 398 EQPEGEGE-DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERER 222
           E  +GE + DNYH  S     A  +        N     N  +S K   KD +    +  
Sbjct: 105 EMDDGEDDLDNYHVTSQESVNAVGEYKQNYLHKNFTKGTNGGDSFK---KDLDGTELKNS 161

Query: 221 KREKGRDRDR--------SRDRDSEKSRD-RERERSRDRVRDGERSKDRGRDGEKSKDRE 69
             EK    D+        + + D  KS+D R R+R  DR RD  R K+  RDG + +D E
Sbjct: 162 NEEKCTMNDKDVYLSENDNFNFDGHKSKDDRMRQRENDRKRDDYRRKE-DRDGGRRRDDE 220

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
           R RD +++R RD + +  D+ R
Sbjct: 221 RYRDNDRDRRRDGEKYRDDKER 242

[115][TOP]
>UniRef100_UPI0000F2B799 PREDICTED: similar to Death-inducer obliterator 1 (DIO-1)
            (Death-associated transcription factor 1) (DATF-1)
            (hDido1) n=1 Tax=Monodelphis domestica
            RepID=UPI0000F2B799
          Length = 2478

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 54/147 (36%), Positives = 79/147 (53%), Gaps = 10/147 (6%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD----- 249
            E +  E  +G G ++   D     P   D     S+      D +R+  + REKD     
Sbjct: 2173 ETQLSENRQGRGFEDRRRDRDHGKPWERDRGRNWSRDRERDWDRNRDWERHREKDSNRDW 2232

Query: 248  -----RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
                 R   R++ER+ E+ ++ +R+R+R   + RDRER+R R R RD  RS+DR RD  +
Sbjct: 2233 DKNKERNPNRDKERESERNKEWERNRERGRNRDRDRERDRDRRRDRDRSRSRDRDRDRTR 2292

Query: 83   SKDRERDRDGEKERDRDRDHHHRDRHR 3
             +DRERDRD EKER+RDR    +DR +
Sbjct: 2293 ERDRERDRDREKERERDRGKDRKDRSK 2319

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 42/135 (31%), Positives = 75/135 (55%), Gaps = 1/135 (0%)
 Frame = -2

Query: 428  EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E +++  R +E+  E +   ++  +    P    + +   +K    +R+  R   + RE+
Sbjct: 2211 ERDWDRNRDWERHREKDSNRDWDKNKERNPNRDKERESERNKEWERNRERGRNRDRDRER 2270

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            DR+  R+R+R R + RDRDR+R+RD E+ RDRE+ER RDR   G+  KDR +  E S+D 
Sbjct: 2271 DRDRRRDRDRSRSRDRDRDRTRERDRERDRDREKERERDR---GKDRKDRSKSKESSRDS 2327

Query: 71   ERDRDGEKERDRDRD 27
            + +   E ++  + +
Sbjct: 2328 KPEEQKEVQKPAETE 2342

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 48/140 (34%), Positives = 79/140 (56%), Gaps = 3/140 (2%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E R+ E+ EG  ++     SS +P     E+          RD D      R++ R   R
Sbjct: 2153 EGRQRERFEGGTKEK----SSDEPETQLSENRQGRGFEDRRRDRDHGKPWERDRGRNWSR 2208

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERS--RDRVRDGERSKDRGRDGEKSKDRERDR 60
            +RER  ++ RD +R R++DS +  D+ +ER+  RD+ R+ ER+K+  R+ E+ ++R+RDR
Sbjct: 2209 DRERDWDRNRDWERHREKDSNRDWDKNKERNPNRDKERESERNKEWERNRERGRNRDRDR 2268

Query: 59   DGEKERDRDRDH-HHRDRHR 3
            + +++R RDRD    RDR R
Sbjct: 2269 ERDRDRRRDRDRSRSRDRDR 2288

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 44/140 (31%), Positives = 76/140 (54%), Gaps = 4/140 (2%)
 Frame = -2

Query: 410  ERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDN--DRESSKSREKDRENG 237
            E R +  EG   + +   +  +     +  L++++      D   DR+  K  E+DR   
Sbjct: 2146 EYRNQAFEGRQRERFEGGTKEKSSDEPETQLSENRQGRGFEDRRRDRDHGKPWERDRGRN 2205

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR--ERD 63
              R+R+R+  R+RD  R R+ + +RD ++ + R+  RD ER  +R ++ E++++R   RD
Sbjct: 2206 WSRDRERDWDRNRDWERHREKDSNRDWDKNKERNPNRDKERESERNKEWERNRERGRNRD 2265

Query: 62   RDGEKERDRDRDHHHRDRHR 3
            RD E++RDR RD   RDR R
Sbjct: 2266 RDRERDRDRRRD---RDRSR 2282

[116][TOP]
>UniRef100_C0P852 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0P852_MAIZE
          Length = 594

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 70/171 (40%), Positives = 89/171 (52%), Gaps = 27/171 (15%)
 Frame = -2

Query: 434 MGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSN--------------H 297
           M EY+   +   + P  EG       ++   PAA      DSK +              H
Sbjct: 1   MSEYDERYQGNGDMPAAEGGYPQAEYAAAAAPAAGGSPPADSKPSGFSDHADGRSSQHQH 60

Query: 296 VSRDNDRESSKSREKDRENG------RERERKREKGRDRDRSRDRD-SEKSRDR----ER 150
            ++ +D  SSKSRE+DRE        R+R+R REKGRDRDR +DR+ S++ RDR     R
Sbjct: 61  ETQSHDSGSSKSRERDRERDKGKDRERDRDRGREKGRDRDRDKDRERSDRDRDRHHRDHR 120

Query: 149 ERSRDRV-RDGERSKDRGRDGEKSKDRER-DRDGEKERDRDRDHHHRDRHR 3
           ERS  R  RD    +DR RDG   +DR R DRD E+ RDRDRD H R R R
Sbjct: 121 ERSEKREHRDRSDDRDRHRDG---RDRHRDDRDSERRRDRDRDGHRRHRSR 168

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 37/95 (38%), Positives = 51/95 (53%), Gaps = 1/95 (1%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D + +D   +   RD+   S K   +DR + R+R R    GRDR R  DRDSE+ RDR+R
Sbjct: 104 DRERSDRDRDRHHRDHRERSEKREHRDRSDDRDRHR---DGRDRHRD-DRDSERRRDRDR 159

Query: 149 E-RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
           +   R R R   +S+DR R   +S+ R R R   K
Sbjct: 160 DGHRRHRSRSPSKSRDRDR---RSRSRSRSRSKSK 191

[117][TOP]
>UniRef100_B6UDT4 Splicing factor U2AF 65 kDa subunit n=1 Tax=Zea mays
           RepID=B6UDT4_MAIZE
          Length = 596

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 70/173 (40%), Positives = 90/173 (52%), Gaps = 29/173 (16%)
 Frame = -2

Query: 434 MGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSN--------------H 297
           M EY+   +   + P  EG       ++   PAA      DSK +              H
Sbjct: 1   MSEYDERYQGNGDMPAAEGGYPQAEYAAAAAPAAGGSPPADSKPSGFSDHADGRSSQHQH 60

Query: 296 VSRDNDRESSKSREKDRENG------RERERKREKGRDRDRSRDRD-SEKSRDRER---- 150
            ++ +D  SSKSRE+DRE        R+R+R REKGRDRDR +DR+ S++ RDR+R    
Sbjct: 61  ETQSHDSGSSKSRERDRERDKGKDRERDRDRGREKGRDRDRDKDRERSDRDRDRDRHHRD 120

Query: 149 --ERSRDRV-RDGERSKDRGRDGEKSKDRERD-RDGEKERDRDRDHHHRDRHR 3
             ERS  R  RD    +DR RDG   +DR RD RD E+ RDRDRD H R R R
Sbjct: 121 HRERSEKREHRDRSDDRDRHRDG---RDRHRDDRDSERRRDRDRDGHRRHRSR 170

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 1/126 (0%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E ++ +  E+    G +   +    +    +D D  D   +H  RD+   S K   +DR 
Sbjct: 78  ERDKGKDRERDRDRGREKGRDRDRDKDRERSDRD-RDRDRHH--RDHRERSEKREHRDRS 134

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERE-RSRDRVRDGERSKDRGRDGEKSKDRER 66
           + R+R R    GRDR R  DRDSE+ RDR+R+   R R R   +S+DR R   +S+ R R
Sbjct: 135 DDRDRHR---DGRDRHRD-DRDSERRRDRDRDGHRRHRSRSPSKSRDRDR---RSRSRSR 187

Query: 65  DRDGEK 48
            R   K
Sbjct: 188 SRSKSK 193

[118][TOP]
>UniRef100_Q54WY7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum
           RepID=Q54WY7_DICDI
          Length = 727

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 52/106 (49%), Positives = 70/106 (66%), Gaps = 10/106 (9%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSE-----KSRDRERERSRDRVR 126
           +D DR+ ++ R++DRE  R ++R RE+ RDRDR RDRD E     + RDR  ER R R R
Sbjct: 5   KDRDRDRNRERDRDRERDRGKDRDRERDRDRDRERDRDGERDRMDRDRDRSEERDRYRGR 64

Query: 125 DGERSKDRGRDGEKSKDR-ERDRDGEKERDR----DRDHHHRDRHR 3
           D E  +DR RD ++SK+R ++DRD  +ERDR    DRD  +RDR R
Sbjct: 65  DKENQRDRERDRDRSKERNKKDRDRSEERDRSRDIDRDRKYRDRSR 110

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 56/102 (54%), Positives = 67/102 (65%), Gaps = 4/102 (3%)
 Frame = -2

Query: 296 VSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER-SRDRVRDG 120
           +S D DR+  ++RE+DR+    RER R K RDR+R RDRD E+ RD ER+R  RDR R  
Sbjct: 1   MSDDKDRDRDRNRERDRD----RERDRGKDRDRERDRDRDRERDRDGERDRMDRDRDRSE 56

Query: 119 ERSKDRGRDGEKSKDRERDRDGEKER---DRDRDHHHRDRHR 3
           ER + RGRD E  +DRERDRD  KER   DRDR    RDR R
Sbjct: 57  ERDRYRGRDKENQRDRERDRDRSKERNKKDRDRS-EERDRSR 97

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 49/141 (34%), Positives = 74/141 (52%), Gaps = 3/141 (2%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDN-DRESSKSREKDREN 240
           E +R  E+  G+  D              D D    +     RD  DR+  +S E+DR  
Sbjct: 14  ERDRDRERDRGKDRDRER-----------DRDRDRERDRDGERDRMDRDRDRSEERDRYR 62

Query: 239 GRERERKREKGRDRDRSRDRD-SEKSRDRERERSRDRVRDGE-RSKDRGRDGEKSKDRER 66
           GR++E +R++ RDRDRS++R+  ++ R  ER+RSRD  RD + R + R RD +KS   E+
Sbjct: 63  GRDKENQRDRERDRDRSKERNKKDRDRSEERDRSRDIDRDRKYRDRSRSRDKKKSSS-EK 121

Query: 65  DRDGEKERDRDRDHHHRDRHR 3
           DR   + R RD+      R+R
Sbjct: 122 DRSKSRSRSRDKKSSSYKRNR 142

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 41/107 (38%), Positives = 55/107 (51%), Gaps = 9/107 (8%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSR-EKDRENGRERERKREKGRDR---DRSRDRD-----SEKSRDR 156
           K N   R+ DR+ SK R +KDR+   ER+R R+  RDR   DRSR RD     SEK R +
Sbjct: 66  KENQRDRERDRDRSKERNKKDRDRSEERDRSRDIDRDRKYRDRSRSRDKKKSSSEKDRSK 125

Query: 155 ERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHR 15
            R RSRD+     +S    R+ +   D + D D     D D D+  +
Sbjct: 126 SRSRSRDK-----KSSSYKRNRKDYSDSDSDSDSSSGSD-DSDYERK 166

[119][TOP]
>UniRef100_B3LAT7 Pre-mRNA splicing factor, putative n=1 Tax=Plasmodium knowlesi
           strain H RepID=B3LAT7_PLAKH
          Length = 701

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 47/124 (37%), Positives = 67/124 (54%)
 Frame = -2

Query: 386 GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKG 207
           G G+ +   D+          +  +      SR    +  + R + R  GR R R R +G
Sbjct: 398 GSGDPDREGDTENGDGTERSRNRDEKTHRRGSRSRSGKRRRRRSRSRSRGRNRSRSRHRG 457

Query: 206 RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           R +DRSRDRD  ++RDR R+R R R RD  R +DR RD ++S+DR+R RD ++ RDRDR 
Sbjct: 458 RHKDRSRDRDRSRNRDRSRDRDRSRNRDRSRDRDRSRDRDRSRDRDRSRDRDRSRDRDRR 517

Query: 26  HHHR 15
              R
Sbjct: 518 RKRR 521

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/121 (42%), Positives = 68/121 (56%), Gaps = 4/121 (3%)
 Frame = -2

Query: 353 SPQPPAAADEDLTDSKSNHVSRDND--RESSKSREKDRENGRERERKREKGRDRDRSRDR 180
           S  P    D +  D      +RD    R  S+SR   R   R R R R + R R R R R
Sbjct: 399 SGDPDREGDTENGDGTERSRNRDEKTHRRGSRSRSGKRRRRRSRSRSRGRNRSRSRHRGR 458

Query: 179 DSEKSRDRERERSRDRVRDGERSK--DRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
             ++SRDR+R R+RDR RD +RS+  DR RD ++S+DR+R RD ++ RDRDR    RDR 
Sbjct: 459 HKDRSRDRDRSRNRDRSRDRDRSRNRDRSRDRDRSRDRDRSRDRDRSRDRDRS-RDRDRR 517

Query: 5   R 3
           R
Sbjct: 518 R 518

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 5/106 (4%)
 Frame = -2

Query: 311 SKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDR 132
           S+S    R+  R   + R KDR   R+R R R++ RDRDRSR+RD  +SRDR+R R RDR
Sbjct: 441 SRSRSRGRNRSRSRHRGRHKDRSRDRDRSRNRDRSRDRDRSRNRD--RSRDRDRSRDRDR 498

Query: 131 VRDGERSKDRGRDGEKSKDRER----DRDGEKERDRDRDHH-HRDR 9
            RD +RS+DR R  ++ + R+R    +R+ +K    D+ H  HRDR
Sbjct: 499 SRDRDRSRDRDRSRDRDRRRKRRTSEERNEKKHSSHDKSHRDHRDR 544

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 39/101 (38%), Positives = 56/101 (55%)
 Frame = -2

Query: 311 SKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDR 132
           S+S H  R  DR   + R ++R+  R+R+R R + R RDR R RD ++SRDR+R R RDR
Sbjct: 451 SRSRHRGRHKDRSRDRDRSRNRDRSRDRDRSRNRDRSRDRDRSRDRDRSRDRDRSRDRDR 510

Query: 131 VRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
            RD +R + R    E+++ +    D      RDR    R R
Sbjct: 511 SRDRDRRRKRRTSEERNEKKHSSHDKSHRDHRDRSLTKRGR 551

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 38/99 (38%), Positives = 54/99 (54%), Gaps = 4/99 (4%)
 Frame = -2

Query: 293 SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           SRD DR  ++ R +DR+  R R+R R++ R RDR R RD ++SRDR+R R RDR R    
Sbjct: 463 SRDRDRSRNRDRSRDRDRSRNRDRSRDRDRSRDRDRSRDRDRSRDRDRSRDRDRRRKRRT 522

Query: 113 SKDRGRDGEKSKDR----ERDRDGEKERDRDRDHHHRDR 9
           S++R      S D+     RDR   K      +  H+ +
Sbjct: 523 SEERNEKKHSSHDKSHRDHRDRSLTKRGRTSYEDLHKKK 561

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 31/91 (34%), Positives = 49/91 (53%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE 147
           +D +  +    +RD  R+  +SR +DR   R+R R R++ RDRDRSRDRD  + RDR R+
Sbjct: 460 KDRSRDRDRSRNRDRSRDRDRSRNRDRSRDRDRSRDRDRSRDRDRSRDRDRSRDRDRRRK 519

Query: 146 RSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           R     R+ ++     +     +DR   + G
Sbjct: 520 RRTSEERNEKKHSSHDKSHRDHRDRSLTKRG 550

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/128 (28%), Positives = 60/128 (46%), Gaps = 8/128 (6%)
 Frame = -2

Query: 365 HNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSR 186
           H D S     + + D +  +    +RD  R+  +SR++DR   R+R R R++ RDRDR R
Sbjct: 459 HKDRSRDRDRSRNRDRSRDRDRSRNRDRSRDRDRSRDRDRSRDRDRSRDRDRSRDRDRRR 518

Query: 185 DRDSEKSRDRERERSRDRVRDGERSKD---RGR----DGEKSKDRERDRDGEK-ERDRDR 30
            R + + R+ ++  S D+     R +    RGR    D  K KD    R       + D 
Sbjct: 519 KRRTSEERNEKKHSSHDKSHRDHRDRSLTKRGRTSYEDLHKKKDMSSSRSSRSYSSEEDG 578

Query: 29  DHHHRDRH 6
             H +D++
Sbjct: 579 KTHRKDKY 586

[120][TOP]
>UniRef100_UPI000198316C PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI000198316C
          Length = 514

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 48/114 (42%), Positives = 71/114 (62%), Gaps = 7/114 (6%)
 Frame = -2

Query: 344 PPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRD---RSRDRDS 174
           PP + +    + +     R+  RE  + RE++RE  RE +R R++    D   R RDR+ 
Sbjct: 256 PPRSEEPRTREDRHGDRDREKSRERGRDREREREKSREPDRARDRDHREDRHHRDRDRNR 315

Query: 173 EKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD----RDGEKERDRDRDH 24
           +K RDR+R R RDR RD +R +DRGRD E+ +DR+RD    R+ EKE+DRD+D+
Sbjct: 316 DKDRDRDRGRDRDRTRDRDRGRDRGRDYERERDRDRDRPREREKEKEKDRDKDY 369

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 59/141 (41%), Positives = 76/141 (53%), Gaps = 25/141 (17%)
 Frame = -2

Query: 353 SPQPPAAADE--DLTDSKSNHVSRDNDRESSKSREKDR---------ENGRERERKREKG 207
           S +P    D   D    KS    RD +RE  KSRE DR          + R+R+R R+K 
Sbjct: 259 SEEPRTREDRHGDRDREKSRERGRDREREREKSREPDRARDRDHREDRHHRDRDRNRDKD 318

Query: 206 RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD---GEKERDR 36
           RDRDR RDRD  + RDR R+R RD  R+ +R +DR R+ EK K+++RD+D   GE   DR
Sbjct: 319 RDRDRGRDRDRTRDRDRGRDRGRDYERERDRDRDRPREREKEKEKDRDKDYDAGEPNYDR 378

Query: 35  DR-------DH----HHRDRH 6
            R       DH    H R+RH
Sbjct: 379 GRSRDKEYYDHMESKHERERH 399

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 49/139 (35%), Positives = 81/139 (58%), Gaps = 10/139 (7%)
 Frame = -2

Query: 410 ERRYEQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK--DREN 240
           +R  E+    G D     + S +P  A D D  + + +H  RD +R+  + R++  DR+ 
Sbjct: 271 DRDREKSRERGRDREREREKSREPDRARDRDHREDR-HHRDRDRNRDKDRDRDRGRDRDR 329

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD---GERSKDRGRDGEKS---- 81
            R+R+R R++GRD +R RDRD ++ R+RE+E+ +DR +D   GE + DRGR  +K     
Sbjct: 330 TRDRDRGRDRGRDYERERDRDRDRPREREKEKEKDRDKDYDAGEPNYDRGRSRDKEYYDH 389

Query: 80  KDRERDRDGEKERDRDRDH 24
            + + +R+   ERDRD +H
Sbjct: 390 MESKHERERHGERDRDLEH 408

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 40/111 (36%), Positives = 57/111 (51%), Gaps = 25/111 (22%)
 Frame = -2

Query: 284 NDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE-------------- 147
           N + S + ++      R  E +  + R  DR R++  E+ RDRERE              
Sbjct: 242 NPKYSGREQQPVGGPPRSEEPRTREDRHGDRDREKSRERGRDREREREKSREPDRARDRD 301

Query: 146 -------RSRDRVRDGERSKDRGRDGEKSKDRERDRDG----EKERDRDRD 27
                  R RDR RD +R +DRGRD ++++DR+R RD     E+ERDRDRD
Sbjct: 302 HREDRHHRDRDRNRDKDRDRDRGRDRDRTRDRDRGRDRGRDYERERDRDRD 352

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 7/83 (8%)
 Frame = -2

Query: 230 RERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE------ 69
           RE++   G  R        ++  DR+RE+SR+R RD ER +++ R+ ++++DR+      
Sbjct: 248 REQQPVGGPPRSEEPRTREDRHGDRDREKSRERGRDREREREKSREPDRARDRDHREDRH 307

Query: 68  -RDRDGEKERDRDRDHHHRDRHR 3
            RDRD  +++DRDRD   RDR R
Sbjct: 308 HRDRDRNRDKDRDRD-RGRDRDR 329

[121][TOP]
>UniRef100_UPI00015B4E8D PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B4E8D
          Length = 1310

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 49/96 (51%), Positives = 65/96 (67%), Gaps = 2/96 (2%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD 135
           D   +  S   DR+  + RE+DRE  RER+R+R++ RDR+R R+RD E+ R+RERER RD
Sbjct: 527 DRYHDRYSAAKDRDRDRDRERDRERDRERDRERDRERDRERDRERDRERERERERERERD 586

Query: 134 RVRDGERSKDRGRDGEKSKD--RERDRDGEKERDRD 33
           R RD  R +DR    E+ +D  RERDRD  +ERDRD
Sbjct: 587 RERDRLRERDRDSLRERDRDPLRERDRDSLRERDRD 622

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 54/136 (39%), Positives = 77/136 (56%), Gaps = 10/136 (7%)
 Frame = -2

Query: 395 QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKR 216
           +P  +  D YH+  S       D D    +     RD +R+  + RE+DRE  RERER+R
Sbjct: 520 KPATKSIDRYHDRYSAAKDRDRDRDRERDRERDRERDRERDRERDRERDRERDRERERER 579

Query: 215 EKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD--RDGEKE- 45
           E+ R+RDR RDR  E+ RD  RER RD +R+ +R   R RD +  ++RERD  R+ E+E 
Sbjct: 580 ERERERDRERDRLRERDRDSLRERDRDPLRERDRDSLRERDRDPLRERERDPLREREREP 639

Query: 44  -------RDRDRDHHH 18
                  R+R+RD +H
Sbjct: 640 LRERDPLRERERDPYH 655

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 55/179 (30%), Positives = 85/179 (47%), Gaps = 54/179 (30%)
 Frame = -2

Query: 407 RRYEQPEGEGEDNYHNDSSPQ--------------------------------------P 342
           RRY++ + EG+D   +D  P+                                      P
Sbjct: 428 RRYKELQAEGKDPSKHDFKPEWIEYWNKRMRELHTEQLEQRKTDIKKKLELEGEMPTVFP 487

Query: 341 PAAADEDLTDSKSN---HVSRDNDRE----------SSKSREKDRENG---RERERKREK 210
               +++ + S      ++ +++D E           S  R  DR +    R+R+R RE+
Sbjct: 488 STRREKNKSPSNGKLAVNIKQESDNEVEYVGMKPATKSIDRYHDRYSAAKDRDRDRDRER 547

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRD 33
            R+RDR RDR+ ++ RDRER+R RDR R+ ER ++R RD E+ + RERDRD  +ERDRD
Sbjct: 548 DRERDRERDRERDRERDRERDRERDRERERERERERERDRERDRLRERDRDSLRERDRD 606

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 44/134 (32%), Positives = 63/134 (47%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           R    E + E +   D         + D    +     R+ DRE  + RE+DR++ RER+
Sbjct: 545 RERDRERDRERDRERDRERDRERDRERDRERERERERERERDRERDRLRERDRDSLRERD 604

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
           R   + RDRD  R+RD    RD  RER RD +R+ ER            +  R+RD  +E
Sbjct: 605 RDPLRERDRDSLRERD----RDPLRERERDPLRERER------------EPLRERDPLRE 648

Query: 44  RDRDRDHHHRDRHR 3
           R+RD  H+   R R
Sbjct: 649 RERDPYHYSYPRGR 662

[122][TOP]
>UniRef100_UPI0000E818EB PREDICTED: hypothetical protein n=1 Tax=Gallus gallus
           RepID=UPI0000E818EB
          Length = 642

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 43/101 (42%), Positives = 70/101 (69%)
 Frame = -2

Query: 311 SKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDR 132
           S+    SR   R   K R+K++   +E+ +++E+ RD+++ RDRD +K R+RERE+ R+R
Sbjct: 332 SRERRKSRSRSRSRDKKRDKEKVKEKEKTKEKERDRDKEKERDRDRDKEREREREKERNR 391

Query: 131 VRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
            +D E+ KDR +D E+ KDR+RDRD  KER++++D   +DR
Sbjct: 392 DKDREKDKDRNKDRERVKDRDRDRD--KEREKEKDEKEKDR 430

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 52/151 (34%), Positives = 81/151 (53%), Gaps = 8/151 (5%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           G +  E  +  E+  G    +  ++S     + +    + SK   +SR  DR  S+S  K
Sbjct: 268 GFFLSESGKSSERKGGRSRSHSRSESRSSSKSRSRRKRSHSKHRSLSRHKDRRRSRSPLK 327

Query: 251 DRENGRERERKREKGRDRDRSRDRDS--------EKSRDRERERSRDRVRDGERSKDRGR 96
            R   RER + R + R RD+ RD++         EK RDR++E+ RDR RD ER ++R +
Sbjct: 328 KRSRSRERRKSRSRSRSRDKKRDKEKVKEKEKTKEKERDRDKEKERDRDRDKEREREREK 387

Query: 95  DGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +  + KDRE+D+D  K+R+R +D   RDR R
Sbjct: 388 ERNRDKDREKDKDRNKDRERVKD---RDRDR 415

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 51/129 (39%), Positives = 77/129 (59%), Gaps = 12/129 (9%)
 Frame = -2

Query: 353 SPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRS----R 186
           SP    +   +   S+S   SRD  R+  K +EK++   +ER+R +EK RDRDR     R
Sbjct: 324 SPLKKRSRSRERRKSRSRSRSRDKKRDKEKVKEKEKTKEKERDRDKEKERDRDRDKERER 383

Query: 185 DRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR--------DGEKERDRDR 30
           +R+ E++RD++RE+ +DR +D ER KDR RD +K +++E+D         D  KE+D DR
Sbjct: 384 EREKERNRDKDREKDKDRNKDRERVKDRDRDRDKEREKEKDEKEKDREDVDQNKEKDDDR 443

Query: 29  DHHHRDRHR 3
           D   RDR +
Sbjct: 444 D-GERDREK 451

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 43/143 (30%), Positives = 82/143 (57%), Gaps = 8/143 (5%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           ++ + ++ E   E     D   +     D++    +    +RD DRE  K R KDRE  +
Sbjct: 350 DKEKVKEKEKTKEKERDRDKEKERDRDRDKEREREREKERNRDKDREKDKDRNKDRERVK 409

Query: 233 ERERKREKGRDRDRSR--------DRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           +R+R R+K R++++          D++ EK  DR+ ER R++++D E  KD+G D EK +
Sbjct: 410 DRDRDRDKEREKEKDEKEKDREDVDQNKEKDDDRDGERDREKMKDREGDKDKGGDKEKDR 469

Query: 77  DRERDRDGEKERDRDRDHHHRDR 9
           ++E+++DG+KER+R+++   + +
Sbjct: 470 EKEKEKDGDKEREREKERDDKKK 492

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 37/138 (26%), Positives = 70/138 (50%), Gaps = 9/138 (6%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHN-------DSSPQPPAAADEDLTDSKSNHVSRDNDRES 270
           E E E+ER  ++   + +D   +       D         ++D  +     V ++ +++ 
Sbjct: 382 EREREKERNRDKDREKDKDRNKDRERVKDRDRDRDKEREKEKDEKEKDREDVDQNKEKDD 441

Query: 269 SKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKD-RGRD 93
            +  E+DRE  ++RE  ++KG D+++ R+++ EK  D+ERER ++  RD ++ KD R R 
Sbjct: 442 DRDGERDREKMKDREGDKDKGGDKEKDREKEKEKDGDKEREREKE--RDDKKKKDKRSRT 499

Query: 92  GEKS-KDRERDRDGEKER 42
             +S     R R   +ER
Sbjct: 500 PPRSYSSSRRSRSSSRER 517

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 41/145 (28%), Positives = 66/145 (45%), Gaps = 7/145 (4%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDN------DRESSKSR 258
           E ER  E+     +D   + D +       D D    K     +D       D + +K +
Sbjct: 380 EREREREKERNRDKDREKDKDRNKDRERVKDRDRDRDKEREKEKDEKEKDREDVDQNKEK 439

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           + DR+     ER REK +DR+  +D+  +K +DRE+E+ +D   D ER +++ RD +K K
Sbjct: 440 DDDRDG----ERDREKMKDREGDKDKGGDKEKDREKEKEKD--GDKEREREKERDDKKKK 493

Query: 77  DRERDRDGEKERDRDRDHHHRDRHR 3
           D+ R R   +     R      R R
Sbjct: 494 DK-RSRTPPRSYSSSRRSRSSSRER 517

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 38/173 (21%), Positives = 76/173 (43%), Gaps = 33/173 (19%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E +++R  ++   +  D   +    +     ++D  D   N   +D+DR+  + REK ++
Sbjct: 396 EKDKDRNKDRERVKDRDRDRDKEREKEKDEKEKDREDVDQNK-EKDDDRDGERDREKMKD 454

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD------------GERSKDRG 99
              ++++  +K +DR++ +++D +K R+RE+ER   + +D              RS+   
Sbjct: 455 REGDKDKGGDKEKDREKEKEKDGDKEREREKERDDKKKKDKRSRTPPRSYSSSRRSRSSS 514

Query: 98  RDGEKSKDRE---------------------RDRDGEKERDRDRDHHHRDRHR 3
           R+  K K R                      R    EK+R+RD  +  R+R R
Sbjct: 515 RERRKRKSRSLSKSPKTSKGTKRKSSRTPSPRRNKKEKKRERDTCNEGRERER 567

[123][TOP]
>UniRef100_UPI0000E4A6CC PREDICTED: similar to WD repeat domain 60 n=2
           Tax=Strongylocentrotus purpuratus RepID=UPI0000E4A6CC
          Length = 1077

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 44/106 (41%), Positives = 72/106 (67%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE 147
           E + +++S+  SR  D++  K REK R+  ++RER R+K RD+D  RD++ E+ RD++R+
Sbjct: 17  ESIKEARSSGKSRHKDKDRDKEREKPRD--KDRERHRDKDRDKDSHRDKEHERKRDKDRD 74

Query: 146 RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           R +++ +D ER KDR  +  K KDRER +D EK+  +D+D   +DR
Sbjct: 75  RQKEKDKDRERRKDREGESSKEKDRERRKDREKDSSKDKDRREKDR 120

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 50/159 (31%), Positives = 85/159 (53%), Gaps = 17/159 (10%)
 Frame = -2

Query: 437 TMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           T G  E  E  +  +  G+       D   +     D+D    +  H  +D D++S + +
Sbjct: 9   TWGAKELTESIKEARSSGKSRHK-DKDRDKEREKPRDKD----RERHRDKDRDKDSHRDK 63

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR---GRDGE 87
           E +R+  ++R+R++EK +DR+R +DR+ E S++++RER +DR +D  + KDR    RDG 
Sbjct: 64  EHERKRDKDRDRQKEKDKDRERRKDREGESSKEKDRERRKDREKDSSKDKDRREKDRDGR 123

Query: 86  KS-------------KDRERDRDGEKERDRD-RDHHHRD 12
           K              KDR + R+ EK+RDR+ ++  HRD
Sbjct: 124 KEREKESSKEKDRGEKDRSKHREKEKDRDREKKERSHRD 162

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/125 (35%), Positives = 70/125 (56%), Gaps = 17/125 (13%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE 147
           E  +  KS H  +D D+E  K R+KDRE  R+++R ++  RD++  R RD ++ R +E++
Sbjct: 21  EARSSGKSRHKDKDRDKEREKPRDKDRERHRDKDRDKDSHRDKEHERKRDKDRDRQKEKD 80

Query: 146 RSRDRVRDGERSKDRGRDGEKSKD-----------RERDRDGEKER------DRDRDHHH 18
           + R+R +D E    + +D E+ KD           RE+DRDG KER      ++DR    
Sbjct: 81  KDRERRKDREGESSKEKDRERRKDREKDSSKDKDRREKDRDGRKEREKESSKEKDRGEKD 140

Query: 17  RDRHR 3
           R +HR
Sbjct: 141 RSKHR 145

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 50/152 (32%), Positives = 76/152 (50%), Gaps = 14/152 (9%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +++R   + +   +D+ H D   +     D D    K     R  DRE   S+EKDRE  
Sbjct: 44  DKDRERHRDKDRDKDS-HRDKEHERKRDKDRDRQKEKDKDRERRKDREGESSKEKDRERR 102

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE---- 69
           ++RE+   K +DR R +DRD  K R++E  + +DR   GE+ + + R+ EK +DRE    
Sbjct: 103 KDREKDSSKDKDR-REKDRDGRKEREKESSKEKDR---GEKDRSKHREKEKDRDREKKER 158

Query: 68  ----------RDRDGEKERDRDRDHHHRDRHR 3
                     R   G+KER RDRD   R+R +
Sbjct: 159 SHRDNKESAERTDSGKKERHRDRDEKKREREK 190

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 35/96 (36%), Positives = 66/96 (68%), Gaps = 4/96 (4%)
 Frame = -2

Query: 278 RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERS--RDRVRDGERSKD 105
           +E ++S ++ R +G+ R + +++ ++R++ RD+D E+ RD++R++   RD+  + +R KD
Sbjct: 13  KELTESIKEARSSGKSRHKDKDRDKEREKPRDKDRERHRDKDRDKDSHRDKEHERKRDKD 72

Query: 104 RGRDGEKSKDRER--DRDGEKERDRDRDHHHRDRHR 3
           R R  EK KDRER  DR+GE  +++DR+   +DR +
Sbjct: 73  RDRQKEKDKDRERRKDREGESSKEKDRE-RRKDREK 107

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 44/151 (29%), Positives = 76/151 (50%), Gaps = 13/151 (8%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDR-ESSKSREKDREN 240
           E E   E+     +D   + S  +     D D    +    S++ DR E  +S+ +++E 
Sbjct: 90  EGESSKEKDRERRKDREKDSSKDKDRREKDRDGRKEREKESSKEKDRGEKDRSKHREKEK 149

Query: 239 GRERERKREKGRD------------RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR 96
            R+RE+K    RD            ++R RDRD EK R+RE+E      RDG++S  +  
Sbjct: 150 DRDREKKERSHRDNKESAERTDSGKKERHRDRD-EKKREREKESGS---RDGDKSSTKDG 205

Query: 95  DGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D +K ++ +R RD ++ER ++++ +  DR R
Sbjct: 206 DRDKRREEKRHRDKDRERRKEKESNDSDRER 236

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 52/151 (34%), Positives = 81/151 (53%), Gaps = 13/151 (8%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E + + ERR ++   EGE +   D   +     D    D       RD  +E  K   K+
Sbjct: 78  EKDKDRERRKDR---EGESSKEKDRERRKDREKDSS-KDKDRREKDRDGRKEREKESSKE 133

Query: 248 RENG-RERERKREKGRDRDRSR----DRDSEKSRDR----ERERSRDR-VRDGERSKDRG 99
           ++ G ++R + REK +DRDR +     RD+++S +R    ++ER RDR  +  ER K+ G
Sbjct: 134 KDRGEKDRSKHREKEKDRDREKKERSHRDNKESAERTDSGKKERHRDRDEKKREREKESG 193

Query: 98  -RDGEKS--KDRERDRDGEKERDRDRDHHHR 15
            RDG+KS  KD +RD+  E++R RD+D   R
Sbjct: 194 SRDGDKSSTKDGDRDKRREEKRHRDKDRERR 224

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 41/147 (27%), Positives = 75/147 (51%), Gaps = 4/147 (2%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           G  E E+E   E+  GE + + H +          E     + N  S +      K R +
Sbjct: 122 GRKEREKESSKEKDRGEKDRSKHREKEKDRDREKKE--RSHRDNKESAERTDSGKKERHR 179

Query: 251 DRENGRERERKREKG-RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           DR+  ++RER++E G RD D+S  +D ++ + RE +R RD+ R+  + K+   D ++ + 
Sbjct: 180 DRDE-KKREREKESGSRDGDKSSTKDGDRDKRREEKRHRDKDRERRKEKE-SNDSDRERR 237

Query: 74  RERDRDG---EKERDRDRDHHHRDRHR 3
           + RD+DG    ++R++  +  HR  H+
Sbjct: 238 KHRDKDGSADRRKREKSGERKHRKEHK 264

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 33/88 (37%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = -2

Query: 266 KSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV--RDGERSKDRGRD 93
           KS+E D    +E     ++ R   +SR +D ++ ++RE+ R +DR   RD +R KD  RD
Sbjct: 4   KSKE-DTWGAKELTESIKEARSSGKSRHKDKDRDKEREKPRDKDRERHRDKDRDKDSHRD 62

Query: 92  GEKSKDRERDRDGEKERDRDRDHHHRDR 9
            E  + R++DRD +KE+D+DR+   +DR
Sbjct: 63  KEHERKRDKDRDRQKEKDKDRE-RRKDR 89

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 43/145 (29%), Positives = 71/145 (48%), Gaps = 15/145 (10%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHN-----DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS- 261
           E E++R  E+ E    DN  +         +     DE   + +    SRD D+ S+K  
Sbjct: 146 EKEKDRDREKKERSHRDNKESAERTDSGKKERHRDRDEKKREREKESGSRDGDKSSTKDG 205

Query: 260 -----REKDRENGRERERKREK---GRDRDRSRDRDSEKSRDR-ERERSRDRVRDGERSK 108
                RE+ R   ++RER++EK     DR+R + RD + S DR +RE+S +R    E  +
Sbjct: 206 DRDKRREEKRHRDKDRERRKEKESNDSDRERRKHRDKDGSADRRKREKSGERKHRKEHKE 265

Query: 107 DRGRDGEKSKDRERDRDGEKERDRD 33
           ++GR   + K+ + +R  +K  D D
Sbjct: 266 EKGRSKSEHKNGQDERHEKKREDED 290

[124][TOP]
>UniRef100_Q5XGT0 LOC495149 protein (Fragment) n=1 Tax=Xenopus laevis
            RepID=Q5XGT0_XENLA
          Length = 1029

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 49/140 (35%), Positives = 89/140 (63%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E  EERR ++ + E  D    +   +     + +  + +     R+++RE ++ R+++RE
Sbjct: 701  ERREERRVDRTD-ERRDERAREREREKEREREREQRE-REREKERESERERARERDRERE 758

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
              ++RER+REK R+R+R  +R+ E+ R+RERER RDR R+ ER ++R R+ ++ K++ER+
Sbjct: 759  REKDREREREKERERERE-ERERERERERERERERDRERERERERERERERDREKEKERE 817

Query: 62   RDGEKERDRDRDHHHRDRHR 3
            R  E++RDR RD   +++ R
Sbjct: 818  RGRERDRDRPRDWEEKEKAR 837

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 55/150 (36%), Positives = 91/150 (60%), Gaps = 7/150 (4%)
 Frame = -2

Query: 431  GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADE--DLTDSKSNHVSRDNDRESSKSR 258
            G+ +  +  R ++P         ND + +     +   D TD + +  +R+ +RE  K R
Sbjct: 671  GDRDRRDRDRDQRPTSPVRHQGRNDDTEREERREERRVDRTDERRDERARERERE--KER 728

Query: 257  EKDRE-NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVR---DGERSKDRGRDG 90
            E++RE   RERE++RE  R+R R RDR+ E+ +DRERER ++R R   + ER ++R R+ 
Sbjct: 729  EREREQREREREKERESERERARERDREREREKDREREREKEREREREERERERERERER 788

Query: 89   EKSKDRERDRDGEKERDRDRDHH-HRDRHR 3
            E+ +DRER+R+ E+ER+R+RD    ++R R
Sbjct: 789  ERERDRERERERERERERERDREKEKERER 818

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 49/140 (35%), Positives = 86/140 (61%), Gaps = 4/140 (2%)
 Frame = -2

Query: 410  ERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSK---SNHVSRDNDRESSKSREKDREN 240
            +RR+   +    D     +SP      ++D    +      V R ++R   ++RE++RE 
Sbjct: 667  DRRHGDRDRRDRDRDQRPTSPVRHQGRNDDTEREERREERRVDRTDERRDERAREREREK 726

Query: 239  GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK-SKDRERD 63
             RERER++   R+R+R ++R+SE+ R RER+R R+R +D ER +++ R+ E+  ++RER+
Sbjct: 727  EREREREQ---REREREKERESERERARERDREREREKDREREREKEREREREERERERE 783

Query: 62   RDGEKERDRDRDHHHRDRHR 3
            R+ E+ER+RDR+   R+R R
Sbjct: 784  RERERERERDRE-RERERER 802

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 54/147 (36%), Positives = 74/147 (50%), Gaps = 7/147 (4%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS---- 261
            E E E+ER  E+ + E E     +S  +     D +    K     R+ +RE  +     
Sbjct: 721  EREREKEREREREQREREREKERESERERARERDREREREKDREREREKEREREREERER 780

Query: 260  ---REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG 90
               RE++RE  R+RER+RE+ R+R+R RDR+ EK R+R RER RDR RD E         
Sbjct: 781  ERERERERERERDRERERERERERERERDREKEKERERGRERDRDRPRDWE--------- 831

Query: 89   EKSKDRERDRDGEKERDRDRDHHHRDR 9
            EK K RE  RD   +   D+   H DR
Sbjct: 832  EKEKAREDRRDKRDDVREDKRELHEDR 858

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 56/151 (37%), Positives = 86/151 (56%), Gaps = 12/151 (7%)
 Frame = -2

Query: 419  FEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTD-SKSNHVSRDNDRESSKSREK--- 252
            + E  RY+  +   + ++      +     D D    S   H  R++D E  + RE+   
Sbjct: 649  YTERDRYDNRDQGRDSSFDRRHGDRDRRDRDRDQRPTSPVRHQGRNDDTEREERREERRV 708

Query: 251  ----DRENGRERERKREKGRDRDRS-RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
                +R + R RER+REK R+R+R  R+R+ EK R+ ERER+R+R R+ ER KDR R  E
Sbjct: 709  DRTDERRDERAREREREKEREREREQREREREKERESERERARERDREREREKDRER--E 766

Query: 86   KSKDRERDRDGEKERDRDRD---HHHRDRHR 3
            + K+RER+R+ E+ER+R+R+      RDR R
Sbjct: 767  REKERERERE-ERERERERERERERERDRER 796

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 45/147 (30%), Positives = 71/147 (48%), Gaps = 6/147 (4%)
 Frame = -2

Query: 428  EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E E E ER  E+  E E E +   +   +     +E     +     R+ +RE  + RE+
Sbjct: 742  ERESERERARERDREREREKDREREREKEREREREER---ERERERERERERERDRERER 798

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRE-----RERSRDRVRDGERSKDRGRDGE 87
            +RE  RERER REK ++R+R R+RD ++ RD E     RE  RD+  D    K    +  
Sbjct: 799  ERERERERERDREKEKERERGRERDRDRPRDWEEKEKAREDRRDKRDDVREDKRELHEDR 858

Query: 86   KSKDRERDRDGEKERDRDRDHHHRDRH 6
            K K  +   +G+  ++  +D   R R+
Sbjct: 859  KPKSEKGKIEGQINQNLHKDQRKRHRN 885

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 51/175 (29%), Positives = 69/175 (39%), Gaps = 33/175 (18%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDS-------SPQPP---AAADEDLTDSKSNHVSRDN 282
           G +      R+  P  +   +    S       SP PP    A+      S S + +R +
Sbjct: 378 GRHHSPMSSRHHSPSSQSGSSVQRHSLSPRHRRSPSPPYQRTASPSARRQSTSPYTTRTS 437

Query: 281 D-----RESSKSREKDRENGR-ERERK------------REKGRDRDRSRDRDSEKSRD- 159
                 R  SK R   RE GR +RER               +GR RDR  +R+   SRD 
Sbjct: 438 SSPQRKRSPSKHRSPTREKGRHDRERASASHDRSHERRDESRGRKRDRDHNREPSGSRDD 497

Query: 158 RERERSRDR--VRDGE--RSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
           RE    RDR  VRD    R     RD  +++D    RD ++ RD+      RD H
Sbjct: 498 RESREGRDRREVRDNRDHREPRDSRDNRETRDSREYRDAKESRDQKDSRSTRDTH 552

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 35/112 (31%), Positives = 52/112 (46%), Gaps = 9/112 (8%)
 Frame = -2

Query: 323 DLTDSKSNHVSRDNDRESSKSREKDRENGRE-----RERKREKGRDRDRSRD----RDSE 171
           D   + ++H      R+ S+ R++DR++ RE      +R+  +GRDR   RD    R+  
Sbjct: 460 DRERASASHDRSHERRDESRGRKRDRDHNREPSGSRDDRESREGRDRREVRDNRDHREPR 519

Query: 170 KSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHR 15
            SRD    R     RD + S+D+       KD    RD  + RDRD    HR
Sbjct: 520 DSRDNRETRDSREYRDAKESRDQ-------KDSRSTRDTHEYRDRDNRESHR 564

[125][TOP]
>UniRef100_B8BFL9 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8BFL9_ORYSI
          Length = 485

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 52/117 (44%), Positives = 71/117 (60%), Gaps = 9/117 (7%)
 Frame = -2

Query: 332 ADEDLTDSKSNHVSRDND-----RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK 168
           AD D   S+     RD D     R   ++RE+D +  R   R R++ RDR+R RDR+ + 
Sbjct: 282 ADRDREKSRERPRERDRDERTRERSHDRTRERDSKEDRHHHRDRDRTRDRERGRDRERDH 341

Query: 167 SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH----HHRDR 9
            RDR+R+R RDR RD +R +DRGRD E+ +DR  DR  E+ RDR+RD+    H RDR
Sbjct: 342 GRDRDRDRERDR-RDRDRDRDRGRDYERDRDRGHDRHRERGRDRERDYERASHERDR 397

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 55/142 (38%), Positives = 80/142 (56%), Gaps = 2/142 (1%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           G    EE RR E+      D     S  +P     ++ T  +S+  +R+ D +  +   +
Sbjct: 268 GRPRSEEPRRDERRA----DRDREKSRERPRERDRDERTRERSHDRTRERDSKEDRHHHR 323

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           DR+  R+RER R++ RD  R RDRD E+ R R+R+R RDR RD ER +DRG D  + + R
Sbjct: 324 DRDRTRDRERGRDRERDHGRDRDRDRERDR-RDRDRDRDRGRDYERDRDRGHDRHRERGR 382

Query: 71  ERDRDGEK-ERDRDRDH-HHRD 12
           +R+RD E+   +RDR H H RD
Sbjct: 383 DRERDYERASHERDRGHVHERD 404

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 44/100 (44%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
 Frame = -2

Query: 293 SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDS---EKSRDRERERSRDRVRD 123
           +RD         E+ R + R  +R REK R+R R RDRD    E+S DR RER     R 
Sbjct: 261 TRDQQHAGRPRSEEPRRDERRADRDREKSRERPRERDRDERTRERSHDRTRERDSKEDRH 320

Query: 122 GERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             R +DR RD E+ +DRERD   +++RDR+RD   RDR R
Sbjct: 321 HHRDRDRTRDRERGRDRERDHGRDRDRDRERDRRDRDRDR 360

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 52/130 (40%), Positives = 72/130 (55%), Gaps = 2/130 (1%)
 Frame = -2

Query: 386 GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERER-KREK 210
           G G      +++ Q  +  D+       +   R ++R + + REK RE  RER+R +R +
Sbjct: 244 GLGSSRIGGENAEQKLSTRDQQHAGRPRSEEPRRDERRADRDREKSRERPRERDRDERTR 303

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERD-RD 33
            R  DR+R+RDS++  DR   R RDR RD ER +DR RD        RDRD ++ERD RD
Sbjct: 304 ERSHDRTRERDSKE--DRHHHRDRDRTRDRERGRDRERD------HGRDRDRDRERDRRD 355

Query: 32  RDHHHRDRHR 3
           RD   RDR R
Sbjct: 356 RD---RDRDR 362

[126][TOP]
>UniRef100_Q7PX02 AGAP001145-PA n=1 Tax=Anopheles gambiae RepID=Q7PX02_ANOGA
          Length = 360

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 57/155 (36%), Positives = 82/155 (52%), Gaps = 26/155 (16%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE--------------- 255
           E   ED    D  P PP A ++ +   K+   S+ N+R  S+ R+               
Sbjct: 191 EMPSEDEAVEDLPPPPPTAKEKKIEAIKAKGASKRNERSVSRERQQVDRYRNYEAGNYHD 250

Query: 254 ----KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG-RDG 90
               +D+E GRERER+R++ RDRDR RDRD ++ R+ ER   RD   + +R K+R  RD 
Sbjct: 251 RENDRDKERGRERERERDRERDRDRDRDRDRDRYREMERRDRRDPYNERDRFKERELRDR 310

Query: 89  EKSKDR------ERDRDGEKERDRDRDHHHRDRHR 3
           E+ + R      ER+R+  +ERDRDRD  H +R R
Sbjct: 311 ERERQRRHERQEERERERRRERDRDRDREHEERPR 345

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 48/136 (35%), Positives = 78/136 (57%), Gaps = 1/136 (0%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +E++ E  + +G    +  S  +     D        N+  R+NDR+  + RE++RE  R
Sbjct: 210 KEKKIEAIKAKGASKRNERSVSRERQQVDRYRNYEAGNYHDRENDRDKERGRERERERDR 269

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD-GERSKDRGRDGEKSKDRERDRD 57
           ER+R R++ RDRDR R+ +    RD   ER R + R+  +R ++R R  E+ ++RER+R 
Sbjct: 270 ERDRDRDRDRDRDRYREMERRDRRDPYNERDRFKERELRDRERERQRRHERQEERERERR 329

Query: 56  GEKERDRDRDHHHRDR 9
            E++RDRDR+H  R R
Sbjct: 330 RERDRDRDREHEERPR 345

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 48/141 (34%), Positives = 74/141 (52%), Gaps = 5/141 (3%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E ++  RY   E     NYH+  +       D D    +     RD +R+  + R++DR+
Sbjct: 233 ERQQVDRYRNYEA---GNYHDREN-------DRDKERGRERERERDRERDRDRDRDRDRD 282

Query: 242 NGRERER--KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR- 72
             RE ER  +R+   +RDR ++R+    RDRERER R   R  ER ++R R+ ++ +DR 
Sbjct: 283 RYREMERRDRRDPYNERDRFKERE---LRDRERERQRRHERQEERERERRRERDRDRDRE 339

Query: 71  --ERDRDGEKERDRDRDHHHR 15
             ER R  ++ERD DR+   R
Sbjct: 340 HEERPRGHDRERDYDRERRRR 360

[127][TOP]
>UniRef100_B3L0D0 Putative uncharacterized protein n=1 Tax=Plasmodium knowlesi strain H
            RepID=B3L0D0_PLAKH
          Length = 971

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 57/159 (35%), Positives = 86/159 (54%), Gaps = 18/159 (11%)
 Frame = -2

Query: 428  EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E E +  R  E+  + E E +   ++    P  A+ D          R+ +R+  +  E+
Sbjct: 702  EAERDRPREAERDRQREAERDRQREAERDRPREAERDRQREAERDRQREAERDRQREAER 761

Query: 251  DRENGRERERKREKGRDRDRS--RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            DR+   ER+R+RE  RDR R   RDR + + RDRER+R RDR RD +R +DR R+ E+ +
Sbjct: 762  DRQREAERDRQREAERDRQREAERDRQTLRERDRERDRERDRERDRDRERDRNREAERER 821

Query: 77   DRERD------------RDGEKERDRDRD---HHHRDRH 6
            +RER+            RD E+ERDR+R+     HR+RH
Sbjct: 822  ERERERDRNRDAERERNRDAERERDRNREAEWDRHRERH 860

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 51/146 (34%), Positives = 84/146 (57%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
            P   E +   E   ++P  E E +   ++       A+ D    +     RD  RE+ + 
Sbjct: 692  PREAERDRPREAERDRPR-EAERDRQREAERDRQREAERD----RPREAERDRQREAERD 746

Query: 260  REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
            R+++ E  R+RE +R++ R+ +R R R++E+ R RE ER R  +R+ +R +DR RD E+ 
Sbjct: 747  RQREAERDRQREAERDRQREAERDRQREAERDRQREAERDRQTLRERDRERDRERDRERD 806

Query: 80   KDRERDRDGEKERDRDRDHHHRDRHR 3
            +DRERDR+ E ER+R+R+   RDR+R
Sbjct: 807  RDRERDRNREAERERERE-RERDRNR 831

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 54/148 (36%), Positives = 78/148 (52%), Gaps = 2/148 (1%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
            P   E +   E   ++P  E E +   ++    P  A+ D          R+ +R+  + 
Sbjct: 668  PREAERDRPREAERDRPR-EAERDRPREAERDRPREAERDRPREAERDRQREAERDRQRE 726

Query: 260  REKDRENGRERERKREKGRDRDRS--RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
             E+DR    ER+R+RE  RDR R   RDR  E  RDR+RE  RDR R+ ER  DR R+ E
Sbjct: 727  AERDRPREAERDRQREAERDRQREAERDRQREAERDRQREAERDRQREAER--DRQREAE 784

Query: 86   KSKDRERDRDGEKERDRDRDHHHRDRHR 3
            + +   R+RD E++R+RDR+   RDR R
Sbjct: 785  RDRQTLRERDRERDRERDRE-RDRDRER 811

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 53/143 (37%), Positives = 77/143 (53%), Gaps = 3/143 (2%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E +  R  ++P  E E +   ++    P  A+ D          R+ +R+  +  E+DR+
Sbjct: 658  ERDRSRERDRPR-EAERDRPREAERDRPREAERDRPREAERDRPREAERDRPREAERDRQ 716

Query: 242  NGRERERKREKGRDRDR--SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
               ER+R+RE  RDR R   RDR  E  RDR+RE  RDR R+ ER  DR R+ E+ + RE
Sbjct: 717  REAERDRQREAERDRPREAERDRQREAERDRQREAERDRQREAER--DRQREAERDRQRE 774

Query: 68   RDRDGEKERDRDRDH-HHRDRHR 3
             +RD ++E +RDR     RDR R
Sbjct: 775  AERDRQREAERDRQTLRERDRER 797

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 51/143 (35%), Positives = 74/143 (51%), Gaps = 2/143 (1%)
 Frame = -2

Query: 431  GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            G++E  + R  E+      D    ++    P  A+ D          R+ +R+  +  E+
Sbjct: 647  GDFERAKRRNMERDRSRERDR-PREAERDRPREAERDRPREAERDRPREAERDRPREAER 705

Query: 251  DRENGRERERKREKGRDRDR--SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            DR    ER+R+RE  RDR R   RDR  E  RDR+RE  RDR R+ ER + R  + ++ +
Sbjct: 706  DRPREAERDRQREAERDRQREAERDRPREAERDRQREAERDRQREAERDRQREAERDRQR 765

Query: 77   DRERDRDGEKERDRDRDHHHRDR 9
            + ERDR  E ERDR R+   RDR
Sbjct: 766  EAERDRQREAERDRQRE-AERDR 787

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 55/148 (37%), Positives = 78/148 (52%), Gaps = 5/148 (3%)
 Frame = -2

Query: 431  GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            GE+   +  R  + + EGE     +   +  A  + D   +K  ++ RD  RE  + RE 
Sbjct: 614  GEHLRADRERDNRNKEEGEKLEKRNRPGE--AEREGDFERAKRRNMERDRSRERDRPREA 671

Query: 251  DRENGRERERKREKGRDRDR----SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
            +R+  RE ER R +  +RDR     RDR  E  RDR RE  RDR R+ ER  DR R+ E+
Sbjct: 672  ERDRPREAERDRPREAERDRPREAERDRPREAERDRPREAERDRQREAER--DRQREAER 729

Query: 83   SKDRERDRDGEKERDRDRDHH-HRDRHR 3
             + RE +RD ++E +RDR     RDR R
Sbjct: 730  DRPREAERDRQREAERDRQREAERDRQR 757

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 48/138 (34%), Positives = 69/138 (50%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            EE  + E+    GE     D         + D +  +      + DR     R++ RE  
Sbjct: 629  EEGEKLEKRNRPGEAEREGDFERAKRRNMERDRSRERDRPREAERDRPREAERDRPREAE 688

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            R+R R+ E+ R R+  RDR  E  RDR+RE  RDR R+ ER + R  + ++ ++ ERDR 
Sbjct: 689  RDRPREAERDRPREAERDRPREAERDRQREAERDRQREAERDRPREAERDRQREAERDRQ 748

Query: 56   GEKERDRDRDHHHRDRHR 3
             E ERDR R+   RDR R
Sbjct: 749  REAERDRQRE-AERDRQR 765

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 45/128 (35%), Positives = 66/128 (51%), Gaps = 2/128 (1%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRES--SKSREKDREN 240
            E  R  Q E E +     +   Q  A  D      +      + DR++   + RE+DRE 
Sbjct: 742  EAERDRQREAERDRQREAERDRQREAERDRQREAERDRQREAERDRQTLRERDRERDRER 801

Query: 239  GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
             RER+R RE+ R+R+  R+R+ E+ RDR R+  R+R RD ER +DR R+ E  + RER  
Sbjct: 802  DRERDRDRERDRNREAERERERERERDRNRDAERERNRDAERERDRNREAEWDRHRERHF 861

Query: 59   DGEKERDR 36
            +  K   R
Sbjct: 862  ENGKNVPR 869

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 48/152 (31%), Positives = 69/152 (45%), Gaps = 20/152 (13%)
 Frame = -2

Query: 398  EQPEGEGEDNYHNDSSPQPPAAADEDL------TDSKSNHVSRDNDRESSKS-------- 261
            E PE  G      +   QPP+   +D       T        +DN   S +         
Sbjct: 558  EGPEKRGGGPSSREREQQPPSQIHKDSNANQRWTKQCDERNKKDNRHPSGRKNIQNGEHL 617

Query: 260  ---REKDRENGRERERKREKGRDRDRSRDRDSE--KSRDRERERSRDRVRDGERSKDRGR 96
               RE+D  N  E E+  ++ R  +  R+ D E  K R+ ER+RSR+R R  E  +DR R
Sbjct: 618  RADRERDNRNKEEGEKLEKRNRPGEAEREGDFERAKRRNMERDRSRERDRPREAERDRPR 677

Query: 95   DGEKSKDRERDRDGEKERDRDRDHH-HRDRHR 3
            + E+ + RE +RD  +E +RDR     RDR R
Sbjct: 678  EAERDRPREAERDRPREAERDRPREAERDRPR 709

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 41/163 (25%), Positives = 69/163 (42%), Gaps = 26/163 (15%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADE-DLTDSKSNHVSRDNDRESSKSREKDR 246
           E EEE  YEQ +G+ ++   +D   +     D+ D  D K+    +D   E  K  EKD 
Sbjct: 378 EEEEEELYEQEDGQTDEEEDDDEDEEEEGDEDDGDEKDVKNEKDEKDEKDEKDKKHEKDE 437

Query: 245 ENGRERERK--REKGRDRDRSRDRDSEKSR-------------DRERERSRDRVRDGERS 111
           E   E  RK  +E   ++D     +S++ R             D + ERS  ++++  ++
Sbjct: 438 EPLSESTRKPAKESPNEKDSRASLESKRERQLKEGTKQNRQKGDIKEERSPRKIQENHQN 497

Query: 110 K----------DRGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
                      DRGR    S +RE    G  +++    +H R+
Sbjct: 498 HRKENPYRPRVDRGRRNNYSNERENQNRGNVDKNGSDSYHRRN 540

[128][TOP]
>UniRef100_A1BYB1 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Cryptosporidium
           hominis RepID=A1BYB1_CRYHO
          Length = 157

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 51/130 (39%), Positives = 83/130 (63%), Gaps = 2/130 (1%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           RY + + + +DN  +D         D+D  + +     R+ +RE  + RE++RE  RERE
Sbjct: 16  RYLEQKEKDQDNNPDDD--------DDDDDNERERERERERERERERERERERERERERE 67

Query: 224 -RKREKGRDRDRSRDRDSEKS-RDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGE 51
            R+RE+ R+R++ R+R+ E+  R+RERER ++R R+ ER K+R R+ E+ KDRER+R+ E
Sbjct: 68  EREREREREREKEREREREREEREREREREKEREREREREKEREREREREKDRERERERE 127

Query: 50  KERDRDRDHH 21
           +ER+ D   H
Sbjct: 128 REREMDGKKH 137

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 47/118 (39%), Positives = 82/118 (69%), Gaps = 1/118 (0%)
 Frame = -2

Query: 353 SPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSR-DRD 177
           SP+     ++   D  +N    D+D ++ + RE++RE  RERER+RE+ R+R+R R +R+
Sbjct: 11  SPKLLRYLEQKEKDQDNNPDDDDDDDDNEREREREREREREREREREREREREREREERE 70

Query: 176 SEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            E+ R+RE+ER R+R R+ ER ++R R+ E+ ++RER+++ E+ER+R++D   R+R R
Sbjct: 71  REREREREKERERERERE-EREREREREKEREREREREKEREREREREKD-RERERER 126

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 44/123 (35%), Positives = 76/123 (61%), Gaps = 1/123 (0%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E++  +Q     +D+  +D+  +     + +    +     R+ +RE  + RE++RE  R
Sbjct: 19  EQKEKDQDNNPDDDDDDDDNEREREREREREREREREREREREREREREE-RERERERER 77

Query: 233 ERERKREKGRD-RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           E+ER+RE+ R+ R+R R+R+ E+ R+RERE+ R+R R  ER KDR R  E+ ++RER+ D
Sbjct: 78  EKEREREREREEREREREREKEREREREREKERERER--EREKDRER--EREREREREMD 133

Query: 56  GEK 48
           G+K
Sbjct: 134 GKK 136

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 32/71 (45%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = -2

Query: 290 RDNDRESSKSRE-KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           R+ +RE  + RE ++RE  RE+ER+RE+ R+++R R+R+ EK R+RERER R+R  DG++
Sbjct: 77  REKEREREREREEREREREREKEREREREREKEREREREREKDREREREREREREMDGKK 136

Query: 113 SKDRGRDGEKS 81
                + GE S
Sbjct: 137 HGLPRKTGEGS 147

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 33/106 (31%), Positives = 53/106 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E     +   +     +E           R+ +RE  K RE++
Sbjct: 55  EREREREREREREEREREREREREKEREREREREE-----------REREREREKERERE 103

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RE  +ERER+RE+ +DR+R R+R+ E+  D ++     +  +G  S
Sbjct: 104 REREKEREREREREKDREREREREREREMDGKKHGLPRKTGEGSSS 149

[129][TOP]
>UniRef100_Q4Z6E2 Splicing factor, putative (Fragment) n=1 Tax=Plasmodium berghei
           RepID=Q4Z6E2_PLABE
          Length = 535

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 52/138 (37%), Positives = 80/138 (57%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E  R+ E      +++YH     +P ++ D + +D        D+++ S KSR   +   
Sbjct: 9   ERSRKREDKSESYKEDYHKKRRRKPHSSNDTNSSD--------DDEKRSHKSRSVKKRRH 60

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
             RER+R +GR R RSRDR  ++SRDR R+RSRD+ RD  RS+DR RD  + +DR+R+R 
Sbjct: 61  ERRERRRHRGRSRGRSRDRSRDRSRDRSRDRSRDKSRD--RSRDRSRDRNRYRDRDRERR 118

Query: 56  GEKERDRDRDHHHRDRHR 3
            E+ER+R R     +R +
Sbjct: 119 RERERERMRREREIEREK 136

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 45/113 (39%), Positives = 58/113 (51%), Gaps = 8/113 (7%)
 Frame = -2

Query: 317 TDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRD--------RDSEKSR 162
           +DS+S+   R   RE  KS     +  ++R RK     D + S D        R  +K R
Sbjct: 1   SDSESDQDERSRKRED-KSESYKEDYHKKRRRKPHSSNDTNSSDDDEKRSHKSRSVKKRR 59

Query: 161 DRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
              RER R R R   RS+DR RD  +S+DR RDR  +K RDR RD   RDR+R
Sbjct: 60  HERRERRRHRGRSRGRSRDRSRD--RSRDRSRDRSRDKSRDRSRD-RSRDRNR 109

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = -2

Query: 311 SKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSR-DRERERSRD 135
           S+     R  DR   +SR+K R+  R+R R R + RDRDR R R+ E+ R  RERE  R+
Sbjct: 76  SRDRSRDRSRDRSRDRSRDKSRDRSRDRSRDRNRYRDRDRERRRERERERMRREREIERE 135

Query: 134 RVRDGERSKDRGRDGEK 84
           + R+  R K+   + ++
Sbjct: 136 KRREERRKKEELEEAKR 152

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 30/101 (29%), Positives = 54/101 (53%), Gaps = 1/101 (0%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           ++RR+E+ E       H   S         D +  +S   SRD  R+ S+ R +DR   R
Sbjct: 56  KKRRHERRERRR----HRGRSRGRSRDRSRDRSRDRSRDRSRDKSRDRSRDRSRDRNRYR 111

Query: 233 ERERKREKGRDRDR-SRDRDSEKSRDRERERSRDRVRDGER 114
           +R+R+R + R+R+R  R+R+ E+ + RE  R ++ + + +R
Sbjct: 112 DRDRERRRERERERMRREREIEREKRREERRKKEELEEAKR 152

[130][TOP]
>UniRef100_Q7RXW5 Predicted protein n=1 Tax=Neurospora crassa RepID=Q7RXW5_NEUCR
          Length = 1015

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 60/166 (36%), Positives = 83/166 (50%), Gaps = 24/166 (14%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDN-DRESSKSREK 252
            E E + ER  ++P   G D Y  D         D D          RD  DR+  + R++
Sbjct: 823  ERERDRERDRDKPR-PGPDRYDGDRGRDERGERDRD----------RDRRDRDRDRDRDR 871

Query: 251  DRENGRERERKREKGRDRDRSRDRD----------------------SEKSRDRERERSR 138
            DR+  R+RER R++ RDRDR RDRD                       ++  DRER+R R
Sbjct: 872  DRDRDRDRERNRDRDRDRDRDRDRDRDMRDDRRRSSIVRRRSRSRSRGDRGGDRERDRHR 931

Query: 137  DRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRD-RDHHHRDRHR 3
            DR RD  R + R    E+S+DR++DRD +++RDR+ RDH   D HR
Sbjct: 932  DRDRDSRRERSRDSRRERSRDRDKDRDRDRDRDRESRDHRGGDLHR 977

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 57/141 (40%), Positives = 83/141 (58%), Gaps = 7/141 (4%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE-KDREN 240
            + ER  E P  + ++ Y   ++ +  A  D            R+ DRE+ ++RE ++RE 
Sbjct: 777  DREREREAPLIDSDNRYVPSTAARVVAERD------------RERDREAREAREERERER 824

Query: 239  GRERERKREK---GRDR-DRSRDRDSEKSRDRERE-RSRDRVRDGERSKDRGRDGEKSKD 75
             R+RER R+K   G DR D  R RD    RDR+R+ R RDR RD +R +DR RD E+++D
Sbjct: 825  ERDRERDRDKPRPGPDRYDGDRGRDERGERDRDRDRRDRDRDRDRDRDRDRDRDRERNRD 884

Query: 74   RERDRDGEKERDRD-RDHHHR 15
            R+RDRD +++RDRD RD   R
Sbjct: 885  RDRDRDRDRDRDRDMRDDRRR 905

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 47/153 (30%), Positives = 73/153 (47%), Gaps = 7/153 (4%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
            P  G   ++ +R  ++      D    D         D D    +  +  RD DR+  + 
Sbjct: 835  PRPGPDRYDGDRGRDERGERDRDRDRRDRDRDRDRDRDRDRDRDRERNRDRDRDRDRDRD 894

Query: 260  REKDRENGRERE---RKREKGRDR-DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD 93
            R++D  + R R    R+R + R R DR  DR+ ++ RDR+R+  R+R RD  R + R RD
Sbjct: 895  RDRDMRDDRRRSSIVRRRSRSRSRGDRGGDRERDRHRDRDRDSRRERSRDSRRERSRDRD 954

Query: 92   GEKSKDRERDRDGEKERDRD---RDHHHRDRHR 3
             ++ +DR+RDR+    R  D     HHH  R R
Sbjct: 955  KDRDRDRDRDRESRDHRGGDLHRNSHHHSRRDR 987

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 54/140 (38%), Positives = 78/140 (55%), Gaps = 32/140 (22%)
 Frame = -2

Query: 326  EDLTDSKSNHVSRDNDRESSKSREKDR---ENGRERERKREKG----------------- 207
            +D  D+ +N+ + + +  SS +RE +R      R+RER+RE                   
Sbjct: 743  QDSRDNNNNNNNNNYNNSSSSNREHNRAGDRGDRDREREREAPLIDSDNRYVPSTAARVV 802

Query: 206  --RDRDRSRD-RDSEKSRDRERERSRDRVRDGER------SKDRGRD--GEKSKDRE-RD 63
              RDR+R R+ R++ + R+RERER R+R RD  R        DRGRD  GE+ +DR+ RD
Sbjct: 803  AERDRERDREAREAREERERERERDRERDRDKPRPGPDRYDGDRGRDERGERDRDRDRRD 862

Query: 62   RDGEKERDRDRDHHHRDRHR 3
            RD +++RDRDRD   RDR R
Sbjct: 863  RDRDRDRDRDRD-RDRDRER 881

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 41/99 (41%), Positives = 54/99 (54%), Gaps = 4/99 (4%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESSKSREKDRENGR----ERERKREKGRDRDRSRDRDSEKSRDRERE 147
           + K     R    E    REK+RE  R    +RER+RE  R+R R R+RD  +SRDR+R 
Sbjct: 208 EQKRREERRKKQLEEDAIREKEREERRARREQRERERELSRER-RHRERDRNRSRDRDRH 266

Query: 146 RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           R RDR RD +R + R RD  + +DR   RD +   D  R
Sbjct: 267 RDRDRDRDRDRGRGRSRDRSRGRDRRLSRDAKARNDHGR 305

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 44/138 (31%), Positives = 67/138 (48%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E++RR E+   E E+    +   +     D            R+ +RE  ++R + RE  
Sbjct: 194 EKKRRLEREIKEKEEQKRREERRKKQLEED----------AIREKEREERRARREQRERE 243

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           RE  R+R + R+RDR+R RD ++ RDR+R+R RDR R   R + RGRD   S+D +   D
Sbjct: 244 RELSRER-RHRERDRNRSRDRDRHRDRDRDRDRDRGRGRSRDRSRGRDRRLSRDAKARND 302

Query: 56  GEKERDRDRDHHHRDRHR 3
             +  D        D  R
Sbjct: 303 HGRPEDVKTQLSKEDNER 320

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 39/103 (37%), Positives = 57/103 (55%), Gaps = 1/103 (0%)
 Frame = -2

Query: 320 LTDSKSNHVSRD-NDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER 144
           L + K   + R+  ++E  K RE+ R+   E +  REK R+  R+R    E+ R+  RER
Sbjct: 191 LVEEKKRRLEREIKEKEEQKRREERRKKQLEEDAIREKEREERRARREQRERERELSRER 250

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHR 15
            R R RD  RS+DR R  ++ +DR+RDR   + RDR R    R
Sbjct: 251 -RHRERDRNRSRDRDRHRDRDRDRDRDRGRGRSRDRSRGRDRR 292

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 47/136 (34%), Positives = 66/136 (48%), Gaps = 27/136 (19%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSR-EKDRENGRERERKREKGRDRDRSRDRD-------- 177
            D D  D+  +  SRDN+  ++ +       + RE  R  ++G DRDR R+R+        
Sbjct: 735  DRDARDTPQD--SRDNNNNNNNNNYNNSSSSNREHNRAGDRG-DRDREREREAPLIDSDN 791

Query: 176  -----------SEKSRDRER-------ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGE 51
                       +E+ R+R+R       ER R+R RD ER +D+ R G    D +R RD  
Sbjct: 792  RYVPSTAARVVAERDRERDREAREAREERERERERDRERDRDKPRPGPDRYDGDRGRDER 851

Query: 50   KERDRDRDHHHRDRHR 3
             ERDRDRD   RDR R
Sbjct: 852  GERDRDRDRRDRDRDR 867

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 45/143 (31%), Positives = 68/143 (47%), Gaps = 1/143 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E    + RR E  +   E+     S      AA+     ++   V  +      K R  +
Sbjct: 141 EAHLRKLRRAEIGDEAAEEERIRGSKTDEDYAAETAARRAERERVREELRLVEEKKRRLE 200

Query: 248 RE-NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           RE   +E +++RE+ R +    D   EK R+  R R   R R+ E S++R R  E+ ++R
Sbjct: 201 REIKEKEEQKRREERRKKQLEEDAIREKEREERRARREQRERERELSRER-RHRERDRNR 259

Query: 71  ERDRDGEKERDRDRDHHHRDRHR 3
            RDRD  ++RDRDRD   RDR R
Sbjct: 260 SRDRDRHRDRDRDRD---RDRGR 279

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 45/139 (32%), Positives = 66/139 (47%), Gaps = 1/139 (0%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           EE +   +P+ E  D        +  +  D   + S S       D+E  K RE +++ G
Sbjct: 389 EETKDVTEPK-EVTDTKDIKEPKETASRVDSRRSKSPSPGTRGHRDKEKEKDREGEKDRG 447

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD-GERSKDRGRDGEKSKDRERDR 60
           R+ +R+R+  R     R R  E+SR   RE SR R+RD  ERS+ R R  ++  DR  D 
Sbjct: 448 RDYDRRRKDNRSAS-PRARRIERSRSHRREDSRSRLRDRRERSRSRPR-LDRRDDRREDH 505

Query: 59  DGEKERDRDRDHHHRDRHR 3
             ++ R R R    RDR R
Sbjct: 506 VRDRSRSRRRATDRRDRSR 524

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 51/159 (32%), Positives = 70/159 (44%), Gaps = 19/159 (11%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR- 246
           E E++R  E+  G   D    D+    P A        +    SR + RE S+SR +DR 
Sbjct: 435 EKEKDREGEKDRGRDYDRRRKDNRSASPRA--------RRIERSRSHRREDSRSRLRDRR 486

Query: 245 ENGRER---ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVR------DGERSKDRGRD 93
           E  R R   +R+ ++  D  R R R   ++ DR R+RSR RVR      D  R++ R R 
Sbjct: 487 ERSRSRPRLDRRDDRREDHVRDRSRSRRRATDR-RDRSRSRVRITDRRDDTRRARSRSRA 545

Query: 92  GEKSKDR---------ERDRDGEKERDRDRDHHHRDRHR 3
               +DR          RDR   + R  DRD   R R R
Sbjct: 546 TRDGRDRSRSPRPRVDRRDRSRSRLRPADRDRRVRSRSR 584

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 45/141 (31%), Positives = 58/141 (41%), Gaps = 12/141 (8%)
 Frame = -2

Query: 398 EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE---NGRER 228
           E  E     +     SP P      D    K     +D  R+  + R+ +R      R  
Sbjct: 408 EPKETASRVDSRRSKSPSPGTRGHRDKEKEKDREGEKDRGRDYDRRRKDNRSASPRARRI 467

Query: 227 ERKREKGRDRDRSRDRDS-EKSRDRER-----ERSRDRVRDGERSKDRG---RDGEKSKD 75
           ER R   R+  RSR RD  E+SR R R     +R  D VRD  RS+ R    RD  +S+ 
Sbjct: 468 ERSRSHRREDSRSRLRDRRERSRSRPRLDRRDDRREDHVRDRSRSRRRATDRRDRSRSRV 527

Query: 74  RERDRDGEKERDRDRDHHHRD 12
           R  DR  +  R R R    RD
Sbjct: 528 RITDRRDDTRRARSRSRATRD 548

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 37/130 (28%), Positives = 61/130 (46%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E +  EERR +Q E   ED        +  A  ++   + + +   R  +R+ ++SR++D
Sbjct: 208 EQKRREERRKKQLE---EDAIREKEREERRARREQRERERELSRERRHRERDRNRSRDRD 264

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R   R+R+R R++GR R          SRDR R R R   RD +   D GR  +      
Sbjct: 265 RHRDRDRDRDRDRGRGR----------SRDRSRGRDRRLSRDAKARNDHGRPEDVKTQLS 314

Query: 68  RDRDGEKERD 39
           ++ +   ER+
Sbjct: 315 KEDNERLERE 324

[131][TOP]
>UniRef100_UPI0001A5E9E0 PREDICTED: hypothetical protein XP_002343921 n=1 Tax=Homo sapiens
           RepID=UPI0001A5E9E0
          Length = 600

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 56/149 (37%), Positives = 81/149 (54%), Gaps = 7/149 (4%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSK-SNHVSRDNDRESSKSREK 252
           E E ++ER  E+      D    +   Q         TD K      RD + E  + R++
Sbjct: 255 ETERDKERERERDRDRDRDRRQKERERQ---------TDRKRQRRTERDRETERKRERQR 305

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVR----DGERSKDRGRDGEK 84
           +RE  RER RKRE+ R+R+R R+R  E  RDRE+ER R R R    D ER++  GR+G +
Sbjct: 306 ERERERERNRKRERERERERERERQRETERDREKERERKRKRQTEMDRERNRQTGREGRR 365

Query: 83  SKDRERDRDGEKERD--RDRDHHHRDRHR 3
             +RER+R+ E++R   R+R+   RDR R
Sbjct: 366 QAERERERERERDRQSAREREERERDRDR 394

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 50/143 (34%), Positives = 81/143 (56%), Gaps = 1/143 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E +R  ++   + E     D   Q     D +    +     R+ +RE ++ RE++
Sbjct: 261 ERERERDRDRDRDRRQKERERQTDRKRQRRTERDRETERKRERQRERERERERNRKRERE 320

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           RE  RERER+RE  RDR++ R+R  ++  + +RER+R   R+G R  +R R+ E+ +DR+
Sbjct: 321 RERERERERQRETERDREKERERKRKRQTEMDRERNRQTGREGRRQAERERERERERDRQ 380

Query: 68  RDRD-GEKERDRDRDHHHRDRHR 3
             R+  E+ERDRDRD   ++R R
Sbjct: 381 SAREREERERDRDRD-RQKERER 402

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 41/97 (42%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+  RE  + R++DR   R+R+R++E+ R  DR RDR  EK R+R++ER R+  R+GER 
Sbjct: 79  RERRREKDRHRKRDRHRERQRDREKERERQTDRERDRQREKERNRQKERERETEREGERG 138

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHR-DRHR 3
           +DR  DG++ ++R+RD + E+ER  DR+   + +R+R
Sbjct: 139 RDRQTDGQRERERQRDAEKERERQTDRERQRQTERNR 175

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 47/141 (33%), Positives = 81/141 (57%), Gaps = 3/141 (2%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E ERR E+ + E E +   +         ++D    +  H  R  DRE  + R+ DRE  
Sbjct: 61  ERERRREKRQTERETDRKRERR------REKDRHRKRDRHRERQRDREKERERQTDRERD 114

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRER--ERSRDRVRDGERSKDRGRDGEKSKDRERD 63
           R+RE++R + ++R+R  +R+ E+ RDR+   +R R+R RD E+ ++R  D E+ +  ER+
Sbjct: 115 RQREKERNRQKERERETEREGERGRDRQTDGQRERERQRDAEKERERQTDRERQRQTERN 174

Query: 62  RDGEKERDRDR-DHHHRDRHR 3
           R  E+ER+++R +   R+R R
Sbjct: 175 RQKEREREKNRQERRERERQR 195

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 52/139 (37%), Positives = 77/139 (55%), Gaps = 6/139 (4%)
 Frame = -2

Query: 428 EYEFEEERRYE-QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E Q E E +     +   +     D +          R  +RE  + RE+
Sbjct: 318 ERERERERERERQRETERDREKERERKRKRQTEMDRERNRQTGREGRRQAERERERERER 377

Query: 251 DRENGRERE-RKREKGRDRDRSRDRDSEKSRDRERE----RSRDRVRDGERSKDRGRDGE 87
           DR++ RERE R+R++ RDR + R+R +EK RD +RE    R R++ R+ ER ++RGR+ E
Sbjct: 378 DRQSAREREERERDRDRDRQKERERQTEKDRDGQRETEKQREREKDRESERGRERGRERE 437

Query: 86  KSKDRERDRDGEKERDRDR 30
           K K RERDR+ + +R   R
Sbjct: 438 KQKGRERDRERQTDRQAGR 456

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 50/154 (32%), Positives = 81/154 (52%), Gaps = 17/154 (11%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           ++ R  + E EGE      +  Q       D    +     R+  R++ ++R+K+RE  +
Sbjct: 124 QKERERETEREGERGRDRQTDGQRERERQRDAEKERERQTDRERQRQTERNRQKEREREK 183

Query: 233 ERERKREKGRDRDR---SRDRDSEKSRDRERE--------------RSRDRVRDGERSKD 105
            R+ +RE+ R R++   + DR SE+ R+RERE              R RDR R  ER ++
Sbjct: 184 NRQERRERERQREKENKTEDRHSERGRERERERETETETERKRQTDRERDRQRKTERERE 243

Query: 104 RGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +  + E++ +RE +RD E+ER+RDRD   RDR R
Sbjct: 244 KQAERERASERETERDKERERERDRD---RDRDR 274

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 48/145 (33%), Positives = 82/145 (56%), Gaps = 5/145 (3%)
 Frame = -2

Query: 422 EFEEERRYE-QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
           E E ER  E + E + + +   D   +     ++     +++    + D+E  + R++DR
Sbjct: 211 ERERERETETETERKRQTDRERDRQRKTEREREKQAERERASERETERDKERERERDRDR 270

Query: 245 ENGR---ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           +  R   ERER+ ++ R R   RDR++E+ R+R+RER R+R R+ +R ++R R+ E+ + 
Sbjct: 271 DRDRRQKERERQTDRKRQRRTERDRETERKRERQRERERERERNRKRERERERERERERQ 330

Query: 74  RERDRDGEKERDRDRDHH-HRDRHR 3
           RE +RD EKER+R R      DR R
Sbjct: 331 RETERDREKERERKRKRQTEMDRER 355

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 51/156 (32%), Positives = 82/156 (52%), Gaps = 14/156 (8%)
 Frame = -2

Query: 428 EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER R  Q +G+ E     D+  +     D +       +  ++ +RE ++   +
Sbjct: 130 ETEREGERGRDRQTDGQRERERQRDAEKERERQTDRERQRQTERNRQKEREREKNRQERR 189

Query: 251 DRENGRERERKRE-----KGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG---- 99
           +RE  RE+E K E     +GR+R+R R+ ++E  R R+ +R RDR R  ER +++     
Sbjct: 190 ERERQREKENKTEDRHSERGRERERERETETETERKRQTDRERDRQRKTEREREKQAERE 249

Query: 98  ----RDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
               R+ E+ K+RER+RD    RDRDRD   ++R R
Sbjct: 250 RASERETERDKERERERD----RDRDRDRRQKERER 281

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 43/136 (31%), Positives = 76/136 (55%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E ER  E+ E + E     +   +       ++   ++    R+  R++ + RE++RE
Sbjct: 318 ERERERERER-ERQRETERDREKERERKRKRQTEMDRERNRQTGREGRRQAERERERERE 376

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+  R+RE   +R+R RDRD +K R+R+ E+ RD  R+ E+ ++R +D E  + RER 
Sbjct: 377 RDRQSARERE---ERERDRDRDRQKERERQTEKDRDGQRETEKQREREKDRESERGRERG 433

Query: 62  RDGEKERDRDRDHHHR 15
           R+ EK++ R+RD   +
Sbjct: 434 REREKQKGRERDRERQ 449

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 51/162 (31%), Positives = 83/162 (51%), Gaps = 20/162 (12%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E + E R+ +   E E     ++  +     D +    +     R+   E  ++ E++
Sbjct: 196 EKENKTEDRHSERGRERERERETETETERKRQTDRERDRQRKTEREREKQAERERASERE 255

Query: 248 RENGRERERKREKGRDRDR-----------------SRDRDSEKSRDR--ERERSRDRVR 126
            E  +ERER+R++ RDRDR                  RDR++E+ R+R  ERER R+R R
Sbjct: 256 TERDKERERERDRDRDRDRRQKERERQTDRKRQRRTERDRETERKRERQRERERERERNR 315

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRD-HHHRDRHR 3
             ER ++R R+ E+ ++ ERDR+ E+ER R R     R+R+R
Sbjct: 316 KRERERERERERERQRETERDREKERERKRKRQTEMDRERNR 357

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 44/126 (34%), Positives = 69/126 (54%), Gaps = 2/126 (1%)
 Frame = -2

Query: 398 EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERK 219
           E P   G    H D      A  D+   + +     R   R++ +  ++ RE  RE++R 
Sbjct: 35  ESPRRRGLGQAHKD------ADGDDRERNRQKERERRREKRQTERETDRKRERRREKDRH 88

Query: 218 REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR--DGEKE 45
           R++ R R+R RDR+ E+ R  +RER R R ++  R K+R R+ E+  +R RDR  DG++E
Sbjct: 89  RKRDRHRERQRDREKERERQTDRERDRQREKERNRQKERERETEREGERGRDRQTDGQRE 148

Query: 44  RDRDRD 27
           R+R RD
Sbjct: 149 RERQRD 154

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 44/107 (41%), Positives = 67/107 (62%), Gaps = 3/107 (2%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR--DRDRSRDRDSEKSRDRERERS 141
           D+  +   R+  +E  + REK R+  RE +RKRE+ R  DR R RDR  E+ RDRE+ER 
Sbjct: 48  DADGDDRERNRQKERERRREK-RQTERETDRKRERRREKDRHRKRDRHRERQRDREKERE 106

Query: 140 RDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD-HHHRDRHR 3
           R   R+ +R +++ R+ +K ++RE +R+GE+ RDR  D    R+R R
Sbjct: 107 RQTDRERDRQREKERNRQKERERETEREGERGRDRQTDGQRERERQR 153

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 42/141 (29%), Positives = 72/141 (51%), Gaps = 4/141 (2%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E +R  + E E + +   D   +      ++          R  DR++   RE++R+   
Sbjct: 96  ERQRDREKERERQTDRERDRQREKERNRQKERERETEREGERGRDRQTDGQRERERQRDA 155

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKD---RGRDGEKSKDRERD 63
           E+ER+R+  R+R R  +R+ +K R+RE+ R   R R+ +R K+     R  E+ ++RER+
Sbjct: 156 EKERERQTDRERQRQTERNRQKEREREKNRQERRERERQREKENKTEDRHSERGRERERE 215

Query: 62  RDGEKERDRDRD-HHHRDRHR 3
           R+ E E +R R     RDR R
Sbjct: 216 RETETETERKRQTDRERDRQR 236

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/140 (29%), Positives = 74/140 (52%), Gaps = 2/140 (1%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E +R+ E+   +  +   N    +      E    ++  H  R  +RE  +  E + E  
Sbjct: 166 ERQRQTERNRQKEREREKNRQERRERERQREKENKTEDRHSERGRERERERETETETERK 225

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD-GEKSKDRERDR 60
           R+ +R+R++ R  +R R++ +E+ R  ERE  RD+ R+ ER +DR RD  +K ++R+ DR
Sbjct: 226 RQTDRERDRQRKTEREREKQAERERASERETERDKERERERDRDRDRDRRQKERERQTDR 285

Query: 59  DGEKERDRDRD-HHHRDRHR 3
             ++  +RDR+    R+R R
Sbjct: 286 KRQRRTERDRETERKRERQR 305

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 46/143 (32%), Positives = 79/143 (55%), Gaps = 6/143 (4%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E+ R E+ E E +    N +        D      +     R+ + E+ + R+ DRE  R
Sbjct: 182 EKNRQERRERERQREKENKTE-------DRHSERGRERERERETETETERKRQTDRE--R 232

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE---RSKDRGRDGEKSKDR--E 69
           +R+RK E+ R++   R+R SE+  +R++ER R+R RD +   R K+R R  ++ + R  E
Sbjct: 233 DRQRKTEREREKQAERERASERETERDKERERERDRDRDRDRRQKERERQTDRKRQRRTE 292

Query: 68  RDRDGEKERDRDRD-HHHRDRHR 3
           RDR+ E++R+R R+    R+R+R
Sbjct: 293 RDRETERKRERQRERERERERNR 315

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 38/122 (31%), Positives = 64/122 (52%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E +R  Q E + E N       +  A  + +    +    +R+ +    + R++DR+  +
Sbjct: 342 ERKRKRQTEMDRERNRQTGREGRRQAERERERERERDRQSAREREE---RERDRDRDRQK 398

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           ERER+ EK RD  R  ++  E+ +DRE ER R+R R+ E+ K R RD E+  DR+  R  
Sbjct: 399 ERERQTEKDRDGQRETEKQREREKDRESERGRERGREREKQKGRERDRERQTDRQAGRQR 458

Query: 53  EK 48
           ++
Sbjct: 459 KR 460

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 38/136 (27%), Positives = 70/136 (51%), Gaps = 3/136 (2%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR--EKDREN 240
           E+ R  Q + E +     + + Q     + +    +      D  RE  + R  EK+RE 
Sbjct: 102 EKERERQTDRERDRQREKERNRQKERERETEREGERGRDRQTDGQRERERQRDAEKERER 161

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE-RSKDRGRDGEKSKDRERD 63
             +RER+R+  R+R + R+R+  +   RERER R++    E R  +RGR+ E+ ++ E +
Sbjct: 162 QTDRERQRQTERNRQKEREREKNRQERRERERQREKENKTEDRHSERGRERERERETETE 221

Query: 62  RDGEKERDRDRDHHHR 15
            + +++ DR+RD   +
Sbjct: 222 TERKRQTDRERDRQRK 237

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 43/120 (35%), Positives = 56/120 (46%), Gaps = 7/120 (5%)
 Frame = -2

Query: 341 PAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSR 162
           PA AD+  T      +  D  R    S+E  R  G  +  K   G DR+R+R    +K R
Sbjct: 7   PATADQLGTLWVEVTIPLDFSRRRPGSQESPRRRGLGQAHKDADGDDRERNR----QKER 62

Query: 161 DRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD-------HHHRDRHR 3
           +R RE+     R  ER  DR R+  + KDR R RD  +ER RDR+          RDR R
Sbjct: 63  ERRREK-----RQTERETDRKRERRREKDRHRKRDRHRERQRDREKERERQTDRERDRQR 117

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 33/111 (29%), Positives = 57/111 (51%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E RR  + E E E      S+ +          + +     RD  +E  +  EKDR+  R
Sbjct: 362 EGRRQAERERERERERDRQSARE---------REERERDRDRDRQKERERQTEKDRDGQR 412

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           E E++RE  R++DR  +R  E+ R+RE+++ R+R R+ +  +  GR  ++S
Sbjct: 413 ETEKQRE--REKDRESERGRERGREREKQKGRERDRERQTDRQAGRQRKRS 461

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 4/138 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E +R+  +   E E +   D   +     ++D          RD  RE+ K RE++
Sbjct: 372 ERERERDRQSAREREERERDRDRDRQKERERQTEKD----------RDGQRETEKQRERE 421

Query: 248 R----ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           +    E GRER R+REK + R+R R+R +++   R+R+RS   V    R+    R G   
Sbjct: 422 KDRESERGRERGREREKQKGRERDRERQTDRQAGRQRKRSTLYVNPPPRT---ARSGVVQ 478

Query: 80  KDRERDRDGEKERDRDRD 27
            D  R   G + +    D
Sbjct: 479 SDPNRPTRGIRWKSSPED 496

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 30/101 (29%), Positives = 47/101 (46%), Gaps = 2/101 (1%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  ++      +    D         D D    +     +D D +    ++++
Sbjct: 368 ERERERERERDRQSAREREERERDR--------DRDRQKERERQTEKDRDGQRETEKQRE 419

Query: 248 RENGRERERKREKGRDRDRS--RDRDSEKSRDRERERSRDR 132
           RE  RE ER RE+GR+R++   R+RD E+  DR+  R R R
Sbjct: 420 REKDRESERGRERGREREKQKGRERDRERQTDRQAGRQRKR 460

[132][TOP]
>UniRef100_UPI000194C58B PREDICTED: similar to RNA binding motif protein 25 n=1
           Tax=Taeniopygia guttata RepID=UPI000194C58B
          Length = 839

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 5/137 (3%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E+ERR  + E E E               + +    +     R+ +RE  + R++ ++
Sbjct: 305 EIEKERRERERERERERERRE---------REREREREREKEKERERERERDRDRDRTKD 355

Query: 242 NGRERERKREKGRDRDRS-----RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
             R+RER R++ RDR+RS     R R  EKSRDRERER R+R R+ ER ++R R+ E+ +
Sbjct: 356 RDRDRERDRDRDRDRERSSDRKDRSRSREKSRDRERERERERERERERERERERERERER 415

Query: 77  DRERDRDGEKERDRDRD 27
           +RER+R+ +K+RDR+ D
Sbjct: 416 EREREREKDKKRDREED 432

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/106 (48%), Positives = 71/106 (66%), Gaps = 10/106 (9%)
 Frame = -2

Query: 290 RDNDRESSKSREK-DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           R+ +RE  + RE+ +RE  RERER++EK R+R+R RDRD    RDR ++R RDR RD +R
Sbjct: 311 RERERERERERERREREREREREREKEKERERERERDRD----RDRTKDRDRDRERDRDR 366

Query: 113 S---------KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
                     KDR R  EKS+DRER+R+ E+ER+R+R+   R+R R
Sbjct: 367 DRDRERSSDRKDRSRSREKSRDRERERERERERERERE-RERERER 411

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/141 (34%), Positives = 80/141 (56%), Gaps = 1/141 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ERR  + E E E     +   +     D D T  +     RD DR+  + R  D
Sbjct: 316 ERERERERREREREREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSD 375

Query: 248 REN-GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           R++  R RE+ R++ R+R+R R+R+ E+ R+RERER R+R R+ ER KD+ RD E+ ++ 
Sbjct: 376 RKDRSRSREKSRDREREREREREREREREREREREREREREREREREKDKKRDREEDEED 435

Query: 71  ERDRDGEKERDRDRDHHHRDR 9
             +R   + + R+++  +++R
Sbjct: 436 AYERRKLERKLREKEAAYQER 456

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 46/98 (46%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRER-ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           R    +  + RE++RE  RER ER+RE+ R+R++ ++R+ E+ RDR+R+R++DR RD ER
Sbjct: 303 RQEIEKERRERERERERERERREREREREREREKEKERERERERDRDRDRTKDRDRDRER 362

Query: 113 SKDRGRDGEKSKDR-ERDRDGEKERDRDRDHHHRDRHR 3
            +DR RD E+S DR +R R  EK RDR+R+   R+R R
Sbjct: 363 DRDRDRDRERSSDRKDRSRSREKSRDRERE-RERERER 399

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 48/129 (37%), Positives = 71/129 (55%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER   + E E E     +   +     D D   +K     R+ DR+  + RE+ 
Sbjct: 314 ERERERERERREREREREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERS 373

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            +  ++R R REK RDR+R R+R+ E+ R+RERER R+R R+ ER ++R +D  K +DRE
Sbjct: 374 SDR-KDRSRSREKSRDREREREREREREREREREREREREREREREREREKD--KKRDRE 430

Query: 68  RDRDGEKER 42
            D +   ER
Sbjct: 431 EDEEDAYER 439

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/107 (45%), Positives = 68/107 (63%), Gaps = 2/107 (1%)
 Frame = -2

Query: 317 TDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSR 138
           T  K        ++E  +  ++ RE  RERER+RE+ R+R+R R+R+ EK ++RERER R
Sbjct: 288 THKKLEEEKGKKEKERQEIEKERRERERERERERER-REREREREREREKEKERERERER 346

Query: 137 DRVRDGERSKDRGRDGEKSKDRERDRDGEKER-DRDRDHH-HRDRHR 3
           DR RD  R+KDR RD E+ +DR+RDR+   +R DR R     RDR R
Sbjct: 347 DRDRD--RTKDRDRDRERDRDRDRDRERSSDRKDRSRSREKSRDRER 391

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 41/115 (35%), Positives = 71/115 (61%), Gaps = 6/115 (5%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDND-----RESSKSREKDRENGRERERKREKGRDRDRSR-DRDSEK 168
           +ED  D  S  +S+  D      E    +EK+R+   +  R+RE+ R+R+R R +R+ E+
Sbjct: 271 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 330

Query: 167 SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R+RE+E+ R+R R+ +R +DR +D ++ ++R+RDRD ++ER  DR    R R +
Sbjct: 331 EREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRKDRSRSREK 385

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 38/108 (35%), Positives = 64/108 (59%), Gaps = 2/108 (1%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERER 144
           +T    N +  + D+    SRE  +     ++ + EKG+ +++R       + R+RERER
Sbjct: 260 ITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERER 319

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH-HHRDRHR 3
            R+R R+ ER ++R R+ EK ++RER+RD +++R +DRD    RDR R
Sbjct: 320 ERER-REREREREREREKEKERERERERDRDRDRTKDRDRDRERDRDR 366

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 38/140 (27%), Positives = 73/140 (52%), Gaps = 6/140 (4%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E +R  ++ +    D   +    +    + +    S+S   SRD +RE  + RE++
Sbjct: 341 ERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRKDRSRSREKSRDRERERERERERE 400

Query: 248 RENGRERERK------REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
           RE  RERER+      RE+ R++D+ RDR+ ++    ER +   ++R+ E +        
Sbjct: 401 REREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNW 460

Query: 86  KSKDRERDRDGEKERDRDRD 27
           + ++R++ R+ EKE +R+ +
Sbjct: 461 EIRERKKSREYEKEAEREEE 480

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 31/131 (23%), Positives = 67/131 (51%), Gaps = 2/131 (1%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E +R  ++      D      S +     + +    +     R+ +RE  + RE++RE  
Sbjct: 361 ERDRDRDRDRERSSDRKDRSRSREKSRDRERERERERERERERERERERERERERERERE 420

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERS-RDRVRDGE-RSKDRGRDGEKSKDRERD 63
           RE+++KR++  D + + +R   + + RE+E + ++R+++ E R + + R+ EK  +RE +
Sbjct: 421 REKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKSREYEKEAEREEE 480

Query: 62  RDGEKERDRDR 30
           R  E  ++  R
Sbjct: 481 RRREMAKEAKR 491

[133][TOP]
>UniRef100_A8JEB6 Predicted protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=A8JEB6_CHLRE
          Length = 620

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 64/167 (38%), Positives = 89/167 (53%), Gaps = 29/167 (17%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLT----------DSKSNHVS-RDNDRES 270
           E++R   + + + ED+       QP  + D+D            DSK    S R +D++ 
Sbjct: 143 EDDRWAGRSDRDREDDEVRGHHQQPQRSKDKDRERERDGKDGKRDSKEKATSSRRDDKDG 202

Query: 269 SKSREKDRENGRERERKREKGRDRDR-SRDRDSEKSRDRERERSRDRVRDGERSKDRGR- 96
             +REKD+E  RER R+    RD++R SRDRD E+ R+RERER RDR RD ER ++R R 
Sbjct: 203 KDNREKDKEKERERSRRERDDRDKERGSRDRDRERERERERERERDRERDRERDRERERE 262

Query: 95  -------------DGEKSKDRERDRDGEKERDRDRDHHH---RDRHR 3
                        D ++ +D ERDR+ E+ERDRD D      RDR R
Sbjct: 263 HDRDSRRDDRDFRDWDRERDWERDRERERERDRDWDRSSVDPRDRDR 309

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 45/142 (31%), Positives = 82/142 (57%), Gaps = 2/142 (1%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E  E +  E  +G G+++   D      +  D +  + + +H      ++  + RE+D +
Sbjct: 123 EEAEAKEREMEKGRGKESRQEDDRWAGRSDRDREDDEVRGHHQQPQRSKDKDRERERDGK 182

Query: 242 NGRERERKREKGRDRDRSRDRDS-EKSRDRERERSRDRVRDGERSKDRG-RDGEKSKDRE 69
           +G+   +++     RD    +D+ EK +++ERERSR R RD +R K+RG RD ++ ++RE
Sbjct: 183 DGKRDSKEKATSSRRDDKDGKDNREKDKEKERERSR-RERD-DRDKERGSRDRDRERERE 240

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
           R+R+ E++R+RDR+   RDR R
Sbjct: 241 RERERERDRERDRE---RDRER 259

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 53/202 (26%), Positives = 78/202 (38%), Gaps = 73/202 (36%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE------KDRENGRER 228
           EG G D   N  S +  A +   +   +     +D+     K +         +E    +
Sbjct: 69  EGRGRDRQRNGGSSKQVADSSGAVNKRRGESPEKDSADRPRKRQAIVWEPPTAKEEAEAK 128

Query: 227 ERKREKGR-----------------------------------DRDRSRDRDS------- 174
           ER+ EKGR                                   D+DR R+RD        
Sbjct: 129 EREMEKGRGKESRQEDDRWAGRSDRDREDDEVRGHHQQPQRSKDKDRERERDGKDGKRDS 188

Query: 173 ------------------EKSRDRERERSRDRVRD------GERSKDRGRDGEKSKDRER 66
                             EK +++ERERSR R RD      G R +DR R+ E+ ++RER
Sbjct: 189 KEKATSSRRDDKDGKDNREKDKEKERERSR-RERDDRDKERGSRDRDRERERERERERER 247

Query: 65  DRDGEKERDRDRDHHH-RDRHR 3
           DR+ ++ERDR+R+  H RD  R
Sbjct: 248 DRERDRERDREREREHDRDSRR 269

[134][TOP]
>UniRef100_B6CB12 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Cryptosporidium
           hominis RepID=B6CB12_CRYHO
          Length = 155

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 51/129 (39%), Positives = 82/129 (63%), Gaps = 1/129 (0%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRE-R 228
           RY + + + +DN  +D         D+D    +     R+ +RE  + RE++RE  RE R
Sbjct: 16  RYLEQKEKDQDNNPDDD--------DDDNEREREREKEREREREREREREREREREREER 67

Query: 227 ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
           ER+RE+ R+++R R+R+ E+ R+RERER ++R R+ ER K+R R+ E+ KDRER+R+ E+
Sbjct: 68  EREREREREKEREREREREE-REREREREKEREREREREKEREREREREKDRERERERER 126

Query: 47  ERDRDRDHH 21
           ER+ D   H
Sbjct: 127 EREMDGKKH 135

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/121 (42%), Positives = 81/121 (66%), Gaps = 4/121 (3%)
 Frame = -2

Query: 353 SPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR-SRDRD 177
           SP+     ++   D  +N    D+D E  + REK+RE  RERER+RE+ R+R+R  R+R+
Sbjct: 11  SPKLLRYLEQKEKDQDNNPDDDDDDNEREREREKEREREREREREREREREREREERERE 70

Query: 176 SEKSRDRERERSR---DRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
            E+ R++ERER R   +R R+ ER K+R R+ E+ K+RER+R+ EK+R+R+R+   R+R 
Sbjct: 71  REREREKEREREREREEREREREREKEREREREREKEREREREREKDRERERE---RERE 127

Query: 5   R 3
           R
Sbjct: 128 R 128

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 43/123 (34%), Positives = 74/123 (60%), Gaps = 1/123 (0%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRES-SKSREKDRENG 237
           E++  +Q     +D+  N+   +     + +    +     R+ +RE   + RE++RE  
Sbjct: 19  EQKEKDQDNNPDDDDDDNEREREREKEREREREREREREREREREREEREREREREREKE 78

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           RERER+RE+ R+R+R R+++ E+ R+RE+ER R+R    ER KDR R  E+ ++RER+ D
Sbjct: 79  REREREREE-REREREREKEREREREREKERERER----EREKDRER--EREREREREMD 131

Query: 56  GEK 48
           G+K
Sbjct: 132 GKK 134

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 38/112 (33%), Positives = 61/112 (54%), Gaps = 1/112 (0%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE-KDRENG 237
           E  R  + E E E     +   +     +E     +     R+ +RE  + RE ++RE  
Sbjct: 37  EREREREKEREREREREREREREREREREER---EREREREREKEREREREREERERERE 93

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           RE+ER+RE+ R+++R R+R+ EK R+RERER R+R  DG++     + GE S
Sbjct: 94  REKEREREREREKEREREREREKDREREREREREREMDGKKHGLPRKTGEGS 145

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 33/106 (31%), Positives = 53/106 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E     +   +     +E           R+ +RE  K RE++
Sbjct: 53  EREREREREREREEREREREREREKEREREREREE-----------REREREREKERERE 101

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RE  +ERER+RE+ +DR+R R+R+ E+  D ++     +  +G  S
Sbjct: 102 REREKEREREREREKDREREREREREREMDGKKHGLPRKTGEGSSS 147

[135][TOP]
>UniRef100_UPI00004EC28D RIKEN cDNA 3110050K21 n=1 Tax=Mus musculus RepID=UPI00004EC28D
          Length = 1729

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/142 (36%), Positives = 88/142 (61%), Gaps = 2/142 (1%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E  EERR ++ + E  D+   D         + +    +     R+ + E  ++RE++RE
Sbjct: 719  ERREERRIDRVD-ERRDDRVRDRDRDREREREREREREREREKERERELERERARERERE 777

Query: 242  NGRERERKREKGRD-RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
              +ERER+RE+ RD RDR  DR+ E+ R+RERE+ R+R R+ ER ++R R+ E+ ++RER
Sbjct: 778  REKERERERERERDQRDRDHDREREREREREREKERERERE-ERERERERERERERERER 836

Query: 65   DRDGEKERDRDRDH-HHRDRHR 3
            +R+ E+ER+R+R+    R++ R
Sbjct: 837  ERERERERERERERAREREKER 858

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 51/141 (36%), Positives = 85/141 (60%), Gaps = 1/141 (0%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E E + R E+   +  D   +D         + +    +     R+ +RE    RE+ RE
Sbjct: 714  ELERDERREERRIDRVDERRDDRVRDRDRDREREREREREREREREKERERELERERARE 773

Query: 242  NGRERERKREKGRDRDR-SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
              RERE++RE+ R+R+R  RDRD ++ R+RERER R++ R+ ER ++R R+ E+ ++RER
Sbjct: 774  REREREKERERERERERDQRDRDHDREREREREREREKERERER-EERERERERERERER 832

Query: 65   DRDGEKERDRDRDHHHRDRHR 3
            +R+ E+ER+R+R+   R+R R
Sbjct: 833  ERERERERERERE---RERER 850

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/149 (36%), Positives = 79/149 (53%), Gaps = 16/149 (10%)
 Frame = -2

Query: 401  YEQPEGEGE--DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG--- 237
            +E+  GE +  DN   D  P  P          +S  + RD  RE  +    D       
Sbjct: 683  FERRHGERDRRDNRERDQRPSSPIRHQ-----GRSEELERDERREERRIDRVDERRDDRV 737

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD------ 75
            R+R+R RE+ R+R+R R+R+ EK R+RE ER R R R+ ER K+R R+ E+ +D      
Sbjct: 738  RDRDRDREREREREREREREREKERERELERERAREREREREKERERERERERDQRDRDH 797

Query: 74   -----RERDRDGEKERDRDRDHHHRDRHR 3
                 RER+R+ EKER+R+R+   R+R R
Sbjct: 798  DREREREREREREKEREREREERERERER 826

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 52/140 (37%), Positives = 79/140 (56%), Gaps = 4/140 (2%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R  + E E E     +   +   A + +    K     R+ +R+  + R+ DRE  R
Sbjct: 745  EREREREREREREREKERERELERERAREREREREKERERERERERDQ-RDRDHDRERER 803

Query: 233  ERERKREKGRDRDRS---RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
            ERER+REK R+R+R    R+R+ E+ R+RERER R+R R+ ER ++R R+ EK ++R+R+
Sbjct: 804  EREREREKEREREREERERERERERERERERERERERERERERERERAREREKERERQRE 863

Query: 62   -RDGEKERDRDRDHHHRDRH 6
              D +K RD DR     D H
Sbjct: 864  WEDKDKGRD-DRREKREDIH 882

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 50/148 (33%), Positives = 77/148 (52%), Gaps = 6/148 (4%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  E+     ++        +     D D          R+ +RE  K RE++
Sbjct: 763  ERELERERAREREREREKERERERERERDQRDRDHD------REREREREREREKERERE 816

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER-----SKDRGRDGEK 84
            RE  RERER+RE+ R+R+R R+R+ E+ R+RERER+R+R ++ ER      KD+GRD  +
Sbjct: 817  REE-RERERERERERERERERERERERERERERERAREREKERERQREWEDKDKGRDDRR 875

Query: 83   SKDRE-RDRDGEKERDRDRDHHHRDRHR 3
             K  +   R+    RD   +   + R+R
Sbjct: 876  EKREDIHVREDRIPRDSHEERKSKKRYR 903

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 42/106 (39%), Positives = 66/106 (62%), Gaps = 9/106 (8%)
 Frame = -2

Query: 293 SRDNDRESSKSR---EKDRENGRERERK-----REKGRDRDRSRDRDSEKSR-DRERERS 141
           +RD  R+SS  R   E+DR + RER+++     R +GR  +  RD   E+ R DR  ER 
Sbjct: 674 TRDPARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRSEELERDERREERRIDRVDERR 733

Query: 140 RDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            DRVRD +R ++R R+ E+ ++RER+++ E+E +R+R    R+R R
Sbjct: 734 DDRVRDRDRDREREREREREREREREKERERELERER-ARERERER 778

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 42/129 (32%), Positives = 66/129 (51%), Gaps = 9/129 (6%)
 Frame = -2

Query: 386  GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKG 207
            GE +         +P  +   D  DS+S H SR +  ES +       +   R+R +E+ 
Sbjct: 1310 GERKSRIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGSFDSRDRLQERD 1368

Query: 206  R---DRDRSRDRDSEKSR--DRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD----G 54
            R   DR+R RDR   + R  DRE E+   R RD +R ++R RD ++ +D +R+R+     
Sbjct: 1369 RYEHDRERERDRRDPRQREWDREAEKEWPRTRDRDRLRERDRDRDRRRDLDRERERLISD 1428

Query: 53   EKERDRDRD 27
              ERDR+R+
Sbjct: 1429 PMERDRERE 1437

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 43/142 (30%), Positives = 67/142 (47%), Gaps = 7/142 (4%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAAD---EDLTDSKSNHVSRDNDRESSKSR 258
            E E E ER  +Q + + +     +   +     +   E+    +     R+ +RE  + R
Sbjct: 781  ERERERERERDQRDRDHDREREREREREREKEREREREERERERERERERERERERERER 840

Query: 257  EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD-RVRDGERSKDRGRDGEKS 81
            E++RE  RER R+REK R+R R  + D +K RD  RE+  D  VR+    +D   +  KS
Sbjct: 841  ERERERERERAREREKERERQREWE-DKDKGRDDRREKREDIHVREDRIPRD-SHEERKS 898

Query: 80   KDRERDRDGEKERD---RDRDH 24
            K R R+      R    R R+H
Sbjct: 899  KKRYRNEGSPSPRQSPKRRREH 920

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 41/106 (38%), Positives = 55/106 (51%), Gaps = 13/106 (12%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRE------NGRERERKREKGRDRDRSRDRDSEKSR--DRERERSRD 135
            R+ DR   + RE DRE        R+R+R RE+ RDRDR RD D E+ R      ER R+
Sbjct: 1376 RERDRRDPRQREWDREAEKEWPRTRDRDRLRERDRDRDRRRDLDRERERLISDPMERDRE 1435

Query: 134  RVRDGERSK-DRGRDGEKSKDRERDRDGE-KERDR---DRDHHHRD 12
            R R  E S+ + G+  E   + E +RD E   RD    D++   RD
Sbjct: 1436 RERTFETSQLESGKRSEVKLESEHERDLEGSSRDSVALDKERMDRD 1481

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 6/125 (4%)
 Frame = -2

Query: 365 HNDSSPQ----PPAAADEDLTDSKSNH--VSRDNDRESSKSREKDRENGRERERKREKGR 204
           H  SSPQ    PP          + +H   S+ +DR   +  E   +  RE++ + E+  
Sbjct: 376 HCLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREETRGKRDREKDTREERES 435

Query: 203 DRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH 24
           + D   DR+   SRDR   R R  +RD    +D     + S+D +  RD    R     H
Sbjct: 436 EHDHRDDREPRDSRDRRDTRDRRELRDSRDMRDSREMRDYSRDAKESRDPRDSRSARDVH 495

Query: 23  HHRDR 9
            +RDR
Sbjct: 496 DYRDR 500

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 39/118 (33%), Positives = 59/118 (50%), Gaps = 11/118 (9%)
 Frame = -2

Query: 323  DLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR----------SRDRDS 174
            ++T  + + + +    E S+S   DR++ R    +R    + DR          SRDR  
Sbjct: 1307 EITGERKSRIDQLKRGEPSRSTSSDRQDSRSHSSRRSSP-ESDRQVHSRSGSFDSRDRLQ 1365

Query: 173  EKSR-DRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            E+ R + +RER RDR    +R  DR  + E  + R+RDR  E++RDRDR     DR R
Sbjct: 1366 ERDRYEHDRERERDRRDPRQREWDREAEKEWPRTRDRDRLRERDRDRDR-RRDLDRER 1422

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 3/104 (2%)
 Frame = -2

Query: 314  DSKSNHVSRD---NDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER 144
            DS+     RD   +DRE  + R   R+   +RE ++E  R RDR R R+ ++ RDR R+ 
Sbjct: 1359 DSRDRLQERDRYEHDRERERDRRDPRQREWDREAEKEWPRTRDRDRLRERDRDRDRRRDL 1418

Query: 143  SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
             R+R R      +R R+ E++ +  +   G++   +    H RD
Sbjct: 1419 DRERERLISDPMERDRERERTFETSQLESGKRSEVKLESEHERD 1462

[136][TOP]
>UniRef100_Q8BHW0 Putative uncharacterized protein (Fragment) n=1 Tax=Mus musculus
            RepID=Q8BHW0_MOUSE
          Length = 734

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 51/140 (36%), Positives = 85/140 (60%), Gaps = 11/140 (7%)
 Frame = -2

Query: 401  YEQPEGEGE--DNYHNDSSPQPPA---AADEDLTDSK---SNHVSRDNDRESSKSREKDR 246
            +E+  GE +  DN   D  P  P       E+L   +      + R ++R   + R++DR
Sbjct: 595  FERRHGERDRRDNRERDQRPSSPIRHQGRSEELERDERREERRIDRVDERRDDRVRDRDR 654

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG---RDGEKSKD 75
            +  RERER+RE+ R+R++ R+R+ E+ R RERER R++ R+ ER ++R    RD ++ ++
Sbjct: 655  DREREREREREREREREKERERELERERAREREREREKERERERERERDQRDRDHDRERE 714

Query: 74   RERDRDGEKERDRDRDHHHR 15
            RER+R+ EKER+R+R+   R
Sbjct: 715  REREREREKEREREREERER 734

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 42/106 (39%), Positives = 66/106 (62%), Gaps = 9/106 (8%)
 Frame = -2

Query: 293 SRDNDRESSKSR---EKDRENGRERERK-----REKGRDRDRSRDRDSEKSR-DRERERS 141
           +RD  R+SS  R   E+DR + RER+++     R +GR  +  RD   E+ R DR  ER 
Sbjct: 586 TRDPARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRSEELERDERREERRIDRVDERR 645

Query: 140 RDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            DRVRD +R ++R R+ E+ ++RER+++ E+E +R+R    R+R R
Sbjct: 646 DDRVRDRDRDREREREREREREREREKERERELERER-ARERERER 690

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 1/106 (0%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E + R E+   +  D   +D         + +    +     R+ +RE    RE+ RE
Sbjct: 626 ELERDERREERRIDRVDERRDDRVRDRDRDREREREREREREREREKERERELERERARE 685

Query: 242 NGRERERKREKGRDRDR-SRDRDSEKSRDRERERSRDRVRDGERSK 108
             RERE++RE+ R+R+R  RDRD ++ R+RERER R++ R+ ER +
Sbjct: 686 REREREKERERERERERDQRDRDHDREREREREREREKEREREREE 731

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 35/125 (28%), Positives = 54/125 (43%), Gaps = 6/125 (4%)
 Frame = -2

Query: 365 HNDSSPQ----PPAAADEDLTDSKSNH--VSRDNDRESSKSREKDRENGRERERKREKGR 204
           H  SSPQ    PP          + +H   S+ +DR   +  E   +  RE++ + E+  
Sbjct: 288 HCLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREETRGKRDREKDTREERES 347

Query: 203 DRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH 24
           + D   DR+   SRD+   R R  +RD    +D     + S+D +  RD    R     H
Sbjct: 348 EHDHRDDREPRDSRDQRDTRDRRELRDSRDMRDSREMRDYSRDAKESRDPRDSRSARDVH 407

Query: 23  HHRDR 9
            +RDR
Sbjct: 408 DYRDR 412

[137][TOP]
>UniRef100_B9EHN9 Zinc finger CCCH type containing 13 n=1 Tax=Mus musculus
            RepID=B9EHN9_MOUSE
          Length = 1730

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/142 (36%), Positives = 88/142 (61%), Gaps = 2/142 (1%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E  EERR ++ + E  D+   D         + +    +     R+ + E  ++RE++RE
Sbjct: 719  ERREERRIDRVD-ERRDDRVRDRDRDREREREREREREREREKERERELERERARERERE 777

Query: 242  NGRERERKREKGRD-RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
              +ERER+RE+ RD RDR  DR+ E+ R+RERE+ R+R R+ ER ++R R+ E+ ++RER
Sbjct: 778  REKERERERERERDQRDRDHDREREREREREREKERERERE-ERERERERERERERERER 836

Query: 65   DRDGEKERDRDRDH-HHRDRHR 3
            +R+ E+ER+R+R+    R++ R
Sbjct: 837  ERERERERERERERAREREKER 858

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 51/141 (36%), Positives = 85/141 (60%), Gaps = 1/141 (0%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E E + R E+   +  D   +D         + +    +     R+ +RE    RE+ RE
Sbjct: 714  ELERDERREERRIDRVDERRDDRVRDRDRDREREREREREREREREKERERELERERARE 773

Query: 242  NGRERERKREKGRDRDR-SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
              RERE++RE+ R+R+R  RDRD ++ R+RERER R++ R+ ER ++R R+ E+ ++RER
Sbjct: 774  REREREKERERERERERDQRDRDHDREREREREREREKERERER-EERERERERERERER 832

Query: 65   DRDGEKERDRDRDHHHRDRHR 3
            +R+ E+ER+R+R+   R+R R
Sbjct: 833  ERERERERERERE---RERER 850

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/149 (36%), Positives = 79/149 (53%), Gaps = 16/149 (10%)
 Frame = -2

Query: 401  YEQPEGEGE--DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG--- 237
            +E+  GE +  DN   D  P  P          +S  + RD  RE  +    D       
Sbjct: 683  FERRHGERDRRDNRERDQRPSSPIRHQ-----GRSEELERDERREERRIDRVDERRDDRV 737

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD------ 75
            R+R+R RE+ R+R+R R+R+ EK R+RE ER R R R+ ER K+R R+ E+ +D      
Sbjct: 738  RDRDRDREREREREREREREREKERERELERERAREREREREKERERERERERDQRDRDH 797

Query: 74   -----RERDRDGEKERDRDRDHHHRDRHR 3
                 RER+R+ EKER+R+R+   R+R R
Sbjct: 798  DREREREREREREKEREREREERERERER 826

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 52/140 (37%), Positives = 79/140 (56%), Gaps = 4/140 (2%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R  + E E E     +   +   A + +    K     R+ +R+  + R+ DRE  R
Sbjct: 745  EREREREREREREREKERERELERERAREREREREKERERERERERDQ-RDRDHDRERER 803

Query: 233  ERERKREKGRDRDRS---RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
            ERER+REK R+R+R    R+R+ E+ R+RERER R+R R+ ER ++R R+ EK ++R+R+
Sbjct: 804  EREREREKEREREREERERERERERERERERERERERERERERERERAREREKERERQRE 863

Query: 62   -RDGEKERDRDRDHHHRDRH 6
              D +K RD DR     D H
Sbjct: 864  WEDKDKGRD-DRREKREDIH 882

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 50/148 (33%), Positives = 77/148 (52%), Gaps = 6/148 (4%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  E+     ++        +     D D          R+ +RE  K RE++
Sbjct: 763  ERELERERAREREREREKERERERERERDQRDRDHD------REREREREREREKERERE 816

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER-----SKDRGRDGEK 84
            RE  RERER+RE+ R+R+R R+R+ E+ R+RERER+R+R ++ ER      KD+GRD  +
Sbjct: 817  REE-RERERERERERERERERERERERERERERERAREREKERERQREWEDKDKGRDDRR 875

Query: 83   SKDRE-RDRDGEKERDRDRDHHHRDRHR 3
             K  +   R+    RD   +   + R+R
Sbjct: 876  EKREDIHVREDRIPRDSHEERKSKKRYR 903

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 42/106 (39%), Positives = 66/106 (62%), Gaps = 9/106 (8%)
 Frame = -2

Query: 293 SRDNDRESSKSR---EKDRENGRERERK-----REKGRDRDRSRDRDSEKSR-DRERERS 141
           +RD  R+SS  R   E+DR + RER+++     R +GR  +  RD   E+ R DR  ER 
Sbjct: 674 TRDPARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRSEELERDERREERRIDRVDERR 733

Query: 140 RDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            DRVRD +R ++R R+ E+ ++RER+++ E+E +R+R    R+R R
Sbjct: 734 DDRVRDRDRDREREREREREREREREKERERELERER-ARERERER 778

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 42/129 (32%), Positives = 66/129 (51%), Gaps = 9/129 (6%)
 Frame = -2

Query: 386  GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKG 207
            GE +         +P  +   D  DS+S H SR +  ES +       +   R+R +E+ 
Sbjct: 1310 GERKSRIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGSFDSRDRLQERD 1368

Query: 206  R---DRDRSRDRDSEKSR--DRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD----G 54
            R   DR+R RDR   + R  DRE E+   R RD +R ++R RD ++ +D +R+R+     
Sbjct: 1369 RYEHDRERERDRRDPRQREWDREAEKEWPRTRDRDRLRERDRDRDRRRDLDRERERLISD 1428

Query: 53   EKERDRDRD 27
              ERDR+R+
Sbjct: 1429 PMERDRERE 1437

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 43/142 (30%), Positives = 67/142 (47%), Gaps = 7/142 (4%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAAD---EDLTDSKSNHVSRDNDRESSKSR 258
            E E E ER  +Q + + +     +   +     +   E+    +     R+ +RE  + R
Sbjct: 781  ERERERERERDQRDRDHDREREREREREREKEREREREERERERERERERERERERERER 840

Query: 257  EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD-RVRDGERSKDRGRDGEKS 81
            E++RE  RER R+REK R+R R  + D +K RD  RE+  D  VR+    +D   +  KS
Sbjct: 841  ERERERERERAREREKERERQREWE-DKDKGRDDRREKREDIHVREDRIPRD-SHEERKS 898

Query: 80   KDRERDRDGEKERD---RDRDH 24
            K R R+      R    R R+H
Sbjct: 899  KKRYRNEGSPSPRQSPKRRREH 920

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 41/106 (38%), Positives = 55/106 (51%), Gaps = 13/106 (12%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRE------NGRERERKREKGRDRDRSRDRDSEKSR--DRERERSRD 135
            R+ DR   + RE DRE        R+R+R RE+ RDRDR RD D E+ R      ER R+
Sbjct: 1376 RERDRRDPRQREWDREAEKEWPRTRDRDRLRERDRDRDRRRDLDRERERLISDPMERDRE 1435

Query: 134  RVRDGERSK-DRGRDGEKSKDRERDRDGE-KERDR---DRDHHHRD 12
            R R  E S+ + G+  E   + E +RD E   RD    D++   RD
Sbjct: 1436 RERTFETSQLESGKRSEVKLESEHERDLEGSSRDSVALDKERMDRD 1481

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 6/125 (4%)
 Frame = -2

Query: 365 HNDSSPQ----PPAAADEDLTDSKSNH--VSRDNDRESSKSREKDRENGRERERKREKGR 204
           H  SSPQ    PP          + +H   S+ +DR   +  E   +  RE++ + E+  
Sbjct: 376 HCLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREETRGKRDREKDTREERES 435

Query: 203 DRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH 24
           + D   DR+   SRDR   R R  +RD    +D     + S+D +  RD    R     H
Sbjct: 436 EHDHRDDREPRDSRDRRDTRDRRELRDSRDMRDSREMRDYSRDAKESRDPRDSRSARDVH 495

Query: 23  HHRDR 9
            +RDR
Sbjct: 496 DYRDR 500

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 39/118 (33%), Positives = 59/118 (50%), Gaps = 11/118 (9%)
 Frame = -2

Query: 323  DLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR----------SRDRDS 174
            ++T  + + + +    E S+S   DR++ R    +R    + DR          SRDR  
Sbjct: 1307 EITGERKSRIDQLKRGEPSRSTSSDRQDSRSHSSRRSSP-ESDRQVHSRSGSFDSRDRLQ 1365

Query: 173  EKSR-DRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            E+ R + +RER RDR    +R  DR  + E  + R+RDR  E++RDRDR     DR R
Sbjct: 1366 ERDRYEHDRERERDRRDPRQREWDREAEKEWPRTRDRDRLRERDRDRDR-RRDLDRER 1422

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 3/104 (2%)
 Frame = -2

Query: 314  DSKSNHVSRD---NDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER 144
            DS+     RD   +DRE  + R   R+   +RE ++E  R RDR R R+ ++ RDR R+ 
Sbjct: 1359 DSRDRLQERDRYEHDRERERDRRDPRQREWDREAEKEWPRTRDRDRLRERDRDRDRRRDL 1418

Query: 143  SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
             R+R R      +R R+ E++ +  +   G++   +    H RD
Sbjct: 1419 DRERERLISDPMERDRERERTFETSQLESGKRSEVKLESEHERD 1462

[138][TOP]
>UniRef100_Q7PN71 AGAP007825-PA (Fragment) n=1 Tax=Anopheles gambiae
           RepID=Q7PN71_ANOGA
          Length = 670

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 51/98 (52%), Positives = 69/98 (70%), Gaps = 4/98 (4%)
 Frame = -2

Query: 284 NDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKD 105
           N++  S+SRE+D    R+RER+RE+ RDRDR R+R+ E+ RDRERER RDR RD +R +D
Sbjct: 3   NEKRRSRSRERDTRPDRDRERERERERDRDRDRERERERDRDRERERERDRDRDWDRRRD 62

Query: 104 RGRDGEK---SKDRERDRD-GEKERDRDRDHHHRDRHR 3
           R R+  +    +DR  DRD  E++R+RDRD   RDR R
Sbjct: 63  RERERHRELQQRDRPGDRDRAERDRERDRD---RDRDR 97

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 43/108 (39%), Positives = 69/108 (63%), Gaps = 4/108 (3%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERS 141
           + + K    SR+ D    + RE++RE  R+R+R RE+ R+RDR R+R+ E+ RDR+ +R 
Sbjct: 1   MVNEKRRSRSRERDTRPDRDRERERERERDRDRDRERERERDRDRERERERDRDRDWDRR 60

Query: 140 RDRVRDGERS-KDRGRDGEK---SKDRERDRDGEKERDRDRDHHHRDR 9
           RDR R+  R  + R R G++    +DRERDRD +++R  D+D   +D+
Sbjct: 61  RDRERERHRELQQRDRPGDRDRAERDRERDRDRDRDRAEDKDKARKDK 108

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 38/99 (38%), Positives = 60/99 (60%), Gaps = 4/99 (4%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKRE--KGRDRDRSRDRD-SEKSRD 159
           D D    +     RD DRE  + R++DRE  RER+R R+  + RDR+R R R+  ++ R 
Sbjct: 18  DRDRERERERERDRDRDRERERERDRDRERERERDRDRDWDRRRDRERERHRELQQRDRP 77

Query: 158 RERERS-RDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
            +R+R+ RDR RD +R +DR  D +K++  + D + E+E
Sbjct: 78  GDRDRAERDRERDRDRDRDRAEDKDKARKDKLDDEQEEE 116

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 37/101 (36%), Positives = 58/101 (57%), Gaps = 20/101 (19%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER----------- 144
           RD +RE  + R++DR+  RERER R++ R+R+R RDRD ++ RDRERER           
Sbjct: 19  RDRERERERERDRDRDRERERERDRDRERERERDRDRDWDRRRDRERERHRELQQRDRPG 78

Query: 143 ---------SRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
                     RDR RD +R++D+ +  +   D E++ + +K
Sbjct: 79  DRDRAERDRERDRDRDRDRAEDKDKARKDKLDDEQEEELKK 119

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 36/123 (29%), Positives = 60/123 (48%), Gaps = 6/123 (4%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E+RR    E +   +   +   +     D D    +     R+ +RE  + R+ DR   R
Sbjct: 4   EKRRSRSRERDTRPDRDRERERERERDRDRDRERERERDRDRERERERDRDRDWDRRRDR 63

Query: 233 ERERKRE-----KGRDRDRS-RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           ERER RE     +  DRDR+ RDR+ ++ RDR+R   +D+ R     KD+  D ++ + +
Sbjct: 64  ERERHRELQQRDRPGDRDRAERDRERDRDRDRDRAEDKDKAR-----KDKLDDEQEEELK 118

Query: 71  ERD 63
           + D
Sbjct: 119 KGD 121

[139][TOP]
>UniRef100_Q5CHL3 Hydroxyproline-rich glycoprotein dz-hrgp n=1 Tax=Cryptosporidium
           hominis RepID=Q5CHL3_CRYHO
          Length = 328

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/118 (44%), Positives = 80/118 (67%), Gaps = 1/118 (0%)
 Frame = -2

Query: 353 SPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRD 177
           SP+     ++   D  +N    D+D E  + RE++RE  RERER+RE+ R +R+R R+R+
Sbjct: 11  SPKLLRYLEQKEKDQDNNPDDDDDDNEREREREREREREREREREREREREERERERERE 70

Query: 176 SEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            EK R+RERER  +R R+ ER K+R R+ E+ K+RER+R+ EK+R+R+R+   R+R R
Sbjct: 71  REKERERERER-EEREREREREKEREREREREKEREREREREKDRERERE---RERER 124

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 51/130 (39%), Positives = 80/130 (61%), Gaps = 2/130 (1%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           RY + + + +DN  +D              D   N   R+ +RE  + RE++RE  RERE
Sbjct: 16  RYLEQKEKDQDNNPDD--------------DDDDNERERERERERERERERERERERERE 61

Query: 224 -RKREKGRDRDRSRDRDSEKS-RDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGE 51
            R+RE+ R+R++ R+R+ E+  R+RERER ++R R+ ER K+R R+ E+ KDRER+R+ E
Sbjct: 62  EREREREREREKEREREREREEREREREREKEREREREREKEREREREREKDRERERERE 121

Query: 50  KERDRDRDHH 21
           +ER+ D   H
Sbjct: 122 REREMDGKKH 131

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 41/116 (35%), Positives = 65/116 (56%), Gaps = 3/116 (2%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E +E+ +   P+ + +DN       +      E   + +     R+ +RE  + +E++RE
Sbjct: 19  EQKEKDQDNNPDDDDDDNEREREREREREREREREREREREREEREREREREREKERERE 78

Query: 242 NGRE---RERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
             RE   RER+REK R+R+R R    EK R+RERER +DR R+ ER ++R  DG+K
Sbjct: 79  REREEREREREREKERERERER----EKEREREREREKDREREREREREREMDGKK 130

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 33/106 (31%), Positives = 53/106 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E     +   +     +E           R+ +RE  K RE++
Sbjct: 49  EREREREREREREEREREREREREKEREREREREE-----------REREREREKERERE 97

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RE  +ERER+RE+ +DR+R R+R+ E+  D ++     +  +G  S
Sbjct: 98  REREKEREREREREKDREREREREREREMDGKKHGLPRKTGEGSSS 143

[140][TOP]
>UniRef100_A1BYA9 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Cryptosporidium
           hominis RepID=A1BYA9_CRYHO
          Length = 155

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 51/129 (39%), Positives = 82/129 (63%), Gaps = 1/129 (0%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRE-R 228
           RY + + + +DN  +D         D+D    +     R+ +RE  + RE++RE  RE R
Sbjct: 16  RYLEQKEKDQDNNPDDD--------DDDNEREREREREREREREREREREREREREREER 67

Query: 227 ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
           ER+RE+ R+++R R+R+ E+ R+RERER ++R R+ ER K+R R+ E+ KDRER+R+ E+
Sbjct: 68  EREREREREKEREREREREE-REREREREKEREREREREKEREREREREKDRERERERER 126

Query: 47  ERDRDRDHH 21
           ER+ D   H
Sbjct: 127 EREMDGKKH 135

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 51/121 (42%), Positives = 81/121 (66%), Gaps = 4/121 (3%)
 Frame = -2

Query: 353 SPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR-SRDRD 177
           SP+     ++   D  +N    D+D E  + RE++RE  RERER+RE+ R+R+R  R+R+
Sbjct: 11  SPKLLRYLEQKEKDQDNNPDDDDDDNEREREREREREREREREREREREREREREERERE 70

Query: 176 SEKSRDRERERSR---DRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
            E+ R++ERER R   +R R+ ER K+R R+ E+ K+RER+R+ EK+R+R+R+   R+R 
Sbjct: 71  REREREKEREREREREEREREREREKEREREREREKEREREREREKDRERERE---RERE 127

Query: 5   R 3
           R
Sbjct: 128 R 128

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 43/123 (34%), Positives = 74/123 (60%), Gaps = 1/123 (0%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRES-SKSREKDRENG 237
           E++  +Q     +D+  N+   +     + +    +     R+ +RE   + RE++RE  
Sbjct: 19  EQKEKDQDNNPDDDDDDNEREREREREREREREREREREREREREREEREREREREREKE 78

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           RERER+RE+ R+R+R R+++ E+ R+RE+ER R+R    ER KDR R  E+ ++RER+ D
Sbjct: 79  REREREREE-REREREREKEREREREREKERERER----EREKDRER--EREREREREMD 131

Query: 56  GEK 48
           G+K
Sbjct: 132 GKK 134

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 32/71 (45%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = -2

Query: 290 RDNDRESSKSRE-KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
           R+ +RE  + RE ++RE  RE+ER+RE+ R+++R R+R+ EK R+RERER R+R  DG++
Sbjct: 75  REKEREREREREEREREREREKEREREREREKEREREREREKDREREREREREREMDGKK 134

Query: 113 SKDRGRDGEKS 81
                + GE S
Sbjct: 135 HGLPRKTGEGS 145

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 33/106 (31%), Positives = 53/106 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E     +   +     +E           R+ +RE  K RE++
Sbjct: 53  EREREREREREREEREREREREREKEREREREREE-----------REREREREKERERE 101

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RE  +ERER+RE+ +DR+R R+R+ E+  D ++     +  +G  S
Sbjct: 102 REREKEREREREREKDREREREREREREMDGKKHGLPRKTGEGSSS 147

[141][TOP]
>UniRef100_A1BYA7 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Cryptosporidium
           hominis RepID=A1BYA7_CRYHO
          Length = 151

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/118 (44%), Positives = 80/118 (67%), Gaps = 1/118 (0%)
 Frame = -2

Query: 353 SPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRD 177
           SP+     ++   D  +N    D+D E  + RE++RE  RERER+RE+ R +R+R R+R+
Sbjct: 11  SPKLLRYLEQKEKDQDNNPDDDDDDNEREREREREREREREREREREREREERERERERE 70

Query: 176 SEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            EK R+RERER  +R R+ ER K+R R+ E+ K+RER+R+ EK+R+R+R+   R+R R
Sbjct: 71  REKERERERER-EEREREREREKEREREREREKEREREREREKDRERERE---RERER 124

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 51/130 (39%), Positives = 80/130 (61%), Gaps = 2/130 (1%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
           RY + + + +DN  +D              D   N   R+ +RE  + RE++RE  RERE
Sbjct: 16  RYLEQKEKDQDNNPDD--------------DDDDNERERERERERERERERERERERERE 61

Query: 224 -RKREKGRDRDRSRDRDSEKS-RDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGE 51
            R+RE+ R+R++ R+R+ E+  R+RERER ++R R+ ER K+R R+ E+ KDRER+R+ E
Sbjct: 62  EREREREREREKEREREREREEREREREREKEREREREREKEREREREREKDRERERERE 121

Query: 50  KERDRDRDHH 21
           +ER+ D   H
Sbjct: 122 REREMDGKKH 131

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 41/116 (35%), Positives = 65/116 (56%), Gaps = 3/116 (2%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E +E+ +   P+ + +DN       +      E   + +     R+ +RE  + +E++RE
Sbjct: 19  EQKEKDQDNNPDDDDDDNEREREREREREREREREREREREREEREREREREREKERERE 78

Query: 242 NGRE---RERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
             RE   RER+REK R+R+R R    EK R+RERER +DR R+ ER ++R  DG+K
Sbjct: 79  REREEREREREREKERERERER----EKEREREREREKDREREREREREREMDGKK 130

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 33/106 (31%), Positives = 53/106 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E     +   +     +E           R+ +RE  K RE++
Sbjct: 49  EREREREREREREEREREREREREKEREREREREE-----------REREREREKERERE 97

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RE  +ERER+RE+ +DR+R R+R+ E+  D ++     +  +G  S
Sbjct: 98  REREKEREREREREKDREREREREREREMDGKKHGLPRKTGEGSSS 143

[142][TOP]
>UniRef100_Q2GW32 Putative uncharacterized protein n=1 Tax=Chaetomium globosum
           RepID=Q2GW32_CHAGB
          Length = 888

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 47/101 (46%), Positives = 64/101 (63%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           K        D+E  + REK+RE  RERE++REK R+++R   RD ++SRDR+RER RDR 
Sbjct: 217 KEREEDERRDKERRERREKEREREREREKEREKEREKERESRRDRDRSRDRDRERDRDRD 276

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
           R  ER  D  R   + + R+RDR  +++RDRDRD   RD H
Sbjct: 277 RFRERGYDSYRGTPRDRSRDRDRGRDRDRDRDRDRGRRDSH 317

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 57/149 (38%), Positives = 80/149 (53%), Gaps = 11/149 (7%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSP-----QPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            +E R    P    +D    D SP     + P   D  L   +     RD +R+    R  
Sbjct: 712  KEAREKGMPVPGIDDRRAGDKSPDLKRRREPEEHDRYLPGDRDRDRDRDRERDRMDYRGG 771

Query: 251  DRENGRERERKREKGRDRDRSRDR-DSEKSRDRERE-----RSRDRVRDGERSKDRGRDG 90
            DR +G +R+R R++ RDRDR RDR D  + RDR R+     R R R R  +R +DR RD 
Sbjct: 772  DRYDG-DRDRPRDRDRDRDRDRDRRDRSRDRDRARDDRRDTRRRSRSRSRDRERDRSRDR 830

Query: 89   EKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            ++++DR+RDRD  ++RDRDRD H+R   R
Sbjct: 831  DRNRDRDRDRD--QDRDRDRDSHYRRSRR 857

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/136 (36%), Positives = 71/136 (52%), Gaps = 7/136 (5%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            + +R  ++ +  G D Y  D         D D    +     RD  R+  ++R+ DR + 
Sbjct: 758  DRDRERDRMDYRGGDRYDGDRDRPRDRDRDRDRDRDR-----RDRSRDRDRARD-DRRDT 811

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG-------ERSKDRGRDGEKSK 78
            R R R R + R+RDRSRDRD  + RDR+R++ RDR RD        ERS    RD ++ +
Sbjct: 812  RRRSRSRSRDRERDRSRDRDRNRDRDRDRDQDRDRDRDSHYRRSRRERSVSSRRDRDRDR 871

Query: 77   DRERDRDGEKERDRDR 30
            DR+RDRD  + R R R
Sbjct: 872  DRDRDRDHGRRRSRSR 887

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 45/102 (44%), Positives = 63/102 (61%), Gaps = 10/102 (9%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRENGRERERKREKGRD-RDRSRDRDSEKSRDRERERSRDRVRDGER 114
            RD DR+  + R++ R+  R+R+R R+  RD R RSR R  ++ RDR R+R R+R RD +R
Sbjct: 782  RDRDRDRDRDRDR-RDRSRDRDRARDDRRDTRRRSRSRSRDRERDRSRDRDRNRDRDRDR 840

Query: 113  SKDRGRD---------GEKSKDRERDRDGEKERDRDRDHHHR 15
             +DR RD          E+S    RDRD +++RDRDRDH  R
Sbjct: 841  DQDRDRDRDSHYRRSRRERSVSSRRDRDRDRDRDRDRDHGRR 882

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 48/140 (34%), Positives = 71/140 (50%), Gaps = 3/140 (2%)
 Frame = -2

Query: 413 EERRYEQPEGEGED---NYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           +ER+ E+ +  G          S  +P  A  +D  D +S    RD    S   R++   
Sbjct: 534 DERKSERKDRSGSRPRAEKRERSRSRPRTARTDDKRD-RSRSRRRDPRDRSRSPRQRTER 592

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R R R R   RDR RSR R+ ++   RER RSR R    +RS+DR RD ++ + RE+D
Sbjct: 593 RDRSRSRLRFGRRDRSRSRSRNRDRRDRRERSRSRARTDQRDRSRDRDRDRDRDQTREKD 652

Query: 62  RDGEKERDRDRDHHHRDRHR 3
           RD +K ++ D++   R R R
Sbjct: 653 RDKDKVKEEDKERRPRSRSR 672

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 48/145 (33%), Positives = 70/145 (48%), Gaps = 11/145 (7%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           EE R+ E+ E E  D    +                K     R+ ++E  K REK+RE+ 
Sbjct: 212 EERRKKEREEDERRDKERRERR-------------EKEREREREREKEREKEREKERESR 258

Query: 236 RERERKREKGRDRDRSRDRDSEKS--------RDRERERSRDRVRDGERSKDRGR---DG 90
           R+R+R R++ R+RDR RDR  E+         RDR R+R R R RD +R +DRGR     
Sbjct: 259 RDRDRSRDRDRERDRDRDRFRERGYDSYRGTPRDRSRDRDRGRDRDRDRDRDRGRRDSHD 318

Query: 89  EKSKDRERDRDGEKERDRDRDHHHR 15
            + K    DR  + E+   ++ H R
Sbjct: 319 NRPKLGTEDRGDDTEKTLTKEDHDR 343

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 40/97 (41%), Positives = 62/97 (63%), Gaps = 1/97 (1%)
 Frame = -2

Query: 314 DSKSNHVSRD-NDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSR 138
           + K   + R+   RE +K RE +R     RE +R+K R+ D  RD++  + R++ERER R
Sbjct: 185 EEKKRQLEREIKAREETKRREVERA---AREERRKKEREEDERRDKERRERREKERERER 241

Query: 137 DRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           +R +  ER K+R ++ E  +DR+R RD ++ERDRDRD
Sbjct: 242 EREK--EREKEREKERESRRDRDRSRDRDRERDRDRD 276

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 40/116 (34%), Positives = 59/116 (50%), Gaps = 7/116 (6%)
 Frame = -2

Query: 425  YEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            Y+ + +R  ++      D    D S     A D D  D++    SR  DRE  +SR++DR
Sbjct: 774  YDGDRDRPRDRDRDRDRDRDRRDRSRDRDRARD-DRRDTRRRSRSRSRDRERDRSRDRDR 832

Query: 245  ENGRERERKREKGRDRD-------RSRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
               R+R+R +++ RDRD       R R   S + RDR+R+R RDR     RS+ RG
Sbjct: 833  NRDRDRDRDQDRDRDRDSHYRRSRRERSVSSRRDRDRDRDRDRDRDHGRRRSRSRG 888

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 44/131 (33%), Positives = 60/131 (45%), Gaps = 30/131 (22%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERER--KREKGRDRDRSRDRD------S 174
           D+   D +    S   DR  S+ R + RE  R R R  + +  RDR RSR RD      S
Sbjct: 526 DDRKDDRRDERKSERKDRSGSRPRAEKRERSRSRPRTARTDDKRDRSRSRRRDPRDRSRS 585

Query: 173 EKSRDRERERSRDRVRDGERSKDRG----------------------RDGEKSKDRERDR 60
            + R   R+RSR R+R G R + R                       RD  + +DR+RDR
Sbjct: 586 PRQRTERRDRSRSRLRFGRRDRSRSRSRNRDRRDRRERSRSRARTDQRDRSRDRDRDRDR 645

Query: 59  DGEKERDRDRD 27
           D  +E+DRD+D
Sbjct: 646 DQTREKDRDKD 656

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 36/117 (30%), Positives = 63/117 (53%), Gaps = 5/117 (4%)
 Frame = -2

Query: 338 AAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRE-RERKREKGRD---RDRSRDRDSE 171
           AA +E +   K++             RE+ R   R   E+KR+  R+   R+ ++ R+ E
Sbjct: 148 AAEEERIRGLKTDEEYAAETAARRAERERVRAELRAVEEKKRQLEREIKAREETKRREVE 207

Query: 170 KSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHH-HRDRHR 3
           ++  RE  R ++R  D  R K+R    EK ++RER+R+ E+E++R+++    RDR R
Sbjct: 208 RAA-REERRKKEREEDERRDKERRERREKEREREREREKEREKEREKERESRRDRDR 263

[143][TOP]
>UniRef100_B6QII3 Arginine rich protein n=1 Tax=Penicillium marneffei ATCC 18224
            RepID=B6QII3_PENMQ
          Length = 821

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 50/135 (37%), Positives = 78/135 (57%), Gaps = 1/135 (0%)
 Frame = -2

Query: 404  RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE 225
            RY      G+ +   D S       ++D  +S     +RD+DR+    R+++R+  ++R 
Sbjct: 686  RYIPGVTTGDRDTEGDKSGNRDRDRNKDGDNSHDKDGARDHDRDRDHDRDRNRDTDKDRT 745

Query: 224  RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
            R  ++ RDR R+RD D    R R+R+R RDR RD +R +DR RD E+ ++RER+R  +++
Sbjct: 746  RDEDRERDRPRARDVDDRDDRARDRDRDRDRDRDRDRDRDRDRDRERDRERERERGRDRD 805

Query: 44   RDRD-RDHHHRDRHR 3
            R RD RD   RDR R
Sbjct: 806  RSRDRRDRDRRDRSR 820

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 57/165 (34%), Positives = 86/165 (52%), Gaps = 31/165 (18%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRD-----NDRESSKSREKDREN 240
           R  +   +  ++   D   +   A+    T SK+    RD     + RE  + RE+DR+ 
Sbjct: 428 RQSRSRSKARNDRERDRDDRSHRASRRSRTRSKTRDRERDRVDSRDRRERDRDRERDRDR 487

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV-RDGERSKDRGRDGEKSKDRE-- 69
            R+R+R+R++ RDR+R RDRD ++ RDR+R+R RDRV RD ER +DR RD ++ +DR+  
Sbjct: 488 DRDRDRERDRDRDRERDRDRDRDRERDRDRDRDRDRVDRDRERDRDRDRDRDRDRDRDNF 547

Query: 68  ----------------------RDRDGEKERDRDRD-HHHRDRHR 3
                                 R R  E++RDR RD   +RDR R
Sbjct: 548 LDRGYDRYTGRDMDRSREREQARKRSAERDRDRSRDKDKNRDRPR 592

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 50/139 (35%), Positives = 71/139 (51%), Gaps = 1/139 (0%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN- 240
           E +R   +   E + +   D         + D    +     RD DRE  + R++DR+  
Sbjct: 465 ERDRVDSRDRRERDRDRERDRDRDRDRDRERDRDRDRERDRDRDRDRERDRDRDRDRDRV 524

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
            R+RER R++ RDRDR RDRD+   R  +R   RD  R  ER + R R  E+ +DR RD+
Sbjct: 525 DRDRERDRDRDRDRDRDRDRDNFLDRGYDRYTGRDMDRSREREQARKRSAERDRDRSRDK 584

Query: 59  DGEKERDRDRDHHHRDRHR 3
           D  ++R RDRD   R R R
Sbjct: 585 DKNRDRPRDRDDRPRSRSR 603

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 53/154 (34%), Positives = 75/154 (48%), Gaps = 19/154 (12%)
 Frame = -2

Query: 407 RRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRER 228
           R  E+   +  D    D   +     D D    +     R+ DR+  + RE+DR+  R+R
Sbjct: 462 RDRERDRVDSRDRRERDRDRERDRDRDRDRDRERDRDRDRERDRDRDRDRERDRDRDRDR 521

Query: 227 ER-KREKGRDRDRSRDRDSEKSRD------------------RERERSRDRVRDGERSKD 105
           +R  R++ RDRDR RDRD ++ RD                  RERE++R   R  ER +D
Sbjct: 522 DRVDRDRERDRDRDRDRDRDRDRDNFLDRGYDRYTGRDMDRSREREQARK--RSAERDRD 579

Query: 104 RGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R RD +K++DR RDRD   +R R R  H R   R
Sbjct: 580 RSRDKDKNRDRPRDRD---DRPRSRSRHRRSPSR 610

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/124 (39%), Positives = 68/124 (54%), Gaps = 28/124 (22%)
 Frame = -2

Query: 290 RDNDRESSKS-REKDRENGRERERKREKGRDRDRSRDRD--------------------- 177
           R++DR S +S R++ R+    + R R K R+ DR RDRD                     
Sbjct: 408 REDDRHSVRSHRDERRDRAARQSRSRSKARN-DRERDRDDRSHRASRRSRTRSKTRDRER 466

Query: 176 ------SEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHR 15
                   + RDR+RER RDR RD +R +DR RD E+ +DR+RDR+ +++RDRDRD   R
Sbjct: 467 DRVDSRDRRERDRDRERDRDRDRDRDRERDRDRDRERDRDRDRDRERDRDRDRDRDRVDR 526

Query: 14  DRHR 3
           DR R
Sbjct: 527 DRER 530

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 39/98 (39%), Positives = 57/98 (58%), Gaps = 5/98 (5%)
 Frame = -2

Query: 287 DNDRESSKSREKDRENGRERERKREKGRD----RDRSRDRDSEKSRDRERERSRDRVRDG 120
           D DRE  + R++DR+  R+R+   ++G D    RD  R R+ E++R R  ER RDR RD 
Sbjct: 525 DRDRERDRDRDRDRDRDRDRDNFLDRGYDRYTGRDMDRSREREQARKRSAERDRDRSRDK 584

Query: 119 ERSKDRGRD-GEKSKDRERDRDGEKERDRDRDHHHRDR 9
           ++++DR RD  ++ + R R R      DR R  H RDR
Sbjct: 585 DKNRDRPRDRDDRPRSRSRHRRSPSRTDRSRTRHRRDR 622

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 44/140 (31%), Positives = 63/140 (45%), Gaps = 3/140 (2%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           + +R  ++      D    D         D D    + N + R  DR + +  ++ RE  
Sbjct: 508 DRDRERDRDRDRDRDRVDRDRERDRDRDRDRDRDRDRDNFLDRGYDRYTGRDMDRSRE-- 565

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERE---RSRDRVRDGERSKDRGRDGEKSKDRER 66
           RE+ RKR   RDRDRSRD+D  + R R+R+   RSR R R      DR R   + +DR  
Sbjct: 566 REQARKRSAERDRDRSRDKDKNRDRPRDRDDRPRSRSRHRRSPSRTDRSRTRHR-RDRSG 624

Query: 65  DRDGEKERDRDRDHHHRDRH 6
            R   + R R  D    DR+
Sbjct: 625 SRTSTRRRSRTPDQLDIDRY 644

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 53/162 (32%), Positives = 70/162 (43%), Gaps = 20/162 (12%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E++FEE    E              S  P     +   D +    +R   R SS+   + 
Sbjct: 335 EFDFEEAEAIESGRKPSARPKSVTESRFPATGTRDSSRDRRRKSRTRSRTRRSSRYETEG 394

Query: 248 RENGRE---RERKREKGRD-----RDRSRDRDSEKSRDRER---ERSRDRVRDGERSKDR 102
           R   R+   R R RE  R      RD  RDR + +SR R +   +R RDR     R+  R
Sbjct: 395 RNKSRDGSIRLRDREDDRHSVRSHRDERRDRAARQSRSRSKARNDRERDRDDRSHRASRR 454

Query: 101 GRDGEKSKDRERD---------RDGEKERDRDRDHHHRDRHR 3
            R   K++DRERD         RD ++ERDRDRD   RDR R
Sbjct: 455 SRTRSKTRDRERDRVDSRDRRERDRDRERDRDRD-RDRDRER 495

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 43/124 (34%), Positives = 63/124 (50%), Gaps = 23/124 (18%)
 Frame = -2

Query: 305  SNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR--------SRDRDSEKSRDRER 150
            SN       R  S  RE+DRE  R R+++  +    DR         RD + +KS +R+R
Sbjct: 649  SNRSRSPRRRMRSPERERDRERDRPRDQEWNREPRGDRYIPGVTTGDRDTEGDKSGNRDR 708

Query: 149  ERSRD----RVRDGERSKDRGRDGEKSK----DRERDRDGEKERDR-------DRDHHHR 15
            +R++D      +DG R  DR RD ++ +    D++R RD ++ERDR       DRD   R
Sbjct: 709  DRNKDGDNSHDKDGARDHDRDRDHDRDRNRDTDKDRTRDEDRERDRPRARDVDDRDDRAR 768

Query: 14   DRHR 3
            DR R
Sbjct: 769  DRDR 772

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 46/160 (28%), Positives = 68/160 (42%), Gaps = 26/160 (16%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E + + +R  ++ + + E +   D         D  L      +  RD DR   + + + 
Sbjct: 512 ERDRDRDRDRDRVDRDRERDRDRDRDRDRDRDRDNFLDRGYDRYTGRDMDRSREREQARK 571

Query: 248 RENGRERERKREKGRDRDRSRDRDSE-KSRDRER------ERSRD---RVRDGERSKDRG 99
           R   R+R+R R+K ++RDR RDRD   +SR R R      +RSR    R R G R+  R 
Sbjct: 572 RSAERDRDRSRDKDKNRDRPRDRDDRPRSRSRHRRSPSRTDRSRTRHRRDRSGSRTSTRR 631

Query: 98  R----------------DGEKSKDRERDRDGEKERDRDRD 27
           R                       R R R  E+ERDR+RD
Sbjct: 632 RSRTPDQLDIDRYVPVTSNRSRSPRRRMRSPERERDRERD 671

[144][TOP]
>UniRef100_A8NYE8 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea
            okayama7#130 RepID=A8NYE8_COPC7
          Length = 3269

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 56/143 (39%), Positives = 81/143 (56%), Gaps = 3/143 (2%)
 Frame = -2

Query: 431  GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            G    +   R E+   E ED   +    +  ++  E  T + S   S  + RE +    +
Sbjct: 2808 GRMRSDRIERSERGNYEPEDRDRDRDRDRKESSRQERETATVSRRDSLTHTRERAN---R 2864

Query: 251  DRENGR--ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD-GERSKDRGRDGEKS 81
            D+ +GR  ERER R++ RDRDR RDR  ++ RD+ER+R RDR RD  ER +DR RD ++ 
Sbjct: 2865 DQASGRDGERERDRDRDRDRDRGRDRHGDRERDKERDRDRDRDRDRSERDRDRDRDRDRD 2924

Query: 80   KDRERDRDGEKERDRDRDHHHRD 12
            +DR+RDR    ++DRDRD   RD
Sbjct: 2925 RDRDRDRHRRDDKDRDRDRKERD 2947

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 57/160 (35%), Positives = 70/160 (43%), Gaps = 40/160 (25%)
 Frame = -2

Query: 362  NDSSPQPPAAADEDLTDSK--SNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRS 189
            N ++P P   +    T S   +   S D+ RES      DR    ER     + RDRDR 
Sbjct: 2775 NSAAPSPRIRSSSPATSSVPGTREASADS-RESGGRMRSDRIERSERGNYEPEDRDRDRD 2833

Query: 188  RDR----------------------------DSEKSRDRERERSRDRVRDGERSKDRGRD 93
            RDR                            D    RD ERER RDR RD +R +DR  D
Sbjct: 2834 RDRKESSRQERETATVSRRDSLTHTRERANRDQASGRDGERERDRDRDRDRDRGRDRHGD 2893

Query: 92   GEKSKDRERDRD-----GEKERDRDRDH-----HHRDRHR 3
             E+ K+R+RDRD      E++RDRDRD        RDRHR
Sbjct: 2894 RERDKERDRDRDRDRDRSERDRDRDRDRDRDRDRDRDRHR 2933

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 42/148 (28%), Positives = 64/148 (43%), Gaps = 41/148 (27%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDR---ENGRERERKREKGRDRDRSRDRDSEKSRD 159
            D D    +  H  R+ D+E  + R++DR   E  R+R+R R++ RDRDR R R  +K RD
Sbjct: 2881 DRDRDRGRDRHGDRERDKERDRDRDRDRDRSERDRDRDRDRDRDRDRDRDRHRRDDKDRD 2940

Query: 158  RER-------------------------ERSRDRVRD-------GERSKDRGRDGEKSKD 75
            R+R                         E SR R          G+R +    D +++  
Sbjct: 2941 RDRKERDSGSNRGGGSSSGNLDGLPSRPEPSRHRPSAQNADESLGKRRRPNDDDSDRASK 3000

Query: 74   RERDRDGEKERDR------DRDHHHRDR 9
            R   +DG ++ DR      ++D H R R
Sbjct: 3001 RSSRKDGHRDSDRGRRPGQEKDAHDRGR 3028

[145][TOP]
>UniRef100_Q5SN81 Os01g0655400 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5SN81_ORYSJ
          Length = 1350

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 47/111 (42%), Positives = 78/111 (70%), Gaps = 1/111 (0%)
 Frame = -2

Query: 332 ADEDLTDSKSNHVSRDN-DRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDR 156
           +D+DL   +S+   RD+ DRE  + REK+R+  +E+E +R+K R+R+R RDR  E+ RDR
Sbjct: 159 SDKDLGRRESSGQYRDDRDRERERDREKERDREKEKEWERQKERERERGRDR--ERDRDR 216

Query: 155 ERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           E++R R+R RD ER ++R R+ E+ +DRER+R+ +K+R+R++  +     R
Sbjct: 217 EKDRERERERDKERDRERDRERERERDRERERERQKDREREKKDYDSKHER 267

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 47/115 (40%), Positives = 75/115 (65%), Gaps = 7/115 (6%)
 Frame = -2

Query: 332 ADEDLTDSKSNHVSRDND---RESS----KSREKDRENGRERERKREKGRDRDRSRDRDS 174
           A+E ++ S S     D D   RESS      R+++RE  RE+ER REK ++ +R ++R+ 
Sbjct: 145 AEEVVSKSDSGKRRSDKDLGRRESSGQYRDDRDRERERDREKERDREKEKEWERQKERER 204

Query: 173 EKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           E+ RDRER+R R++ R+ ER +D+ RD E+ ++RER+RD E+ER+R +D     +
Sbjct: 205 ERGRDRERDRDREKDRERERERDKERDRERDRERERERDRERERERQKDREREKK 259

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 50/129 (38%), Positives = 74/129 (57%), Gaps = 10/129 (7%)
 Frame = -2

Query: 359 DSSPQPPAAADEDLTDSKSNHVSRDNDRES--SKSREKDRENGRERERKREKGR---DRD 195
           D  P+    + ++   S    VS D+  E   SKS    R + ++  R+   G+   DRD
Sbjct: 118 DKLPEKSRGSGDESKRSSRRMVSMDDRAEEVVSKSDSGKRRSDKDLGRRESSGQYRDDRD 177

Query: 194 RSRDRDSEKSRDRERE----RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           R R+RD EK RDRE+E    R ++R R+  R ++R RD EK ++RER+RD E++R+RDR+
Sbjct: 178 RERERDREKERDREKEKEWERQKERERERGRDRERDRDREKDRERERERDKERDRERDRE 237

Query: 26  -HHHRDRHR 3
               RDR R
Sbjct: 238 RERERDRER 246

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 44/115 (38%), Positives = 69/115 (60%)
 Frame = -2

Query: 377 EDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR 198
           +D    +SS Q     D +    +     R+ ++E  + +E++RE GR+RER R++ +DR
Sbjct: 161 KDLGRRESSGQYRDDRDRERERDREKERDREKEKEWERQKERERERGRDRERDRDREKDR 220

Query: 197 DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRD 33
           +R R+RD  K RDRER+R R+R RD ER ++R +D E+ K   +D D + ER  D
Sbjct: 221 ERERERD--KERDRERDRERERERDRERERERQKDREREK---KDYDSKHERYDD 270

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 41/131 (31%), Positives = 73/131 (55%), Gaps = 9/131 (6%)
 Frame = -2

Query: 410 ERRYEQPEGEGEDN--YHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +RR ++  G  E +  Y +D   +     +++    K     R  +RE  + R+++R+  
Sbjct: 156 KRRSDKDLGRRESSGQYRDDRDRERERDREKERDREKEKEWERQKERERERGRDRERDRD 215

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSK-------DRGRDGEKSK 78
           RE++R+RE+ RD++R R+RD E+ R+R+RER R+R +D ER K       +R  DG   K
Sbjct: 216 REKDRERERERDKERDRERDRERERERDRERERERQKDREREKKDYDSKHERYDDGGAKK 275

Query: 77  DRERDRDGEKE 45
           +  +   GE++
Sbjct: 276 NGSKASRGEED 286

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 40/143 (27%), Positives = 66/143 (46%), Gaps = 4/143 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER+ E+    G D              + D    K     R+ D+E  + R+++
Sbjct: 191 EKEKEWERQKERERERGRDR-------------ERDRDREKDRERERERDKERDRERDRE 237

Query: 248 RENGRERERKREKGRDRDR-SRDRDSEKSR--DRERERSRDRVRDGER-SKDRGRDGEKS 81
           RE  R+RER+RE+ +DR+R  +D DS+  R  D   +++  +   GE       RD E +
Sbjct: 238 RERERDRERERERQKDREREKKDYDSKHERYDDGGAKKNGSKASRGEEDGYSYKRDTEIN 297

Query: 80  KDRERDRDGEKERDRDRDHHHRD 12
               +++    E+D DR    +D
Sbjct: 298 ASATKEKYNNTEKDLDRHSRRKD 320

[146][TOP]
>UniRef100_C5Y7Z5 Putative uncharacterized protein Sb05g026740 n=1 Tax=Sorghum
           bicolor RepID=C5Y7Z5_SORBI
          Length = 545

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 46/108 (42%), Positives = 66/108 (61%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE 147
           ED+  ++      D+    SK REKDRE  ++R+R+R++ RDR R RDRD ++ RDR+R+
Sbjct: 19  EDVVRAEGETQPHDDGSSKSKDREKDREKDKDRDRRRDRDRDRGRDRDRDRDRDRDRDRD 78

Query: 146 RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R RD+ R     ++R R+     D  R RD E+ R+RDRD H R R R
Sbjct: 79  RDRDKDRQSRHHRER-REPRDRPDDHRGRDSERRRERDRDGHRRHRSR 125

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 55/152 (36%), Positives = 75/152 (49%), Gaps = 6/152 (3%)
 Frame = -2

Query: 440 PTMGEYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK 264
           PT G    E   R E     EGE   H+D S +           SK     R+ D++  +
Sbjct: 5   PTTGGGGGEGGDRVEDVVRAEGETQPHDDGSSK-----------SKDREKDREKDKDRDR 53

Query: 263 SREKDRENGRERERKREKGRDRDR--SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG 90
            R++DR+ GR+R+R R++ RDRDR   RD+D +    RER   RDR  D      RGRD 
Sbjct: 54  RRDRDRDRGRDRDRDRDRDRDRDRDRDRDKDRQSRHHRERREPRDRPDD-----HRGRDS 108

Query: 89  EKSKDRERD---RDGEKERDRDRDHHHRDRHR 3
           E+ ++R+RD   R   + R R RD   R R R
Sbjct: 109 ERRRERDRDGHRRHRSRSRSRGRDRRSRSRSR 140

[147][TOP]
>UniRef100_C5WNQ6 Putative uncharacterized protein Sb01g010590 n=1 Tax=Sorghum
           bicolor RepID=C5WNQ6_SORBI
          Length = 750

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 50/116 (43%), Positives = 76/116 (65%), Gaps = 2/116 (1%)
 Frame = -2

Query: 344 PPAAADEDLTDSKSNHVSRDN-DRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK 168
           PP+ ++    DS ++H  RD+ DR+  + R++DRE  R+ + +R++ RDRDR RDRD   
Sbjct: 61  PPSGSNLAPRDSSNSH--RDSSDRDRDRDRDRDRERRRDDDSRRDRDRDRDRDRDRDDSS 118

Query: 167 SRDRERER-SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            RDR+R+R  RDR RD +R ++R R+ E+ +DRER   GE+ERDR      R+R +
Sbjct: 119 RRDRDRDRRDRDRDRDRDRERERERERERDRDRERGDRGERERDRLEKMAEREREK 174

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/123 (43%), Positives = 70/123 (56%), Gaps = 7/123 (5%)
 Frame = -2

Query: 350 PQPPAAADEDLTDSKSNHVSRD--NDRESSKSREKDRENGRERERKREKGRDRDRSRDRD 177
           P PPA        S SN   RD  N    S  R++DR+  R+RER+R+    RDR RDRD
Sbjct: 53  PPPPAGG---APPSGSNLAPRDSSNSHRDSSDRDRDRDRDRDRERRRDDDSRRDRDRDRD 109

Query: 176 SEKSRDRERERSRDR-VRDGERSKDRGRDGEKSKDRERDRDGEK----ERDRDRDHHHRD 12
            ++ RD    R RDR  RD +R +DR R+ E+ ++RERDRD E+    ER+RDR     +
Sbjct: 110 RDRDRDDSSRRDRDRDRRDRDRDRDRDRERERERERERDRDRERGDRGERERDRLEKMAE 169

Query: 11  RHR 3
           R R
Sbjct: 170 RER 172

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 44/111 (39%), Positives = 68/111 (61%)
 Frame = -2

Query: 359 DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDR 180
           DSS     ++D D    +     R  D +S + R++DR+  R+R+    + RDRDR RDR
Sbjct: 71  DSSNSHRDSSDRDRDRDRDRDRERRRDDDSRRDRDRDRDRDRDRDDSSRRDRDRDR-RDR 129

Query: 179 DSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           D ++ RDRERER R+R RD  R ++RG  GE+ +DR  ++  E+ER+++ D
Sbjct: 130 DRDRDRDRERERERERERD--RDRERGDRGERERDR-LEKMAEREREKELD 177

[148][TOP]
>UniRef100_B8A6V1 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8A6V1_ORYSI
          Length = 1350

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 47/111 (42%), Positives = 78/111 (70%), Gaps = 1/111 (0%)
 Frame = -2

Query: 332 ADEDLTDSKSNHVSRDN-DRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDR 156
           +D+DL   +S+   RD+ DRE  + REK+R+  +E+E +R+K R+R+R RDR  E+ RDR
Sbjct: 159 SDKDLGRRESSGQYRDDRDRERERDREKERDREKEKEWERQKERERERGRDR--ERDRDR 216

Query: 155 ERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           E++R R+R RD ER ++R R+ E+ +DRER+R+ +K+R+R++  +     R
Sbjct: 217 EKDRERERERDKERDRERDRERERERDRERERERQKDREREKKDYDSKHER 267

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 47/115 (40%), Positives = 75/115 (65%), Gaps = 7/115 (6%)
 Frame = -2

Query: 332 ADEDLTDSKSNHVSRDND---RESS----KSREKDRENGRERERKREKGRDRDRSRDRDS 174
           A+E ++ S S     D D   RESS      R+++RE  RE+ER REK ++ +R ++R+ 
Sbjct: 145 AEEVVSKSDSGKRRSDKDLGRRESSGQYRDDRDRERERDREKERDREKEKEWERQKERER 204

Query: 173 EKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           E+ RDRER+R R++ R+ ER +D+ RD E+ ++RER+RD E+ER+R +D     +
Sbjct: 205 ERGRDRERDRDREKDRERERERDKERDRERDRERERERDRERERERQKDREREKK 259

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 50/129 (38%), Positives = 74/129 (57%), Gaps = 10/129 (7%)
 Frame = -2

Query: 359 DSSPQPPAAADEDLTDSKSNHVSRDNDRES--SKSREKDRENGRERERKREKGR---DRD 195
           D  P+    + ++   S    VS D+  E   SKS    R + ++  R+   G+   DRD
Sbjct: 118 DKLPEKSRGSGDESKRSSRRMVSMDDRAEEVVSKSDSGKRRSDKDLGRRESSGQYRDDRD 177

Query: 194 RSRDRDSEKSRDRERE----RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           R R+RD EK RDRE+E    R ++R R+  R ++R RD EK ++RER+RD E++R+RDR+
Sbjct: 178 RERERDREKERDREKEKEWERQKERERERGRDRERDRDREKDRERERERDKERDRERDRE 237

Query: 26  -HHHRDRHR 3
               RDR R
Sbjct: 238 RERERDRER 246

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 44/115 (38%), Positives = 69/115 (60%)
 Frame = -2

Query: 377 EDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR 198
           +D    +SS Q     D +    +     R+ ++E  + +E++RE GR+RER R++ +DR
Sbjct: 161 KDLGRRESSGQYRDDRDRERERDREKERDREKEKEWERQKERERERGRDRERDRDREKDR 220

Query: 197 DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRD 33
           +R R+RD  K RDRER+R R+R RD ER ++R +D E+ K   +D D + ER  D
Sbjct: 221 ERERERD--KERDRERDRERERERDRERERERQKDREREK---KDYDSKHERYDD 270

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 41/131 (31%), Positives = 73/131 (55%), Gaps = 9/131 (6%)
 Frame = -2

Query: 410 ERRYEQPEGEGEDN--YHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +RR ++  G  E +  Y +D   +     +++    K     R  +RE  + R+++R+  
Sbjct: 156 KRRSDKDLGRRESSGQYRDDRDRERERDREKERDREKEKEWERQKERERERGRDRERDRD 215

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSK-------DRGRDGEKSK 78
           RE++R+RE+ RD++R R+RD E+ R+R+RER R+R +D ER K       +R  DG   K
Sbjct: 216 REKDRERERERDKERDRERDRERERERDRERERERQKDREREKKDYDSKHERYDDGGAKK 275

Query: 77  DRERDRDGEKE 45
           +  +   GE++
Sbjct: 276 NGSKASRGEED 286

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 40/143 (27%), Positives = 66/143 (46%), Gaps = 4/143 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER+ E+    G D              + D    K     R+ D+E  + R+++
Sbjct: 191 EKEKEWERQKERERERGRDR-------------ERDRDREKDRERERERDKERDRERDRE 237

Query: 248 RENGRERERKREKGRDRDR-SRDRDSEKSR--DRERERSRDRVRDGER-SKDRGRDGEKS 81
           RE  R+RER+RE+ +DR+R  +D DS+  R  D   +++  +   GE       RD E +
Sbjct: 238 RERERDRERERERQKDREREKKDYDSKHERYDDGGAKKNGSKASRGEEDGYSYKRDTEIN 297

Query: 80  KDRERDRDGEKERDRDRDHHHRD 12
               +++    E+D DR    +D
Sbjct: 298 ASATKEKYNNTEKDLDRHSRRKD 320

[149][TOP]
>UniRef100_A9SNZ3 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SNZ3_PHYPA
          Length = 1098

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 48/109 (44%), Positives = 74/109 (67%), Gaps = 1/109 (0%)
 Frame = -2

Query: 332 ADEDLTDS-KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDR 156
           +D++L +  K    S+ ++RE  +SREK+++  R +E  REK RDRD+ RDR+ EK +DR
Sbjct: 12  SDQELFEKEKEKESSKRSEREKDRSREKEKDKERSKEH-REKDRDRDKDRDREKEKEKDR 70

Query: 155 ERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
            +E+ R+R ++ ER K++GRD EK    ER+RD +KER R+R  H  D+
Sbjct: 71  AKEKERERAKEKEREKEKGRDREK----ERERDKDKERHRERSGHGHDK 115

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 46/136 (33%), Positives = 82/136 (60%), Gaps = 1/136 (0%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E +++ R  +  G  E     D   +   +  +   D +     R+ +RE  K++E++RE
Sbjct: 244 EDKDKDRERENHGAREKTREKDEKVKEKHSDRDKTKDGEKEKREREKEREKEKAKERERE 303

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVR-DGERSKDRGRDGEKSKDRER 66
             RERE+++E+ R+++R R+R+ E+ ++RERER RDR R + ER ++R R+ EK K+R+R
Sbjct: 304 KEREREKEKEREREKEREREREREREKERERERERDRDREERERDREREREREKEKERQR 363

Query: 65  DRDGEKERDRDRDHHH 18
            R  + E +R+ +H H
Sbjct: 364 IRHKDHENEREVEHEH 379

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 50/143 (34%), Positives = 84/143 (58%), Gaps = 5/143 (3%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +E  RY   E   +D    +   +   + DED    K     R+N     K+REKD E  
Sbjct: 214 KERERYGAREKREKDEKVKEKHSEKGKSKDED----KDKDRERENHGAREKTREKD-EKV 268

Query: 236 RERERKREKGRD-----RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           +E+   R+K +D     R+R ++R+ EK+++RERE+ R+R ++ ER +++ R+ E+ ++R
Sbjct: 269 KEKHSDRDKTKDGEKEKREREKEREKEKAKEREREKEREREKEKEREREKERERERERER 328

Query: 71  ERDRDGEKERDRDRDHHHRDRHR 3
           E++R+ E+ERDRDR+   RDR R
Sbjct: 329 EKERERERERDRDREERERDRER 351

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 48/140 (34%), Positives = 83/140 (59%), Gaps = 6/140 (4%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDN-----YHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           +E+  E+ + + ED        N  + +     DE + +  S+     +  +  + REK+
Sbjct: 232 KEKHSEKGKSKDEDKDKDRERENHGAREKTREKDEKVKEKHSDRDKTKDGEKEKREREKE 291

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG-EKSKDR 72
           RE  + +ER+REK R+R++ ++R+ EK R+RERER R++ R+ ER +DR R+  E+ ++R
Sbjct: 292 REKEKAKEREREKEREREKEKEREREKEREREREREREKERERERERDRDREERERDRER 351

Query: 71  ERDRDGEKERDRDRDHHHRD 12
           ER+R+ EKER R R   H +
Sbjct: 352 EREREKEKERQRIRHKDHEN 371

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 41/94 (43%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = -2

Query: 293 SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRE-RERSRDRVRDGE 117
           +++ +RE  + REK++E  RE+ER+RE+ R+R++ R+R+ E+ RDRE RER R+R R+ E
Sbjct: 297 AKEREREKEREREKEKEREREKEREREREREREKERERERERDRDREERERDRERERERE 356

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHR 15
           + K+R R   + KD E +R+ E E D++RD   R
Sbjct: 357 KEKERQR--IRHKDHENEREVEHEHDQERDQRTR 388

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 47/137 (34%), Positives = 75/137 (54%), Gaps = 9/137 (6%)
 Frame = -2

Query: 395 QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVS---RDNDRESSKSREKDRENGRERE 225
           + E E E +  ++         ++D   SK +      RD DR+  K +EKDR   +ERE
Sbjct: 18  EKEKEKESSKRSEREKDRSREKEKDKERSKEHREKDRDRDKDRDREKEKEKDRAKEKERE 77

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG-----ERSKDRGRDGEKSK-DRERD 63
           R +EK R++++ RDR+ E+ RD+++ER R+R   G     E  KD+ R  +KS   RE+D
Sbjct: 78  RAKEKEREKEKGRDREKERERDKDKERHRERSGHGHDKEHETVKDKERHHDKSSHGREKD 137

Query: 62  RDGEKERDRDRDHHHRD 12
            D  +E+ R++  H  D
Sbjct: 138 HDTAREKHREKSPHEAD 154

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 46/183 (25%), Positives = 87/183 (47%), Gaps = 43/183 (23%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E++R  E+ + +     H +         D D    K    +++ +RE +K +E+++E
Sbjct: 30  EREKDRSREKEKDKERSKEHREKDRDRDK--DRDREKEKEKDRAKEKERERAKEKEREKE 87

Query: 242 NGR----ERERKREKGRDRDRS------------------------RDRDSEKSRDRERE 147
            GR    ERER ++K R R+RS                        R++D + +R++ RE
Sbjct: 88  KGRDREKERERDKDKERHRERSGHGHDKEHETVKDKERHHDKSSHGREKDHDTAREKHRE 147

Query: 146 RS---------RDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD------HHHRD 12
           +S         + R  D E  K + ++G++ KD+ER++ G +E+ +++D      H  RD
Sbjct: 148 KSPHEADAKKEKSRDTDREMDKSKPKEGDREKDKEREKHGTREKIKEKDEKMKEKHSERD 207

Query: 11  RHR 3
           +H+
Sbjct: 208 KHK 210

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 38/121 (31%), Positives = 70/121 (57%), Gaps = 19/121 (15%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK----SRDRERERS 141
           +  H   D +RE   +REK  ++ + +E+  EKG+ +D  +D+D E+    +R++ RE+ 
Sbjct: 206 RDKHKEDDKERERYGAREKREKDEKVKEKHSEKGKSKDEDKDKDRERENHGAREKTREKD 265

Query: 140 ---------RDRVRDGE-----RSKDRGRDGEKSKDRERDRDGEKERDRDRD-HHHRDRH 6
                    RD+ +DGE     R K+R ++  K ++RE++R+ EKE++R+R+    R+R 
Sbjct: 266 EKVKEKHSDRDKTKDGEKEKREREKEREKEKAKEREREKEREREKEKEREREKERERERE 325

Query: 5   R 3
           R
Sbjct: 326 R 326

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 42/154 (27%), Positives = 78/154 (50%), Gaps = 17/154 (11%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK--DRE 243
           +++ R+      G +  H+ +  +    +  +    K    SRD DRE  KS+ K  DRE
Sbjct: 121 KDKERHHDKSSHGREKDHDTAREKHREKSPHEADAKKEK--SRDTDREMDKSKPKEGDRE 178

Query: 242 NGRERER---------KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG 90
             +ERE+         K EK +++   RD+  E  ++RER  +R++    E+ K++  + 
Sbjct: 179 KDKEREKHGTREKIKEKDEKMKEKHSERDKHKEDDKERERYGAREKREKDEKVKEKHSEK 238

Query: 89  EKSKDRERDRD------GEKERDRDRDHHHRDRH 6
            KSKD ++D+D      G +E+ R++D   +++H
Sbjct: 239 GKSKDEDKDKDRERENHGAREKTREKDEKVKEKH 272

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 44/147 (29%), Positives = 75/147 (51%), Gaps = 10/147 (6%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +++ R+ +  G G D  H           D++    KS+H  R+ D +++  REK RE  
Sbjct: 100 KDKERHRERSGHGHDKEHE-------TVKDKERHHDKSSH-GREKDHDTA--REKHREKS 149

Query: 236 -RERERKREKGRDRDRSRDRDSEKS--RDRERERSRDRVRDGERSKDR-------GRDGE 87
             E + K+EK RD DR  D+   K   R++++ER +   R+  + KD         RD  
Sbjct: 150 PHEADAKKEKSRDTDREMDKSKPKEGDREKDKEREKHGTREKIKEKDEKMKEKHSERDKH 209

Query: 86  KSKDRERDRDGEKERDRDRDHHHRDRH 6
           K  D+ER+R G +E+ R++D   +++H
Sbjct: 210 KEDDKERERYGAREK-REKDEKVKEKH 235

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 40/139 (28%), Positives = 65/139 (46%), Gaps = 1/139 (0%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           GE E  E  +  + E   E     +   +     + +    +     R+ +RE  + R++
Sbjct: 281 GEKEKREREKEREKEKAKEREREKEREREKEKEREREKEREREREREREKERERERERDR 340

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           DRE         E+ RDR+R R+R+ EK R R R +  +  R+ E   D+ RD ++++  
Sbjct: 341 DRE---------ERERDREREREREKEKERQRIRHKDHENEREVEHEHDQERD-QRTRGM 390

Query: 71  ERDRDG-EKERDRDRDHHH 18
           E D  G E+ER RD D  H
Sbjct: 391 ELDNAGPERERARDSDQPH 409

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 36/105 (34%), Positives = 60/105 (57%), Gaps = 18/105 (17%)
 Frame = -2

Query: 269 SKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD-RVRDGERSKDRGRD 93
           S+  + DR +    E+++EK   +   R++D  + +++++ERS++ R +D +R KDR R+
Sbjct: 4   SEVMDVDRSDQELFEKEKEKESSKRSEREKDRSREKEKDKERSKEHREKDRDRDKDRDRE 63

Query: 92  GEKSKDR----------------ERDRDGEKERDRDRD-HHHRDR 9
            EK KDR                E+ RD EKER+RD+D   HR+R
Sbjct: 64  KEKEKDRAKEKERERAKEKEREKEKGRDREKERERDKDKERHRER 108

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 33/133 (24%), Positives = 64/133 (48%), Gaps = 9/133 (6%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E+E+R  + E E E     +   +     +++    K     R+ +RE  + RE++R+  
Sbjct: 282 EKEKREREKEREKEKAKEREREKEREREKEKEREREKEREREREREREKERERERERDRD 341

Query: 236 RE---------RERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
           RE         RER++EK R R R +D ++E+  + E ++ RD+   G    + G + E+
Sbjct: 342 REERERDREREREREKEKERQRIRHKDHENEREVEHEHDQERDQRTRGMELDNAGPERER 401

Query: 83  SKDRERDRDGEKE 45
           ++D ++      E
Sbjct: 402 ARDSDQPHVSSSE 414

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 43/182 (23%), Positives = 86/182 (47%), Gaps = 44/182 (24%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQ----PPAAADEDLTDSKSNHVSRDNDRESSKS---- 261
           E+ R     E + +     D+  +     P   D +    +  H +R+  +E  +     
Sbjct: 143 EKHREKSPHEADAKKEKSRDTDREMDKSKPKEGDREKDKEREKHGTREKIKEKDEKMKEK 202

Query: 260 ---REKDRENGRERER--KREKGRDRDRSRDRDSEKSR----DRERER------------ 144
              R+K +E+ +ERER   REK    ++ +++ SEK +    D++++R            
Sbjct: 203 HSERDKHKEDDKERERYGAREKREKDEKVKEKHSEKGKSKDEDKDKDRERENHGAREKTR 262

Query: 143 -----------SRDRVRDGE---RSKDRGRDGEKSKDRERDRDGEKERDRDRDHH-HRDR 9
                       RD+ +DGE   R +++ R+ EK+K+RER+++ E+E++++R+    R+R
Sbjct: 263 EKDEKVKEKHSDRDKTKDGEKEKREREKEREKEKAKEREREKEREREKEKEREREKERER 322

Query: 8   HR 3
            R
Sbjct: 323 ER 324

[150][TOP]
>UniRef100_A0D0L0 Chromosome undetermined scaffold_33, whole genome shotgun sequence
           n=1 Tax=Paramecium tetraurelia RepID=A0D0L0_PARTE
          Length = 430

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 48/150 (32%), Positives = 86/150 (57%), Gaps = 10/150 (6%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDND---------RES 270
           E ++E+  +Q E      Y  D         D+D    K     RD +         +E 
Sbjct: 160 EIKKEKELKQKEEYARAKYREDKQKNENKDLDKDKDKEKDRDKDRDKELQKKDSDQQQEQ 219

Query: 269 SKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD 93
            K +EK++E  RE+ERK +E+ ++R+R R+R+ EK R++E+ER R+R R+ ER +++ ++
Sbjct: 220 QKLKEKEKEKEREKERKEKEREKEREREREREREKEREKEKEREREREREKEREREKEKE 279

Query: 92  GEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            EK K+RER+++ E+ER++ R+   + + R
Sbjct: 280 REKEKEREREKEKEREREKQREKQKQKQKR 309

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/144 (27%), Positives = 85/144 (59%), Gaps = 6/144 (4%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSR-DNDRESSKSREKDREN 240
           ++++  ++ +   ++    DS  Q      ++    K     R + +RE  + RE++RE 
Sbjct: 193 DKDKEKDRDKDRDKELQKKDSDQQQEQQKLKEKEKEKEREKERKEKEREKERERERERER 252

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD-RERD 63
            +ERE+++E+ R+R+R ++R+ EK ++RE+E+ R+R ++ ER +++ R+ +K K  RE++
Sbjct: 253 EKEREKEKEREREREREKEREREKEKEREKEKEREREKEKEREREKQREKQKQKQKREKE 312

Query: 62  RDGEK----ERDRDRDHHHRDRHR 3
           ++ EK    ER++ +  H   R R
Sbjct: 313 KEKEKQERIEREKKKKQHSTSRKR 336

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 41/139 (29%), Positives = 75/139 (53%), Gaps = 1/139 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+ER  E+ E E E     +   +                  R+ +RE  K RE++
Sbjct: 224 EKEKEKEREKERKEKEREKERERERERE------------------REKEREKEKERERE 265

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           RE  +ERER++EK R++++ R+R+ EK R+RE++R + + +  +R K++ ++ ++  +RE
Sbjct: 266 REREKEREREKEKEREKEKEREREKEKEREREKQREKQKQKQ-KREKEKEKEKQERIERE 324

Query: 68  -RDRDGEKERDRDRDHHHR 15
            + +     R R  D HH+
Sbjct: 325 KKKKQHSTSRKRSSDRHHK 343

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 32/140 (22%), Positives = 70/140 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E E+  ++ E E E     +   +     +++    +     R+ ++E  + +EK+
Sbjct: 226 EKEKEREKERKEKEREKEREREREREREKEREKEKEREREREREKEREREKEKEREKEKE 285

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           RE  +E+ER+REK R++ + + +  EK +++E++   +R+   ++ K      ++S DR 
Sbjct: 286 REREKEKEREREKQREKQKQKQK-REKEKEKEKQ---ERIEREKKKKQHSTSRKRSSDRH 341

Query: 68  RDRDGEKERDRDRDHHHRDR 9
             R   ++R   R +  R +
Sbjct: 342 HKRSSSRKRHSKRRYSKRSK 361

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 35/129 (27%), Positives = 63/129 (48%), Gaps = 35/129 (27%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKRE---KGRDRDRSRDRDSEKSRDRER---- 150
           K+  + +   RE  K +E  ++    R + RE   K  ++D  +D+D EK RD++R    
Sbjct: 149 KNERLDKLRQREIKKEKELKQKEEYARAKYREDKQKNENKDLDKDKDKEKDRDKDRDKEL 208

Query: 149 ----------------------------ERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
                                       E+ R++ R+ ER ++R ++ EK K+RER+R+ 
Sbjct: 209 QKKDSDQQQEQQKLKEKEKEKEREKERKEKEREKEREREREREREKEREKEKERERERER 268

Query: 53  EKERDRDRD 27
           EKER+R+++
Sbjct: 269 EKEREREKE 277

[151][TOP]
>UniRef100_B2B5M7 Predicted CDS Pa_2_5160 n=1 Tax=Podospora anserina RepID=B2B5M7_PODAN
          Length = 871

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 44/96 (45%), Positives = 63/96 (65%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
            RD DR+  + R +D   G +R R R + R R+R RDRD  ++RDR+R+R RD  RD +RS
Sbjct: 770  RDRDRDRDRDRRRDDSRG-DRRRSRSRNRSRERDRDRDRSRNRDRDRDRDRDFRRDRDRS 828

Query: 110  KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR RD ++ + R R+R  +++RDRDR    RDR R
Sbjct: 829  RDRSRDRDRDRSRHRERSRDRDRDRDRSRTRRDRDR 864

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 59/138 (42%), Positives = 75/138 (54%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            + +R  ++ +  G D Y  D     P   D D          RD DR    SR  DR   
Sbjct: 746  DRDRERDRMDYRGGDRYDGDRDR--PRDRDRD----------RDRDRRRDDSRG-DRRRS 792

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            R R R RE+ RDRDRSR+RD ++ RDR+  R RDR RD  RS+DR RD  +S+ RER RD
Sbjct: 793  RSRNRSRERDRDRDRSRNRDRDRDRDRDFRRDRDRSRD--RSRDRDRD--RSRHRERSRD 848

Query: 56   GEKERDRDRDHHHRDRHR 3
             +++RDR R    RDR R
Sbjct: 849  RDRDRDRSRTRRDRDRRR 866

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 49/115 (42%), Positives = 69/115 (60%), Gaps = 19/115 (16%)
 Frame = -2

Query: 290  RDNDRESSKSREKDREN-GRERERK-----------REKGRDRDRSRDRD-------SEK 168
            RD DR+  + R++DR++  RER+R            R++ RDRDR RDRD        ++
Sbjct: 730  RDRDRDRDRDRDRDRKDRDRERDRMDYRGGDRYDGDRDRPRDRDRDRDRDRRRDDSRGDR 789

Query: 167  SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             R R R RSR+R RD +RS++R RD ++ +D  RDRD  ++R RDRD   R RHR
Sbjct: 790  RRSRSRNRSRERDRDRDRSRNRDRDRDRDRDFRRDRDRSRDRSRDRD-RDRSRHR 843

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 54/150 (36%), Positives = 85/150 (56%), Gaps = 13/150 (8%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDR-ESSKSREKDREN 240
           E +R+ E+   E ED    +   +  AA +      K     R+ +R E  + RE++RE 
Sbjct: 177 ENKRKLERAIKEKEDAKRRE---EERAAREARRKKEKEEDERREKERRERREQREREREE 233

Query: 239 GRERERK-REKGRDRDRSRD-RDSEKSRD--RERERSRDRVR--------DGERSKDRGR 96
            RE+ RK RE+ R+R+R R+ RD ++ RD  R+R+R RDR++         G+RS +R R
Sbjct: 234 EREQRRKEREREREREREREERDKDRGRDDSRDRDRRRDRIQVGYDSYRGSGDRS-NRDR 292

Query: 95  DGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
           D  +++DR RDR  +++RDRDRD     +H
Sbjct: 293 DRSRNRDRSRDRGRDRDRDRDRDRDRSRKH 322

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 45/111 (40%), Positives = 65/111 (58%), Gaps = 16/111 (14%)
 Frame = -2

Query: 287  DNDRESSKSREKDRENGRERERKREKGRDRDRSRDR---------DSEKSRDRERERSRD 135
            ++DR     R++DR+  R+R+R R   +DRDR RDR         D ++ R R+R+R RD
Sbjct: 721  NSDRYQPGERDRDRDRDRDRDRDR---KDRDRERDRMDYRGGDRYDGDRDRPRDRDRDRD 777

Query: 134  RVR-------DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R R       D  RS+ R R  E+ +DR+R R+ +++RDRDRD   RDR R
Sbjct: 778  RDRRRDDSRGDRRRSRSRNRSRERDRDRDRSRNRDRDRDRDRD-FRRDRDR 827

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 44/104 (42%), Positives = 67/104 (64%), Gaps = 12/104 (11%)
 Frame = -2

Query: 278 RESSKSREKDRENGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR 102
           RE+ + +EK+ +  RE+ER+ R + R+R+R  +R+ ++ ++RERER R+R R+ ER KDR
Sbjct: 202 REARRKKEKEEDERREKERRERREQREREREEERE-QRRKERERERERERERE-ERDKDR 259

Query: 101 GRDGEKSKDRERDR----------DGEK-ERDRDRDHHHRDRHR 3
           GRD  + +DR RDR           G++  RDRDR   +RDR R
Sbjct: 260 GRDDSRDRDRRRDRIQVGYDSYRGSGDRSNRDRDRS-RNRDRSR 302

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 21/117 (17%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRD-RSRDRDSEKSRDRER-ERSRDRVRDGE 117
           R  ++E  + REK+R   RE +R+RE+  +R+ R ++R+ E+ R+RER ER +DR RD  
Sbjct: 206 RKKEKEEDERREKERRERRE-QREREREEEREQRRKEREREREREREREERDKDRGRDDS 264

Query: 116 RSKDR-------------------GRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R +DR                    RD ++S++R+R RD  ++RDRDRD   RDR R
Sbjct: 265 RDRDRRRDRIQVGYDSYRGSGDRSNRDRDRSRNRDRSRDRGRDRDRDRD-RDRDRSR 320

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 43/118 (36%), Positives = 66/118 (55%), Gaps = 9/118 (7%)
 Frame = -2

Query: 425  YEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            Y+ + +R  ++      D   +DS          D   S+S + SR+ DR+  +SR +DR
Sbjct: 762  YDGDRDRPRDRDRDRDRDRRRDDSRG--------DRRRSRSRNRSRERDRDRDRSRNRDR 813

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSR--------DRERERSRD-RVRDGERSKDRG 99
            +  R+R+ +R++ R RDRSRDRD ++SR        DR+R+RSR  R RD  RS+ RG
Sbjct: 814  DRDRDRDFRRDRDRSRDRSRDRDRDRSRHRERSRDRDRDRDRSRTRRDRDRRRSRSRG 871

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 48/137 (35%), Positives = 69/137 (50%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +ERR ++ +   +D   +    + P    ++    K    ++   RE S+SR +      
Sbjct: 500 DERRDDRRDDRRDDRRDDRKVEETPTKRKDEAAIPKETP-AKSEARERSRSRPRTARTDD 558

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
            R+R R + RDRDR+R   S +SR   R+RSR R+R   R + R R    S+DR RDRD 
Sbjct: 559 RRDRSRSRHRDRDRTR---SPRSRPDRRDRSRSRLRFNRRDRTRSR----SRDR-RDRD- 609

Query: 53  EKERDRDRDHHHRDRHR 3
              RDRDRD   R R R
Sbjct: 610 ---RDRDRDRRDRSRSR 623

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 54/119 (45%), Positives = 66/119 (55%), Gaps = 1/119 (0%)
 Frame = -2

Query: 356 SSPQPPAAADEDLTD-SKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDR 180
           S  +P  A  +D  D S+S H  RD DR  S     DR + R R R R   RDR RSR R
Sbjct: 547 SRSRPRTARTDDRRDRSRSRH--RDRDRTRSPRSRPDRRD-RSRSRLRFNRRDRTRSRSR 603

Query: 179 DSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D    RDR+R+R RDR RD  RS++R R+ EK KD   D+D   E+D  +  H RDR R
Sbjct: 604 D---RRDRDRDRDRDR-RDRSRSRNRSREREK-KDTATDKD---EKDGSK-LHLRDRSR 653

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 41/97 (42%), Positives = 57/97 (58%), Gaps = 9/97 (9%)
 Frame = -2

Query: 266 KSREKDRENGR---ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVR-DGERSKDR- 102
           ++REK  E GR   ER  +  K R  +  R +  E+ RDR+R+R RDR R D +R +DR 
Sbjct: 695 EAREKGLEEGRRTGERSPEVVKRRVENSDRYQPGERDRDRDRDRDRDRDRKDRDRERDRM 754

Query: 101 -GRDGEK---SKDRERDRDGEKERDRDRDHHHRDRHR 3
             R G++    +DR RDRD +++RDR RD    DR R
Sbjct: 755 DYRGGDRYDGDRDRPRDRDRDRDRDRRRDDSRGDRRR 791

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 44/141 (31%), Positives = 65/141 (46%), Gaps = 7/141 (4%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNH----VSRDNDRESSKS 261
           E E EEER   + E E E     +   +      +D  D         V  D+ R S   
Sbjct: 228 EREREEEREQRRKEREREREREREREERDKDRGRDDSRDRDRRRDRIQVGYDSYRGSGDR 287

Query: 260 REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR-DGEK 84
             +DR+  R R+R R++GRDRDR RDRD ++SR    ER  + V+     +++ R + E 
Sbjct: 288 SNRDRDRSRNRDRSRDRGRDRDRDRDRDRDRSRKHSAERKTEEVKKPLTKEEQERLEQEA 347

Query: 83  SKD--RERDRDGEKERDRDRD 27
             D  RE  R   K+ + + D
Sbjct: 348 LADLLRESKRVAPKQPELEID 368

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 37/134 (27%), Positives = 59/134 (44%), Gaps = 13/134 (9%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E +E R  E+ E   +     +   +      E   + +     RD DR    SR++D
Sbjct: 209 EKEEDERREKERRERREQREREREEEREQRRKEREREREREREREERDKDRGRDDSRDRD 268

Query: 248 RE-------------NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSK 108
           R              +G    R R++ R+RDRSRDR  ++ RDR+R+R R R    ER  
Sbjct: 269 RRRDRIQVGYDSYRGSGDRSNRDRDRSRNRDRSRDRGRDRDRDRDRDRDRSRKHSAERKT 328

Query: 107 DRGRDGEKSKDRER 66
           +  +     +++ER
Sbjct: 329 EEVKKPLTKEEQER 342

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 40/110 (36%), Positives = 53/110 (48%)
 Frame = -2

Query: 338 AAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRD 159
           A A ++ TD+K      + +R  S+S  +     R RER  ++ R R RS  R     R 
Sbjct: 415 APAVKESTDAKPAEPRAEKERRRSRSPSRPARRERSRERDDDRRRPRTRS-PRPRHDDRS 473

Query: 158 RERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           R R RSR RVRD  R  DR    ++S+ R RD   +  RD  RD    DR
Sbjct: 474 RSRRRSRSRVRD--RRDDR---RDRSRSRRRDERRDDRRDDRRDDRRDDR 518

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 53/182 (29%), Positives = 70/182 (38%), Gaps = 47/182 (25%)
 Frame = -2

Query: 407 RRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRER 228
           RR    E + +       SP+P     +D + S+    SR  DR   +   +DR   R R
Sbjct: 446 RRERSRERDDDRRRPRTRSPRP---RHDDRSRSRRRSRSRVRDRRDDR---RDRSRSRRR 499

Query: 227 ERKREKGRDRDRSRDRDSEK---------------------SRDRERERSRDRV------ 129
           + +R+  RD  R   RD  K                     S  RER RSR R       
Sbjct: 500 DERRDDRRDDRRDDRRDDRKVEETPTKRKDEAAIPKETPAKSEARERSRSRPRTARTDDR 559

Query: 128 RDGERSKDRGRDGEKS-------------------KDRERDRDGE-KERDRDRDHHHRDR 9
           RD  RS+ R RD  +S                   +DR R R  + ++RDRDRD   RDR
Sbjct: 560 RDRSRSRHRDRDRTRSPRSRPDRRDRSRSRLRFNRRDRTRSRSRDRRDRDRDRDRDRRDR 619

Query: 8   HR 3
            R
Sbjct: 620 SR 621

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 48/161 (29%), Positives = 61/161 (37%), Gaps = 44/161 (27%)
 Frame = -2

Query: 359 DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRER-------ERKREKGRD 201
           D+ P  P A  E     +S   SR   RE S+ R+ DR   R R       +R R + R 
Sbjct: 423 DAKPAEPRAEKER---RRSRSPSRPARRERSRERDDDRRRPRTRSPRPRHDDRSRSRRRS 479

Query: 200 RDRSRDRDSEKSRDRERERSRDRVRDGER------------------------------- 114
           R R RDR  ++ RDR R R RD  RD  R                               
Sbjct: 480 RSRVRDRRDDR-RDRSRSRRRDERRDDRRDDRRDDRRDDRKVEETPTKRKDEAAIPKETP 538

Query: 113 SKDRGRDGEKSKDR------ERDRDGEKERDRDRDHHHRDR 9
           +K   R+  +S+ R       RDR   + RDRDR    R R
Sbjct: 539 AKSEARERSRSRPRTARTDDRRDRSRSRHRDRDRTRSPRSR 579

[152][TOP]
>UniRef100_Q54PM6 Uncharacterized protein DDB_G0284459 n=1 Tax=Dictyostelium discoideum
            RepID=Y8605_DICDI
          Length = 1224

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 48/116 (41%), Positives = 68/116 (58%)
 Frame = -2

Query: 359  DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDR 180
            D+S +     D D  D  S   SRD DR+  + R++DR+  R+R R R  G   +  RDR
Sbjct: 777  DNSSRTTNGRDSD-RDRDSREGSRDRDRDRDRDRDRDRDRDRDRGRDRGNGDRGEGDRDR 835

Query: 179  DSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
            D     DR+R+R RDR RD +R +DRG D ++ +DR+RDRD  ++R  DRD   +D
Sbjct: 836  DRSGRSDRDRDRDRDRDRDRDRDRDRGNDRDRDRDRDRDRDRGRDRGSDRDRDRKD 891

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 36/137 (26%), Positives = 66/137 (48%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            + +R  +  EG  + +   D         D D    + N    + DR+  +S   DR+  
Sbjct: 787  DSDRDRDSREGSRDRDRDRDRDRDRDRDRDRDRGRDRGNGDRGEGDRDRDRSGRSDRDRD 846

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            R+R+R R++ RDRDR  DRD ++ RDR+R+R RDR  D +R +        S +   + +
Sbjct: 847  RDRDRDRDRDRDRDRGNDRDRDRDRDRDRDRGRDRGSDRDRDRKDSNSNNNSNNNNNNNN 906

Query: 56   GEKERDRDRDHHHRDRH 6
                 + + +++ +D +
Sbjct: 907  NNNNNNNNNNNNKKDNN 923

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 33/138 (23%), Positives = 67/138 (48%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            + +R  ++    G D  + D         D D   S  +   RD DR+  + R++DR+ G
Sbjct: 808  DRDRDRDRDRDRGRDRGNGDRGE-----GDRDRDRSGRSDRDRDRDRDRDRDRDRDRDRG 862

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
             +R+R R++ RDRDR RDR S++ RDR+   S +   +   + +   +   + +  +  +
Sbjct: 863  NDRDRDRDRDRDRDRGRDRGSDRDRDRKDSNSNNNSNNNNNNNNNNNNNNNNNNNNKKDN 922

Query: 56   GEKERDRDRDHHHRDRHR 3
                 + + +++ RD ++
Sbjct: 923  NNNNNNNNNNNNKRDGNK 940

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 46/121 (38%), Positives = 56/121 (46%), Gaps = 5/121 (4%)
 Frame = -2

Query: 350  PQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSE 171
            P PP              VS  + +   K   KD  + R+R+        RD  RDRDS 
Sbjct: 736  PPPPQQPPPPPPPINPFSVSEHDKKIIEKETGKDLGSSRDRDNSSRTTNGRDSDRDRDS- 794

Query: 170  KSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD----GEKERDRDRD-HHHRDRH 6
                  RE SRDR RD  R +DR RD ++ +DR RDR     GE +RDRDR     RDR 
Sbjct: 795  ------REGSRDRDRD--RDRDRDRDRDRDRDRGRDRGNGDRGEGDRDRDRSGRSDRDRD 846

Query: 5    R 3
            R
Sbjct: 847  R 847

[153][TOP]
>UniRef100_Q5RBA9 Putative uncharacterized protein DKFZp469G0339 (Fragment) n=1
           Tax=Pongo abelii RepID=Q5RBA9_PONAB
          Length = 774

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 42/93 (45%), Positives = 67/93 (72%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           +   V R + R   ++RE+DRE  R+RER+RE+ R+RDR R+++ E  R+R RER R+R 
Sbjct: 679 EERRVDRVDGRRDERARERDRERERDRERERERERERDREREKERELERERARERERERE 738

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           ++ +R +DR RD ++ ++RER+RD EKER+R +
Sbjct: 739 KERDRERDRDRDHDRERERERERDREKERERKK 771

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 47/126 (37%), Positives = 78/126 (61%), Gaps = 12/126 (9%)
 Frame = -2

Query: 350  PQPPAAADEDLTD-----SKSNHVSRDN-------DRESSKSREKDRENGRERERKREKG 207
            P PP  +D+  +       +++ + RD        DR   +  E+ RE  RERER RE+ 
Sbjct: 649  PLPPVFSDQRPSSPIRHQGRNDELERDERREERRVDRVDGRRDERARERDRERERDRERE 708

Query: 206  RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
            R+R+R RDR+ EK R+ ERER+R+R R+ E+ +DR RD ++  DRER+R+ E++R+++R+
Sbjct: 709  RERERERDREREKERELERERAREREREREKERDRERDRDRDHDRERERERERDREKERE 768

Query: 26   HHHRDR 9
               + +
Sbjct: 769  RKKKKK 774

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 37/107 (34%), Positives = 58/107 (54%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E + R E+   +  D   ++ + +     + D    +     RD +RE  +  E++R 
Sbjct: 671 ELERDERREERRVDRVDGRRDERARERDRERERDRERERERERERDREREKERELERERA 730

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR 102
             RERER++E+ R+RDR RD D    R+RERER RDR ++ ER K +
Sbjct: 731 REREREREKERDRERDRDRDHD----RERERERERDREKERERKKKK 773

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 7/99 (7%)
 Frame = -2

Query: 422 EFEEERRYEQPEG-------EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK 264
           E  EERR ++ +G       E +     D   +     + D    K   + R+  RE  +
Sbjct: 676 ERREERRVDRVDGRRDERARERDRERERDRERERERERERDREREKERELERERARERER 735

Query: 263 SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE 147
            REK+R+  R+R+R  ++ R+R+R RDR+ E+ R ++++
Sbjct: 736 EREKERDRERDRDRDHDRERERERERDREKERERKKKKK 774

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 42/142 (29%), Positives = 66/142 (46%), Gaps = 21/142 (14%)
 Frame = -2

Query: 365 HNDSSPQ----PPAAAD-------EDLTDSKSNHVSRDNDRESSKS-REKDRENGRERER 222
           H+ SSPQ    PP            D   +  +H  R   RE ++  R++++++  ERE 
Sbjct: 377 HSLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREDTRGKRDREKDSREEREY 436

Query: 221 KREKGRDRDRSRDRDSEKSRDRERER-SRDR--------VRDGERSKDRGRDGEKSKDRE 69
           ++++   RD   DR+    RDR   R +RDR        +RD    +D  RD ++S+D  
Sbjct: 437 EQDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDMRDSREMRDYSRDTKESRD-P 495

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
           RD    ++    RD   RD HR
Sbjct: 496 RDSRSTRDAHDYRDREGRDTHR 517

[154][TOP]
>UniRef100_B4P1V7 GE12588 n=1 Tax=Drosophila yakuba RepID=B4P1V7_DROYA
          Length = 970

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 50/130 (38%), Positives = 81/130 (62%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E ER  E    E  D+  +D    P  A ++          +RD +R+S + RE  RE  
Sbjct: 67  ERERPNEVISLEESDSDSSDCVEVPVQAQEQAKVRDARESTNRDRERDSGRDRELLREKE 126

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           RERER RE+ RDRDR ++R+ E+ ++R+RER ++R+R+ E  ++R R+ E+ K+RE++R 
Sbjct: 127 RERERDRERERDRDREKEREREREKERDREREKERLRERE-EREREREKERLKEREKERF 185

Query: 56  GEKERDRDRD 27
            E+ER+R+R+
Sbjct: 186 RERERERERE 195

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 41/111 (36%), Positives = 69/111 (62%), Gaps = 6/111 (5%)
 Frame = -2

Query: 317 TDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSR 138
           +DS S+       +   +++ +D      R+R+R+ GRDR+  R+++ E+ RDRERER R
Sbjct: 80  SDSDSSDCVEVPVQAQEQAKVRDARESTNRDRERDSGRDRELLREKERERERDRERERDR 139

Query: 137 DRVRDGERSKDRGRDGEKSKDR-----ERDRDGEKERDRDRD-HHHRDRHR 3
           DR ++ ER +++ RD E+ K+R     ER+R+ EKER ++R+    R+R R
Sbjct: 140 DREKEREREREKERDREREKERLREREEREREREKERLKEREKERFRERER 190

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 44/127 (34%), Positives = 70/127 (55%), Gaps = 18/127 (14%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR-----DRSRDRDSEKS 165
           D +L   K     RD +RE  + REK+RE  RE+ER RE+ ++R     +R R+R+ E+ 
Sbjct: 118 DRELLREKERERERDRERERDRDREKEREREREKERDREREKERLREREEREREREKERL 177

Query: 164 RDRERERSRDRVRDGER------------SKDRGRDGEKSKDRERDRDGEKERDRDRD-H 24
           ++RE+ER R+R R+ ER            SK    +  + ++ ER+RD  K   R+R+  
Sbjct: 178 KEREKERFRERERERERERELTAPPPPQISKHAEYESRREREIERERDARKRSGRERERE 237

Query: 23  HHRDRHR 3
            +R+R R
Sbjct: 238 RNRERSR 244

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 38/144 (26%), Positives = 67/144 (46%), Gaps = 6/144 (4%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E +R  E+     ++        +      E L + +     R+ +RE  + +E++
Sbjct: 126 ERERERDRERERDRDREKEREREREKERDREREKERLREREE----REREREKERLKERE 181

Query: 248 RENGRERERKREKGRDRDR------SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
           +E  RERER+RE+ R+         S+  + E  R+RE ER RD  +   R ++R R+ E
Sbjct: 182 KERFRERERERERERELTAPPPPQISKHAEYESRREREIERERDARKRSGRERERERNRE 241

Query: 86  KSKDRERDRDGEKERDRDRDHHHR 15
           +S+ +       K   R+R+   R
Sbjct: 242 RSRSQSPPSASRKPATREREPSSR 265

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 42/135 (31%), Positives = 67/135 (49%), Gaps = 12/135 (8%)
 Frame = -2

Query: 371 NYHNDSSP--QPPAAADEDLT-----DSKSNHVSRDNDRESSKSREKDRENGRERERKRE 213
           N H   SP  Q  A  DED+T     DS S H      R     + K+  +   + ++RE
Sbjct: 16  NRHRSRSPERQRRATEDEDVTLDLTDDSSSRH------RHHKHKKHKEHRHKHHKHKERE 69

Query: 212 KGRDRDRSRDRDSEKSRDRE---RERSRDRVRDGERSKDRGRDGEKSKDRE--RDRDGEK 48
           +  +     + DS+ S   E   + + + +VRD   S +R R+ +  +DRE  R+++ E+
Sbjct: 70  RPNEVISLEESDSDSSDCVEVPVQAQEQAKVRDARESTNRDRERDSGRDRELLREKERER 129

Query: 47  ERDRDRDHHHRDRHR 3
           ERDR+R+   RDR R
Sbjct: 130 ERDRERE---RDRDR 141

[155][TOP]
>UniRef100_A4RMR5 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea
            RepID=A4RMR5_MAGGR
          Length = 943

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 59/153 (38%), Positives = 81/153 (52%), Gaps = 14/153 (9%)
 Frame = -2

Query: 419  FEEERRYEQPEGEGEDNYHNDSSPQPP--------AAADEDLTDSKSNHVSR---DNDRE 273
            + ++ R E+    G     +  SP+P         A A+ +L   KS+       D    
Sbjct: 627  YRDKDRGERSHRHGGRAARSSRSPEPDSYEADRRKAIAERELNYRKSSMAESLLSDRPDR 686

Query: 272  SSKSREKDRE-NGRERERKREKGRDRDRSRDR--DSEKSRDRERERSRDRVRDGERSKDR 102
             S  R +DR+   R R+R R++ RDRDRSRDR  D E+ RDR R+R  DRV    R  DR
Sbjct: 687  RSDDRHRDRDYRARSRDRDRDRARDRDRSRDRERDRERERDRARDRESDRVPRSRRDDDR 746

Query: 101  GRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             R+ E+ +DRERDRD ++ER RDRD+    R R
Sbjct: 747  SRERERDRDRERDRDRDRERARDRDYDRPPRSR 779

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 54/143 (37%), Positives = 77/143 (53%), Gaps = 6/143 (4%)
 Frame = -2

Query: 419  FEEERRYEQPEGEGEDNYHNDS------SPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
            +E +RR  +   E E NY   S      S +P   +D+   D      SRD DR+    R
Sbjct: 655  YEADRR--KAIAERELNYRKSSMAESLLSDRPDRRSDDRHRDRDYRARSRDRDRD----R 708

Query: 257  EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
             +DR+  R+RER RE+ RDR R R+ D      R+ +RSR+R RD +R +DR RD E+++
Sbjct: 709  ARDRDRSRDRERDRERERDRARDRESDRVPRSRRDDDRSRERERDRDRERDRDRDRERAR 768

Query: 77   DRERDRDGEKERDRDRDHHHRDR 9
            DR+ DR     RD    H+ R+R
Sbjct: 769  DRDYDRPPRSRRDDGPGHYDRER 791

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 45/142 (31%), Positives = 69/142 (48%), Gaps = 1/142 (0%)
 Frame = -2

Query: 431  GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            G +E    R  E+ E    D        +  +  D+D  +    H  R     SS+S E 
Sbjct: 595  GAFEKYLRRLREKEEDAERDRQRRRERDERASYRDKDRGERSHRHGGRA--ARSSRSPEP 652

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE-RSKDRGRDGEKSKD 75
            D      R+   E+  +  +S   +S  S DR   RS DR RD + R++ R RD ++++D
Sbjct: 653  DSYEADRRKAIAERELNYRKSSMAESLLS-DRPDRRSDDRHRDRDYRARSRDRDRDRARD 711

Query: 74   RERDRDGEKERDRDRDHHHRDR 9
            R+R RD E++R+R+RD   RDR
Sbjct: 712  RDRSRDRERDRERERD-RARDR 732

[156][TOP]
>UniRef100_Q2QKB4 Splicing factor U2af large subunit B n=1 Tax=Triticum aestivum
           RepID=U2A2B_WHEAT
          Length = 543

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 54/128 (42%), Positives = 74/128 (57%)
 Frame = -2

Query: 386 GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKG 207
           G G D+Y ++      A   E  T ++   +S+  DR+    REKD++  R R+R R++G
Sbjct: 6   GGGGDDYVSE------AVRPEGDTHTREEGLSKSRDRD----REKDKDKERHRDRDRDRG 55

Query: 206 RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           RDRDR RDRD +K RDR+++R  DR +   R K   RD     DR R RD E+ RDR+RD
Sbjct: 56  RDRDRGRDRDLDKDRDRDKDR--DRHQRHHRDKREHRDRPDDHDRHRSRDSERRRDRERD 113

Query: 26  HHHRDRHR 3
            H R R R
Sbjct: 114 GHRRHRSR 121

[157][TOP]
>UniRef100_UPI0001A5EDA6 PREDICTED: hypothetical protein n=1 Tax=Homo sapiens
           RepID=UPI0001A5EDA6
          Length = 290

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 53/155 (34%), Positives = 82/155 (52%), Gaps = 10/155 (6%)
 Frame = -2

Query: 437 TMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           T  E + + +R  E+   E E N + D   Q     D +    K     RD  RE  + R
Sbjct: 88  TEKERDRDRKRDRERRRKEKETNRNRDREKQTEIERDREREKQKGRERERDRGRERERDR 147

Query: 257 ----------EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSK 108
                     EKDR+  RE E +RE+ R+R++ ++R++E+ RDR+R+  ++R R  +R +
Sbjct: 148 DREKERERQTEKDRDGQRETETERERDREREKQKERETERDRDRQRDTEKERERQTDRER 207

Query: 107 DRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           DR R  +  + RE DR+GE+E DR R+   RDR R
Sbjct: 208 DRQRKTQTERQRETDREGERETDRRRE-RQRDRDR 241

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 49/146 (33%), Positives = 75/146 (51%), Gaps = 6/146 (4%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E +R  E+ +G   +    D   +     D +    +     RD  RE+   RE+DRE
Sbjct: 120 EIERDREREKQKGRERER---DRGRERERDRDREKERERQTEKDRDGQRETETERERDRE 176

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR--- 72
             RE++++RE  RDRDR RD + E+ R  +RER R R    ER ++  R+GE+  DR   
Sbjct: 177 --REKQKERETERDRDRQRDTEKERERQTDRERDRQRKTQTERQRETDREGERETDRRRE 234

Query: 71  ---ERDRDGEKERDRDRDHHHRDRHR 3
              +RDR  E++R+RDR    +   +
Sbjct: 235 RQRDRDRGKERDRERDRKEERKKERK 260

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/141 (31%), Positives = 74/141 (52%), Gaps = 1/141 (0%)
 Frame = -2

Query: 422 EFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
           E E +R R ++ E + E +       +     D +    K     RD DR+    +E++R
Sbjct: 142 ERERDRDREKERERQTEKDRDGQRETETERERDREREKQKERETERDRDRQRDTEKERER 201

Query: 245 ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
           +  RER+R+R+   +R R  DR+ E+  DR RER RDR R  ER ++R R  E+ K+R++
Sbjct: 202 QTDRERDRQRKTQTERQRETDREGERETDRRRERQRDRDRGKERDRERDRKEERKKERKK 261

Query: 65  DRDGEKERDRDRDHHHRDRHR 3
           +R  E++  +  +    D+ R
Sbjct: 262 ERKKERKEKKKEEKRREDKKR 282

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 45/111 (40%), Positives = 70/111 (63%), Gaps = 7/111 (6%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESSKS-REKDRENGRERERKR-EKGRDRDRSRDRDSEKSRDRERERS 141
           D+  +   R+ DR   K+ +E+DR+  R+RER+R EK  +R+R R++ +E  RDRERE+ 
Sbjct: 71  DADGDDRQRERDRVREKTEKERDRDRKRDRERRRKEKETNRNRDREKQTEIERDREREKQ 130

Query: 140 RDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRD-----RDHHHRDRHR 3
           + R    ER +DRGR+ E+ +DRE++R+ + E+DRD          RDR R
Sbjct: 131 KGR----ERERDRGRERERDRDREKERERQTEKDRDGQRETETERERDRER 177

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 42/137 (30%), Positives = 73/137 (53%), Gaps = 5/137 (3%)
 Frame = -2

Query: 398 EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERK 219
           E P   G    H D+         + + +       RD  R+  + R K++E  R R+R+
Sbjct: 58  ESPRSWGLGQAHKDADGDDRQRERDRVREKTEKERDRDRKRDRER-RRKEKETNRNRDRE 116

Query: 218 REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR----GRDGEKSKDRERDRDGE 51
           ++   +RDR R++   + R+R+R R R+R RD E+ ++R     RDG++  + ER+RD E
Sbjct: 117 KQTEIERDREREKQKGRERERDRGRERERDRDREKERERQTEKDRDGQRETETERERDRE 176

Query: 50  KERDRDRD-HHHRDRHR 3
           +E+ ++R+    RDR R
Sbjct: 177 REKQKERETERDRDRQR 193

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 40/134 (29%), Positives = 64/134 (47%), Gaps = 7/134 (5%)
 Frame = -2

Query: 422 EFEEERRYE-------QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK 264
           E E ER+ E       + E E E +   +   +     D D          R  DRE  +
Sbjct: 150 EKERERQTEKDRDGQRETETERERDREREKQKERETERDRDRQRDTEKERERQTDRERDR 209

Query: 263 SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
            R+   E  RE +R+ E+  DR R R RD ++ ++R+RER R   R  ER K+R ++ ++
Sbjct: 210 QRKTQTERQRETDREGERETDRRRERQRDRDRGKERDRERDRKEERKKERKKERKKERKE 269

Query: 83  SKDRERDRDGEKER 42
            K  E+ R+ +K +
Sbjct: 270 KKKEEKRREDKKRK 283

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 42/127 (33%), Positives = 68/127 (53%), Gaps = 5/127 (3%)
 Frame = -2

Query: 431 GEYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRE----SS 267
           G+ E E ER R  + E + E     D   Q       D    +     R+ DR+    + 
Sbjct: 163 GQRETETERERDREREKQKERETERDRDRQ------RDTEKERERQTDRERDRQRKTQTE 216

Query: 266 KSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
           + RE DRE  RE +R+RE+ RDRDR ++RD E+ R  ER++ R + R  ER K++ ++ +
Sbjct: 217 RQRETDREGERETDRRRERQRDRDRGKERDRERDRKEERKKERKKERKKER-KEKKKEEK 275

Query: 86  KSKDRER 66
           + +D++R
Sbjct: 276 RREDKKR 282

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 41/103 (39%), Positives = 54/103 (52%), Gaps = 16/103 (15%)
 Frame = -2

Query: 287 DNDRESSKSREKDRENGRERERKREKGRDRDRSRD---------RDSEKSRDRER----- 150
           D  R    S+E  R  G  +  K   G DR R RD         RD ++ RDRER     
Sbjct: 48  DFSRGRLGSQESPRSWGLGQAHKDADGDDRQRERDRVREKTEKERDRDRKRDRERRRKEK 107

Query: 149 --ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
              R+RDR +  E  +DR R+ +K ++RERDR  E+ERDRDR+
Sbjct: 108 ETNRNRDREKQTEIERDREREKQKGRERERDRGRERERDRDRE 150

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 31/116 (26%), Positives = 64/116 (55%), Gaps = 2/116 (1%)
 Frame = -2

Query: 437 TMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSR--DNDRESSK 264
           T  E + E E++ E+ E E + +   D+  +     D +    +     R  + DRE  +
Sbjct: 169 TERERDREREKQKER-ETERDRDRQRDTEKERERQTDRERDRQRKTQTERQRETDREGER 227

Query: 263 SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR 96
             ++ RE  R+R+R +E+ R+RDR  +R  E+ ++R++ER +++ ++ +R +D+ R
Sbjct: 228 ETDRRRERQRDRDRGKERDRERDRKEERKKERKKERKKER-KEKKKEEKRREDKKR 282

[158][TOP]
>UniRef100_UPI00017930ED PREDICTED: similar to ATP-dependent RNA helicase n=1
           Tax=Acyrthosiphon pisum RepID=UPI00017930ED
          Length = 1246

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 50/128 (39%), Positives = 76/128 (59%), Gaps = 5/128 (3%)
 Frame = -2

Query: 371 NYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR-----ERERKREKG 207
           N   D + +P    D+ L+ S+S    R + R +SK+R + RE  R     +++R R++ 
Sbjct: 134 NGTEDETNKPSGPDDKRLSRSRSKSHDRQHRRRNSKNRSRSREKHRGDKSHDKQRDRQRD 193

Query: 206 RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           R RDR RDR  ++ RDR R+R RDR RD +R + R R G++++D+   RD   +R RDR 
Sbjct: 194 RSRDRYRDRSRDRQRDRSRDRQRDRSRDRQRDRSRDRQGDRNRDK---RDRNCDRQRDRS 250

Query: 26  HHHRDRHR 3
           H  RDR+R
Sbjct: 251 HDKRDRNR 258

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 50/142 (35%), Positives = 81/142 (57%), Gaps = 6/142 (4%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +++R  +   +  D  H   + +  + + E     KS+   RD  R+ S+ R +DR    
Sbjct: 147 DDKRLSRSRSKSHDRQHRRRNSKNRSRSREKHRGDKSHDKQRDRQRDRSRDRYRDRS--- 203

Query: 233 ERERKREKGRD--RDRSRDRDSEKSRDRERERSRD-RVRDGERSKDRGRDGEKSKDRERD 63
            R+R+R++ RD  RDRSRDR  ++SRDR+ +R+RD R R+ +R +DR  D    +DR RD
Sbjct: 204 -RDRQRDRSRDRQRDRSRDRQRDRSRDRQGDRNRDKRDRNCDRQRDRSHD---KRDRNRD 259

Query: 62  RDGEK---ERDRDRDHHHRDRH 6
           R G++   +RDR  D   ++RH
Sbjct: 260 RLGDRSRDKRDRSNDGLRKERH 281

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 39/132 (29%), Positives = 70/132 (53%), Gaps = 5/132 (3%)
 Frame = -2

Query: 425 YEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
           ++ +  RR  +      + +  D S         D +  +    SRD  R+ S+ R++DR
Sbjct: 159 HDRQHRRRNSKNRSRSREKHRGDKSHDKQRDRQRDRSRDRYRDRSRDRQRDRSRDRQRDR 218

Query: 245 ENGRERERKREKGRDRDR-SRDRDSEKSRDR---ERERSRDRVRDGERSK-DRGRDGEKS 81
              R+R+R R++  DR+R  RDR+ ++ RDR   +R+R+RDR+ D  R K DR  DG + 
Sbjct: 219 SRDRQRDRSRDRQGDRNRDKRDRNCDRQRDRSHDKRDRNRDRLGDRSRDKRDRSNDGLRK 278

Query: 80  KDRERDRDGEKE 45
           +  E++ + + +
Sbjct: 279 ERHEKEIESKSK 290

[159][TOP]
>UniRef100_UPI00015B471E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B471E
          Length = 199

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/146 (36%), Positives = 82/146 (56%), Gaps = 7/146 (4%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E E+  EQ E E E         +  + A  +  + K    S    R   K RE++
Sbjct: 50  EREREREKEKEQREREREQR-------RQQSGAVREGREKKMVRESESRRRRERKERERE 102

Query: 248 RENGRERERKRE-------KGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG 90
           RE  RERER+RE       KG+  +R  +R+ E+ R+RERER R+R R+ ER ++  R G
Sbjct: 103 RERERERERERERGGTCNNKGKHDERETEREGEREREREREREREREREREREREDERRG 162

Query: 89  EKSKDRERDRDGEKERDRDRDHHHRD 12
           E+ ++RER+R+ E+ER+R+R+   R+
Sbjct: 163 ERERERERERERERERERERERERRE 188

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 40/106 (37%), Positives = 61/106 (57%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E  RR E+ E E E     +   +          ++K  H  R+ +RE  + RE++RE
Sbjct: 87  ESESRRRRERKERERERERERERERERERGGT---CNNKGKHDERETEREGERERERERE 143

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKD 105
             RERER+RE+ R+ +R  +R+ E+ R+RERER R+R R+ ER +D
Sbjct: 144 REREREREREREREDERRGERERERERERERERERERERERERRED 189

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 46/147 (31%), Positives = 77/147 (52%), Gaps = 17/147 (11%)
 Frame = -2

Query: 392 PEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS-REKDRENGRERERKR 216
           P+G    +    S    P   + +  DS +    R+ +RE  K  RE++RE  R++    
Sbjct: 18  PQGRARTHPRIHSHSLSPEDVERE-RDSGTREREREREREKEKEQREREREQRRQQSGAV 76

Query: 215 EKGRDRDRSRDRDSEKSRDR-ERERSRDRVRDGERSKDRG---------------RDGEK 84
            +GR++   R+ +S + R+R ERER R+R R+ ER ++RG               R+GE+
Sbjct: 77  REGREKKMVRESESRRRRERKERERERERERERERERERGGTCNNKGKHDERETEREGER 136

Query: 83  SKDRERDRDGEKERDRDRDHHHRDRHR 3
             +RER+R+ E+ER+R+R+    D  R
Sbjct: 137 --EREREREREREREREREREREDERR 161

[160][TOP]
>UniRef100_UPI0001A2D9BA hypothetical protein LOC563852 n=1 Tax=Danio rerio
           RepID=UPI0001A2D9BA
          Length = 466

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 56/141 (39%), Positives = 75/141 (53%), Gaps = 6/141 (4%)
 Frame = -2

Query: 428 EYEFEEERRYE-QPEGEGEDNYHNDSSPQPPAAADEDL----TDSKSNHVSRDNDRESSK 264
           E E E+ER  E + E E E     D         D D     + S S H SR +DR  S+
Sbjct: 274 EKEREKEREREREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSR 333

Query: 263 SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
           SR++ R   +ERERKR + RDR+R R RD    + R R R R R R  ER   R R   +
Sbjct: 334 SRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKRRSRSRDRRRSRSSERKSHRHRSRSR 393

Query: 83  SKDRERDRDGEKER-DRDRDH 24
            +DR+RDRD +K++  +D+DH
Sbjct: 394 DRDRDRDRDRDKDKSSKDKDH 414

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 50/143 (34%), Positives = 75/143 (52%)
 Frame = -2

Query: 437 TMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           T+ E + +  RR E PE E +     D   +     ++   + +     ++ ++E  + R
Sbjct: 226 TVEELKEKLRRRSEDPEKEDQGKKVKDDREREREEREKRRKEEEEKEKEKEREKERERER 285

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           EK+RE  RERER R++ RDR+R RDR S +S    R  SR   R   RS+DR R   K +
Sbjct: 286 EKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKER 345

Query: 77  DRERDRDGEKERDRDRDHHHRDR 9
           +R+R R  ++ER R RD   R R
Sbjct: 346 ERKRSRSRDRERRRSRDRSDRKR 368

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/143 (33%), Positives = 69/143 (48%), Gaps = 12/143 (8%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHN---------DSSPQPPAAADEDLTDSKSNHVSRDNDR 276
           E E E ER  E+      D   +          +S      +D   + S+    SR  +R
Sbjct: 286 EKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKER 345

Query: 275 ESSKSREKDRENGRERER--KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR 102
           E  +SR +DRE  R R+R  ++ + R RDR R R SE+   R R RSRDR RD +R +D+
Sbjct: 346 ERKRSRSRDRERRRSRDRSDRKRRSRSRDRRRSRSSERKSHRHRSRSRDRDRDRDRDRDK 405

Query: 101 GRDGEKSKDRE-RDRDGEKERDR 36
            +    SKD++ +D   EK   R
Sbjct: 406 DK---SSKDKDHKDSSDEKRSSR 425

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 34/91 (37%), Positives = 58/91 (63%), Gaps = 1/91 (1%)
 Frame = -2

Query: 275 ESSKSREKDRENGRERERKREKGRDRDRSRDRDS-EKSRDRERERSRDRVRDGERSKDRG 99
           E  K + + R    E+E + +K +D DR R+R+  EK R  E E+ +++ R+ ER ++R 
Sbjct: 228 EELKEKLRRRSEDPEKEDQGKKVKD-DREREREEREKRRKEEEEKEKEKEREKERERERE 286

Query: 98  RDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
           ++ E+ ++RERDRD +++R+RDRD   R  H
Sbjct: 287 KERERERERERDRDRDRDRERDRDRRSRRSH 317

[161][TOP]
>UniRef100_C5XF99 Putative uncharacterized protein Sb03g029860 n=1 Tax=Sorghum
           bicolor RepID=C5XF99_SORBI
          Length = 1247

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 52/137 (37%), Positives = 81/137 (59%), Gaps = 4/137 (2%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSN-HVSRDNDRESSKSRE 255
           G+      RR    +   E+      S +  +  ++DL   +S+ H   D DRE  K RE
Sbjct: 127 GDEPKRSSRRAVVVDDRAEEVASKSDSGKRRSEKEKDLGRKESSGHYKDDRDREREKERE 186

Query: 254 KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           +++E  R++ER RE+ RDR+R ++R+ EK R+RERER R++ RD ER ++R R+ E+ K+
Sbjct: 187 REKEWERQKERDRERSRDRERDKEREREKEREREREREREKDRDRERDRERERERERQKE 246

Query: 74  RERDR---DGEKERDRD 33
           RERD+   D + ER  D
Sbjct: 247 RERDKKDYDSKHERYED 263

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 40/105 (38%), Positives = 71/105 (67%), Gaps = 3/105 (2%)
 Frame = -2

Query: 317 TDSKSNHVSRDND---RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE 147
           +DS      ++ D   +ESS   + DR+  RE+ER+REK  +R + RDR  E+SRDRER+
Sbjct: 151 SDSGKRRSEKEKDLGRKESSGHYKDDRDREREKEREREKEWERQKERDR--ERSRDRERD 208

Query: 146 RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
           + R+R ++ ER ++R R+ ++ ++R+R+R+ E+ER ++R+   +D
Sbjct: 209 KEREREKEREREREREREKDRDRERDRERERERERQKERERDKKD 253

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 44/129 (34%), Positives = 67/129 (51%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           G+   E+E+   + E  G      D   +     +++    K     R  DRE  K RE+
Sbjct: 154 GKRRSEKEKDLGRKESSGHYKDDRDREREKEREREKEWERQKERDRERSRDRERDKERER 213

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           ++E  RERER+REK  DRDR RDR+ E+ R+R++ER RD+ +D +   +R  DG   K  
Sbjct: 214 EKEREREREREREK--DRDRERDRERERERERQKERERDK-KDYDSKHERYEDGGSRKSL 270

Query: 71  ERDRDGEKE 45
            +    E+E
Sbjct: 271 SKTSRTEEE 279

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/116 (40%), Positives = 70/116 (60%), Gaps = 5/116 (4%)
 Frame = -2

Query: 335 AADEDLTDSKSNHVSRDNDRE-SSKSREKDRENGRERE--RKREKGRDRDRSRDRDSEKS 165
           + DE    S+   V  D   E +SKS    R + +E++  RK   G  +D   DRD E+ 
Sbjct: 126 SGDEPKRSSRRAVVVDDRAEEVASKSDSGKRRSEKEKDLGRKESSGHYKD---DRDRERE 182

Query: 164 RDRERER--SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ++RERE+   R + RD ERS+DR RD E+ +++ER+R+ E+ER++DRD   RDR R
Sbjct: 183 KEREREKEWERQKERDRERSRDRERDKEREREKEREREREREREKDRD-RERDRER 237

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 37/151 (24%), Positives = 63/151 (41%), Gaps = 10/151 (6%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           G Y+ + +R  E+ E E E  +          + D +    +     R+ +RE  + +++
Sbjct: 171 GHYKDDRDREREK-EREREKEWERQKERDRERSRDRERDKEREREKEREREREREREKDR 229

Query: 251 DRENGRERERKREKGRDRDR-SRDRDSEKSRDRE---------RERSRDRVRDGERSKDR 102
           DRE  RERER+RE+ ++R+R  +D DS+  R  +           R+ +      R  D 
Sbjct: 230 DRERDRERERERERQKERERDKKDYDSKHERYEDGGSRKSLSKTSRTEEEAYSYRRDTDA 289

Query: 101 GRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
                K K    D   +K   R  D    D+
Sbjct: 290 NEISAKEKYNNPDMQADKHSRRKDDSEDTDK 320

[162][TOP]
>UniRef100_B8BLH5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8BLH5_ORYSI
          Length = 574

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 66/152 (43%), Positives = 87/152 (57%), Gaps = 15/152 (9%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDN-----YHNDSSPQ--PPAAA------DEDLTDS-KSNHVSRDNDR 276
           EE+ YE   G G D      Y    +P+  PPAAA       +  TD  +S H ++ +D 
Sbjct: 5   EEQPYEG-NGNGGDPAPASAYAEYPAPEGSPPAAAAKPTGFSDGATDGGRSQHETQPHDG 63

Query: 275 ESSKSREKDRENGRERERKREKGRDRDRSRDR-DSEKSRDRERERSRDRVRDGERSKDRG 99
            SSKSRE++RE  +++ER R++GRDR R RDR D ++ RDR RE  RDR    ER + R 
Sbjct: 64  RSSKSRERERERDKDKERDRDRGRDR-RDRDRGDKDRDRDRHREH-RDR---SERREHRD 118

Query: 98  RDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R+    +DR R  D E+ RDRDRD H R R R
Sbjct: 119 RERSDDRDRRRGHDSERRRDRDRDGHRRHRSR 150

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 42/102 (41%), Positives = 55/102 (53%), Gaps = 6/102 (5%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRD-RD-SEKSRDRERERSRDRVR--- 126
           ++ DR+  + R +DR+ G       +K RDRDR R+ RD SE+   R+RERS DR R   
Sbjct: 79  KERDRDRGRDR-RDRDRG-------DKDRDRDRHREHRDRSERREHRDRERSDDRDRRRG 130

Query: 125 -DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            D ER +DR RDG +   R R R     + RDR    R R R
Sbjct: 131 HDSERRRDRDRDGHR---RHRSRSRSPSKGRDRRSRSRSRSR 169

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 35/92 (38%), Positives = 45/92 (48%)
 Frame = -2

Query: 323 DLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER 144
           D  D       RD DR        +R   R+RER      DRDR R  DSE+ RDR+R+ 
Sbjct: 88  DRRDRDRGDKDRDRDRHREHRDRSERREHRDRERS----DDRDRRRGHDSERRRDRDRDG 143

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
            R R R   RS  +GRD  +S+ R R R  ++
Sbjct: 144 HR-RHRSRSRSPSKGRD-RRSRSRSRSRSSKR 173

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 36/108 (33%), Positives = 50/108 (46%), Gaps = 3/108 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ++  E+    G D    D   +     D D      +   R   R+  +S ++D
Sbjct: 70  ERERERDKDKERDRDRGRDRRDRDRGDKD---RDRDRHREHRDRSERREHRDRERSDDRD 126

Query: 248 RENGRERERKREKGRD---RDRSRDRDSEKSRDRERERSRDRVRDGER 114
           R  G + ER+R++ RD   R RSR R   K RDR R RSR R R  +R
Sbjct: 127 RRRGHDSERRRDRDRDGHRRHRSRSRSPSKGRDR-RSRSRSRSRSSKR 173

[163][TOP]
>UniRef100_Q55AD4 YEATS family protein n=1 Tax=Dictyostelium discoideum
           RepID=Q55AD4_DICDI
          Length = 717

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/138 (39%), Positives = 85/138 (61%), Gaps = 15/138 (10%)
 Frame = -2

Query: 371 NYHNDSSPQPPAAADEDLTDSKSNHVSRDN---DRESSKSREKDRENGRERERKREKGRD 201
           NY N+  PQ     D+   +S +N  S+ N   ++E  K +EK++E  +E+E+++EK +D
Sbjct: 570 NYLNE--PQKIVNNDKVSENSSNNEDSQKNKEKEKEKEKEKEKEKEKEKEKEKEKEKEKD 627

Query: 200 RDRSRDRDSEKSRDRERERS------------RDRVRDGERSKDRGRDGEKSKDRERDRD 57
           +D+ +++D EK + +ER+              RDR R+ ER +DR RD EK K+RER+R+
Sbjct: 628 KDKEKEKDKEKDKVKERDNKEKELENNRPKDDRDRDREKERVRDRDRDREKEKERERERE 687

Query: 56  GEKERDRDRDHHHRDRHR 3
            E+ER RDRD   RDR+R
Sbjct: 688 RERERYRDRD-RDRDRYR 704

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 48/126 (38%), Positives = 74/126 (58%), Gaps = 6/126 (4%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR---EKDR 246
           E+ ++ ++ E E E     +   +     +++    K     +D +++  K R   EK+ 
Sbjct: 592 EDSQKNKEKEKEKEKEKEKEKEKEKEKEKEKEKEKDKDKEKEKDKEKDKVKERDNKEKEL 651

Query: 245 ENGR---ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           EN R   +R+R REK R RDR RDR+ EK R+RERER R+R RD +R +DR RD ++ +D
Sbjct: 652 ENNRPKDDRDRDREKERVRDRDRDREKEKERERERERERERYRDRDRDRDRYRDRDRDRD 711

Query: 74  RERDRD 57
           R+RDRD
Sbjct: 712 RDRDRD 717

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 43/132 (32%), Positives = 77/132 (58%), Gaps = 16/132 (12%)
 Frame = -2

Query: 374 DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRD 195
           +N  N+   Q     +++    K     ++ ++E  K +EKD++  +E++++++K ++RD
Sbjct: 586 ENSSNNEDSQKNKEKEKEKEKEKEKEKEKEKEKEKEKEKEKDKDKEKEKDKEKDKVKERD 645

Query: 194 RS------------RDRDSEKSR----DRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
                         RDRD EK R    DR+RE+ ++R R+ ER ++R RD ++ +DR RD
Sbjct: 646 NKEKELENNRPKDDRDRDREKERVRDRDRDREKEKERERERERERERYRDRDRDRDRYRD 705

Query: 62  RDGEKERDRDRD 27
           RD +++RDRDRD
Sbjct: 706 RDRDRDRDRDRD 717

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 32/117 (27%), Positives = 67/117 (57%), Gaps = 12/117 (10%)
 Frame = -2

Query: 317 TDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSR 138
           T   SN+++      ++    ++  N  + ++ +EK +++++ ++++ EK +++E+E+ +
Sbjct: 565 TSPTSNYLNEPQKIVNNDKVSENSSNNEDSQKNKEKEKEKEKEKEKEKEKEKEKEKEKEK 624

Query: 137 DRVRDGERSKDRGRDGEKSKDR------------ERDRDGEKERDRDRDHHHRDRHR 3
           ++ +D E+ KD+ +D  K +D             +RDRD EKER RDRD   RDR +
Sbjct: 625 EKDKDKEKEKDKEKDKVKERDNKEKELENNRPKDDRDRDREKERVRDRD---RDREK 678

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 29/160 (18%), Positives = 83/160 (51%), Gaps = 22/160 (13%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYH----NDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E++++ +Q      +N +    N+++       + ++ ++ +N+++ +N+  ++ S    
Sbjct: 507 EKQQKLDQLNNNNNNNNNSENNNNNNNNNNNNNNNNINNNNNNNINNNNNDNNNSSNNTS 566

Query: 248 RENGRERERKREKGRDR---------DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR 96
             +    E ++    D+         D  ++++ EK +++E+E+ +++ ++ E+ K++ +
Sbjct: 567 PTSNYLNEPQKIVNNDKVSENSSNNEDSQKNKEKEKEKEKEKEKEKEKEKEKEKEKEKEK 626

Query: 95  DGEKSKDRERDRDGEKERD---------RDRDHHHRDRHR 3
           D +K K++++++D  KERD         R +D   RDR +
Sbjct: 627 DKDKEKEKDKEKDKVKERDNKEKELENNRPKDDRDRDREK 666

[164][TOP]
>UniRef100_B2ACQ5 Predicted CDS Pa_3_1750 (Fragment) n=1 Tax=Podospora anserina
            RepID=B2ACQ5_PODAN
          Length = 2347

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 41/130 (31%), Positives = 82/130 (63%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            EE     + E   E      ++    A++ +     + +   RD +RE  +  E++R+  
Sbjct: 1130 EEAAAAAEAEAAAERARAEAAAEAEAASSKKSKKGDRKSKSKRDKEREREEEEERERDRE 1189

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            RERER+RE+ R+R+R ++++ +K +D++R++ RD+ +D +R KDR +D +K K++ER+R+
Sbjct: 1190 REREREREREREREREKEKEKDKKKDKDRDKDRDKDKDKDRDKDRKKDKKKGKEKERERE 1249

Query: 56   GEKERDRDRD 27
             E+E++R+R+
Sbjct: 1250 REREKERERE 1259

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 34/93 (36%), Positives = 68/93 (73%)
 Frame = -2

Query: 290  RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
            R+ + E  + R+++RE  RERER+RE+ R++++ +D+  +K RD++R++ +D+ RD +R 
Sbjct: 1176 REREEEEERERDREREREREREREREREREKEKEKDKKKDKDRDKDRDKDKDKDRDKDRK 1235

Query: 110  KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
            KD+ +  EK ++RER+R+ E+ER+++++    D
Sbjct: 1236 KDKKKGKEKEREREREREKEREREKEKEKEEED 1268

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 33/95 (34%), Positives = 67/95 (70%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D++    +     RD +RE  + RE++RE  RE+E++++K +D+DR +DRD +K +DR++
Sbjct: 1173 DKEREREEEEERERDREREREREREREREREREKEKEKDKKKDKDRDKDRDKDKDKDRDK 1232

Query: 149  ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
            +R +D+ +  E+ ++R R+ EK ++RE++++ E+E
Sbjct: 1233 DRKKDKKKGKEKEREREREREKEREREKEKEKEEE 1267

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 34/102 (33%), Positives = 71/102 (69%)
 Frame = -2

Query: 323  DLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER 144
            D    +     R+ DRE  + RE++RE  RERER++EK +D+ + +DRD ++ +D++++R
Sbjct: 1173 DKEREREEEEERERDRERERERERERE--REREREKEKEKDKKKDKDRDKDRDKDKDKDR 1230

Query: 143  SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHH 18
             +DR +D ++ K++ R+ E+ +++ER+R+ EKE++ + + ++
Sbjct: 1231 DKDRKKDKKKGKEKEREREREREKEREREKEKEKEEEDEANY 1272

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 46/143 (32%), Positives = 82/143 (57%), Gaps = 1/143 (0%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK- 252
            E E   ER  E+ E E ++    +++    AA +E    +++   +     E++   E  
Sbjct: 1097 EAEEAAEREREEEERERQEAEAAEAAAAAAAAEEEAAAAAEAEAAAERARAEAAAEAEAA 1156

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
              +  ++ +RK +  RD++R R+ + E+ RDRERER R+R    ER ++R R+ EK KD+
Sbjct: 1157 SSKKSKKGDRKSKSKRDKEREREEEEERERDRERERERER----EREREREREKEKEKDK 1212

Query: 71   ERDRDGEKERDRDRDHHHRDRHR 3
            ++D+D +K+RD+D+D   RD+ R
Sbjct: 1213 KKDKDRDKDRDKDKD-KDRDKDR 1234

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 33/128 (25%), Positives = 70/128 (54%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            E E    +   +G+    +    +     +E+    +     R+ +RE  + REK++E  
Sbjct: 1152 EAEAASSKKSKKGDRKSKSKRDKEREREEEEERERDREREREREREREREREREKEKEKD 1211

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            +++++ R+K RD+D+ +DRD ++ +D+++ + ++R R+ ER K+R R+ EK K+ E + +
Sbjct: 1212 KKKDKDRDKDRDKDKDKDRDKDRKKDKKKGKEKEREREREREKEREREKEKEKEEEDEAN 1271

Query: 56   GEKERDRD 33
                 D D
Sbjct: 1272 YLTAEDED 1279

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 29/93 (31%), Positives = 51/93 (54%), Gaps = 1/93 (1%)
 Frame = -2

Query: 428  EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E E EEER R  + E E E     +   +     D+     +     +D D++  K R+K
Sbjct: 1177 EREEEEERERDREREREREREREREREREKEKEKDKKKDKDRDKDRDKDKDKDRDKDRKK 1236

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRE 153
            D++ G+E+ER+RE+ R+++R R+++ EK  + E
Sbjct: 1237 DKKKGKEKEREREREREKEREREKEKEKEEEDE 1269

[165][TOP]
>UniRef100_UPI0000E494E8 PREDICTED: similar to CTD-binding SR-like protein rA9 n=1
            Tax=Strongylocentrotus purpuratus RepID=UPI0000E494E8
          Length = 2000

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 56/151 (37%), Positives = 86/151 (56%), Gaps = 6/151 (3%)
 Frame = -2

Query: 437  TMGEYEFEEERRYEQPEGEGE--DNYHNDSSPQPPAAADEDLT---DSKSNHVSRDNDRE 273
            T  + + +++ + E+ + +G   +N   D + +     ++D       K     R+ DRE
Sbjct: 1242 TRSQKDEKDKSKKEKTKSKGHVHENSARDKNGREREEGEKDKKYRDKEKGKEKDREKDRE 1301

Query: 272  SSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD 93
            S      D+E  R R+++RE+ R+RDRSR     +SRDR+R RSRDR    ERS+DRGR 
Sbjct: 1302 SRDKHGHDKEKDRSRQKERERSRERDRSRKDREHRSRDRDRHRSRDR----ERSRDRGR- 1356

Query: 92   GEKSKDRERDRDGEKERDRDRDH-HHRDRHR 3
             E+S+DR   + GE+ER R RD+ H R +HR
Sbjct: 1357 -EQSRDRHHKKSGERERSRSRDNDHSRSKHR 1386

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 51/144 (35%), Positives = 73/144 (50%), Gaps = 11/144 (7%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDS-SPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            E + E+  E  +  G D   + S   +   + + D +     H SRD DR  S+ RE+ R
Sbjct: 1293 EKDREKDRESRDKHGHDKEKDRSRQKERERSRERDRSRKDREHRSRDRDRHRSRDRERSR 1352

Query: 245  ENGRER----------ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR 96
            + GRE+          ER+R + RD D SR +   +SRDRER R R+R  + ER   R R
Sbjct: 1353 DRGREQSRDRHHKKSGERERSRSRDNDHSRSKHRSRSRDRERSRKRERSSESERVTSRDR 1412

Query: 95   DGEKSKDRERDRDGEKERDRDRDH 24
              ++S+DR RDR  EK     +DH
Sbjct: 1413 RRDRSRDRGRDRSREKVVRTSKDH 1436

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 50/142 (35%), Positives = 69/142 (48%), Gaps = 2/142 (1%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADE--DLTDSKSNHVSRDNDRESSKSREKD 249
            E E++++Y   E   E +   D   +     D+  D +  K    SR+ DR       + 
Sbjct: 1278 EGEKDKKYRDKEKGKEKDREKDRESRDKHGHDKEKDRSRQKERERSRERDRSRKDREHRS 1337

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            R+  R R R RE+ RDR R + RD    +  ERERSR R  D  RSK R R  ++ + R+
Sbjct: 1338 RDRDRHRSRDRERSRDRGREQSRDRHHKKSGERERSRSRDNDHSRSKHRSRSRDRERSRK 1397

Query: 68   RDRDGEKERDRDRDHHHRDRHR 3
            R+R  E ER   RD   RDR R
Sbjct: 1398 RERSSESERVTSRD-RRRDRSR 1418

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 41/123 (33%), Positives = 60/123 (48%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            + ER  ++   +  D +H  S               +    SRDND   SK R + R+  
Sbjct: 1347 DRERSRDRGREQSRDRHHKKSG-------------ERERSRSRDNDHSRSKHRSRSRDRE 1393

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            R R+R+R    +R  SRDR  ++SRDR R+RSR++V          +D +K K+RER RD
Sbjct: 1394 RSRKRERSSESERVTSRDRRRDRSRDRGRDRSREKV------VRTSKDHDKPKERERTRD 1447

Query: 56   GEK 48
              K
Sbjct: 1448 SVK 1450

[166][TOP]
>UniRef100_UPI00006A142D UPI00006A142D related cluster n=1 Tax=Xenopus (Silurana) tropicalis
            RepID=UPI00006A142D
          Length = 1030

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 57/141 (40%), Positives = 79/141 (56%), Gaps = 1/141 (0%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E + ER  E+ + E E     +S  +     + +    K      D +RE  K RE++
Sbjct: 726  ERERDREREREREQREREREKERESERERVREREREREREK------DREREREKERERE 779

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD-GEKSKDR 72
            RE  RERER+RE+ R+R+R RDRD E+ R+RERER +DR R  ER +DR RD  EK K R
Sbjct: 780  REE-RERERERERERERERERDRDREREREREREREKDRERGRERERDRPRDWEEKEKTR 838

Query: 71   ERDRDGEKERDRDRDHHHRDR 9
            E  RD  ++   ++   H DR
Sbjct: 839  EDRRDKREDVREEKRETHEDR 859

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 46/138 (33%), Positives = 86/138 (62%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            E E R E+   +  D   ++ + +     + +  + +     R+ +RES + R ++RE  
Sbjct: 703  EREERREERRVDRTDERRDERARERERDRERE-REREQREREREKERESERERVRERERE 761

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            RERE+ RE+ R+++R R+R+ E+ R+RERER R+R R+ +R ++R R+ E+ ++++R+R 
Sbjct: 762  REREKDREREREKERERERE-ERERERERERERERERERDRDREREREREREREKDRERG 820

Query: 56   GEKERDRDRDHHHRDRHR 3
             E+ERDR RD   +++ R
Sbjct: 821  RERERDRPRDWEEKEKTR 838

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 50/145 (34%), Positives = 86/145 (59%), Gaps = 2/145 (1%)
 Frame = -2

Query: 431  GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            G+ +  +  R ++P         +D + +     +  +  +      R  +RE  + RE+
Sbjct: 676  GDRDRRDRDRDQRPTSPVRHQGRSDDTEREERREERRVDRTDERRDERARERERDRERER 735

Query: 251  DRE-NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD-GERSKDRGRDGEKSK 78
            +RE   RERE++RE  R+R R R+R+ E+ +DRERER ++R R+  ER ++R R+ E+ +
Sbjct: 736  EREQREREREKERESERERVREREREREREKDREREREKEREREREERERERERERERER 795

Query: 77   DRERDRDGEKERDRDRDHHHRDRHR 3
            +RERDRD E+ER+R+R+   +DR R
Sbjct: 796  ERERDRDRERERERERE-REKDRER 819

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 52/138 (37%), Positives = 84/138 (60%), Gaps = 2/138 (1%)
 Frame = -2

Query: 410  ERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRE 231
            +RR+   +    D     +SP       +D T+ +     R  DR   +  E+ RE  R+
Sbjct: 672  DRRHGDRDRRDRDRDQRPTSPVRHQGRSDD-TEREERREERRVDRTDERRDERARERERD 730

Query: 230  RERKREKG-RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK-SKDRERDRD 57
            RER+RE+  R+R+R ++R+SE+ R RERER R+R +D ER +++ R+ E+  ++RER+R+
Sbjct: 731  REREREREQREREREKERESERERVREREREREREKDREREREKEREREREERERERERE 790

Query: 56   GEKERDRDRDHHHRDRHR 3
             E+ER+R+RD   RDR R
Sbjct: 791  RERERERERD---RDRER 805

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/139 (33%), Positives = 76/139 (54%), Gaps = 1/139 (0%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
            E  EERR ++ +   ++        +      E     +      + +R   + RE++RE
Sbjct: 706  ERREERRVDRTDERRDERARERERDREREREREQREREREKERESERERVRERERERERE 765

Query: 242  NGRERERKREKGRDR-DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
              RERER++E+ R+R +R R+R+ E+ R+RERER RDR R+ ER ++R +D E+ ++RER
Sbjct: 766  KDREREREKEREREREERERERERERERERERERDRDREREREREREREKDRERGRERER 825

Query: 65   DRDGEKERDRDRDHHHRDR 9
            DR  + E         RD+
Sbjct: 826  DRPRDWEEKEKTREDRRDK 844

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 47/138 (34%), Positives = 77/138 (55%), Gaps = 3/138 (2%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            +ERR E+      D        Q     +++    +     R+ +RE  K RE++RE  R
Sbjct: 717  DERRDERARERERDREREREREQREREREKERESERERVREREREREREKDREREREKER 776

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR---ERD 63
            ERER+ E+ R+R+R R+R+ E+ RDR+RER R+R R+ E+ ++RGR+ E+ + R   E++
Sbjct: 777  ERERE-ERERERERERERERERERDRDREREREREREREKDRERGRERERDRPRDWEEKE 835

Query: 62   RDGEKERDRDRDHHHRDR 9
            +  E  RD+  D     R
Sbjct: 836  KTREDRRDKREDVREEKR 853

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 55/149 (36%), Positives = 83/149 (55%), Gaps = 10/149 (6%)
 Frame = -2

Query: 419  FEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTD-SKSNHVSRDNDRESSKSREKDR- 246
            + E  RY+  +   + ++      +     D D    S   H  R +D E  + RE+ R 
Sbjct: 654  YTERDRYDSRDQGRDSSFDRRHGDRDRRDRDRDQRPTSPVRHQGRSDDTEREERREERRV 713

Query: 245  --------ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG 90
                    E  RERER RE+ R+R++ R+R+ EK R+ ERER R+R R+ ER KDR R  
Sbjct: 714  DRTDERRDERARERERDREREREREQ-REREREKERESERERVREREREREREKDRER-- 770

Query: 89   EKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            E+ K+RER+R+ E+ER+R+R+   R+R R
Sbjct: 771  EREKERERERE-ERERERERE-RERERER 797

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 41/146 (28%), Positives = 69/146 (47%), Gaps = 5/146 (3%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E+ER  E+      +        +      E   + +     R+ +RE  + RE+D
Sbjct: 741  EREREKERESERERVREREREREREKDREREREKEREREREERERERERERERERERERD 800

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRE-----RERSRDRVRDGERSKDRGRDGEK 84
            R+  RERER+RE+ +DR+R R+R+ ++ RD E     RE  RD+  D    K    +  K
Sbjct: 801  RDREREREREREREKDRERGRERERDRPRDWEEKEKTREDRRDKREDVREEKRETHEDRK 860

Query: 83   SKDRERDRDGEKERDRDRDHHHRDRH 6
             K  +   +G+  ++  +D   R R+
Sbjct: 861  PKSEKGKIEGQINQNLHKDQRKRHRN 886

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 11/128 (8%)
 Frame = -2

Query: 353 SPQPPAAADEDLTDSKS-NHVSRDNDRESSKSR----EKDRENGRERER-----KREKGR 204
           +P PP  A      S++ NH S  N  ++ +SR    E+DR + R++ R     +R   R
Sbjct: 619 APDPPEKAGRAARSSQADNHSSSSNYHDNWESRSSYTERDRYDSRDQGRDSSFDRRHGDR 678

Query: 203 DRDRSRDRDSEKSRD-RERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           DR R RDRD   +   R + RS D  R+ ER ++R  D    +  ER R+ E++R+R+R+
Sbjct: 679 DR-RDRDRDQRPTSPVRHQGRSDDTERE-ERREERRVDRTDERRDERARERERDRERERE 736

Query: 26  HHHRDRHR 3
              R+R R
Sbjct: 737 REQRERER 744

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 37/101 (36%), Positives = 49/101 (48%), Gaps = 1/101 (0%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESSKSRE-KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSR 138
           D + +   RD+DRE S SR+ +D    RE   +RE   +RDR   RDS  SR+    R  
Sbjct: 478 DRERDERDRDHDREPSGSRDHRDDRESREGRDRREVRDNRDRREPRDSRDSRETRDSR-- 535

Query: 137 DRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHR 15
              RD + S+D+       KD    RD  + RDRD    HR
Sbjct: 536 -EYRDVKESRDQ-------KDSRSTRDAHEYRDRDNRESHR 568

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 40/124 (32%), Positives = 57/124 (45%), Gaps = 5/124 (4%)
 Frame = -2

Query: 365 HNDSSPQP--PAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR 192
           H   SP      A ++   D +    S+D   E    RE+D    R+R+  RE    RD 
Sbjct: 442 HRKRSPSKHRSPAREKGRHDRERTSASQDRRHERRDDRERDE---RDRDHDREPSGSRDH 498

Query: 191 SRDRDSEKSRDRERER-SRDR--VRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHH 21
             DR+S + RDR   R +RDR   RD   S++  RD  + +D +  RD +  R     H 
Sbjct: 499 RDDRESREGRDRREVRDNRDRREPRDSRDSRET-RDSREYRDVKESRDQKDSRSTRDAHE 557

Query: 20  HRDR 9
           +RDR
Sbjct: 558 YRDR 561

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 43/119 (36%), Positives = 55/119 (46%), Gaps = 17/119 (14%)
 Frame = -2

Query: 311 SKSNHVSRDNDRESSKSREK---DRE-----NGRERERKREKGRD-RDRSRDRDSEKSR- 162
           S S H  R   +  S +REK   DRE       R  ER+ ++ RD RDR  DR+   SR 
Sbjct: 438 SSSPHRKRSPSKHRSPAREKGRHDRERTSASQDRRHERRDDRERDERDRDHDREPSGSRD 497

Query: 161 ---DRERERSRDR--VRDG--ERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
              DRE    RDR  VRD    R     RD  +++D    RD ++ RD+      RD H
Sbjct: 498 HRDDRESREGRDRREVRDNRDRREPRDSRDSRETRDSREYRDVKESRDQKDSRSTRDAH 556

[167][TOP]
>UniRef100_B9MXR1 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MXR1_POPTR
          Length = 541

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 50/106 (47%), Positives = 66/106 (62%), Gaps = 7/106 (6%)
 Frame = -2

Query: 299 HVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG 120
           H SRD +RESSK REK+R     R+  R++ RDRDR RDRD ++ + R R+R RDR +D 
Sbjct: 6   HGSRDYERESSKGREKERS----RDSDRDRDRDRDRKRDRDKDREKSRGRDRERDRDKDS 61

Query: 119 ERSKDRGRDGEKSKDRERDRDGEK-------ERDRDRDHHHRDRHR 3
           +R +DR RD  + +DR RDRD +        +R RD D    DRHR
Sbjct: 62  DRHRDRHRDCSERRDRGRDRDDDDYYRSRDYDRRRDYDRDSEDRHR 107

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = -2

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           +   R+ ER+  KGR+++RSRD D ++ RDR+R+R RD+ R+  R +DR RD +K  DR 
Sbjct: 5   QHGSRDYERESSKGREKERSRDSDRDRDRDRDRKRDRDKDREKSRGRDRERDRDKDSDRH 64

Query: 68  RD--RDGEKERDRDRDHHHRDRHR 3
           RD  RD  + RDR RD    D +R
Sbjct: 65  RDRHRDCSERRDRGRDRDDDDYYR 88

[168][TOP]
>UniRef100_A0ECF9 Chromosome undetermined scaffold_9, whole genome shotgun sequence n=1
            Tax=Paramecium tetraurelia RepID=A0ECF9_PARTE
          Length = 805

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 38/130 (29%), Positives = 83/130 (63%)
 Frame = -2

Query: 398  EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERK 219
            +Q + + +     D +P      +++    K     ++ DRE  K +E+++E  RE+E++
Sbjct: 624  KQKKNQQDKKRKEDEAPVKEKPKEKERGKQKEKEKQKEMDREREKDKEREKEREREKEKE 683

Query: 218  REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERD 39
            REK R++++ R+R+ E+ R++ERER ++R R+ ER K + R+ EK K+++ +++ E+ER+
Sbjct: 684  REKKREKEKEREREKEREREKEREREKEREREKEREKQKEREREKQKEKKLEKERERERE 743

Query: 38   RDRDHHHRDR 9
            R+++   +++
Sbjct: 744  REKEKKQKEK 753

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 38/136 (27%), Positives = 83/136 (61%)
 Frame = -2

Query: 437  TMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
            T  E + E +      +   +D+  +DSS        +D    +     ++  +E  + +
Sbjct: 593  TSAEEDSESDESDSSEDSSSDDSSDSDSSKDKQKKNQQDKKRKEDEAPVKEKPKEKERGK 652

Query: 257  EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            +K++E  +E +R+REK ++R++ R+R+ EK R+++RE+ ++R R+ ER +++ R+ EK +
Sbjct: 653  QKEKEKQKEMDREREKDKEREKEREREKEKEREKKREKEKEREREKEREREKEREREKER 712

Query: 77   DRERDRDGEKERDRDR 30
            +RE++R+ +KER+R++
Sbjct: 713  EREKEREKQKEREREK 728

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 40/134 (29%), Positives = 81/134 (60%), Gaps = 2/134 (1%)
 Frame = -2

Query: 398 EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVS--RDNDRESSKSREKDRENGRERE 225
           E+     E +   DSS    + +D      K N     R  D    K + K++E G+++E
Sbjct: 596 EEDSESDESDSSEDSSSDDSSDSDSSKDKQKKNQQDKKRKEDEAPVKEKPKEKERGKQKE 655

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
           ++++K  DR+R +D++ EK R+RE+E+ R++ R+ E+ ++R ++ E+ K+RER+++ E+E
Sbjct: 656 KEKQKEMDREREKDKEREKEREREKEKEREKKREKEKEREREKEREREKEREREKERERE 715

Query: 44  RDRDRDHHHRDRHR 3
           ++R++    R+R +
Sbjct: 716 KEREK-QKEREREK 728

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 38/130 (29%), Positives = 76/130 (58%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            ++++R E      E     +   Q      +++   +     R+ +RE  K +E++++  
Sbjct: 630  QDKKRKEDEAPVKEKPKEKERGKQKEKEKQKEMDREREKDKEREKEREREKEKEREKKRE 689

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            +E+ER+REK R+R++ R+R+ E+ R++ERE+ ++R    ER K + +  EK ++RER+R+
Sbjct: 690  KEKEREREKEREREKEREREKEREREKEREKQKER----EREKQKEKKLEKERERERERE 745

Query: 56   GEKERDRDRD 27
             EK++   RD
Sbjct: 746  KEKKQKEKRD 755

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 37/124 (29%), Positives = 70/124 (56%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            E+E   ++   E E     +   Q     + +    +     R+ ++E  K REK++E  
Sbjct: 636  EDEAPVKEKPKEKERGKQKEKEKQKEMDREREKDKEREKEREREKEKEREKKREKEKERE 695

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            RE+ER+REK R+R++ R+R+ E+ + +ERER + + +  E+ ++R R+ EK K ++  RD
Sbjct: 696  REKEREREKEREREKEREREKEREKQKEREREKQKEKKLEKEREREREREKEKKQKEKRD 755

Query: 56   GEKE 45
             +K+
Sbjct: 756  QKKK 759

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 40/148 (27%), Positives = 90/148 (60%), Gaps = 10/148 (6%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHV---SRDNDRESSKSREKDR 246
            EE R+  + + + E  +  ++  Q   +A+ED    +S+     S D+  +S  S++K +
Sbjct: 567  EELRQIYEQQNKIEFQHAQEALKQFGTSAEEDSESDESDSSEDSSSDDSSDSDSSKDKQK 626

Query: 245  ENGRERERK------REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
            +N ++++RK      +EK ++++R + ++ EK ++ +RER +D+ R+ ER  +R ++ E+
Sbjct: 627  KNQQDKKRKEDEAPVKEKPKEKERGKQKEKEKQKEMDREREKDKEREKER--EREKEKER 684

Query: 83   SKDRERDRDGEKERDRDRD-HHHRDRHR 3
             K RE++++ E+E++R+R+    R++ R
Sbjct: 685  EKKREKEKEREREKEREREKEREREKER 712

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 33/138 (23%), Positives = 72/138 (52%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            +E+ R +Q E E +     +         + +    K     R+ ++E  + +E++RE  
Sbjct: 646  KEKERGKQKEKEKQKEMDREREKDKEREKEREREKEKEREKKREKEKEREREKEREREKE 705

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
            RERE++RE+ ++R++ ++R+ EK ++++ E+ R+R R  ER K++ +  ++ + ++    
Sbjct: 706  REREKEREREKEREKQKEREREKQKEKKLEKERERER--EREKEKKQKEKRDQKKKYKSP 763

Query: 56   GEKERDRDRDHHHRDRHR 3
               + D   D   R R R
Sbjct: 764  SPSQSDSLSDSRSRSRSR 781

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 32/134 (23%), Positives = 68/134 (50%)
 Frame = -2

Query: 431  GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            G+ + +E+++    E E +     +   +     ++     K     ++ +RE  + REK
Sbjct: 651  GKQKEKEKQKEMDREREKDKEREKEREREKEKEREKKREKEKEREREKEREREKEREREK 710

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            +RE  RE+ER+++K R+R++ +++  EK R+RERER +++ +  E+   + +    S  +
Sbjct: 711  ERE--REKEREKQKEREREKQKEKKLEKEREREREREKEK-KQKEKRDQKKKYKSPSPSQ 767

Query: 71   ERDRDGEKERDRDR 30
                   + R R R
Sbjct: 768  SDSLSDSRSRSRSR 781

[169][TOP]
>UniRef100_C5PC59 Putative uncharacterized protein n=1 Tax=Coccidioides posadasii C735
            delta SOWgp RepID=C5PC59_COCP7
          Length = 1013

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 52/150 (34%), Positives = 80/150 (53%), Gaps = 16/150 (10%)
 Frame = -2

Query: 407  RRYEQPEGEGEDNYHNDSSPQPPAAADED--------LTDSKSNHVSRDNDRESSKSRE- 255
            RRY  P          + S      A ED          + +  H  R+ +RE  + R+ 
Sbjct: 749  RRYRSPTRRDAQEGSKERSSSKALLAGEDGESRRLARAKEKEDRHRRREKERERERERDR 808

Query: 254  ------KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD 93
                  KDRE  ++R+R++ + RDR+R R+RD+++ RDR+RER RDR RD  R +D+G+D
Sbjct: 809  DHHRRHKDREQEKDRDREKYRDRDRERERERDTDRDRDRDRERDRDRERD--RDRDKGKD 866

Query: 92   GEKSKDRERDRDGEKERDRDR-DHHHRDRH 6
             ++ +D++RDR   +ER   R D  H  RH
Sbjct: 867  KDRGRDKDRDRKRRRERSESRADSEHSRRH 896

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 47/100 (47%), Positives = 61/100 (61%)
 Frame = -2

Query: 302  NHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD 123
            +H  R  DRE  K R  DRE  R+R+R+RE+ RD DR RDRD E+ RDRER+R RD+ +D
Sbjct: 809  DHHRRHKDREQEKDR--DREKYRDRDRERERERDTDRDRDRDRERDRDRERDRDRDKGKD 866

Query: 122  GERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
                KDRGRD ++ + R R+R  E   D +    H  R R
Sbjct: 867  ----KDRGRDKDRDRKRRRER-SESRADSEHSRRHARRAR 901

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 45/117 (38%), Positives = 62/117 (52%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            E+E R+ + E E E     D         D +    +     RD DRE    RE++R+  
Sbjct: 788  EKEDRHRRREKERERERERDRDHHR-RHKDREQEKDRDREKYRDRDRE----RERERDTD 842

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
            R+R+R RE+ RDR+R RDRD  K +DR R++ RDR R  ERS+ R  D E S+   R
Sbjct: 843  RDRDRDRERDRDRERDRDRDKGKDKDRGRDKDRDRKRRRERSESRA-DSEHSRRHAR 898

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 41/132 (31%), Positives = 66/132 (50%), Gaps = 1/132 (0%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGE-DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E E    RR ++ E E E D  H+          D D    +  +  RD +RE  +  ++
Sbjct: 788  EKEDRHRRREKERERERERDRDHHRRHKDREQEKDRD----REKYRDRDRERERERDTDR 843

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            DR+  RER+R RE+ RDRD+ +D+D  + +DR+R+R R+R      S+   R   +++  
Sbjct: 844  DRDRDRERDRDRERDRDRDKGKDKDRGRDKDRDRKRRRERSESRADSEHSRRHARRARRD 903

Query: 71   ERDRDGEKERDR 36
            E D      RD+
Sbjct: 904  EADEPVNGSRDK 915

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 39/146 (26%), Positives = 66/146 (45%), Gaps = 10/146 (6%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            E+ER  E+         H D   +     ++     +     RD DR+  + RE+DR+  
Sbjct: 797  EKERERERERDRDHHRRHKDREQEKDRDREKYRDRDRERERERDTDRDRDRDRERDRDRE 856

Query: 236  RERERKR----EKGRDRDRSRDRDSEKSRDR-ERERSRDRVRDGERSK-----DRGRDGE 87
            R+R+R +    ++GRD+DR R R  E+S  R + E SR   R   R +     +  RD +
Sbjct: 857  RDRDRDKGKDKDRGRDKDRDRKRRRERSESRADSEHSRRHARRARRDEADEPVNGSRDKK 916

Query: 86   KSKDRERDRDGEKERDRDRDHHHRDR 9
             ++  + +    K    D+D H  +R
Sbjct: 917  LAERVQANGTSTKSATEDKDPHTLER 942

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 47/158 (29%), Positives = 67/158 (42%), Gaps = 23/158 (14%)
 Frame = -2

Query: 407  RRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSR-----DNDRESSKSREKDRE 243
            RR           Y + S  + P ++ +D    +  H  +     D+D E+S        
Sbjct: 662  RRSRAHRNRSRSRYRSYSRSRSPGSSHDDERSDRHRHGRKSRKDPDHDGEASVRSRSASA 721

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR--------GRDGE 87
            +   R   R + RDRDR R R  EK     R RS  R    E SK+R        G DGE
Sbjct: 722  DTTHRPSHRSR-RDRDRVR-RSDEKGSSSRRYRSPTRRDAQEGSKERSSSKALLAGEDGE 779

Query: 86   ----------KSKDRERDRDGEKERDRDRDHHHRDRHR 3
                      + + R R+++ E+ER+RDRDHH R + R
Sbjct: 780  SRRLARAKEKEDRHRRREKERERERERDRDHHRRHKDR 817

[170][TOP]
>UniRef100_A1DHX8 Putative uncharacterized protein n=1 Tax=Neosartorya fischeri NRRL
            181 RepID=A1DHX8_NEOFI
          Length = 1001

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 52/111 (46%), Positives = 66/111 (59%)
 Frame = -2

Query: 341  PAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSR 162
            P   +E  + S+S       DR S +  E+DRE  R+R+R   + RDRDR RDRD ++ R
Sbjct: 778  PRILEEPASRSESRASVSRKDRSSRREEERDRERDRDRDRDSRR-RDRDRDRDRDRDRDR 836

Query: 161  DRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
            DRERER RDR        DR R  E+ KDR+R RD ++ERDRDR    RDR
Sbjct: 837  DRERERDRDR--------DRDRYREREKDRDRHRDRDRERDRDRKRSRRDR 879

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 42/116 (36%), Positives = 73/116 (62%), Gaps = 1/116 (0%)
 Frame = -2

Query: 347  QPPAAADEDLTDSKSNHVSR-DNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSE 171
            +P + ++   + S+ +  SR + +R+  + R++DR++ R R+R R++ RDRDR RDR+ E
Sbjct: 783  EPASRSESRASVSRKDRSSRREEERDRERDRDRDRDS-RRRDRDRDRDRDRDRDRDRERE 841

Query: 170  KSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            + RDR+R+R R+R +D +R +D  RD E+ +DR+R R    +   D D+  R   R
Sbjct: 842  RDRDRDRDRYREREKDRDRHRD--RDRERDRDRKRSRRDRTQSPADSDYSSRHHSR 895

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 53/150 (35%), Positives = 70/150 (46%), Gaps = 4/150 (2%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEG-EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK 264
            PT+ +   +  RR + P     ED Y   S+ +    +     DSK +   RD +RE   
Sbjct: 688  PTVDKDADDRGRRRDAPRRPRREDKYDEHSTAEDDRRSRSPSVDSKRSSHRRDREREGRN 747

Query: 263  SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
            +R   R   R R R R + R+ D S D D    R  E   SR   R     KDR    E+
Sbjct: 748  ARRSHRPRRRSRSRSRSRSRNGD-SHDVD-RLPRILEEPASRSESRASVSRKDRSSRREE 805

Query: 83   SKDRERDRDGEKE---RDRDRDHHHRDRHR 3
             +DRERDRD +++   RDRDRD   RDR R
Sbjct: 806  ERDRERDRDRDRDSRRRDRDRD-RDRDRDR 834

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 48/149 (32%), Positives = 70/149 (46%), Gaps = 11/149 (7%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            EEER  E+      D+   D         D D    +     R+ DR+  + R ++RE  
Sbjct: 804  EEERDRERDRDRDRDSRRRDRD------RDRDRDRDRDRDRERERDRDRDRDRYREREKD 857

Query: 236  RERERKREKGRDRDRSRDR--------DSE-KSRDRERERSRDRVRDGERSKDRGRDGEK 84
            R+R R R++ RDRDR R R        DS+  SR   R   RDR   G+R KD  RD   
Sbjct: 858  RDRHRDRDRERDRDRKRSRRDRTQSPADSDYSSRHHSRRIKRDREDGGDRDKDSARDKAP 917

Query: 83   SKDRERDRDGEK-ERD-RDRDHHHRDRHR 3
            +K  E ++D    ER+ R+R+   +++ R
Sbjct: 918  AKTSEPEKDPHTLEREARNRERMLKEQQR 946

[171][TOP]
>UniRef100_UPI000186DCF0 hypothetical protein Phum_PHUM263920 n=1 Tax=Pediculus humanus
           corporis RepID=UPI000186DCF0
          Length = 1364

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 50/140 (35%), Positives = 83/140 (59%), Gaps = 2/140 (1%)
 Frame = -2

Query: 428 EYEFEEERR--YEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE 255
           +Y++  + R   ++P  E +    ++SS +P          S   H   D ++E    RE
Sbjct: 291 KYDYSSDSRAIIKEPVVEKKKFEESESSRKP----------SNQYHEPDDKNKEYDTERE 340

Query: 254 KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           ++RE+ +E +   ++ R+RDR RDR+ ++ R+ ER+  RDRVR+ ER +D  RD E+ +D
Sbjct: 341 REREHKQEDDYGSDRERERDRDRDRERDRDRNIERDWDRDRVRERERDRDSERDRERERD 400

Query: 74  RERDRDGEKERDRDRDHHHR 15
           R+RDRD +++RDRDRD   R
Sbjct: 401 RDRDRDRDRDRDRDRDRDDR 420

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 47/143 (32%), Positives = 71/143 (49%)
 Frame = -2

Query: 440 PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
           P + + +FEE     +P  +    YH           + +            +DRE  + 
Sbjct: 305 PVVEKKKFEESESSRKPSNQ----YHEPDDKNKEYDTEREREREHKQEDDYGSDRERERD 360

Query: 260 REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           R++DRE  R+R  +R+  RDR R R+RD +  RDRERER RDR RD +R +DR RD +  
Sbjct: 361 RDRDRERDRDRNIERDWDRDRVRERERDRDSERDRERERDRDRDRDRDRDRDRDRDRDDR 420

Query: 80  KDRERDRDGEKERDRDRDHHHRD 12
             R+R    ++ R  D D+ + D
Sbjct: 421 LYRDRRPPKKRRRPDDVDYEYDD 443

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 47/141 (33%), Positives = 71/141 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           EY+ E ER  E  +   ED+Y +D   +     D            R+ DR+ +  R+ D
Sbjct: 334 EYDTEREREREHKQ---EDDYGSDRERERDRDRD------------RERDRDRNIERDWD 378

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R+  RERER R+  RDR+R RDRD ++ RDR+R+R RDR     R +   +   +  D +
Sbjct: 379 RDRVRERERDRDSERDRERERDRDRDRDRDRDRDRDRDRDDRLYRDRRPPKKRRRPDDVD 438

Query: 68  RDRDGEKERDRDRDHHHRDRH 6
            + D  +E  R R   +R R+
Sbjct: 439 YEYDDYEEVRRYRPGRNRPRY 459

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 43/122 (35%), Positives = 62/122 (50%), Gaps = 3/122 (2%)
 Frame = -2

Query: 359 DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE---KDRENGRERERKREKGRDRDRS 189
           D S    A   E + + K    S  + + S++  E   K++E   ERER+RE  ++ D  
Sbjct: 293 DYSSDSRAIIKEPVVEKKKFEESESSRKPSNQYHEPDDKNKEYDTEREREREHKQEDDYG 352

Query: 188 RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
            DR+ E+ RDR+RER RDR                + +R+ DRD  +ER+RDRD   RDR
Sbjct: 353 SDRERERDRDRDRERDRDR----------------NIERDWDRDRVRERERDRD-SERDR 395

Query: 8   HR 3
            R
Sbjct: 396 ER 397

[172][TOP]
>UniRef100_UPI000179756D PREDICTED: splicing factor, arginine/serine-rich 12 n=1 Tax=Equus
           caballus RepID=UPI000179756D
          Length = 628

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 46/122 (37%), Positives = 75/122 (61%), Gaps = 9/122 (7%)
 Frame = -2

Query: 365 HNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR---------ENGRERERKRE 213
           H   S     +  +D   SKS H  R   RE  KSR + R         E  +E+ER +E
Sbjct: 333 HRSRSHNRSRSRQKDRRRSKSPHRKRSKSRERRKSRSRSRSRDKRKDTREKIKEKERVKE 392

Query: 212 KGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRD 33
           K R+++R ++RD EK R++E+ER +++ +D E+ KDR +D EK ++RER+++ EKERD++
Sbjct: 393 KDREKERDKERDREKEREKEKERGKNKDKDREKDKDRDKDKEKDREREREKEHEKERDKE 452

Query: 32  RD 27
           ++
Sbjct: 453 KE 454

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 40/118 (33%), Positives = 80/118 (67%), Gaps = 1/118 (0%)
 Frame = -2

Query: 353 SPQPPAAADEDLTDSKSNHVSRDNDRES-SKSREKDRENGRERERKREKGRDRDRSRDRD 177
           SP    +   +   S+S   SRD  +++  K +EK+R   ++RE++R+K RDR++ R+++
Sbjct: 353 SPHRKRSKSRERRKSRSRSRSRDKRKDTREKIKEKERVKEKDREKERDKERDREKEREKE 412

Query: 176 SEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            E+ ++++++R +D+ RD ++ KDR R+ EK  ++ERD++ EKE+D+++D   +DR +
Sbjct: 413 KERGKNKDKDREKDKDRDKDKEKDREREREKEHEKERDKEKEKEQDKEKD-REKDRSK 469

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 36/92 (39%), Positives = 64/92 (69%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           ++ DRE  + +E+DRE  RE+E++R K +D+DR +D+D +K ++++RER R++  + ER 
Sbjct: 391 KEKDREKERDKERDREKEREKEKERGKNKDKDREKDKDRDKDKEKDREREREKEHEKERD 450

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHR 15
           K++ ++ +K KDRE+DR  E +  R +D   R
Sbjct: 451 KEKEKEQDKEKDREKDRSKEIDEKRKKDKKSR 482

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/148 (33%), Positives = 82/148 (55%), Gaps = 22/148 (14%)
 Frame = -2

Query: 380 GEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRD 201
           G    H  S  +  + +      S+S H SR ++R  S+SR+KDR   +   RKR K R+
Sbjct: 306 GRSRSHTRSKSRSSSKSHSRRKRSQSKHRSRSHNR--SRSRQKDRRRSKSPHRKRSKSRE 363

Query: 200 R----DRSRDRD---------------SEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           R     RSR RD                EK R++ER++ RDR ++ E+ K+RG++ +K +
Sbjct: 364 RRKSRSRSRSRDKRKDTREKIKEKERVKEKDREKERDKERDREKEREKEKERGKNKDKDR 423

Query: 77  DRERDRDGEKERDRDRD---HHHRDRHR 3
           ++++DRD +KE+DR+R+    H ++R +
Sbjct: 424 EKDKDRDKDKEKDREREREKEHEKERDK 451

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 33/92 (35%), Positives = 67/92 (72%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           ++ +R   K REK+R+  R+RE++REK ++R +++D+D EK +DR++++ +DR R+ E+ 
Sbjct: 385 KEKERVKEKDREKERDKERDREKEREKEKERGKNKDKDREKDKDRDKDKEKDREREREKE 444

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHR 15
            ++ RD EK K++++++D EK+R ++ D   +
Sbjct: 445 HEKERDKEKEKEQDKEKDREKDRSKEIDEKRK 476

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/133 (30%), Positives = 75/133 (56%), Gaps = 2/133 (1%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           + +E+ R ++ + E E +   D         +++    K    ++D DRE  K R+KD+E
Sbjct: 383 KIKEKERVKEKDREKERDKERDR--------EKEREKEKERGKNKDKDREKDKDRDKDKE 434

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKD-RGRDGEKSKD-RE 69
             RERER++E  ++RD+ ++++ +K +DRE++RS++   D +R KD + R   +S +   
Sbjct: 435 KDREREREKEHEKERDKEKEKEQDKEKDREKDRSKE--IDEKRKKDKKSRTPPRSYNASR 492

Query: 68  RDRDGEKERDRDR 30
           R R   +ER R R
Sbjct: 493 RSRSSSRERRRRR 505

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 43/164 (26%), Positives = 71/164 (43%), Gaps = 22/164 (13%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E + E+ER  E+  G+ +D              D +    +     +D +RE  K  EK+
Sbjct: 402 ERDREKEREKEKERGKNKDK-------------DREKDKDRDKDKEKDREREREKEHEKE 448

Query: 248 RENGRERERKREKGRDRDRSRDRDSEK----------------------SRDRERERSRD 135
           R+  +E+E+ +EK R++DRS++ D ++                      SR+R R RSR 
Sbjct: 449 RDKEKEKEQDKEKDREKDRSKEIDEKRKKDKKSRTPPRSYNASRRSRSSSRERRRRRSRS 508

Query: 134 RVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             R    SK   R   +S         +K+R+++RDH    R R
Sbjct: 509 SSRSPRTSKTMKRKSSRSPSPRSRNKKDKKREKERDHISERRER 552

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 37/134 (27%), Positives = 60/134 (44%), Gaps = 11/134 (8%)
 Frame = -2

Query: 371 NYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR 192
           N+ N++  +PP    +         + R  + +S  S   + E+G+  ERK  + R   R
Sbjct: 254 NHSNNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPESGKSNERKGGRSRSHTR 313

Query: 191 SRDRDSEKS-----------RDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
           S+ R S KS           R R   RSR R +D  RSK   R   KS++R + R   + 
Sbjct: 314 SKSRSSSKSHSRRKRSQSKHRSRSHNRSRSRQKDRRRSKSPHRKRSKSRERRKSRSRSRS 373

Query: 44  RDRDRDHHHRDRHR 3
           RD+ +D   + + +
Sbjct: 374 RDKRKDTREKIKEK 387

[173][TOP]
>UniRef100_UPI0001A2C723 hypothetical protein LOC553240 n=1 Tax=Danio rerio
           RepID=UPI0001A2C723
          Length = 434

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 51/142 (35%), Positives = 82/142 (57%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E  +E+  E+ EG+  D  H ++  +      E   D +     RD  R+    R+++
Sbjct: 226 EQEQLKEKEREREEGKKTDRRHAETQQRERDREGEREGDKERE---RDRGRQRDGERQRE 282

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R+ GR+R+ +R++ R+RD  R RD E+ R+R+  R RD  RD ER +D GR  +  +DRE
Sbjct: 283 RDGGRQRDGERDRERERDGGRQRDGERQRERDGGRQRDGERDRERERDGGRQRDGDRDRE 342

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
           ++RDG ++RD +RD   R+R R
Sbjct: 343 QERDGGRQRDVERD---RERER 361

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 57/155 (36%), Positives = 80/155 (51%), Gaps = 15/155 (9%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E ++  R  + E EG+     D   Q       +    +     RD +RE    R++D E
Sbjct: 249 ETQQRERDREGEREGDKERERDRGRQRDGERQRERDGGRQRDGERDRERERDGGRQRDGE 308

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRD----RERERSRDRVRDGERSKDRGRDG----- 90
             RER+  R++  +RDR R+RD  + RD    RE+ER   R RD ER ++R RDG     
Sbjct: 309 RQRERDGGRQRDGERDRERERDGGRQRDGDRDREQERDGGRQRDVERDRERERDGGRQRD 368

Query: 89  -EKSKDRERD----RDGEKERDRDRD-HHHRDRHR 3
            EK K+RERD    RDGE++R+R+RD    RD  R
Sbjct: 369 VEKVKERERDGGRQRDGERDRERERDGGRQRDEER 403

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/140 (37%), Positives = 73/140 (52%), Gaps = 9/140 (6%)
 Frame = -2

Query: 395 QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKR 216
           Q +GE +     D   Q       +    +     RD +RE    R++D +  RE+ER  
Sbjct: 288 QRDGERDRERERDGGRQRDGERQRERDGGRQRDGERDRERERDGGRQRDGDRDREQERDG 347

Query: 215 EKGRD--RDRSRDRDSEKSRD----RERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
            + RD  RDR R+RD  + RD    +ERER   R RDGER ++R RDG + +D ER R  
Sbjct: 348 GRQRDVERDRERERDGGRQRDVEKVKERERDGGRQRDGERDRERERDGGRQRDEERVRQR 407

Query: 53  EKERDRDRDH---HHRDRHR 3
           E++RDR+RD     HRD  R
Sbjct: 408 ERDRDRERDRGNGKHRDHSR 427

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 57/139 (41%), Positives = 79/139 (56%), Gaps = 20/139 (14%)
 Frame = -2

Query: 383 EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS----------REKDRENGR 234
           E ED  +   S + PAA   D  D +     ++ +RE  K           RE+DRE  R
Sbjct: 202 EKEDVAYEKYSVKGPAANRRDRADEQEQLKEKEREREEGKKTDRRHAETQQRERDREGER 261

Query: 233 E--RERKREKGRDRD--RSRDRDSEKSRDRERERSRDR----VRDGERSKDR--GRDGEK 84
           E  +ER+R++GR RD  R R+RD  + RD ER+R R+R     RDGER ++R  GR  + 
Sbjct: 262 EGDKERERDRGRQRDGERQRERDGGRQRDGERDRERERDGGRQRDGERQRERDGGRQRDG 321

Query: 83  SKDRERDRDGEKERDRDRD 27
            +DRER+RDG ++RD DRD
Sbjct: 322 ERDRERERDGGRQRDGDRD 340

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/141 (34%), Positives = 70/141 (49%), Gaps = 7/141 (4%)
 Frame = -2

Query: 416 EEERRYEQPEG---EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
           E +R  E+  G   +GE     D   Q     D +           D DRE  +   + R
Sbjct: 292 ERDRERERDGGRQRDGERQRERDGGRQRDGERDRERERDGGRQRDGDRDREQERDGGRQR 351

Query: 245 ENGRERERKREKGRDRD----RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           +  R+RER+R+ GR RD    + R+RD  + RD ER+R R+R    +R ++R R  E+ +
Sbjct: 352 DVERDRERERDGGRQRDVEKVKERERDGGRQRDGERDRERERDGGRQRDEERVRQRERDR 411

Query: 77  DRERDRDGEKERDRDRDHHHR 15
           DRERDR   K RD  R+  HR
Sbjct: 412 DRERDRGNGKHRDHSREREHR 432

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 54/158 (34%), Positives = 85/158 (53%), Gaps = 18/158 (11%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSK-------SNHVSRDNDRESSK 264
           E ++  + E+ EG  E +    SSP       ED+   K       +N   R +++E  K
Sbjct: 175 EKKKALKEEKREGRSESSA---SSPIRVKKEKEDVAYEKYSVKGPAANRRDRADEQEQLK 231

Query: 263 SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR--GRDG 90
            +E++RE G++ +R+  + + R+R  DR+ E+  D+ERER R R RDGER ++R  GR  
Sbjct: 232 EKEREREEGKKTDRRHAETQQRER--DREGEREGDKERERDRGRQRDGERQRERDGGRQR 289

Query: 89  EKSKDRERDRDGEKERDRDRDHH---------HRDRHR 3
           +  +DRER+RDG ++RD +R             RDR R
Sbjct: 290 DGERDRERERDGGRQRDGERQRERDGGRQRDGERDRER 327

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 41/117 (35%), Positives = 62/117 (52%), Gaps = 4/117 (3%)
 Frame = -2

Query: 395 QPEGEGEDNYHNDSSPQPPAAAD--EDLTDSKSNHVSRDNDRESSKSREKDRENGRERER 222
           Q +GE +     D   Q     D  ++    +   V RD +RE    R++D E  +ERER
Sbjct: 318 QRDGERDRERERDGGRQRDGDRDREQERDGGRQRDVERDRERERDGGRQRDVEKVKERER 377

Query: 221 K--REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
              R++  +RDR R+RD  + RD ER R R+R RD ER +  G+  + S++RE  R+
Sbjct: 378 DGGRQRDGERDRERERDGGRQRDEERVRQRERDRDRERDRGNGKHRDHSREREHRRN 434

[174][TOP]
>UniRef100_A4U212 Putative uncharacterized protein n=1 Tax=Magnetospirillum
           gryphiswaldense RepID=A4U212_9PROT
          Length = 176

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 51/143 (35%), Positives = 80/143 (55%), Gaps = 9/143 (6%)
 Frame = -2

Query: 431 GEYEFEEER---------RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDND 279
           GE E E ER         R  + E E E     DS P+   A + +        + R+ +
Sbjct: 33  GEREIESERDRELAREIERERESEREREIERERDSEPESERARERE------REIERERE 86

Query: 278 RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
           RE    RE++RE+  E  R+RE+ R+R+   +R+ E  R+RERE  R+R R+ ER ++R 
Sbjct: 87  RERVSERERERESELESARERERERERESDEEREEESERERERESERERERESERCRERE 146

Query: 98  RDGEKSKDRERDRDGEKERDRDR 30
           R+ E+ ++RER+R+ E+ER R+R
Sbjct: 147 RERERERERERERETERERARER 169

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 48/138 (34%), Positives = 78/138 (56%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +E  R    EGE E     D         + +    +     RD++ ES ++RE++RE  
Sbjct: 23  QERDRQRCREGEREIESERDRELAREIERERESEREREIERERDSEPESERAREREREIE 82

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           RERER+R   R+R+R  + +S + R+RERER  D  R+ E  ++R R+ E+ ++RE +R 
Sbjct: 83  RERERERVSERERERESELESARERERERERESDEEREEESERERERESERERERESERC 142

Query: 56  GEKERDRDRDHHHRDRHR 3
            E+ER+R+R+   R+R R
Sbjct: 143 RERERERERE-RERERER 159

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 45/143 (31%), Positives = 76/143 (53%), Gaps = 6/143 (4%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +  R+ Q   E +     +   +  +  D +L          + +RE  + R+ + E+ R
Sbjct: 14  DRERWRQSRQERDRQRCREGEREIESERDRELAREIERERESEREREIERERDSEPESER 73

Query: 233 ERERKREKGRDR------DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            RER+RE  R+R      +R R+R+SE    RERER R+R  D ER ++  R+ E+  +R
Sbjct: 74  AREREREIERERERERVSERERERESELESARERERERERESDEEREEESERERERESER 133

Query: 71  ERDRDGEKERDRDRDHHHRDRHR 3
           ER+R+ E+ R+R+R+   R+R R
Sbjct: 134 ERERESERCRERERE-RERERER 155

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 36/88 (40%), Positives = 55/88 (62%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           RD DRE  +   ++R+  R RE +RE   +RDR   R+ E+ R+ ERER  +R RD E  
Sbjct: 11  RDGDRERWRQSRQERDRQRCREGEREIESERDRELAREIERERESEREREIERERDSEPE 70

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRD 27
            +R R+ E+  +RER+R+   ER+R+R+
Sbjct: 71  SERAREREREIERERERERVSERERERE 98

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 39/91 (42%), Positives = 55/91 (60%), Gaps = 5/91 (5%)
 Frame = -2

Query: 260 REKDRENGRERERKREKGRDRDRSRD--RDSEKSRDRE--RERSRDRVRDGERSKDRGRD 93
           RE +R+  RER R+  + RDR R R+  R+ E  RDRE  RE  R+R  + ER  +R RD
Sbjct: 7   REXERDGDRERWRQSRQERDRQRCREGEREIESERDRELAREIERERESEREREIERERD 66

Query: 92  GEKSKDRERDRDGEKERDRDRDH-HHRDRHR 3
            E   +R R+R+ E ER+R+R+    R+R R
Sbjct: 67  SEPESERAREREREIERERERERVSERERER 97

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 32/104 (30%), Positives = 55/104 (52%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E  R  + E E E     +   +     + +L  ++     R+ + +  +  E +RE  R
Sbjct: 70  ESERAREREREIERERERERVSERERERESELESARERERERERESDEEREEESERERER 129

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR 102
           E ER+RE+  +R R R+R+ E+ R+RERER  +R R  ER+++R
Sbjct: 130 ESERERERESERCRERERERERERERERERETERERARERARER 173

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/103 (35%), Positives = 58/103 (56%), Gaps = 1/103 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQ-PEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E+  E E E     +S+ +     + +  + +     R+ +RES + RE+
Sbjct: 78  EREIERERERERVSERERERESELESARERERERERESDEEREEESERERERESERERER 137

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD 123
           + E  RERER+RE    R+R R+R+ E  R+R RER+R+RV +
Sbjct: 138 ESERCRERERERE----RERERERERETERERARERARERVSE 176

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 33/101 (32%), Positives = 52/101 (51%), Gaps = 1/101 (0%)
 Frame = -2

Query: 416 EEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN 240
           E ER  E+  E E       +   +  +A + +    + +   R+ + E  + RE +RE 
Sbjct: 76  EREREIERERERERVSERERERESELESARERERERERESDEEREEESERERERESERER 135

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE 117
            RE ER RE+ R+R+R R+R+ E+  +RER R R R R  E
Sbjct: 136 ERESERCRERERERERERERERERETERERARERARERVSE 176

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 31/78 (39%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = -2

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
           E E +RE  RD DR R R S + RDR+R R  +R  + ER ++  R+ E+ ++ ER+R+ 
Sbjct: 2   ELEIQREXERDGDRERWRQSRQERDRQRCREGEREIESERDRELAREIERERESEREREI 61

Query: 53  EKERDRDRDHHH-RDRHR 3
           E+ERD + +    R+R R
Sbjct: 62  ERERDSEPESERARERER 79

[175][TOP]
>UniRef100_Q9BHM3 Cyclophilin-RNA interacting protein n=1 Tax=Paramecium tetraurelia
           RepID=Q9BHM3_PARTE
          Length = 695

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 40/130 (30%), Positives = 85/130 (65%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +++++ ++ E   E     D   Q      ++L   K     R+ ++E  + +EK+RE  
Sbjct: 452 KDQQKRKEKEKLKEQEKQQDLEKQKEIQKQKEL--EKQQEKEREKEKEREREKEKERERE 509

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           +ERE++REK R+R+R ++++ E+ RDRERE+ ++R+R+ E+ +++ R+ E+ K+R+R R+
Sbjct: 510 KEREKEREKEREREREKEKERERKRDREREKEKERLREKEKQREKDREREREKERKRKRE 569

Query: 56  GEKERDRDRD 27
            EKE++++++
Sbjct: 570 KEKEKEKEKE 579

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 42/109 (38%), Positives = 72/109 (66%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           +++    K     ++ +RE  K REK+RE  RERER++EK R+R R R+R+ EK R RE+
Sbjct: 489 EKEREKEKEREREKEKEREREKEREKEREKEREREREKEKERERKRDREREKEKERLREK 548

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           E+ R++ R+ ER K+R R  EK K++E++++ EKE+++ +    + + R
Sbjct: 549 EKQREKDREREREKERKRKREKEKEKEKEKEKEKEKEKGKQEEQKLKER 597

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 40/140 (28%), Positives = 84/140 (60%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           + +E+ + +  E + E     +   Q     +++    +     R+ ++E  K REK+RE
Sbjct: 462 KLKEQEKQQDLEKQKEIQKQKELEKQQEKEREKEKEREREKEKEREREKEREKEREKERE 521

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             RERE+++E+ R RDR R+++ E+ R++E++R +DR R+ E+ + R R+ EK K++E++
Sbjct: 522 --REREKEKERERKRDREREKEKERLREKEKQREKDREREREKERKRKREKEKEKEKEKE 579

Query: 62  RDGEKERDRDRDHHHRDRHR 3
           ++ EKE+ +  +   ++R +
Sbjct: 580 KEKEKEKGKQEEQKLKERQQ 599

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 42/123 (34%), Positives = 78/123 (63%)
 Frame = -2

Query: 371 NYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR 192
           +Y  D   Q      E L   K     +D +++    ++K+ E  +E+ER++EK R+R++
Sbjct: 446 SYDRDDKDQQKRKEKEKL---KEQEKQQDLEKQKEIQKQKELEKQQEKEREKEKEREREK 502

Query: 191 SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
            ++R+ EK R++ERE+ R+R R+ E+ ++R RD E+ K++ER R+ EK+R++DR+   R+
Sbjct: 503 EKEREREKEREKEREKEREREREKEKERERKRDREREKEKERLREKEKQREKDRE-RERE 561

Query: 11  RHR 3
           + R
Sbjct: 562 KER 564

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 33/142 (23%), Positives = 86/142 (60%), Gaps = 4/142 (2%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE-KDREN 240
           ++E++ ++   E ++  H  SS     +  + L + K     ++ ++  S  R+ KD++ 
Sbjct: 397 KKEKKNKKKSAEKKNKRHRSSSQGESDSDSQSLKNKKQKDKHKNKNKHKSYDRDDKDQQK 456

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
            +E+E+ +E+ + +D  + ++ +K ++ E+++ ++R ++ ER +++ ++ E+ K+RE++R
Sbjct: 457 RKEKEKLKEQEKQQDLEKQKEIQKQKELEKQQEKEREKEKEREREKEKEREREKEREKER 516

Query: 59  DGEKERDRDRD---HHHRDRHR 3
           + E+ER+R+++      RDR R
Sbjct: 517 EKEREREREKEKERERKRDRER 538

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 35/142 (24%), Positives = 83/142 (58%), Gaps = 5/142 (3%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E+++ ++ E E E     +   +     +++    +     ++ +RE  + RE+++E  R
Sbjct: 485 EKQQEKEREKEKEREREKEKEREREKEREKEREKEREREREKEKERERKRDREREKEKER 544

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGE-KSKDRERDRD 57
            RE++++  R++DR R+R+ E+ R RE+E+ +++ ++ E+ K++G+  E K K+R++ +D
Sbjct: 545 LREKEKQ--REKDREREREKERKRKREKEKEKEKEKEKEKEKEKGKQEEQKLKERQQSKD 602

Query: 56  GEK----ERDRDRDHHHRDRHR 3
           G K    E ++D + + +D  +
Sbjct: 603 GGKNKQSESNQDNEGNQKDNSK 624

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 36/129 (27%), Positives = 72/129 (55%), Gaps = 3/129 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+E+  E+ E E E     +   +     + +    K     RD +RE  K R ++
Sbjct: 489 EKEREKEKERER-EKEKEREREKEREKEREKEREREREKEKERERKRDREREKEKERLRE 547

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE---RSKDRGRDGEKSK 78
           +E  RE++R+RE+ ++R R R+++ EK +++E+E+ +++ +  E   + + + +DG K+K
Sbjct: 548 KEKQREKDREREREKERKRKREKEKEKEKEKEKEKEKEKGKQEEQKLKERQQSKDGGKNK 607

Query: 77  DRERDRDGE 51
             E ++D E
Sbjct: 608 QSESNQDNE 616

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 35/130 (26%), Positives = 72/130 (55%), Gaps = 2/130 (1%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+E+  E+ E E E     +   +     + +    +     ++  RE  K REKD
Sbjct: 497 EREREKEKERER-EKEREKEREKEREREREKEKERERKRDREREKEKERLREKEKQREKD 555

Query: 248 RENGRERERK--REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           RE  RE+ERK  REK +++++ ++++ EK + ++ E+   ++++ ++SKD G++  K  +
Sbjct: 556 REREREKERKRKREKEKEKEKEKEKEKEKEKGKQEEQ---KLKERQQSKDGGKN--KQSE 610

Query: 74  RERDRDGEKE 45
             +D +G ++
Sbjct: 611 SNQDNEGNQK 620

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 25/142 (17%), Positives = 81/142 (57%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           + + + +++ +Q     ++    +   +  +A  ++     S+    D+D +S K++++ 
Sbjct: 376 QMQLDSQQKIQQQTQLKQEKQKKEKKNKKKSAEKKNKRHRSSSQGESDSDSQSLKNKKQK 435

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            ++  + + K     D+D+ + ++ EK +++E+++  ++ ++ ++ K+  +  EK +++E
Sbjct: 436 DKHKNKNKHKSYDRDDKDQQKRKEKEKLKEQEKQQDLEKQKEIQKQKELEKQQEKEREKE 495

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
           ++R+ EKE++R+R+   R++ R
Sbjct: 496 KEREREKEKERERE-KEREKER 516

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 29/138 (21%), Positives = 71/138 (51%), Gaps = 4/138 (2%)
 Frame = -2

Query: 428 EYEFEEERRYE-QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E + E E E     +   +     D +    K     ++  RE  + RE+
Sbjct: 501 EKEKEREREKEREKEREKEREREREKEKERERKRDREREKEKERLREKEKQREKDRERER 560

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRD---RERERSRDRVRDGERSKDRGRDGEKS 81
           ++E  R+RE+++EK +++++ ++++  K  +   +ER++S+D  ++ +   ++  +G + 
Sbjct: 561 EKERKRKREKEKEKEKEKEKEKEKEKGKQEEQKLKERQQSKDGGKNKQSESNQDNEGNQK 620

Query: 80  KDRERDRDGEKERDRDRD 27
            + +  ++ EK+    ++
Sbjct: 621 DNSKLKQEQEKQNQTQQN 638

[176][TOP]
>UniRef100_Q5CL39 Putative uncharacterized protein n=1 Tax=Cryptosporidium hominis
           RepID=Q5CL39_CRYHO
          Length = 570

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 57/151 (37%), Positives = 83/151 (54%), Gaps = 8/151 (5%)
 Frame = -2

Query: 431 GEYEFEEE--RRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDS------KSNHVSRDNDR 276
           G YE+E+   RR    EG  + ++ ++   +       D          +++   R  D 
Sbjct: 17  GNYEWEDNDRRRVADNEGRRDRDFDSERGRRREHYGGRDRKRDFRRRSVENSRGGRHRDD 76

Query: 275 ESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR 96
           E+    + D +N  + ER+REK RDRDR RDR+ ++ RDRER+R RDR R  ER  DR R
Sbjct: 77  ENMDKGKNDDQNNFQWEREREKERDRDRERDRERDRERDRERDRERDRERGRER--DRER 134

Query: 95  DGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           D E+ +DRERDRD  KER +DR +  + R +
Sbjct: 135 DRERDRDRERDRDRCKERIKDRGYMEKKRSK 165

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 42/107 (39%), Positives = 68/107 (63%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           DE++   K++     N+ +  + REK+R+  RER+R+R++ RDR+R R+RD E+ R+R+R
Sbjct: 76  DENMDKGKNDD---QNNFQWEREREKERDRDRERDRERDRERDRERDRERDRERGRERDR 132

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           ER R+R RD ER +DR       K+R +DR G  E+ R + +  + R
Sbjct: 133 ERDRERDRDRERDRDR------CKERIKDR-GYMEKKRSKGYRSKRR 172

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 35/99 (35%), Positives = 61/99 (61%), Gaps = 3/99 (3%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG--- 120
           RD DRE  + R+++R+  R+RER RE+GR+RDR RDR+ ++ R+R+R+R ++R++D    
Sbjct: 100 RDRDRERDRERDRERDRERDRERDRERGRERDRERDRERDRDRERDRDRCKERIKDRGYM 159

Query: 119 ERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           E+ + +G   ++        D +    R R+   R+R R
Sbjct: 160 EKKRSKGYRSKRRSSSVSSDDSDLPPRRYREFRSRNRRR 198

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 43/169 (25%), Positives = 68/169 (40%), Gaps = 28/169 (16%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           G +  +E     + + +    +  +   +     + D    +     RD +R+  + RE+
Sbjct: 71  GRHRDDENMDKGKNDDQNNFQWEREREKERDRDRERDRERDRERDRERDRERDRERGRER 130

Query: 251 DRENGRERERKREKGRDRDRSRDRD---SEKSRDRE------------------------ 153
           DRE  RER+R RE+ RDR + R +D    EK R +                         
Sbjct: 131 DRERDRERDRDRERDRDRCKERIKDRGYMEKKRSKGYRSKRRSSSVSSDDSDLPPRRYRE 190

Query: 152 -RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
            R R+R R R    S+        S+   RDR+ E+ R RDRD + R R
Sbjct: 191 FRSRNRRRRRSVSSSRSSSEVSSSSEYERRDRNYERGRGRDRDRYKRSR 239

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 40/114 (35%), Positives = 60/114 (52%), Gaps = 7/114 (6%)
 Frame = -2

Query: 323 DLTDSKSNHVSRDNDRESSKSRE--KDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D    + N+   DNDR      E  +DR+   ER R+RE    RDR RD      R R  
Sbjct: 11  DTDRHRGNYEWEDNDRRRVADNEGRRDRDFDSERGRRREHYGGRDRKRD-----FRRRSV 65

Query: 149 ERSRDRVRDGERSKDRGRDGEKS-----KDRERDRDGEKERDRDRDHHHRDRHR 3
           E SR      + + D+G++ +++     ++RE++RD ++ERDR+RD   RDR R
Sbjct: 66  ENSRGGRHRDDENMDKGKNDDQNNFQWEREREKERDRDRERDRERD-RERDRER 118

[177][TOP]
>UniRef100_B9PLR5 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1
           RepID=B9PLR5_TOXGO
          Length = 845

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 39/95 (41%), Positives = 72/95 (75%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           +   + R+  RE  ++RE+ RE  RE+ER+RE+ ++R+R R+++ E+ R+RE+ER R+R 
Sbjct: 270 RETELDRERVRERGRARERGREREREQEREREREQEREREREQEREREREREQERERERE 329

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH 24
           ++ ER +D+ R+ E+ ++RERD++ E+E++RD+DH
Sbjct: 330 QERERERDQEREREQERERERDQEREREQERDQDH 364

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 42/96 (43%), Positives = 70/96 (72%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R   RE+   RE+ RE GR RER RE+ R+++R R+R+ E+ R+RE+ER R+R R+ ER 
Sbjct: 266 RRRRRETELDRERVRERGRARERGREREREQEREREREQEREREREQEREREREREQERE 325

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ++R ++ E+ +D+ER+R+ E+ER+RD++   R++ R
Sbjct: 326 REREQERERERDQEREREQERERERDQE-REREQER 360

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/98 (42%), Positives = 69/98 (70%)
 Frame = -2

Query: 296 VSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE 117
           VS    R   +  E DRE  RER R RE+GR+R+R ++R+ E+ ++RERER ++R R+ E
Sbjct: 260 VSARRRRRRRRETELDRERVRERGRARERGREREREQEREREREQEREREREQERERERE 319

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R ++R R+ E+ ++RERD++ E+E++R+R+   RD+ R
Sbjct: 320 REQEREREREQERERERDQEREREQERERE---RDQER 354

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 42/92 (45%), Positives = 66/92 (71%), Gaps = 4/92 (4%)
 Frame = -2

Query: 281 DRESSKSREKDRENGRERERKREKGRDR----DRSRDRDSEKSRDRERERSRDRVRDGER 114
           DRE  + R + RE GRERER  E+ R+R    +R R+R+ E+ R+RERE+ R+R R+ ER
Sbjct: 275 DRERVRERGRARERGRERER--EQEREREREQEREREREQEREREREREQEREREREQER 332

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHH 18
            ++R ++ E+ ++RER+RD E+ER+++RD  H
Sbjct: 333 ERERDQEREREQERERERDQEREREQERDQDH 364

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 38/107 (35%), Positives = 68/107 (63%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D +    +     R  +RE  + RE++RE  RERER++E+ R+R+R ++R+ E+ ++RER
Sbjct: 275 DRERVRERGRARERGREREREQEREREREQEREREREQEREREREREQEREREREQERER 334

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           ER ++R R+ ER ++R ++ E+ ++R++D  G    DRD     R+R
Sbjct: 335 ERDQEREREQERERERDQEREREQERDQDHSG-SGIDRDEPRVARER 380

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/96 (38%), Positives = 64/96 (66%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ ++E  + RE++RE  RERE++RE+ R+++R R+RD E+ R++ERER RD+ R+ E+ 
Sbjct: 300 REREQEREREREQEREREREREQEREREREQERERERDQEREREQERERERDQEREREQE 359

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +D+   G    DR+  R   +ER  +R+ + R+  R
Sbjct: 360 RDQDHSG-SGIDRDEPRVA-RERGDNRERNGRETER 393

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 15/122 (12%)
 Frame = -2

Query: 428 EYEFEEERRYEQP-------EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRES 270
           E E + ER  E+        E E E     +   +     +++    +     R+ +RE 
Sbjct: 271 ETELDRERVRERGRARERGREREREQEREREREQEREREREQEREREREREQEREREREQ 330

Query: 269 SKSREKDRENGRERERKREKGRDRDRSRDRDSEKSR---DRE-----RERSRDRVRDGER 114
            + RE+D+E  RE+ER+RE+ ++R+R ++RD + S    DR+     RER  +R R+G  
Sbjct: 331 ERERERDQEREREQERERERDQEREREQERDQDHSGSGIDRDEPRVARERGDNRERNGRE 390

Query: 113 SK 108
           ++
Sbjct: 391 TE 392

[178][TOP]
>UniRef100_B3MZS2 GF19228 n=1 Tax=Drosophila ananassae RepID=B3MZS2_DROAN
          Length = 1429

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 49/109 (44%), Positives = 69/109 (63%), Gaps = 2/109 (1%)
 Frame = -2

Query: 365 HNDSSPQPPAAADED--LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR 192
           HN   P PP   D    + + K     +D  R   + RE++RE  RERER+R++ R+RDR
Sbjct: 79  HNAPPPPPPPPYDHHHLVPEHKPPKERKDKTRVREREREREREKERERERERDRDRERDR 138

Query: 191 SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
            R+RD E+ RDRER+R R+R R+ ER +DR RD  + K+RER R+ E+E
Sbjct: 139 ERERDRERERDRERQRERERERERERERDRERDRLRDKERER-RERERE 186

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 41/82 (50%), Positives = 59/82 (71%), Gaps = 1/82 (1%)
 Frame = -2

Query: 245 ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
           E+   +ERK +K R R+R R+R+ EK R+RERER RDR RD ER +DR R+ ++ + RER
Sbjct: 98  EHKPPKERK-DKTRVREREREREREKERERERERDRDRERDRERERDRERERDRERQRER 156

Query: 65  DRDGEKERDRDRDHHH-RDRHR 3
           +R+ E+ER+RDR+    RD+ R
Sbjct: 157 ERERERERERDRERDRLRDKER 178

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/106 (38%), Positives = 65/106 (61%)
 Frame = -2

Query: 374 DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRD 195
           D++H     +PP    +D T  +     R+ ++E  + RE+DR+  R+RER+R++ R+RD
Sbjct: 91  DHHHLVPEHKPPKER-KDKTRVREREREREREKERERERERDRDRERDRERERDRERERD 149

Query: 194 RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           R R R+ E+ R+RERER R+R        DR RD E+ + RER+R+
Sbjct: 150 RERQRERERERERERERDRER--------DRLRDKERER-RERERE 186

[179][TOP]
>UniRef100_A9V3E1 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V3E1_MONBE
          Length = 407

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 40/84 (47%), Positives = 66/84 (78%)
 Frame = -2

Query: 266 KSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
           + RE++RE  RERER+RE+ R+R+R R+R+ E+ R+RERER R+R R+ ER ++R R+ E
Sbjct: 22  EERERERERERERERERERERERERERERERERERERERERERERERERERERERERERE 81

Query: 86  KSKDRERDRDGEKERDRDRDHHHR 15
           + ++RER+R+ E+ER+R+R+   +
Sbjct: 82  REREREREREREREREREREREQK 105

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 40/82 (48%), Positives = 65/82 (79%)
 Frame = -2

Query: 281 DRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR 102
           +RE  + RE++RE  RERER+RE+ R+R+R R+R+ E+ R+RERER R+R R+ ER ++R
Sbjct: 23  ERERERERERERERERERERERERERERERERERERERERERERERERERERERERERER 82

Query: 101 GRDGEKSKDRERDRDGEKERDR 36
            R+ E+ ++RER+R+ E+ER++
Sbjct: 83  EREREREREREREREREREREQ 104

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 40/82 (48%), Positives = 65/82 (79%)
 Frame = -2

Query: 275 ESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR 96
           E  + RE++RE  RERER+RE+ R+R+R R+R+ E+ R+RERER R+R R+ ER ++R R
Sbjct: 23  ERERERERERERERERERERERERERERERERERERERERERERERERERERERERERER 82

Query: 95  DGEKSKDRERDRDGEKERDRDR 30
           + E+ ++RER+R+ E+ER+R++
Sbjct: 83  EREREREREREREREREREREQ 104

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 39/83 (46%), Positives = 64/83 (77%)
 Frame = -2

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           E++RE  RERER+RE+ R+R+R R+R+ E+ R+RERER R+R R+ ER ++R R+ E+ +
Sbjct: 23  ERERERERERERERERERERERERERERERERERERERERERERERERERERERERERER 82

Query: 77  DRERDRDGEKERDRDRDHHHRDR 9
           +RER+R+ E+ER+R+R+     +
Sbjct: 83  EREREREREREREREREREREQK 105

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 39/82 (47%), Positives = 64/82 (78%)
 Frame = -2

Query: 287 DNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSK 108
           + +RE  + RE++RE  RERER+RE+ R+R+R R+R+ E+ R+RERER R+R R+ ER +
Sbjct: 23  ERERERERERERERERERERERERERERERERERERERERERERERERERERERERERER 82

Query: 107 DRGRDGEKSKDRERDRDGEKER 42
           +R R+ E+ ++RER+R+ E+E+
Sbjct: 83  EREREREREREREREREREREQ 104

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 39/82 (47%), Positives = 64/82 (78%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  + RE++RE  RERER+RE+ R+R+R R+R+ E+ R+RERER R+R R+ ER 
Sbjct: 24  RERERERERERERERERERERERERERERERERERERERERERERERERERERERERERE 83

Query: 110 KDRGRDGEKSKDRERDRDGEKE 45
           ++R R+ E+ ++RER+R+ E++
Sbjct: 84  REREREREREREREREREREQK 105

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 36/83 (43%), Positives = 60/83 (72%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD 135
           + +     R+ +RE  + RE++RE  RERER+RE+ R+R+R R+R+ E+ R+RERER R+
Sbjct: 22  EERERERERERERERERERERERERERERERERERERERERERERERERERERERERERE 81

Query: 134 RVRDGERSKDRGRDGEKSKDRER 66
           R R+ ER ++R R+ E+ ++RE+
Sbjct: 82  REREREREREREREREREREREQ 104

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 37/89 (41%), Positives = 59/89 (66%)
 Frame = -2

Query: 344 PPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKS 165
           PP    E+    +     R+ +RE  + RE++RE  RERER+RE+ R+R+R R+R+ E+ 
Sbjct: 16  PPYVCREERERERERERERERERERERERERERERERERERERERERERERERERERERE 75

Query: 164 RDRERERSRDRVRDGERSKDRGRDGEKSK 78
           R+RERER R+R R+ ER ++R R+ E+ +
Sbjct: 76  REREREREREREREREREREREREREREQ 104

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 33/73 (45%), Positives = 56/73 (76%)
 Frame = -2

Query: 221 KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKER 42
           + E+ R+R+R R+R+ E+ R+RERER R+R R+ ER ++R R+ E+ ++RER+R+ E+ER
Sbjct: 21  REERERERERERERERERERERERERERERERERERERERERERERERERERERERERER 80

Query: 41  DRDRDHHHRDRHR 3
           +R+R+   R+R R
Sbjct: 81  ERERE-RERERER 92

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 31/66 (46%), Positives = 49/66 (74%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  + RE++RE  RERER+RE+ R+R+R R+R+ E+ R+RERER R+R R+ + +
Sbjct: 48  REREREREREREREREREREREREREREREREREREREREREREREREREREREREQKIT 107

Query: 110 KDRGRD 93
              GR+
Sbjct: 108 TCIGRE 113

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 27/84 (32%), Positives = 48/84 (57%)
 Frame = -2

Query: 398 EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERK 219
           E+ E E E     +   +     + +    +     R+ +RE  + RE++RE  RERER+
Sbjct: 22  EERERERERERERERERERERERERERERERERERERERERERERERERERERERERERE 81

Query: 218 REKGRDRDRSRDRDSEKSRDRERE 147
           RE+ R+R+R R+R+ E+ R+RE++
Sbjct: 82  REREREREREREREREREREREQK 105

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 28/91 (30%), Positives = 49/91 (53%)
 Frame = -2

Query: 425 YEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
           Y   EER  E+   E E     +   +     + +    +     R+ +RE  + RE++R
Sbjct: 18  YVCREERERER---ERERERERERERERERERERERERERERERERERERERERERERER 74

Query: 245 ENGRERERKREKGRDRDRSRDRDSEKSRDRE 153
           E  RERER+RE+ R+R+R R+R+ E+ R+++
Sbjct: 75  EREREREREREREREREREREREREREREQK 105

[180][TOP]
>UniRef100_A0C963 Chromosome undetermined scaffold_16, whole genome shotgun sequence
           n=1 Tax=Paramecium tetraurelia RepID=A0C963_PARTE
          Length = 686

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 40/130 (30%), Positives = 85/130 (65%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +++++ ++ E   E     D   Q      ++L   K     R+ ++E  + +EK+RE  
Sbjct: 452 KDQQKRKEKEKLKEQEKQQDLEKQKEIQKQKEL--EKQQEKEREKEKEREREKEKERERE 509

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           +ERE++REK R+R+R ++++ E+ RDRERE+ ++R+R+ E+ +++ R+ E+ K+R+R R+
Sbjct: 510 KEREKEREKEREREREKEKERERKRDREREKEKERLREKEKQREKDREREREKERKRKRE 569

Query: 56  GEKERDRDRD 27
            EKE++++++
Sbjct: 570 KEKEKEKEKE 579

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 42/109 (38%), Positives = 72/109 (66%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           +++    K     ++ +RE  K REK+RE  RERER++EK R+R R R+R+ EK R RE+
Sbjct: 489 EKEREKEKEREREKEKEREREKEREKEREKEREREREKEKERERKRDREREKEKERLREK 548

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           E+ R++ R+ ER K+R R  EK K++E++++ EKE+++ +    + + R
Sbjct: 549 EKQREKDREREREKERKRKREKEKEKEKEKEKEKEKEKGKQEEQKLKER 597

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 40/140 (28%), Positives = 84/140 (60%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           + +E+ + +  E + E     +   Q     +++    +     R+ ++E  K REK+RE
Sbjct: 462 KLKEQEKQQDLEKQKEIQKQKELEKQQEKEREKEKEREREKEKEREREKEREKEREKERE 521

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             RERE+++E+ R RDR R+++ E+ R++E++R +DR R+ E+ + R R+ EK K++E++
Sbjct: 522 --REREKEKERERKRDREREKEKERLREKEKQREKDREREREKERKRKREKEKEKEKEKE 579

Query: 62  RDGEKERDRDRDHHHRDRHR 3
           ++ EKE+ +  +   ++R +
Sbjct: 580 KEKEKEKGKQEEQKLKERQQ 599

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 42/123 (34%), Positives = 78/123 (63%)
 Frame = -2

Query: 371 NYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR 192
           +Y  D   Q      E L   K     +D +++    ++K+ E  +E+ER++EK R+R++
Sbjct: 446 SYDRDDKDQQKRKEKEKL---KEQEKQQDLEKQKEIQKQKELEKQQEKEREKEKEREREK 502

Query: 191 SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRD 12
            ++R+ EK R++ERE+ R+R R+ E+ ++R RD E+ K++ER R+ EK+R++DR+   R+
Sbjct: 503 EKEREREKEREKEREKEREREREKEKERERKRDREREKEKERLREKEKQREKDRE-RERE 561

Query: 11  RHR 3
           + R
Sbjct: 562 KER 564

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 33/142 (23%), Positives = 86/142 (60%), Gaps = 4/142 (2%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE-KDREN 240
           ++E++ ++   E ++  H  SS     +  + L + K     ++ ++  S  R+ KD++ 
Sbjct: 397 KKEKKNKKKSAEKKNKRHRSSSQGESDSDSQSLKNKKQKDKHKNKNKHKSYDRDDKDQQK 456

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
            +E+E+ +E+ + +D  + ++ +K ++ E+++ ++R ++ ER +++ ++ E+ K+RE++R
Sbjct: 457 RKEKEKLKEQEKQQDLEKQKEIQKQKELEKQQEKEREKEKEREREKEKEREREKEREKER 516

Query: 59  DGEKERDRDRD---HHHRDRHR 3
           + E+ER+R+++      RDR R
Sbjct: 517 EKEREREREKEKERERKRDRER 538

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 35/142 (24%), Positives = 83/142 (58%), Gaps = 5/142 (3%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E+++ ++ E E E     +   +     +++    +     ++ +RE  + RE+++E  R
Sbjct: 485 EKQQEKEREKEKEREREKEKEREREKEREKEREKEREREREKEKERERKRDREREKEKER 544

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGE-KSKDRERDRD 57
            RE++++  R++DR R+R+ E+ R RE+E+ +++ ++ E+ K++G+  E K K+R++ +D
Sbjct: 545 LREKEKQ--REKDREREREKERKRKREKEKEKEKEKEKEKEKEKGKQEEQKLKERQQSKD 602

Query: 56  GEK----ERDRDRDHHHRDRHR 3
           G K    E ++D + + +D  +
Sbjct: 603 GGKNKQSESNQDNEGNQKDNSK 624

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 36/129 (27%), Positives = 72/129 (55%), Gaps = 3/129 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+E+  E+ E E E     +   +     + +    K     RD +RE  K R ++
Sbjct: 489 EKEREKEKERER-EKEKEREREKEREKEREKEREREREKEKERERKRDREREKEKERLRE 547

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE---RSKDRGRDGEKSK 78
           +E  RE++R+RE+ ++R R R+++ EK +++E+E+ +++ +  E   + + + +DG K+K
Sbjct: 548 KEKQREKDREREREKERKRKREKEKEKEKEKEKEKEKEKGKQEEQKLKERQQSKDGGKNK 607

Query: 77  DRERDRDGE 51
             E ++D E
Sbjct: 608 QSESNQDNE 616

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 35/130 (26%), Positives = 72/130 (55%), Gaps = 2/130 (1%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+E+  E+ E E E     +   +     + +    +     ++  RE  K REKD
Sbjct: 497 EREREKEKERER-EKEREKEREKEREREREKEKERERKRDREREKEKERLREKEKQREKD 555

Query: 248 RENGRERERK--REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           RE  RE+ERK  REK +++++ ++++ EK + ++ E+   ++++ ++SKD G++  K  +
Sbjct: 556 REREREKERKRKREKEKEKEKEKEKEKEKEKGKQEEQ---KLKERQQSKDGGKN--KQSE 610

Query: 74  RERDRDGEKE 45
             +D +G ++
Sbjct: 611 SNQDNEGNQK 620

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 25/142 (17%), Positives = 81/142 (57%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           + + + +++ +Q     ++    +   +  +A  ++     S+    D+D +S K++++ 
Sbjct: 376 QMQLDSQQKIQQQTQLKQEKQKKEKKNKKKSAEKKNKRHRSSSQGESDSDSQSLKNKKQK 435

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            ++  + + K     D+D+ + ++ EK +++E+++  ++ ++ ++ K+  +  EK +++E
Sbjct: 436 DKHKNKNKHKSYDRDDKDQQKRKEKEKLKEQEKQQDLEKQKEIQKQKELEKQQEKEREKE 495

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
           ++R+ EKE++R+R+   R++ R
Sbjct: 496 KEREREKEKERERE-KEREKER 516

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 29/138 (21%), Positives = 71/138 (51%), Gaps = 4/138 (2%)
 Frame = -2

Query: 428 EYEFEEERRYE-QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E ER  E + E E E     +   +     D +    K     ++  RE  + RE+
Sbjct: 501 EKEKEREREKEREKEREKEREREREKEKERERKRDREREKEKERLREKEKQREKDRERER 560

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRD---RERERSRDRVRDGERSKDRGRDGEKS 81
           ++E  R+RE+++EK +++++ ++++  K  +   +ER++S+D  ++ +   ++  +G + 
Sbjct: 561 EKERKRKREKEKEKEKEKEKEKEKEKGKQEEQKLKERQQSKDGGKNKQSESNQDNEGNQK 620

Query: 80  KDRERDRDGEKERDRDRD 27
            + +  ++ EK+    ++
Sbjct: 621 DNSKLKQEQEKQNQTQQN 638

[181][TOP]
>UniRef100_Q7SE76 Putative uncharacterized protein n=1 Tax=Neurospora crassa
           RepID=Q7SE76_NEUCR
          Length = 1007

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 47/115 (40%), Positives = 77/115 (66%), Gaps = 10/115 (8%)
 Frame = -2

Query: 341 PAAADEDLTDSKSNHVSRD-------NDRESSKSREKDRENGRERERKREKGRDR---DR 192
           P++ D+D+    ++ V  D       +D    K R++DR+  R+R+R+RE+ RDR   DR
Sbjct: 2   PSSKDQDVDFDNNSRVREDRLPHRSRSDLRRDKDRDRDRDRDRDRDRERERDRDRTITDR 61

Query: 191 SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           +R+R  E ++D++RER RDR RD +R +DR +D E+ +DR+RDR+ +K+RD DR+
Sbjct: 62  NRERKKE-NKDKDRERDRDRDRDRDRERDRDKDRERDRDRDRDRERDKDRDYDRE 115

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 48/116 (41%), Positives = 65/116 (56%), Gaps = 3/116 (2%)
 Frame = -2

Query: 374 DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN---GRERERKREKGR 204
           DN       + P  +  DL   K     RD DR+  + RE+DR+     R RERK+E  +
Sbjct: 12  DNNSRVREDRLPHRSRSDLRRDKDRDRDRDRDRDRDRERERDRDRTITDRNRERKKEN-K 70

Query: 203 DRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDR 36
           D+DR RDRD ++ RDRER+R +DR RD +R +DR RD ++  DRE     EK   R
Sbjct: 71  DKDRERDRDRDRDRDRERDRDKDRERDRDRDRDRERDKDRDYDREPSLLREKRSSR 126

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 34/109 (31%), Positives = 56/109 (51%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D  +TD        + D++  + R++DR+  RER+R +++ RDRDR RDR+ +K RD +R
Sbjct: 55  DRTITDRNRERKKENKDKDRERDRDRDRDRDRERDRDKDRERDRDRDRDRERDKDRDYDR 114

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           E S  R    E+   R     K+ D + +    ++    R H  +D  R
Sbjct: 115 EPSLLR----EKRSSRTPRLLKTTDSDTNSRSSRQSVSYRRHRPKDMDR 159

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 32/68 (47%), Positives = 40/68 (58%)
 Frame = -2

Query: 206 RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           +D+D   D +S    DR   RSR  +R   R KDR RD    +DR+RDRD E+ERDRDR 
Sbjct: 5   KDQDVDFDNNSRVREDRLPHRSRSDLR---RDKDRDRD----RDRDRDRDRERERDRDRT 57

Query: 26  HHHRDRHR 3
              R+R R
Sbjct: 58  ITDRNRER 65

[182][TOP]
>UniRef100_B2AYS9 Predicted CDS Pa_1_12110 n=1 Tax=Podospora anserina
            RepID=B2AYS9_PODAN
          Length = 864

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 63/163 (38%), Positives = 89/163 (54%), Gaps = 21/163 (12%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGE---GEDNYHNDSSPQPPAAADEDLT-DSKSNHVSRDNDRESSK- 264
            E E E +RR E+P+G    GE +Y +  S +  + + E  T ++   H   D +R   K 
Sbjct: 589  ENENERQRRRERPDGHRDRGERSYRSGRSARSRSRSPEHNTYEADRRHAMADRERNYRKT 648

Query: 263  -----------SREKDRENGRERERKREKGRDR----DRSRDRDSEKSRDRERERSRDRV 129
                       S +   ++ R+RER R++ RDR    DR RDRD    RDR+RER RDR 
Sbjct: 649  SAAEVLLSDRRSADGHHDSVRDRERDRDRDRDRISERDRERDRD----RDRDRERDRDRA 704

Query: 128  RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHH-HRDRHR 3
            RD    +DR RD ++ +DR+RD   +++RDRDRDH  HRD  R
Sbjct: 705  RD---YRDRDRDRDRERDRDRDHGRDRDRDRDRDHRDHRDYDR 744

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 54/146 (36%), Positives = 70/146 (47%), Gaps = 7/146 (4%)
 Frame = -2

Query: 419  FEEERRYEQPEGEGEDNYHNDS------SPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
            +E +RR+     + E NY   S      S +  A    D    +     RD DR S + R
Sbjct: 630  YEADRRHAM--ADRERNYRKTSAAEVLLSDRRSADGHHDSVRDRERDRDRDRDRISERDR 687

Query: 257  EKDRENGRERERKREKGRD-RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
            E+DR+  R+RER R++ RD RDR RDRD E+ RDR+  R RDR RD +      RD    
Sbjct: 688  ERDRDRDRDRERDRDRARDYRDRDRDRDRERDRDRDHGRDRDRDRDRDH-----RDHRDY 742

Query: 80   KDRERDRDGEKERDRDRDHHHRDRHR 3
              R R  D     DR+R     DR R
Sbjct: 743  DRRSRPADDFNHYDRERRTREEDRER 768

[183][TOP]
>UniRef100_UPI0000DA3D05 PREDICTED: similar to RIKEN cDNA 3110050K21 n=1 Tax=Rattus norvegicus
            RepID=UPI0000DA3D05
          Length = 1728

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/147 (36%), Positives = 82/147 (55%), Gaps = 14/147 (9%)
 Frame = -2

Query: 401  YEQPEGEGE--DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK-----SREKDRE 243
            +E+  GE +  DN   D  P  P          +S  + R+  RE  +      R  +R 
Sbjct: 679  FERRHGERDRRDNRERDQRPSSPIRHQ-----GRSEELEREERREERRIDRVDERRDERV 733

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK----- 78
              R+RER+RE+ R+RDR R+R+ EK R+RE ER R R R+ ER K+R R+ E+ +     
Sbjct: 734  RDRDRERERERERERDREREREREKERERELERERAREREREREKERERERERERDQRDR 793

Query: 77   --DRERDRDGEKERDRDRDHHHRDRHR 3
              DRER+R+ E+ER+++R+   R+R R
Sbjct: 794  DHDREREREREREREKEREREERERER 820

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 50/151 (33%), Positives = 87/151 (57%), Gaps = 11/151 (7%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            E  EERR ++ +   ++   + D   +     + D    +     R+ + E  ++RE++R
Sbjct: 715  ERREERRIDRVDERRDERVRDRDRERERERERERDREREREREKERERELERERARERER 774

Query: 245  ENGRERERKREKGRD---------RDRSRDRDSEKSRDRE-RERSRDRVRDGERSKDRGR 96
            E  +ERER+RE+ RD         R+R R+R+ EK R+RE RER R+R R+ ER ++R R
Sbjct: 775  EREKERERERERERDQRDRDHDREREREREREREKEREREERERERERERERERERERER 834

Query: 95   DGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            + E+ ++RER+R  E+E++R+R     D+ +
Sbjct: 835  ERERERERERERAREREKERERQREWEDKDK 865

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 55/143 (38%), Positives = 83/143 (58%), Gaps = 2/143 (1%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  ++ E E E     +   +   A + +    K     R+ +R+  + R+ D
Sbjct: 739  ERERERERERDR-EREREREKERERELERERAREREREREKERERERERERDQ-RDRDHD 796

Query: 248  RENGRERERKREKGRDRD-RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            RE  RERER+REK R+R+ R R+R+ E+ R+RERER R+R R+ ER ++R R+ EK ++R
Sbjct: 797  REREREREREREKEREREERERERERERERERERERERERERERERERERAREREKERER 856

Query: 71   ERD-RDGEKERDRDRDHHHRDRH 6
            +R+  D +K RD DR     D H
Sbjct: 857  QREWEDKDKGRD-DRREKREDVH 878

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 52/149 (34%), Positives = 79/149 (53%), Gaps = 7/149 (4%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  E+ E E E     +   +          D +     R+ +RE  + REK+
Sbjct: 761  ERELERERARER-EREREKERERERERE---------RDQRDRDHDREREREREREREKE 810

Query: 248  RENG-RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER-----SKDRGRDGE 87
            RE   RERER+RE+ R+R+R R+R+ E+ R+RERER+R+R ++ ER      KD+GRD  
Sbjct: 811  REREERERERERERERERERERERERERERERERERAREREKERERQREWEDKDKGRDDR 870

Query: 86   KSKDRE-RDRDGEKERDRDRDHHHRDRHR 3
            + K  +   R+    RD   +   + R+R
Sbjct: 871  REKREDVHVREDRIPRDGHEERKSKKRYR 899

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 52/169 (30%), Positives = 84/169 (49%), Gaps = 25/169 (14%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHND-----SSPQPPAAADEDLTDSK--SNHVSRDN 282
            P + E      R  +        NYH+      S P+     + D  D    S+   R  
Sbjct: 625  PELPEKGGRSTRGSQMDSHSSGSNYHDSWETRSSYPERDRYPERDTRDQARDSSFERRHG 684

Query: 281  DRESSKSREKD-------RENGRERERKREKGRDR---DRSRDRDSEKSRDRERERSRDR 132
            +R+   +RE+D       R  GR  E +RE+ R+    DR  +R  E+ RDR+RER R+R
Sbjct: 685  ERDRRDNRERDQRPSSPIRHQGRSEELEREERREERRIDRVDERRDERVRDRDRERERER 744

Query: 131  VRDGERSKDRGR--------DGEKSKDRERDRDGEKERDRDRDHHHRDR 9
             R+ +R ++R R        + E++++RER+R+ E+ER+R+R+   RDR
Sbjct: 745  ERERDREREREREKERERELERERAREREREREKERERERERERDQRDR 793

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 51/161 (31%), Positives = 73/161 (45%), Gaps = 36/161 (22%)
 Frame = -2

Query: 386  GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS--------------REKD 249
            GE +         +P  +   D  DS+S H SR +  ES +               +E+D
Sbjct: 1308 GERKSRIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGSFDSRDRLQERD 1366

Query: 248  R-ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK---- 84
            R E+ RERER+R   R R+  R+ D E  R R+R+R R+R RD ++ +D  R+ E+    
Sbjct: 1367 RYEHDRERERERRDPRQREWDREADKEWPRTRDRDRLRERERDRDKRRDLDRERERLVAD 1426

Query: 83   --SKDRERDRDG---------------EKERDRDRDHHHRD 12
               +DRERDR                 E E DRD +   RD
Sbjct: 1427 PMERDRERDRTFETSQLESVKRSEVKLESEHDRDLEGSSRD 1467

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 44/140 (31%), Positives = 68/140 (48%), Gaps = 5/140 (3%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAAD-EDLTDSKSNHVSRDNDRESSKSREK 252
            E E E ER  +Q + + +     +   +     + E+    +     R+ +RE  + RE+
Sbjct: 779  ERERERERERDQRDRDHDREREREREREREKEREREERERERERERERERERERERERER 838

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD-RVRDGERSKDRGRDGEKSKD 75
            +RE  RER R+REK R+R R  + D +K RD  RE+  D  VR+    +D G +  KSK 
Sbjct: 839  ERERERERAREREKERERQREWE-DKDKGRDDRREKREDVHVREDRIPRD-GHEERKSKK 896

Query: 74   RERDRDGEKERD---RDRDH 24
            R R+      R    R R+H
Sbjct: 897  RYRNEGSPSPRQSPKRRREH 916

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 41/118 (34%), Positives = 59/118 (50%), Gaps = 11/118 (9%)
 Frame = -2

Query: 323  DLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERE 147
            +LT  + + + +    E S+S   DR++ R    +R     DR       S  SRDR +E
Sbjct: 1305 ELTGERKSRIDQLKRGEPSRSTSSDRQDSRSHSSRRSSPESDRQVHSRSGSFDSRDRLQE 1364

Query: 146  RSR---DRVRDGERSKDRGRDGEKSKDRE----RDRDGEKERDRDRDHHH---RDRHR 3
            R R   DR R+ ER   R R+ ++  D+E    RDRD  +ER+RDRD      R+R R
Sbjct: 1365 RDRYEHDRERERERRDPRQREWDREADKEWPRTRDRDRLRERERDRDKRRDLDRERER 1422

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 6/125 (4%)
 Frame = -2

Query: 365 HNDSSPQ----PPAAADEDLTDSKSNH--VSRDNDRESSKSREKDRENGRERERKREKGR 204
           H  SSPQ    PP          + +H   S+ +DR   +  E   +  RE++ + E+  
Sbjct: 375 HCLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREEARGKRDREKDTREERES 434

Query: 203 DRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH 24
           + D   DR+   SRDR   R R  +RD    +D     + S+D +  RD    R     H
Sbjct: 435 EHDHRDDREPRDSRDRRDTRDRRELRDSRDMRDSREIRDYSRDTKESRDPRDSRSARDVH 494

Query: 23  HHRDR 9
            +RDR
Sbjct: 495 DYRDR 499

[184][TOP]
>UniRef100_UPI00006A12B7 UPI00006A12B7 related cluster n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI00006A12B7
          Length = 387

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 43/105 (40%), Positives = 66/105 (62%)
 Frame = -2

Query: 317 TDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSR 138
           ++ +     R+ DR++ + +E DRE  RER+R+R++ RDR R  DR+ +  RDR+RE  R
Sbjct: 284 SNGRQRETDRERDRQTEREKETDRETDRERDRERDRERDRQRETDRERQTERDRQRETQR 343

Query: 137 DRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +  R  ER ++R R  E+   RE D + ++ R+RDR H  RDRHR
Sbjct: 344 ETERHRERHRERERHRERQTQRETDTERDRHRERDR-HRERDRHR 387

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 43/114 (37%), Positives = 69/114 (60%), Gaps = 12/114 (10%)
 Frame = -2

Query: 308 KSNHVSRDND---RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSR-------- 162
           KS++  R N    ++SS  R+++ +  R+R+ +REK  DR+  R+RD E+ R        
Sbjct: 268 KSSNGRRKNSNGRQKSSNGRQRETDRERDRQTEREKETDRETDRERDRERDRERDRQRET 327

Query: 161 DRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD-HHHRDRHR 3
           DRER+  RDR R+ +R  +R R+  + ++R R+R  ++E D +RD H  RDRHR
Sbjct: 328 DRERQTERDRQRETQRETERHRERHRERERHRERQTQRETDTERDRHRERDRHR 381

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 41/106 (38%), Positives = 60/106 (56%), Gaps = 4/106 (3%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERK---REKGRDRDRSRDRDSEKSRDRERERSR 138
           KS +  R N     KS    R+N   R++    R++  DR+R R  + EK  DRE +R R
Sbjct: 254 KSRNGRRKNSHGRKKSSNGRRKNSNGRQKSSNGRQRETDRERDRQTEREKETDRETDRER 313

Query: 137 DRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD-HHHRDRHR 3
           DR RD ER + R  D E+  +R+R R+ ++E +R R+ H  R+RHR
Sbjct: 314 DRERDRERDRQRETDRERQTERDRQRETQRETERHRERHRERERHR 359

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 34/91 (37%), Positives = 53/91 (58%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           + D    +     R+ DRE  + R+++R+  RE +R+R+  RDR R   R++E+ R+R R
Sbjct: 294 ERDRQTEREKETDRETDRERDRERDRERDRQRETDRERQTERDRQRETQRETERHRERHR 353

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           ER R R R  +R  D  RD  + +DR R+RD
Sbjct: 354 ERERHRERQTQRETDTERDRHRERDRHRERD 384

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 36/110 (32%), Positives = 53/110 (48%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           G     +  R  Q E E E +   D         + D    +     R+ DRE    R++
Sbjct: 286 GRQRETDRERDRQTEREKETDRETDR--------ERDRERDRERDRQRETDRERQTERDR 337

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR 102
            RE  RE ER RE+ R+R+R R+R +++  D ER+R R+R R  ER + R
Sbjct: 338 QRETQRETERHRERHRERERHRERQTQRETDTERDRHRERDRHRERDRHR 387

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 33/104 (31%), Positives = 48/104 (46%)
 Frame = -2

Query: 377 EDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDR 198
           E +   D   +     D +    +     R+ DR+    RE+  E  R+RE +RE  R R
Sbjct: 290 ETDRERDRQTEREKETDRETDRERDRERDRERDRQRETDRERQTERDRQRETQRETERHR 349

Query: 197 DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
           +R R+      R+R RER   R  D ER + R RD  + +DR R
Sbjct: 350 ERHRE------RERHRERQTQRETDTERDRHRERDRHRERDRHR 387

[185][TOP]
>UniRef100_UPI0000DA3DB4 PREDICTED: similar to RIKEN cDNA 3110050K21 n=1 Tax=Rattus norvegicus
            RepID=UPI0000DA3DB4
          Length = 1727

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/147 (36%), Positives = 82/147 (55%), Gaps = 14/147 (9%)
 Frame = -2

Query: 401  YEQPEGEGE--DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK-----SREKDRE 243
            +E+  GE +  DN   D  P  P          +S  + R+  RE  +      R  +R 
Sbjct: 679  FERRHGERDRRDNRERDQRPSSPIRHQ-----GRSEELEREERREERRIDRVDERRDERV 733

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK----- 78
              R+RER+RE+ R+RDR R+R+ EK R+RE ER R R R+ ER K+R R+ E+ +     
Sbjct: 734  RDRDRERERERERERDREREREREKERERELERERAREREREREKERERERERERDQRDR 793

Query: 77   --DRERDRDGEKERDRDRDHHHRDRHR 3
              DRER+R+ E+ER+++R+   R+R R
Sbjct: 794  DHDREREREREREREKEREREERERER 820

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 50/151 (33%), Positives = 87/151 (57%), Gaps = 11/151 (7%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            E  EERR ++ +   ++   + D   +     + D    +     R+ + E  ++RE++R
Sbjct: 715  ERREERRIDRVDERRDERVRDRDRERERERERERDREREREREKERERELERERARERER 774

Query: 245  ENGRERERKREKGRD---------RDRSRDRDSEKSRDRE-RERSRDRVRDGERSKDRGR 96
            E  +ERER+RE+ RD         R+R R+R+ EK R+RE RER R+R R+ ER ++R R
Sbjct: 775  EREKERERERERERDQRDRDHDREREREREREREKEREREERERERERERERERERERER 834

Query: 95   DGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            + E+ ++RER+R  E+E++R+R     D+ +
Sbjct: 835  ERERERERERERAREREKERERQREWEDKDK 865

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 55/143 (38%), Positives = 83/143 (58%), Gaps = 2/143 (1%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  ++ E E E     +   +   A + +    K     R+ +R+  + R+ D
Sbjct: 739  ERERERERERDR-EREREREKERERELERERAREREREREKERERERERERDQ-RDRDHD 796

Query: 248  RENGRERERKREKGRDRD-RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            RE  RERER+REK R+R+ R R+R+ E+ R+RERER R+R R+ ER ++R R+ EK ++R
Sbjct: 797  REREREREREREKEREREERERERERERERERERERERERERERERERERAREREKERER 856

Query: 71   ERD-RDGEKERDRDRDHHHRDRH 6
            +R+  D +K RD DR     D H
Sbjct: 857  QREWEDKDKGRD-DRREKREDVH 878

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 52/149 (34%), Positives = 79/149 (53%), Gaps = 7/149 (4%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  E+ E E E     +   +          D +     R+ +RE  + REK+
Sbjct: 761  ERELERERARER-EREREKERERERERE---------RDQRDRDHDREREREREREREKE 810

Query: 248  RENG-RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER-----SKDRGRDGE 87
            RE   RERER+RE+ R+R+R R+R+ E+ R+RERER+R+R ++ ER      KD+GRD  
Sbjct: 811  REREERERERERERERERERERERERERERERERERAREREKERERQREWEDKDKGRDDR 870

Query: 86   KSKDRE-RDRDGEKERDRDRDHHHRDRHR 3
            + K  +   R+    RD   +   + R+R
Sbjct: 871  REKREDVHVREDRIPRDGHEERKSKKRYR 899

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 52/169 (30%), Positives = 84/169 (49%), Gaps = 25/169 (14%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHND-----SSPQPPAAADEDLTDSK--SNHVSRDN 282
            P + E      R  +        NYH+      S P+     + D  D    S+   R  
Sbjct: 625  PELPEKGGRSTRGSQMDSHSSGSNYHDSWETRSSYPERDRYPERDTRDQARDSSFERRHG 684

Query: 281  DRESSKSREKD-------RENGRERERKREKGRDR---DRSRDRDSEKSRDRERERSRDR 132
            +R+   +RE+D       R  GR  E +RE+ R+    DR  +R  E+ RDR+RER R+R
Sbjct: 685  ERDRRDNRERDQRPSSPIRHQGRSEELEREERREERRIDRVDERRDERVRDRDRERERER 744

Query: 131  VRDGERSKDRGR--------DGEKSKDRERDRDGEKERDRDRDHHHRDR 9
             R+ +R ++R R        + E++++RER+R+ E+ER+R+R+   RDR
Sbjct: 745  ERERDREREREREKERERELERERAREREREREKERERERERERDQRDR 793

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 51/161 (31%), Positives = 73/161 (45%), Gaps = 36/161 (22%)
 Frame = -2

Query: 386  GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS--------------REKD 249
            GE +         +P  +   D  DS+S H SR +  ES +               +E+D
Sbjct: 1308 GERKSRIDQLKRGEPSRSTSSDRQDSRS-HSSRRSSPESDRQVHSRSGSFDSRDRLQERD 1366

Query: 248  R-ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK---- 84
            R E+ RERER+R   R R+  R+ D E  R R+R+R R+R RD ++ +D  R+ E+    
Sbjct: 1367 RYEHDRERERERRDPRQREWDREADKEWPRTRDRDRLRERERDRDKRRDLDRERERLVAD 1426

Query: 83   --SKDRERDRDG---------------EKERDRDRDHHHRD 12
               +DRERDR                 E E DRD +   RD
Sbjct: 1427 PMERDRERDRTFETSQLESVKRSEVKLESEHDRDLEGSSRD 1467

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 44/140 (31%), Positives = 68/140 (48%), Gaps = 5/140 (3%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAAD-EDLTDSKSNHVSRDNDRESSKSREK 252
            E E E ER  +Q + + +     +   +     + E+    +     R+ +RE  + RE+
Sbjct: 779  ERERERERERDQRDRDHDREREREREREREKEREREERERERERERERERERERERERER 838

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD-RVRDGERSKDRGRDGEKSKD 75
            +RE  RER R+REK R+R R  + D +K RD  RE+  D  VR+    +D G +  KSK 
Sbjct: 839  ERERERERAREREKERERQREWE-DKDKGRDDRREKREDVHVREDRIPRD-GHEERKSKK 896

Query: 74   RERDRDGEKERD---RDRDH 24
            R R+      R    R R+H
Sbjct: 897  RYRNEGSPSPRQSPKRRREH 916

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 41/118 (34%), Positives = 59/118 (50%), Gaps = 11/118 (9%)
 Frame = -2

Query: 323  DLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR-DRDRSRDRDSEKSRDRERE 147
            +LT  + + + +    E S+S   DR++ R    +R     DR       S  SRDR +E
Sbjct: 1305 ELTGERKSRIDQLKRGEPSRSTSSDRQDSRSHSSRRSSPESDRQVHSRSGSFDSRDRLQE 1364

Query: 146  RSR---DRVRDGERSKDRGRDGEKSKDRE----RDRDGEKERDRDRDHHH---RDRHR 3
            R R   DR R+ ER   R R+ ++  D+E    RDRD  +ER+RDRD      R+R R
Sbjct: 1365 RDRYEHDRERERERRDPRQREWDREADKEWPRTRDRDRLRERERDRDKRRDLDRERER 1422

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 6/125 (4%)
 Frame = -2

Query: 365 HNDSSPQ----PPAAADEDLTDSKSNH--VSRDNDRESSKSREKDRENGRERERKREKGR 204
           H  SSPQ    PP          + +H   S+ +DR   +  E   +  RE++ + E+  
Sbjct: 375 HCLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREEARGKRDREKDTREERES 434

Query: 203 DRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH 24
           + D   DR+   SRDR   R R  +RD    +D     + S+D +  RD    R     H
Sbjct: 435 EHDHRDDREPRDSRDRRDTRDRRELRDSRDMRDSREIRDYSRDTKESRDPRDSRSARDVH 494

Query: 23  HHRDR 9
            +RDR
Sbjct: 495 DYRDR 499

[186][TOP]
>UniRef100_B4KT85 GI21186 n=1 Tax=Drosophila mojavensis RepID=B4KT85_DROMO
          Length = 1260

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 47/140 (33%), Positives = 83/140 (59%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E +E  + E+ E + +   + +      AA    + + ++       +++ S+ R++DR+
Sbjct: 116 EIDEGEQSEEKESKQKLKINKNDMSDVDAA----MLELEALEPGERKEQDRSRERDRDRD 171

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             RERER R++ R+ DR R+RD +  R+RER+R R+R ++  R + R R+ E+ +DR+RD
Sbjct: 172 RHRERERDRDRKRESDRHRERDKDNQRERERDRDRERDKEHRRRRSRSRE-ERDRDRDRD 230

Query: 62  RDGEKERDRDRDHHHRDRHR 3
           RD +++ DRDRD  H   HR
Sbjct: 231 RDRDRDHDRDRDRDHDRDHR 250

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 44/95 (46%), Positives = 62/95 (65%), Gaps = 5/95 (5%)
 Frame = -2

Query: 278 RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
           +E  +SRE+DR+  R RER+R++ R R+  R R+ +K   RERER RDR RD E  + R 
Sbjct: 158 KEQDRSRERDRDRDRHRERERDRDRKRESDRHRERDKDNQRERERDRDRERDKEHRRRRS 217

Query: 98  -----RDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
                RD ++ +DR+RDRD +++RDRD D  HR R
Sbjct: 218 RSREERDRDRDRDRDRDRDHDRDRDRDHDRDHRKR 252

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 42/118 (35%), Positives = 63/118 (53%), Gaps = 9/118 (7%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR---------SRDRD 177
           D D    +     RD  RES + RE+D++N RERER R++ RD++           RDRD
Sbjct: 167 DRDRDRHRERERDRDRKRESDRHRERDKDNQRERERDRDRERDKEHRRRRSRSREERDRD 226

Query: 176 SEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            ++ RDR+R+  RDR RD +R  D  +    S++R+   +  + R R R H    RH+
Sbjct: 227 RDRDRDRDRDHDRDRDRDHDR--DHRKRRSSSRERQDRHEQRRRRSRSRSHERSSRHQ 282

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 30/128 (23%), Positives = 57/128 (44%), Gaps = 9/128 (7%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE---- 255
           E +E+ R  + + + + +   +        +D      K N   R+ DR+  + +E    
Sbjct: 156 ERKEQDRSRERDRDRDRHRERERDRDRKRESDRHRERDKDNQRERERDRDRERDKEHRRR 215

Query: 254 -----KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG 90
                ++R+  R+R+R R++  DRDR RD D +  + R   R R    +  R + R R  
Sbjct: 216 RSRSREERDRDRDRDRDRDRDHDRDRDRDHDRDHRKRRSSSRERQDRHEQRRRRSRSRSH 275

Query: 89  EKSKDRER 66
           E+S   ++
Sbjct: 276 ERSSRHQQ 283

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 31/115 (26%), Positives = 49/115 (42%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E  R    + E + +   D   Q     D D    K +   R   RE    R++DR+  R
Sbjct: 175 ERERDRDRKRESDRHRERDKDNQRERERDRDRERDKEHRRRRSRSREE---RDRDRDRDR 231

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           +R+R  ++ RDRD  RD    +S  RER+   ++ R   RS+   R     +  +
Sbjct: 232 DRDRDHDRDRDRDHDRDHRKRRSSSRERQDRHEQRRRRSRSRSHERSSRHQQQEK 286

[187][TOP]
>UniRef100_A5KC39 Putative uncharacterized protein n=1 Tax=Plasmodium vivax
            RepID=A5KC39_PLAVI
          Length = 1084

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 49/127 (38%), Positives = 74/127 (58%)
 Frame = -2

Query: 383  EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGR 204
            E E +   D     P   + D          R+ +R+  +  E+DR    ERER+  + R
Sbjct: 779  EAERDRQRDVERDRPRETERDRQRDAERDRPRETERDRQRDAERDRPRETERERQTLRER 838

Query: 203  DRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH 24
            DR+R RDR+ E  R+RERER RDR R+ ER ++R  + E+++D ER+R+ E ERDR+R+ 
Sbjct: 839  DRERERDRNREAERERERERERDRNREAERERNREAERERNRDAERERNREAERDRNRE- 897

Query: 23   HHRDRHR 3
              R+R+R
Sbjct: 898  AERERNR 904

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 53/147 (36%), Positives = 86/147 (58%), Gaps = 7/147 (4%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHN---DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E E ER+ E       D   +   D+    P  A+ D    +   V RD  RE+ + R++
Sbjct: 747  EAERERQREAERDRPRDTERDRPRDTERDRPREAERD----RQRDVERDRPRETERDRQR 802

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSR----DRERERSRDRVRDGERSKDRGRDGEK 84
            D E  R RE +R++ RD +R R R++E+ R    +R+RER RDR R+ ER ++R R+ ++
Sbjct: 803  DAERDRPRETERDRQRDAERDRPRETERERQTLRERDRERERDRNREAERERERERERDR 862

Query: 83   SKDRERDRDGEKERDRDRDHHHRDRHR 3
            +++ ER+R+ E ER+R+RD   R+R+R
Sbjct: 863  NREAERERNREAERERNRD-AERERNR 888

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 49/146 (33%), Positives = 83/146 (56%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
            P   E + + +   ++P  E E +   D+    P   + D          R+ +RE    
Sbjct: 777  PREAERDRQRDVERDRPR-ETERDRQRDAERDRPRETERDRQRDAERDRPRETERERQTL 835

Query: 260  REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
            RE+DRE  R+R R+ E+ R+R+R RDR+ E  R+R RE  R+R RD ER ++R  + +++
Sbjct: 836  RERDRERERDRNREAERERERERERDRNREAERERNREAERERNRDAERERNREAERDRN 895

Query: 80   KDRERDRDGEKERDRDRDHHHRDRHR 3
            ++ ER+R+ E ER+R+R+   R+R+R
Sbjct: 896  REAERERNREAERERNRE-VERERNR 920

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/143 (37%), Positives = 77/143 (53%)
 Frame = -2

Query: 431  GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            G+   +E  R  + E E E     +     P  A+ +    +   V R+  RE  + R++
Sbjct: 691  GKRRNKERERNREKERERERERERERERDHPREAERE----RPREVERERPREVERDRQR 746

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            + E  R+RE +R++ RD +R R RD+E  RDR RE  RDR RD ER + R  + ++ +D 
Sbjct: 747  EAERERQREAERDRPRDTERDRPRDTE--RDRPREAERDRQRDVERDRPRETERDRQRDA 804

Query: 71   ERDRDGEKERDRDRDHHHRDRHR 3
            ERDR  E ERDR RD   RDR R
Sbjct: 805  ERDRPRETERDRQRD-AERDRPR 826

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 47/147 (31%), Positives = 84/147 (57%), Gaps = 1/147 (0%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLT-DSKSNHVSRDNDRESSK 264
            P   E + + +   ++P     D   +    +P     E  T   +     RD +RE+ +
Sbjct: 793  PRETERDRQRDAERDRPRETERDRQRDAERDRPRETERERQTLRERDRERERDRNREAER 852

Query: 263  SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
             RE++RE  R RE +RE+ R+ +R R+RD+E+ R+RE ER R+R  + ER+++  R+  +
Sbjct: 853  ERERERERDRNREAERERNREAERERNRDAERERNREAERDRNREAERERNREAERERNR 912

Query: 83   SKDRERDRDGEKERDRDRDHHHRDRHR 3
              +RER+R+ E+ER+R+ +   R+R+R
Sbjct: 913  EVERERNREAERERNRETE---RERNR 936

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 45/102 (44%), Positives = 62/102 (60%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           +     R+ D E  K R K+RE  RE+ER+RE+ R+R+R RD   E  R+R RE  R+R 
Sbjct: 678 RQGEAEREGDSERGKRRNKERERNREKERERERERERERERDHPREAERERPREVERERP 737

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R+ ER + R  + E+ ++ ERDR  + ERDR RD   RDR R
Sbjct: 738 REVERDRQREAERERQREAERDRPRDTERDRPRD-TERDRPR 778

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 54/139 (38%), Positives = 75/139 (53%), Gaps = 2/139 (1%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            +  R  + + EGE     D   Q  A  + D    K  +  R+ +RE  + RE++RE  R
Sbjct: 659  DRERDSRNKEEGEKIERRDR--QGEAEREGDSERGKRRNKERERNREKERERERERERER 716

Query: 233  ERERKREKGRDRDRS--RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
            ER+  RE  R+R R   R+R  E  RDR+RE  R+R R+ ER + R  + ++ +D ERDR
Sbjct: 717  ERDHPREAERERPREVERERPREVERDRQREAERERQREAERDRPRDTERDRPRDTERDR 776

Query: 59   DGEKERDRDRDHHHRDRHR 3
              E ERDR RD   RDR R
Sbjct: 777  PREAERDRQRD-VERDRPR 794

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 55/153 (35%), Positives = 81/153 (52%), Gaps = 7/153 (4%)
 Frame = -2

Query: 440  PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
            P   E E   E   E+P  E E +   ++  +    A+ D          RD +R+  + 
Sbjct: 721  PREAERERPREVERERPR-EVERDRQREAERERQREAERDRPRDTERDRPRDTERDRPRE 779

Query: 260  REKDRENGRERERKREKGRDRDRS--RDRDSEKSRDRERERSRDRVRDGERSKD--RGRD 93
             E+DR+   ER+R RE  RDR R   RDR  E  RDR+R+  RDR R+ ER +   R RD
Sbjct: 780  AERDRQRDVERDRPRETERDRQRDAERDRPRETERDRQRDAERDRPRETERERQTLRERD 839

Query: 92   GEKSKDRERDRDGEKERDRDRDHH---HRDRHR 3
             E+ +DR R+ + E+ER+R+RD +    R+R+R
Sbjct: 840  RERERDRNREAERERERERERDRNREAERERNR 872

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 46/138 (33%), Positives = 82/138 (59%), Gaps = 1/138 (0%)
 Frame = -2

Query: 437  TMGEYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
            T+ E + E ER R  + E E E     D + +     + +    ++    R+ +RE+ + 
Sbjct: 834  TLRERDRERERDRNREAERERERERERDRNREAERERNREAERERNRDAERERNREAERD 893

Query: 260  REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
            R ++ E  R RE +RE+ R+ +R R+R++E+ R+RE ER R+R  + ER ++R  + E++
Sbjct: 894  RNREAERERNREAERERNREVERERNREAERERNRETERERNR--EAERERNREAERERN 951

Query: 80   KDRERDRDGEKERDRDRD 27
            ++ ERDR+ E ERDR+R+
Sbjct: 952  REAERDRNREAERDRNRE 969

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 53/144 (36%), Positives = 73/144 (50%), Gaps = 6/144 (4%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS------RE 255
            EE  + E+ + +GE     DS        + +    K     R+ +RE  +       RE
Sbjct: 668  EEGEKIERRDRQGEAEREGDSERGKRRNKERERNREKERERERERERERERDHPREAERE 727

Query: 254  KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
            + RE  RER R+ E+ R R+  R+R  E  RDR R+  RDR RD ER + R  + ++ +D
Sbjct: 728  RPREVERERPREVERDRQREAERERQREAERDRPRDTERDRPRDTERDRPREAERDRQRD 787

Query: 74   RERDRDGEKERDRDRDHHHRDRHR 3
             ERDR  E ERDR RD   RDR R
Sbjct: 788  VERDRPRETERDRQRD-AERDRPR 810

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 54/144 (37%), Positives = 75/144 (52%), Gaps = 2/144 (1%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  + P  E E     +   + P   + D          R+ +R+  +  E+D
Sbjct: 709  ERERERERERDHPR-EAERERPREVERERPREVERDRQREAERERQREAERDRPRDTERD 767

Query: 248  RENGRERERKREKGRDRDR--SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
            R    ER+R RE  RDR R   RDR  E  RDR+R+  RDR R+ ER  DR RD E+ + 
Sbjct: 768  RPRDTERDRPREAERDRQRDVERDRPRETERDRQRDAERDRPRETER--DRQRDAERDRP 825

Query: 74   RERDRDGEKERDRDRDHHHRDRHR 3
            RE +R+ +  R+RDR+   RDR+R
Sbjct: 826  RETERERQTLRERDRE-RERDRNR 848

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 42/137 (30%), Positives = 79/137 (57%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R  Q   E +     D + +     + +    ++    R+ +RE+ + R +D E  R
Sbjct: 827  ETERERQTLRERDRERERDRNREAERERERERERDRNREAERERNREAERERNRDAERER 886

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
             RE +R++ R+ +R R+R++E+ R+RE ER R+R  + ER+++  R+  +  +RER+R+ 
Sbjct: 887  NREAERDRNREAERERNREAERERNREVERERNREAERERNRETERERNREAERERNREA 946

Query: 53   EKERDRDRDHHHRDRHR 3
            E+ER+R+ +   RDR+R
Sbjct: 947  ERERNREAE---RDRNR 960

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/137 (31%), Positives = 78/137 (56%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R  Q + E +     +   Q     D +    ++    R+ +RE  + R ++ E  R
Sbjct: 811  ETERDRQRDAERDRPRETERERQTLRERDRERERDRNREAERERERERERDRNREAERER 870

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
             RE +RE+ RD +R R+R++E+ R+RE ER R+R  + ER+++  R+  +  +RER+R+ 
Sbjct: 871  NREAERERNRDAERERNREAERDRNREAERERNREAERERNREVERERNREAERERNRET 930

Query: 53   EKERDRDRDHHHRDRHR 3
            E+ER+R+ +   R+R+R
Sbjct: 931  ERERNREAE---RERNR 944

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 42/140 (30%), Positives = 79/140 (56%), Gaps = 3/140 (2%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R  + E + + +   D   +       D    +     RD  R++ + R ++ E  R
Sbjct: 773  ERDRPREAERDRQRDVERDRPRETERDRQRDAERDRPRETERDRQRDAERDRPRETERER 832

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSR--DRVRDGERSKDRGRDGEKSKDRERDR 60
            +  R+R++ R+RDR+R+ + E+ R+RER+R+R  +R R+ E  ++R RD E+ ++RE +R
Sbjct: 833  QTLRERDRERERDRNREAERERERERERDRNREAERERNREAERERNRDAERERNREAER 892

Query: 59   DGEKERDRDRDHH-HRDRHR 3
            D  +E +R+R+    R+R+R
Sbjct: 893  DRNREAERERNREAERERNR 912

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 45/141 (31%), Positives = 76/141 (53%), Gaps = 2/141 (1%)
 Frame = -2

Query: 419  FEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN 240
            +EE  + +     G  +  N  + +  A  + D  + +        DR+    RE D E 
Sbjct: 633  YEERNKRDNSHPSGRKSTQNGDTLR--ADRERDSRNKEEGEKIERRDRQGEAEREGDSER 690

Query: 239  GRERERKREKGRDRDRSRDRDSEKSRDRE--RERSRDRVRDGERSKDRGRDGEKSKDRER 66
            G+ R ++RE+ R+++R R+R+ E+ R+R+  RE  R+R R+ ER + R  + ++ ++ ER
Sbjct: 691  GKRRNKERERNREKERERERERERERERDHPREAERERPREVERERPREVERDRQREAER 750

Query: 65   DRDGEKERDRDRDHHHRDRHR 3
            +R  E ERDR RD   RDR R
Sbjct: 751  ERQREAERDRPRD-TERDRPR 770

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 41/135 (30%), Positives = 72/135 (53%), Gaps = 2/135 (1%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  E+      +   N  + +     + D    ++    RD +RE+ + R ++
Sbjct: 849  EAERERERERERDRNREAERERNREAERE---RNRDAERERNREAERDRNREAERERNRE 905

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDR--ERERSRDRVRDGERSKDRGRDGEKSKD 75
             E  R RE +RE+ R+ +R R+R++E+ R+R  ERER+R+  R+  R  +R R+ E  +D
Sbjct: 906  AERERNREVERERNREAERERNRETERERNREAERERNREAERERNREAERDRNREAERD 965

Query: 74   RERDRDGEKERDRDR 30
            R R++  E  ++  R
Sbjct: 966  RNREKQFENGKNTPR 980

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 42/132 (31%), Positives = 66/132 (50%), Gaps = 5/132 (3%)
 Frame = -2

Query: 404 RYEQPEGEGEDNYHNDSSPQPPAAAD-EDLTDSK---SNHVSRDNDRESSK-SREKDREN 240
           R  + +    D   +    QPPA    E  T+ K   + H    N R++S  S  K  +N
Sbjct: 593 RSREGQANERDKPSSREKEQPPAQVQKESNTNGKLRSAKHYEERNKRDNSHPSGRKSTQN 652

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
           G      RE    RD     + EK   R+R+   +R  D ER K R ++ E+++++ER+R
Sbjct: 653 GDTLRADRE----RDSRNKEEGEKIERRDRQGEAEREGDSERGKRRNKERERNREKERER 708

Query: 59  DGEKERDRDRDH 24
           + E+ER+R+RDH
Sbjct: 709 ERERERERERDH 720

[188][TOP]
>UniRef100_C5PCQ2 DNA double-strand break repair Rad50 ATPase, putative n=1
           Tax=Coccidioides posadasii C735 delta SOWgp
           RepID=C5PCQ2_COCP7
          Length = 723

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 55/140 (39%), Positives = 80/140 (57%), Gaps = 5/140 (3%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQ--PPAAADEDLTDSKSNHVSRDNDRESSKSREKDREN 240
           E+ RY   + +  D+   D       P+    D  D +S+   R   R  +  R++DR +
Sbjct: 433 EDDRYRWRDSDRRDSERRDREMDLYRPSRERHD-RDDRSDTRRRSRARSRTPIRDRDRGD 491

Query: 239 G---RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           G    +RE +REK  DRD +RDRD  + RDRER+R ++R R+ ER  DR +D E+ +DR+
Sbjct: 492 GYRPHDREGEREKDSDRDFNRDRD--RDRDRERDRDKERERERERENDRDQDKERGRDRD 549

Query: 68  RDRDGEKERDRDRDHHHRDR 9
           RDRD  ++RDRDRD    DR
Sbjct: 550 RDRDRNRDRDRDRDWDRSDR 569

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/109 (36%), Positives = 63/109 (57%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D  D    H  R+ +RE    R+ +R+  R+R+R+R++ ++R+R R+R++++ +D+ER
Sbjct: 486 DRDRGDGYRPH-DREGEREKDSDRDFNRDRDRDRDRERDRDKERERERERENDRDQDKER 544

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            R RDR RD  R +DR RD ++S    R R     R R R    R R R
Sbjct: 545 GRDRDRDRDRNRDRDRDRDWDRSDRSYRPRAYSHSRSRSRSRRRRSRSR 593

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 53/199 (26%), Positives = 88/199 (44%), Gaps = 57/199 (28%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHND------SSPQPPAAADEDLTDSKSNHVSR------D 285
           E++FE+    E  E + +  +         S P+   A+D  + ++  +   R      D
Sbjct: 359 EFDFEKAEALEMEEQQAQAPHQAQTRTSIPSRPKTERASDHTIREATEDRYDRYRGRQRD 418

Query: 284 NDRESSKSR-----EKDRENGRERERKREKGRDRD------------------------- 195
           + R  S++R     E DR   R+ +R+  + RDR+                         
Sbjct: 419 DSRSRSRTRRSSRYEDDRYRWRDSDRRDSERRDREMDLYRPSRERHDRDDRSDTRRRSRA 478

Query: 194 ---------------RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
                          R  DR+ E+ +D +R+ +RDR RD +R +DR ++ E+ ++RE DR
Sbjct: 479 RSRTPIRDRDRGDGYRPHDREGEREKDSDRDFNRDRDRDRDRERDRDKERERERERENDR 538

Query: 59  DGEKERDRDRDHHHRDRHR 3
           D +KER RDRD   RDR+R
Sbjct: 539 DQDKERGRDRD-RDRDRNR 556

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 43/130 (33%), Positives = 63/130 (48%), Gaps = 8/130 (6%)
 Frame = -2

Query: 374 DNYH-NDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRE--RERKREKGR 204
           D Y  +D   +    +D D    +     R+ DR+  + RE++REN R+  +ER R++ R
Sbjct: 491 DGYRPHDREGEREKDSDRDFNRDRDRDRDRERDRDKERERERERENDRDQDKERGRDRDR 550

Query: 203 DRDRSRDRDSEKSRDRERERSRDRVRDGERSKD-----RGRDGEKSKDRERDRDGEKERD 39
           DRDR+RDRD ++  DR     R R     RS+      R R   +S+ R   R G +ERD
Sbjct: 551 DRDRNRDRDRDRDWDRSDRSYRPRAYSHSRSRSRSRRRRSRSRVRSRSRSLTRRGREERD 610

Query: 38  RDRDHHHRDR 9
           R        R
Sbjct: 611 RSESRRRLSR 620

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 39/104 (37%), Positives = 58/104 (55%), Gaps = 1/104 (0%)
 Frame = -2

Query: 311 SKSNHVSRDNDRESSKS-REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD 135
           +K+    R   RE  +  +E +R+   ERE KR   R++ R  +R  E+ R++ERE  R 
Sbjct: 193 AKAEAEERQRQRELRRQQKEAERKEREEREEKRRVEREKRREEERKLEEQREKEREERRR 252

Query: 134 RVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R  + ER     R  E+ ++RER+R+ E+E DR RD   RDR R
Sbjct: 253 RRDEEEREHRERRREEREREREREREREREDDRRRDERDRDRGR 296

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 45/145 (31%), Positives = 68/145 (46%), Gaps = 5/145 (3%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDS--SPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE 255
           E E +++   E+ + E E+          Q  A   E     +   V R+  RE  +  E
Sbjct: 181 ELEMKKKLEEERAKAEAEERQRQRELRRQQKEAERKEREEREEKRRVEREKRREEERKLE 240

Query: 254 KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD---GERSKDRGRDGEK 84
           + RE  RE  R+R    +R+    R  E+ R+RERER R+R  D    ER +DRGRD   
Sbjct: 241 EQREKEREERRRRRDEEEREHRERRREEREREREREREREREDDRRRDERDRDRGRD--- 297

Query: 83  SKDRERDRDGEKERDRDRDHHHRDR 9
            +DR+ +RD + ER   ++     R
Sbjct: 298 -RDRDWNRDVKSERTPKKERSDTPR 321

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 42/136 (30%), Positives = 71/136 (52%), Gaps = 7/136 (5%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E +R E+ E   ++        +  A A+ +  + +     R   +E+ +   ++RE  R
Sbjct: 168 EAKRQEREEARLKELEMKKKLEEERAKAEAE--ERQRQRELRRQQKEAERKEREEREEKR 225

Query: 233 --ERERKREKGRDRDRSRDRDSEKSRDR----ERERSRDRVRDGERSKDRGRDGEKSKDR 72
             ERE++RE+ R  +  R+++ E+ R R    ERE    R  + ER ++R R+ E+  DR
Sbjct: 226 RVEREKRREEERKLEEQREKEREERRRRRDEEEREHRERRREEREREREREREREREDDR 285

Query: 71  ERD-RDGEKERDRDRD 27
            RD RD ++ RDRDRD
Sbjct: 286 RRDERDRDRGRDRDRD 301

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 53/195 (27%), Positives = 73/195 (37%), Gaps = 70/195 (35%)
 Frame = -2

Query: 389  EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
            EGE E +   D +       D D    +     R+ +RE    R++D+E GR+R+R R++
Sbjct: 499  EGEREKDSDRDFNRD----RDRDRDRERDRDKERERERERENDRDQDKERGRDRDRDRDR 554

Query: 209  GRDRDRSRDRDSE---------------------KSRDRERERSRD-------------- 135
             RDRDR RD D                       +SR R R RSR               
Sbjct: 555  NRDRDRDRDWDRSDRSYRPRAYSHSRSRSRSRRRRSRSRVRSRSRSLTRRGREERDRSES 614

Query: 134  --------------------------------RVRDGERSK---DRGRDGEKSKDRERDR 60
                                            RVR  ER +   DR R  ++S+DR+RD 
Sbjct: 615  RRRLSRRSRSPNQLDIDRYVPPTSTRSRSPKRRVRSPERDRTWSDRDRVRDRSRDRDRDW 674

Query: 59   DGEKERDRDRDHHHR 15
            D ++ERD DR    R
Sbjct: 675  DRDRERDHDRSRIDR 689

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 2/106 (1%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESSKSREKDRENGRERER-KREKGRDRDRSRDRDSEKSRDRERERSR 138
           +++     R+  R+  ++  K+RE   E+ R +REK R+ +R  +   EK R+  R R  
Sbjct: 196 EAEERQRQRELRRQQKEAERKEREEREEKRRVEREKRREEERKLEEQREKEREERRRRRD 255

Query: 137 DRVRDGERSKDRGRDGEKSKDRERDRDGEKERD-RDRDHHHRDRHR 3
           +  R+    +   R+ E+ ++RER+R+ ++ RD RDRD   RDR R
Sbjct: 256 EEEREHRERRREEREREREREREREREDDRRRDERDRD-RGRDRDR 300

[189][TOP]
>UniRef100_Q9ZR39 Splicing factor U2af large subunit A n=1 Tax=Nicotiana
           plumbaginifolia RepID=U2A2A_NICPL
          Length = 555

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/132 (40%), Positives = 77/132 (58%), Gaps = 3/132 (2%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKRE- 213
           EG G D  +N +SP     +  D  + + +  SRD +R+  + +++DR+  R+R+R R+ 
Sbjct: 5   EGNGVDIDNNGASPYSQHIS-RDHENERDSSRSRDKERDKGRDKDRDRDRNRDRDRDRDR 63

Query: 212 -KGRDRDRSRDRDSEKSRDR-ERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERD 39
            K RD+DR RDRD EK RDR  R+R RDR    ER + R RD +   D  R RD ++ RD
Sbjct: 64  VKERDKDRHRDRDGEKDRDRHHRDRHRDRSDRRERERTRDRDED---DLHRSRDYDRRRD 120

Query: 38  RDRDHHHRDRHR 3
            D+D   R RHR
Sbjct: 121 NDKDREDRRRHR 132

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 43/111 (38%), Positives = 68/111 (61%), Gaps = 5/111 (4%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERS 141
           + D + N V  DN+  S  S+   R++  ER+  R + ++RD+ RD+D ++ R+R+R+R 
Sbjct: 1   MRDYEGNGVDIDNNGASPYSQHISRDHENERDSSRSRDKERDKGRDKDRDRDRNRDRDRD 60

Query: 140 RDRVRDGERSKDRGRDGEKS-----KDRERDRDGEKERDRDRDHHHRDRHR 3
           RDRV++ ++ + R RDGEK      +DR RDR   +ER+R RD    D HR
Sbjct: 61  RDRVKERDKDRHRDRDGEKDRDRHHRDRHRDRSDRRERERTRDRDEDDLHR 111

[190][TOP]
>UniRef100_UPI000186D3EA zinc finger protein CCCH domain-containing protein, putative n=1
           Tax=Pediculus humanus corporis RepID=UPI000186D3EA
          Length = 1016

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 47/106 (44%), Positives = 71/106 (66%), Gaps = 13/106 (12%)
 Frame = -2

Query: 287 DNDRESSKSREKDRENGRERERKREKGRDRDRSR------DRDS---EKSRDRERERSRD 135
           D +  + K +EK++E  +ERERKRE+ R+R++ R      DRD    ++ RDR+R+R RD
Sbjct: 144 DKNLANEKEKEKEKEKEKERERKRERSREREKERRDKYRSDRDKIERDRGRDRDRDRDRD 203

Query: 134 RVRDGERSKDRGRDGEKSKD----RERDRDGEKERDRDRDHHHRDR 9
           R RD +R +D+ RD +K KD    RERDRD +KERD+D+D   +++
Sbjct: 204 RDRDKDRDRDKDRDKDKEKDRDRERERDRDRDKERDKDKDKREKEK 249

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 42/125 (33%), Positives = 75/125 (60%), Gaps = 14/125 (11%)
 Frame = -2

Query: 335 AADEDLTDSKSNHVSRDNDRESSKSREKDR-------------ENGRERERKREKGRDRD 195
           A +++    K     R+  RE S+ REK+R             + GR+R+R R++ RDRD
Sbjct: 148 ANEKEKEKEKEKEKERERKRERSREREKERRDKYRSDRDKIERDRGRDRDRDRDRDRDRD 207

Query: 194 RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE-RDRDRDHHH 18
           + RDRD ++ +D+E++R R+R RD +R K+R +D +K   RE+++  EKE  +R+++   
Sbjct: 208 KDRDRDKDRDKDKEKDRDRERERDRDRDKERDKDKDK---REKEKGKEKESNEREKEDDR 264

Query: 17  RDRHR 3
           +++ R
Sbjct: 265 KEKKR 269

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 56/157 (35%), Positives = 76/157 (48%), Gaps = 22/157 (14%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAAD------EDLTDSKSNHVSRDNDRESSKSREK 252
           +E    Q E   + +  + SS + P   D      ED    K ++  R N   SS++   
Sbjct: 366 KENSVRQEEKGSKRSVSSASSERSPKKDDFEIRKKEDSVQKKRHY--RSNRSHSSENERS 423

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDR-------ERERSRDRVRDGERSKDRGRD 93
            R++ R +   R  GR RD  RDR+ EK RDR       ERER RDR RD ER ++R RD
Sbjct: 424 SRQDRRGKSHSRSPGRRRD-DRDREREKRRDRDDRDRERERERDRDRDRDRERERERERD 482

Query: 92  ---------GEKSKDRERDRDGEKERDRDRDHHHRDR 9
                     EK +   R+R+ E+ERDRDR+   R R
Sbjct: 483 LRYKIERERREKERIERREREKERERDRDRERERRRR 519

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 43/133 (32%), Positives = 76/133 (57%), Gaps = 3/133 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQP---EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           E E E ER+ E+    E E  D Y +D                  + + RD  R+  + R
Sbjct: 158 EKEKERERKRERSREREKERRDKYRSDR-----------------DKIERDRGRDRDRDR 200

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           ++DR+  R+++R R+K RD+D+ +DRD E+ RDR+R++ RD+ +D +R K++G++ E ++
Sbjct: 201 DRDRD--RDKDRDRDKDRDKDKEKDRDRERERDRDRDKERDKDKD-KREKEKGKEKESNE 257

Query: 77  DRERDRDGEKERD 39
             + D   EK+R+
Sbjct: 258 REKEDDRKEKKRE 270

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 40/123 (32%), Positives = 71/123 (57%), Gaps = 5/123 (4%)
 Frame = -2

Query: 356 SSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRD 177
           S+ Q  +   +   D K   + +  + +       D+    E+E+++EK ++++R R R 
Sbjct: 109 SAQQSVSGIPQQFLDQKKEDIKKRMEEQERIQSIVDKNLANEKEKEKEKEKEKERERKR- 167

Query: 176 SEKSRDRERERSRDRVRDG----ERSKDRGRDGEKSKDRERDRDGEKERDRDRD-HHHRD 12
            E+SR+RE+ER RD+ R      ER + R RD ++ +DR+RD+D ++++DRD+D    RD
Sbjct: 168 -ERSREREKER-RDKYRSDRDKIERDRGRDRDRDRDRDRDRDKDRDRDKDRDKDKEKDRD 225

Query: 11  RHR 3
           R R
Sbjct: 226 RER 228

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 41/152 (26%), Positives = 61/152 (40%), Gaps = 11/152 (7%)
 Frame = -2

Query: 425 YEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
           Y        E      +D      S  P    D+   + +      D DRE  + R++DR
Sbjct: 410 YRSNRSHSSENERSSRQDRRGKSHSRSPGRRRDDRDREREKRRDRDDRDRERERERDRDR 469

Query: 245 ENGRERERKREKG-----------RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
           +  RERER+RE+            ++R   R+R+ E+ RDR+RER R R     R +   
Sbjct: 470 DRDRERERERERDLRYKIERERREKERIERREREKERERDRDRERERRRRSPSPRRRRSR 529

Query: 98  RDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
                S  + R R     R++ R    R R R
Sbjct: 530 SSQRSSSPKSRSRRSRSPREKTRHSRSRSRKR 561

[191][TOP]
>UniRef100_UPI0001A2D9BC UPI0001A2D9BC related cluster n=1 Tax=Danio rerio
           RepID=UPI0001A2D9BC
          Length = 339

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 50/143 (34%), Positives = 75/143 (52%)
 Frame = -2

Query: 437 TMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           T+ E + +  RR E PE E +     D   +     ++   + +     ++ ++E  + R
Sbjct: 157 TVEELKEKLRRRSEDPEKEDQGKKVKDDREREREEREKRRKEEEEKEKEKEREKERERER 216

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           EK+RE  RERER R++ RDR+R RDR S +S    R  SR   R   RS+DR R   K +
Sbjct: 217 EKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKER 276

Query: 77  DRERDRDGEKERDRDRDHHHRDR 9
           +R+R R  ++ER R RD   R R
Sbjct: 277 ERKRSRSRDRERRRSRDRSDRKR 299

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 54/132 (40%), Positives = 69/132 (52%), Gaps = 5/132 (3%)
 Frame = -2

Query: 428 EYEFEEERRYE-QPEGEGEDNYHNDSSPQPPAAADEDL----TDSKSNHVSRDNDRESSK 264
           E E E+ER  E + E E E     D         D D     + S S H SR +DR  S+
Sbjct: 205 EKEREKEREREREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSR 264

Query: 263 SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
           SR++ R   +ERERKR + RDR+R R RD    + R R R R R R  ER   R R   +
Sbjct: 265 SRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKRRSRSRDRRRSRSSERKSHRHR--SR 322

Query: 83  SKDRERDRDGEK 48
           S+DR+RDRD +K
Sbjct: 323 SRDRDRDRDKDK 334

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 50/146 (34%), Positives = 69/146 (47%), Gaps = 4/146 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E  E+RR E+ E E E     +         + +    +     R+ DR+  + RE+D
Sbjct: 188 EREEREKRRKEEEEKEKEKEREKER--------EREREKERERERERERDRDRDRDRERD 239

Query: 248 RENGRER----ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           R+    R     R   +  DR RSR RD  +SR +ERER R R RD ER + R R   K 
Sbjct: 240 RDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKR 299

Query: 80  KDRERDRDGEKERDRDRDHHHRDRHR 3
           + R RDR   +  +R + H HR R R
Sbjct: 300 RSRSRDRRRSRSSER-KSHRHRSRSR 324

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 34/91 (37%), Positives = 58/91 (63%), Gaps = 1/91 (1%)
 Frame = -2

Query: 275 ESSKSREKDRENGRERERKREKGRDRDRSRDRDS-EKSRDRERERSRDRVRDGERSKDRG 99
           E  K + + R    E+E + +K +D DR R+R+  EK R  E E+ +++ R+ ER ++R 
Sbjct: 159 EELKEKLRRRSEDPEKEDQGKKVKD-DREREREEREKRRKEEEEKEKEKEREKERERERE 217

Query: 98  RDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
           ++ E+ ++RERDRD +++R+RDRD   R  H
Sbjct: 218 KERERERERERDRDRDRDRERDRDRRSRRSH 248

[192][TOP]
>UniRef100_UPI00015A7A78 hypothetical protein LOC563852 n=1 Tax=Danio rerio
           RepID=UPI00015A7A78
          Length = 462

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 50/143 (34%), Positives = 75/143 (52%)
 Frame = -2

Query: 437 TMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           T+ E + +  RR E PE E +     D   +     ++   + +     ++ ++E  + R
Sbjct: 226 TVEELKEKLRRRSEDPEKEDQGKKVKDDREREREEREKRRKEEEEKEKEKEREKERERER 285

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           EK+RE  RERER R++ RDR+R RDR S +S    R  SR   R   RS+DR R   K +
Sbjct: 286 EKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKER 345

Query: 77  DRERDRDGEKERDRDRDHHHRDR 9
           +R+R R  ++ER R RD   R R
Sbjct: 346 ERKRSRSRDRERRRSRDRSDRKR 368

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 57/140 (40%), Positives = 74/140 (52%), Gaps = 5/140 (3%)
 Frame = -2

Query: 428 EYEFEEERRYE-QPEGEGEDNYHNDSSPQPPAAADEDL----TDSKSNHVSRDNDRESSK 264
           E E E+ER  E + E E E     D         D D     + S S H SR +DR  S+
Sbjct: 274 EKEREKEREREREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSR 333

Query: 263 SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
           SR++ R   +ERERKR + RDR+R R RD    + R R R R R R  ER   R R   +
Sbjct: 334 SRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKRRSRSRDRRRSRSSERKSHRHR--SR 391

Query: 83  SKDRERDRDGEKERDRDRDH 24
           S+DR+RDRD +K   +D+DH
Sbjct: 392 SRDRDRDRDKDKS-SKDKDH 410

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 50/146 (34%), Positives = 69/146 (47%), Gaps = 4/146 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E  E+RR E+ E E E     +         + +    +     R+ DR+  + RE+D
Sbjct: 257 EREEREKRRKEEEEKEKEKEREKER--------EREREKERERERERERDRDRDRDRERD 308

Query: 248 RENGRER----ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           R+    R     R   +  DR RSR RD  +SR +ERER R R RD ER + R R   K 
Sbjct: 309 RDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKR 368

Query: 80  KDRERDRDGEKERDRDRDHHHRDRHR 3
           + R RDR   +  +R + H HR R R
Sbjct: 369 RSRSRDRRRSRSSER-KSHRHRSRSR 393

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 47/142 (33%), Positives = 68/142 (47%), Gaps = 13/142 (9%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHN---------DSSPQPPAAADEDLTDSKSNHVSRDNDR 276
           E E E ER  E+      D   +          +S      +D   + S+    SR  +R
Sbjct: 286 EKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKER 345

Query: 275 ESSKSREKDRENGRERER--KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSK-D 105
           E  +SR +DRE  R R+R  ++ + R RDR R R SE+   R R RSRDR RD ++ K  
Sbjct: 346 ERKRSRSRDRERRRSRDRSDRKRRSRSRDRRRSRSSERKSHRHRSRSRDRDRDRDKDKSS 405

Query: 104 RGRDGEKSKDRER-DRDGEKER 42
           + +D + S D +R  R G  E+
Sbjct: 406 KDKDHKDSSDEKRSSRKGSVEK 427

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 34/91 (37%), Positives = 58/91 (63%), Gaps = 1/91 (1%)
 Frame = -2

Query: 275 ESSKSREKDRENGRERERKREKGRDRDRSRDRDS-EKSRDRERERSRDRVRDGERSKDRG 99
           E  K + + R    E+E + +K +D DR R+R+  EK R  E E+ +++ R+ ER ++R 
Sbjct: 228 EELKEKLRRRSEDPEKEDQGKKVKD-DREREREEREKRRKEEEEKEKEKEREKERERERE 286

Query: 98  RDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
           ++ E+ ++RERDRD +++R+RDRD   R  H
Sbjct: 287 KERERERERERDRDRDRDRERDRDRRSRRSH 317

[193][TOP]
>UniRef100_UPI0001B7B475 UPI0001B7B475 related cluster n=1 Tax=Rattus norvegicus
            RepID=UPI0001B7B475
          Length = 2256

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 58/148 (39%), Positives = 82/148 (55%), Gaps = 10/148 (6%)
 Frame = -2

Query: 422  EFEEER--RYEQPEGEGEDNYHNDSSP------QPPAAADEDLTDSKSNHVSRDNDRESS 267
            EF E +   Y  P  EG      ++ P      +P A   E           R+ +R  +
Sbjct: 2081 EFREGKGHEYRSPAFEGRQRERFEAGPKEKPLDEPEAQGLESRQGRAFEDRRRERERGRN 2140

Query: 266  KSREKDRENGRERERKRE--KGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD 93
             SREKD E  R+ +R RE  KGRDR  +RDR+ +  R +E +RSR+R R+ +R ++R RD
Sbjct: 2141 WSREKDWERSRDWDRHREWDKGRDRSSNRDRERDTDRGKEWDRSRERSRNRDRDRERRRD 2200

Query: 92   GEKSKDRERDRDGEKERDRDRDHHHRDR 9
             ++S+ R+RDRD E+ RDRDRD   RDR
Sbjct: 2201 RDRSRSRDRDRDRERARDRDRD-RGRDR 2227

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 52/138 (37%), Positives = 78/138 (56%), Gaps = 9/138 (6%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE--N 240
            +E+  ++PE +G +      S Q  A  D      +  + SR+ D E S+  ++ RE   
Sbjct: 2108 KEKPLDEPEAQGLE------SRQGRAFEDRRRERERGRNWSREKDWERSRDWDRHREWDK 2161

Query: 239  GRERERKREKGRDRDRSR--DRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
            GR+R   R++ RD DR +  DR  E+SR+R+R+R R R RD  RS+DR RD E+++DR+R
Sbjct: 2162 GRDRSSNRDRERDTDRGKEWDRSRERSRNRDRDRERRRDRDRSRSRDRDRDRERARDRDR 2221

Query: 65   DR-----DGEKERDRDRD 27
            DR     D  K R+  RD
Sbjct: 2222 DRGRDRKDRSKSRESPRD 2239

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/125 (38%), Positives = 68/125 (54%), Gaps = 2/125 (1%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            E+RR E+  G       + + S       + D    +S++  R+ D +  K  ++ RE  
Sbjct: 2129 EDRRRERERGRNWSREKDWERSRDWDRHREWDKGRDRSSNRDRERDTDRGKEWDRSRERS 2188

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD-GEKSKDRERDR 60
            R R+R RE+ RDRDRSR RD    RDR+RER+RD      R +DRGRD  ++SK RE  R
Sbjct: 2189 RNRDRDRERRRDRDRSRSRD----RDRDRERARD------RDRDRGRDRKDRSKSRESPR 2238

Query: 59   DGEKE 45
            D + E
Sbjct: 2239 DLKPE 2243

[194][TOP]
>UniRef100_Q6DC42 Rbmx2 protein (Fragment) n=1 Tax=Danio rerio RepID=Q6DC42_DANRE
          Length = 358

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 52/131 (39%), Positives = 74/131 (56%), Gaps = 12/131 (9%)
 Frame = -2

Query: 383 EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS----------REKDRENGR 234
           E ED  +   S + PAA   D  D +     ++ +RE  K           RE+DRE  R
Sbjct: 202 EKEDVAYEKYSVKGPAANRRDRADEQEQLKEKEREREEGKKTDRRHAETQQRERDREGER 261

Query: 233 E--RERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
           +  +ER+R++GR RD  R RD EK R+RER+  R R  + +R +D GR  +  +DRER+R
Sbjct: 262 DGDKERERDRGRQRDGGRQRDGEKDRERERDGGRQRDGERQRERDGGRQRDGERDRERER 321

Query: 59  DGEKERDRDRD 27
           DG ++RD DRD
Sbjct: 322 DGGRQRDGDRD 332

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 46/142 (32%), Positives = 79/142 (55%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E  +E+  E+ EG+  D  H ++  +            +     RD D+E  + R + 
Sbjct: 226 EQEQLKEKEREREEGKKTDRRHAETQQR-----------ERDREGERDGDKERERDRGRQ 274

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R+ GR+R+ ++++ R+RD  R RD E+ R+R+  R RD  RD ER +D GR  +  +DRE
Sbjct: 275 RDGGRQRDGEKDRERERDGGRQRDGERQRERDGGRQRDGERDRERERDGGRQRDGDRDRE 334

Query: 68  RDRDGEKERDRDRDHHHRDRHR 3
           ++RDG ++RD +RD   + + +
Sbjct: 335 QERDGGRQRDVERDQKKKKKKK 356

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 49/149 (32%), Positives = 78/149 (52%), Gaps = 11/149 (7%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E+++  ++ + EG     ++SS   P    ++  D      S      + + R  ++E  
Sbjct: 175 EKKKALKEEKREGR----SESSASSPVRVKKEKEDVAYEKYSVKGPAANRRDRADEQEQL 230

Query: 236 RERERKREKGRDRD--------RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           +E+ER+RE+G+  D        R RDR+ E+  D+ERER R R RDG R +D  +D E+ 
Sbjct: 231 KEKEREREEGKKTDRRHAETQQRERDREGERDGDKERERDRGRQRDGGRQRDGEKDRERE 290

Query: 80  KDRERDRDGEKERDRDRDHH---HRDRHR 3
           +D  R RDGE++R+RD        RDR R
Sbjct: 291 RDGGRQRDGERQRERDGGRQRDGERDRER 319

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 50/153 (32%), Positives = 87/153 (56%), Gaps = 13/153 (8%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSK-------SNHVSRDNDRESSK 264
           E ++  + E+ EG  E +    SSP       ED+   K       +N   R +++E  K
Sbjct: 175 EKKKALKEEKREGRSESSA---SSPVRVKKEKEDVAYEKYSVKGPAANRRDRADEQEQLK 231

Query: 263 SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD----RVRDGERSKDRGR 96
            +E++RE G++ +R+  + + R+R R+ + +  ++RER+R R     R RDGE+ ++R R
Sbjct: 232 EKEREREEGKKTDRRHAETQQRERDREGERDGDKERERDRGRQRDGGRQRDGEKDRERER 291

Query: 95  DGEKSKD--RERDRDGEKERDRDRDHHHRDRHR 3
           DG + +D  R+R+RDG ++RD +RD   R+R R
Sbjct: 292 DGGRQRDGERQRERDGGRQRDGERD---RERER 321

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 37/119 (31%), Positives = 60/119 (50%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E ++  R  + E +G+     D   Q       D    K     RD  R+    R+++R+
Sbjct: 249 ETQQRERDREGERDGDKERERDRGRQRDGGRQRD--GEKDRERERDGGRQRDGERQRERD 306

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
            GR+R+ +R++ R+RD  R RD +  RDRE+E      RDG R +D  RD +K K +++
Sbjct: 307 GGRQRDGERDRERERDGGRQRDGD--RDREQE------RDGGRQRDVERDQKKKKKKKK 357

[195][TOP]
>UniRef100_A5D6T9 Zgc:136380 protein n=1 Tax=Danio rerio RepID=A5D6T9_DANRE
          Length = 465

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 50/143 (34%), Positives = 75/143 (52%)
 Frame = -2

Query: 437 TMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           T+ E + +  RR E PE E +     D   +     ++   + +     ++ ++E  + R
Sbjct: 226 TVEELKEKLRRRSEDPEKEDQGKKVKDDREREREEREKRRKEEEEKEKEKEREKERERER 285

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           EK+RE  RERER R++ RDR+R RDR S +S    R  SR   R   RS+DR R   K +
Sbjct: 286 EKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKER 345

Query: 77  DRERDRDGEKERDRDRDHHHRDR 9
           +R+R R  ++ER R RD   R R
Sbjct: 346 ERKRSRSRDRERRRSRDRSDRKR 368

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 58/146 (39%), Positives = 77/146 (52%), Gaps = 7/146 (4%)
 Frame = -2

Query: 428 EYEFEEERRYE-QPEGEGEDNYHNDSSPQPPAAADEDL----TDSKSNHVSRDNDRESSK 264
           E E E+ER  E + E E E     D         D D     + S S H SR +DR  S+
Sbjct: 274 EKEREKEREREREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSR 333

Query: 263 SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
           SR++ R   +ERERKR + RDR+R R RD    + R R R R R R  ER   R R    
Sbjct: 334 SRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKRRSRSRDRRRSRSSERKSHRHR---- 389

Query: 83  SKDRERDRD-GEKERDR-DRDHHHRD 12
           S+ RERDRD G++++D+  +D  H+D
Sbjct: 390 SRSRERDRDRGDRDKDKSSKDKDHKD 415

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 50/146 (34%), Positives = 69/146 (47%), Gaps = 4/146 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E  E+RR E+ E E E     +         + +    +     R+ DR+  + RE+D
Sbjct: 257 EREEREKRRKEEEEKEKEKEREKER--------EREREKERERERERERDRDRDRDRERD 308

Query: 248 RENGRER----ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           R+    R     R   +  DR RSR RD  +SR +ERER R R RD ER + R R   K 
Sbjct: 309 RDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKR 368

Query: 80  KDRERDRDGEKERDRDRDHHHRDRHR 3
           + R RDR   +  +R + H HR R R
Sbjct: 369 RSRSRDRRRSRSSER-KSHRHRSRSR 393

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 49/145 (33%), Positives = 70/145 (48%), Gaps = 16/145 (11%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHN---------DSSPQPPAAADEDLTDSKSNHVSRDNDR 276
           E E E ER  E+      D   +          +S      +D   + S+    SR  +R
Sbjct: 286 EKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKER 345

Query: 275 ESSKSREKDRENGRERER--KREKGRDRDRSRDRDSEKSRDRERERSRDRVRD-GERSKD 105
           E  +SR +DRE  R R+R  ++ + R RDR R R SE+   R R RSR+R RD G+R KD
Sbjct: 346 ERKRSRSRDRERRRSRDRSDRKRRSRSRDRRRSRSSERKSHRHRSRSRERDRDRGDRDKD 405

Query: 104 RG---RDGEKSKDRER-DRDGEKER 42
           +    +D + S D +R  R G  E+
Sbjct: 406 KSSKDKDHKDSSDEKRSSRKGSVEK 430

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 34/91 (37%), Positives = 58/91 (63%), Gaps = 1/91 (1%)
 Frame = -2

Query: 275 ESSKSREKDRENGRERERKREKGRDRDRSRDRDS-EKSRDRERERSRDRVRDGERSKDRG 99
           E  K + + R    E+E + +K +D DR R+R+  EK R  E E+ +++ R+ ER ++R 
Sbjct: 228 EELKEKLRRRSEDPEKEDQGKKVKD-DREREREEREKRRKEEEEKEKEKEREKERERERE 286

Query: 98  RDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
           ++ E+ ++RERDRD +++R+RDRD   R  H
Sbjct: 287 KERERERERERDRDRDRDRERDRDRRSRRSH 317

[196][TOP]
>UniRef100_A1L1N4 Zgc:136380 n=1 Tax=Danio rerio RepID=A1L1N4_DANRE
          Length = 465

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 50/143 (34%), Positives = 75/143 (52%)
 Frame = -2

Query: 437 TMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           T+ E + +  RR E PE E +     D   +     ++   + +     ++ ++E  + R
Sbjct: 226 TVEELKEKLRRRSEDPEKEDQGKKVKDDREREREEREKRRKEEEEKEKEKEREKERERER 285

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           EK+RE  RERER R++ RDR+R RDR S +S    R  SR   R   RS+DR R   K +
Sbjct: 286 EKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKER 345

Query: 77  DRERDRDGEKERDRDRDHHHRDR 9
           +R+R R  ++ER R RD   R R
Sbjct: 346 ERKRSRSRDRERRRSRDRSDRKR 368

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 58/146 (39%), Positives = 77/146 (52%), Gaps = 7/146 (4%)
 Frame = -2

Query: 428 EYEFEEERRYE-QPEGEGEDNYHNDSSPQPPAAADEDL----TDSKSNHVSRDNDRESSK 264
           E E E+ER  E + E E E     D         D D     + S S H SR +DR  S+
Sbjct: 274 EKEREKEREREREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSR 333

Query: 263 SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
           SR++ R   +ERERKR + RDR+R R RD    + R R R R R R  ER   R R    
Sbjct: 334 SRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKRRSRSRDRRRSRSSERKSHRHR---- 389

Query: 83  SKDRERDRD-GEKERDR-DRDHHHRD 12
           S+ RERDRD G++++D+  +D  H+D
Sbjct: 390 SRSRERDRDRGDRDKDKSSKDKDHKD 415

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 50/146 (34%), Positives = 69/146 (47%), Gaps = 4/146 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E  E+RR E+ E E E     +         + +    +     R+ DR+  + RE+D
Sbjct: 257 EREEREKRRKEEEEKEKEKEREKER--------EREREKERERERERERDRDRDRDRERD 308

Query: 248 RENGRER----ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           R+    R     R   +  DR RSR RD  +SR +ERER R R RD ER + R R   K 
Sbjct: 309 RDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKR 368

Query: 80  KDRERDRDGEKERDRDRDHHHRDRHR 3
           + R RDR   +  +R + H HR R R
Sbjct: 369 RSRSRDRRRSRSSER-KSHRHRSRSR 393

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 49/145 (33%), Positives = 70/145 (48%), Gaps = 16/145 (11%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHN---------DSSPQPPAAADEDLTDSKSNHVSRDNDR 276
           E E E ER  E+      D   +          +S      +D   + S+    SR  +R
Sbjct: 286 EKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKER 345

Query: 275 ESSKSREKDRENGRERER--KREKGRDRDRSRDRDSEKSRDRERERSRDRVRD-GERSKD 105
           E  +SR +DRE  R R+R  ++ + R RDR R R SE+   R R RSR+R RD G+R KD
Sbjct: 346 ERKRSRSRDRERRRSRDRSDRKRRSRSRDRRRSRSSERKSHRHRSRSRERDRDRGDRDKD 405

Query: 104 RG---RDGEKSKDRER-DRDGEKER 42
           +    +D + S D +R  R G  E+
Sbjct: 406 KSSKDKDHKDSSDEKRSSRKGSVEK 430

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 34/91 (37%), Positives = 58/91 (63%), Gaps = 1/91 (1%)
 Frame = -2

Query: 275 ESSKSREKDRENGRERERKREKGRDRDRSRDRDS-EKSRDRERERSRDRVRDGERSKDRG 99
           E  K + + R    E+E + +K +D DR R+R+  EK R  E E+ +++ R+ ER ++R 
Sbjct: 228 EELKEKLRRRSEDPEKEDQGKKVKD-DREREREEREKRRKEEEEKEKEKEREKERERERE 286

Query: 98  RDGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
           ++ E+ ++RERDRD +++R+RDRD   R  H
Sbjct: 287 KERERERERERDRDRDRDRERDRDRRSRRSH 317

[197][TOP]
>UniRef100_Q94LP1 Putative U1 small nuclear ribonucleoprotein n=1 Tax=Oryza sativa
           Japonica Group RepID=Q94LP1_ORYSJ
          Length = 491

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 51/117 (43%), Positives = 69/117 (58%), Gaps = 9/117 (7%)
 Frame = -2

Query: 332 ADEDLTDSKSNHVSRDND-----RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK 168
           AD D   S+     RD D     R   ++RE+D +  R   R R++ RDR+R RDR+ + 
Sbjct: 297 ADRDREKSRERPRERDRDERTRERSHDRTRERDSKEDRHHHRDRDRTRDRERGRDRERDH 356

Query: 167 SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH----HHRDR 9
            RDR+RER R   RD +R +DRGRD E+ +DR  DR  E+ RDR+RD+    H RDR
Sbjct: 357 GRDRDRERDR---RDRDRDRDRGRDYERDRDRGHDRHRERGRDRERDYERASHERDR 410

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/130 (40%), Positives = 77/130 (59%), Gaps = 2/130 (1%)
 Frame = -2

Query: 386 GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERER-KREK 210
           G G      +++ Q  +  D+       +   R ++R + + REK RE  RER+R +R +
Sbjct: 259 GLGSSRIGGENAEQKLSTRDQQHAGRPRSEEPRRDERRADRDREKSRERPRERDRDERTR 318

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD-RDGEKERDRD 33
            R  DR+R+RDS++  DR   R RDR RD ER +DR RD  + +DRERD RD +++RDR 
Sbjct: 319 ERSHDRTRERDSKE--DRHHHRDRDRTRDRERGRDRERDHGRDRDRERDRRDRDRDRDRG 376

Query: 32  RDHHHRDRHR 3
           RD + RDR R
Sbjct: 377 RD-YERDRDR 385

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/134 (39%), Positives = 77/134 (57%), Gaps = 3/134 (2%)
 Frame = -2

Query: 404 RYEQPE-GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRER 228
           R E+P   E   +   + S + P   D D    + +H  R  +R+S + R   R+  R R
Sbjct: 286 RSEEPRRDERRADRDREKSRERPRERDRDERTRERSH-DRTRERDSKEDRHHHRDRDRTR 344

Query: 227 ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
           +R+R + R+RD  RDRD E+ R R+R+R RDR RD ER +DRG D  + + R+R+RD E+
Sbjct: 345 DRERGRDRERDHGRDRDRERDR-RDRDRDRDRGRDYERDRDRGHDRHRERGRDRERDYER 403

Query: 47  -ERDRDRDH-HHRD 12
              +RDR H H RD
Sbjct: 404 ASHERDRGHMHERD 417

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/128 (35%), Positives = 71/128 (55%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           + E+  E+P     D    + S       + D  + + +H  RD  R+  + R+++R++G
Sbjct: 300 DREKSRERPRERDRDERTRERSHD--RTRERDSKEDRHHHRDRDRTRDRERGRDRERDHG 357

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           R+R+R+R++ RDRDR RDR     RD ER+R R   R  ER +DR RD E++   ERDR 
Sbjct: 358 RDRDRERDR-RDRDRDRDR----GRDYERDRDRGHDRHRERGRDRERDYERA-SHERDRG 411

Query: 56  GEKERDRD 33
              ERD +
Sbjct: 412 HMHERDAE 419

[198][TOP]
>UniRef100_Q33BE1 Os10g0115600 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q33BE1_ORYSJ
          Length = 463

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 51/117 (43%), Positives = 69/117 (58%), Gaps = 9/117 (7%)
 Frame = -2

Query: 332 ADEDLTDSKSNHVSRDND-----RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK 168
           AD D   S+     RD D     R   ++RE+D +  R   R R++ RDR+R RDR+ + 
Sbjct: 269 ADRDREKSRERPRERDRDERTRERSHDRTRERDSKEDRHHHRDRDRTRDRERGRDRERDH 328

Query: 167 SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH----HHRDR 9
            RDR+RER R   RD +R +DRGRD E+ +DR  DR  E+ RDR+RD+    H RDR
Sbjct: 329 GRDRDRERDR---RDRDRDRDRGRDYERDRDRGHDRHRERGRDRERDYERASHERDR 382

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/130 (40%), Positives = 77/130 (59%), Gaps = 2/130 (1%)
 Frame = -2

Query: 386 GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERER-KREK 210
           G G      +++ Q  +  D+       +   R ++R + + REK RE  RER+R +R +
Sbjct: 231 GLGSSRIGGENAEQKLSTRDQQHAGRPRSEEPRRDERRADRDREKSRERPRERDRDERTR 290

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD-RDGEKERDRD 33
            R  DR+R+RDS++  DR   R RDR RD ER +DR RD  + +DRERD RD +++RDR 
Sbjct: 291 ERSHDRTRERDSKE--DRHHHRDRDRTRDRERGRDRERDHGRDRDRERDRRDRDRDRDRG 348

Query: 32  RDHHHRDRHR 3
           RD + RDR R
Sbjct: 349 RD-YERDRDR 357

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/134 (39%), Positives = 77/134 (57%), Gaps = 3/134 (2%)
 Frame = -2

Query: 404 RYEQPE-GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRER 228
           R E+P   E   +   + S + P   D D    + +H  R  +R+S + R   R+  R R
Sbjct: 258 RSEEPRRDERRADRDREKSRERPRERDRDERTRERSH-DRTRERDSKEDRHHHRDRDRTR 316

Query: 227 ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
           +R+R + R+RD  RDRD E+ R R+R+R RDR RD ER +DRG D  + + R+R+RD E+
Sbjct: 317 DRERGRDRERDHGRDRDRERDR-RDRDRDRDRGRDYERDRDRGHDRHRERGRDRERDYER 375

Query: 47  -ERDRDRDH-HHRD 12
              +RDR H H RD
Sbjct: 376 ASHERDRGHMHERD 389

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/128 (35%), Positives = 71/128 (55%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           + E+  E+P     D    + S       + D  + + +H  RD  R+  + R+++R++G
Sbjct: 272 DREKSRERPRERDRDERTRERSHD--RTRERDSKEDRHHHRDRDRTRDRERGRDRERDHG 329

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           R+R+R+R++ RDRDR RDR     RD ER+R R   R  ER +DR RD E++   ERDR 
Sbjct: 330 RDRDRERDR-RDRDRDRDR----GRDYERDRDRGHDRHRERGRDRERDYERA-SHERDRG 383

Query: 56  GEKERDRD 33
              ERD +
Sbjct: 384 HMHERDAE 391

[199][TOP]
>UniRef100_Q2EIH1 U1 small nuclear ribonucleoprotein 70K n=1 Tax=Oryza sativa
           Japonica Group RepID=Q2EIH1_ORYSJ
          Length = 463

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 51/117 (43%), Positives = 69/117 (58%), Gaps = 9/117 (7%)
 Frame = -2

Query: 332 ADEDLTDSKSNHVSRDND-----RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK 168
           AD D   S+     RD D     R   ++RE+D +  R   R R++ RDR+R RDR+ + 
Sbjct: 269 ADRDREKSRERPRERDRDERTRERSHDRTRERDSKEDRHHHRDRDRTRDRERGRDRERDH 328

Query: 167 SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH----HHRDR 9
            RDR+RER R   RD +R +DRGRD E+ +DR  DR  E+ RDR+RD+    H RDR
Sbjct: 329 GRDRDRERDR---RDRDRDRDRGRDYERDRDRGHDRHRERGRDRERDYERASHERDR 382

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/134 (39%), Positives = 77/134 (57%), Gaps = 3/134 (2%)
 Frame = -2

Query: 404 RYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRER 228
           R E+P   E   +   + S + P   D D    + +H  R  +R+S + R   R+  R R
Sbjct: 258 RSEEPMRDERRADRDREKSRERPRERDRDERTRERSH-DRTRERDSKEDRHHHRDRDRTR 316

Query: 227 ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
           +R+R + R+RD  RDRD E+ R R+R+R RDR RD ER +DRG D  + + R+R+RD E+
Sbjct: 317 DRERGRDRERDHGRDRDRERDR-RDRDRDRDRGRDYERDRDRGHDRHRERGRDRERDYER 375

Query: 47  -ERDRDRDH-HHRD 12
              +RDR H H RD
Sbjct: 376 ASHERDRGHMHERD 389

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 52/130 (40%), Positives = 76/130 (58%), Gaps = 2/130 (1%)
 Frame = -2

Query: 386 GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERER-KREK 210
           G G      +++ Q  +  D+       +     ++R + + REK RE  RER+R +R +
Sbjct: 231 GLGSSRIGGENAEQKLSTRDQQHAGRPRSEEPMRDERRADRDREKSRERPRERDRDERTR 290

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD-RDGEKERDRD 33
            R  DR+R+RDS++  DR   R RDR RD ER +DR RD  + +DRERD RD +++RDR 
Sbjct: 291 ERSHDRTRERDSKE--DRHHHRDRDRTRDRERGRDRERDHGRDRDRERDRRDRDRDRDRG 348

Query: 32  RDHHHRDRHR 3
           RD + RDR R
Sbjct: 349 RD-YERDRDR 357

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/128 (35%), Positives = 71/128 (55%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           + E+  E+P     D    + S       + D  + + +H  RD  R+  + R+++R++G
Sbjct: 272 DREKSRERPRERDRDERTRERSHD--RTRERDSKEDRHHHRDRDRTRDRERGRDRERDHG 329

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           R+R+R+R++ RDRDR RDR     RD ER+R R   R  ER +DR RD E++   ERDR 
Sbjct: 330 RDRDRERDR-RDRDRDRDR----GRDYERDRDRGHDRHRERGRDRERDYERA-SHERDRG 383

Query: 56  GEKERDRD 33
              ERD +
Sbjct: 384 HMHERDAE 391

[200][TOP]
>UniRef100_B9G790 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9G790_ORYSJ
          Length = 476

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 51/117 (43%), Positives = 69/117 (58%), Gaps = 9/117 (7%)
 Frame = -2

Query: 332 ADEDLTDSKSNHVSRDND-----RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEK 168
           AD D   S+     RD D     R   ++RE+D +  R   R R++ RDR+R RDR+ + 
Sbjct: 282 ADRDREKSRERPRERDRDERTRERSHDRTRERDSKEDRHHHRDRDRTRDRERGRDRERDH 341

Query: 167 SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH----HHRDR 9
            RDR+RER R   RD +R +DRGRD E+ +DR  DR  E+ RDR+RD+    H RDR
Sbjct: 342 GRDRDRERDR---RDRDRDRDRGRDYERDRDRGHDRHRERGRDRERDYERASHERDR 395

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/130 (40%), Positives = 77/130 (59%), Gaps = 2/130 (1%)
 Frame = -2

Query: 386 GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERER-KREK 210
           G G      +++ Q  +  D+       +   R ++R + + REK RE  RER+R +R +
Sbjct: 244 GLGSSRIGGENAEQKLSTRDQQHAGRPRSEEPRRDERRADRDREKSRERPRERDRDERTR 303

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD-RDGEKERDRD 33
            R  DR+R+RDS++  DR   R RDR RD ER +DR RD  + +DRERD RD +++RDR 
Sbjct: 304 ERSHDRTRERDSKE--DRHHHRDRDRTRDRERGRDRERDHGRDRDRERDRRDRDRDRDRG 361

Query: 32  RDHHHRDRHR 3
           RD + RDR R
Sbjct: 362 RD-YERDRDR 370

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/134 (39%), Positives = 77/134 (57%), Gaps = 3/134 (2%)
 Frame = -2

Query: 404 RYEQPE-GEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRER 228
           R E+P   E   +   + S + P   D D    + +H  R  +R+S + R   R+  R R
Sbjct: 271 RSEEPRRDERRADRDREKSRERPRERDRDERTRERSH-DRTRERDSKEDRHHHRDRDRTR 329

Query: 227 ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
           +R+R + R+RD  RDRD E+ R R+R+R RDR RD ER +DRG D  + + R+R+RD E+
Sbjct: 330 DRERGRDRERDHGRDRDRERDR-RDRDRDRDRGRDYERDRDRGHDRHRERGRDRERDYER 388

Query: 47  -ERDRDRDH-HHRD 12
              +RDR H H RD
Sbjct: 389 ASHERDRGHMHERD 402

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/128 (35%), Positives = 71/128 (55%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           + E+  E+P     D    + S       + D  + + +H  RD  R+  + R+++R++G
Sbjct: 285 DREKSRERPRERDRDERTRERSHD--RTRERDSKEDRHHHRDRDRTRDRERGRDRERDHG 342

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           R+R+R+R++ RDRDR RDR     RD ER+R R   R  ER +DR RD E++   ERDR 
Sbjct: 343 RDRDRERDR-RDRDRDRDR----GRDYERDRDRGHDRHRERGRDRERDYERA-SHERDRG 396

Query: 56  GEKERDRD 33
              ERD +
Sbjct: 397 HMHERDAE 404

[201][TOP]
>UniRef100_B3N400 GG10289 n=1 Tax=Drosophila erecta RepID=B3N400_DROER
          Length = 956

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 52/127 (40%), Positives = 78/127 (61%), Gaps = 1/127 (0%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E ER  E    E  D+  +D    P  A ++          +RD +R+S + RE  RE  
Sbjct: 67  ERERPNEVISLEESDSDSSDCVEVPVQAQEQAKVRDARESSNRDKERDSGRERELLREKE 126

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDR-VRDGERSKDRGRDGEKSKDRERDR 60
           RERER+RE+ R+R+R RDR+ E+ R+RE+ER R+R  R+ ER K+R ++ EK + RER+R
Sbjct: 127 RERERERERDRERERDRDREKEREREREKERLREREEREREREKERLKEREKERLRERER 186

Query: 59  DGEKERD 39
           + E+ER+
Sbjct: 187 ERERERE 193

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 47/148 (31%), Positives = 69/148 (46%), Gaps = 30/148 (20%)
 Frame = -2

Query: 356 SSPQPPAAADEDLT-----DSKSNHVSRDNDRESSKSREKDRENGRERERKRE------- 213
           S  Q  A  DED+T     DS S H  R +  +  K         +ERER  E       
Sbjct: 23  SERQRRATEDEDVTLDLTDDSSSRH--RHHKHKKHKEHRHKHHKQKERERPNEVISLEES 80

Query: 212 ------------------KGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGE 87
                             K RD   S +RD E+   RERE  R++ R+ ER ++R R+ E
Sbjct: 81  DSDSSDCVEVPVQAQEQAKVRDARESSNRDKERDSGRERELLREKERERERERERDRERE 140

Query: 86  KSKDRERDRDGEKERDRDRDHHHRDRHR 3
           + +DRE++R+ E+E++R R+   R+R R
Sbjct: 141 RDRDREKEREREREKERLREREERERER 168

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 36/98 (36%), Positives = 59/98 (60%), Gaps = 3/98 (3%)
 Frame = -2

Query: 287 DNDRESSKSRE---KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE 117
           ++D +SS   E   + +E  + R+ +    RD++R   R+ E  R++ERER R+R RD E
Sbjct: 79  ESDSDSSDCVEVPVQAQEQAKVRDARESSNRDKERDSGRERELLREKERERERERERDRE 138

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R +DR R      ++ER+R+ EKER R+R+   R+R +
Sbjct: 139 RERDRDR------EKEREREREKERLREREEREREREK 170

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 38/142 (26%), Positives = 66/142 (46%), Gaps = 6/142 (4%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E ER  E+      +   +    +      E L + +     R+ +RE  + +E+++E
Sbjct: 124 EKERERERERERDRERERDRDREKEREREREKERLREREE----REREREKERLKEREKE 179

Query: 242 NGRERERKREKGRDRDR------SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
             RERER+RE+ R+         S+  + E  R+RE ER RD  +   R ++R R+ E+S
Sbjct: 180 RLRERERERERERELTAPPPPQISKHAEYESRREREIERERDARKRSGRERERERNRERS 239

Query: 80  KDRERDRDGEKERDRDRDHHHR 15
           + +       K   R+R+   R
Sbjct: 240 RSQSPPSASRKPATREREPSSR 261

[202][TOP]
>UniRef100_A7US43 AGAP011217-PA n=1 Tax=Anopheles gambiae RepID=A7US43_ANOGA
          Length = 1241

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 50/150 (33%), Positives = 92/150 (61%), Gaps = 7/150 (4%)
 Frame = -2

Query: 431  GEYEFEEER---RYEQPEGEGEDNYHNDSSPQPPAAA-DEDLTDSKSNHVSRDNDRESSK 264
            G+++ E ER   R  Q + E E + + +      A   D D    K     ++ ++E  +
Sbjct: 713  GDHQRERERERDRDRQRDREREKDRNKEKERGDHAEHHDRDRDRRKEKEREKEKEKERER 772

Query: 263  SREKDRENGRERERKREKGRDRDRSRDRDSEKSR---DRERERSRDRVRDGERSKDRGRD 93
             +E++RE  RE+ER++E+ RDR++ RD++ ++ R   DRERE+ RD+ +D +  KDR R+
Sbjct: 773  EKEREREKVREKEREKERLRDREKERDKEKDRERGEKDREREKDRDKEKDRDMEKDRERE 832

Query: 92   GEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             E+ K+RE++R+ E+E++R+++   RDR +
Sbjct: 833  KEREKEREKEREKEREKEREKE---RDREK 859

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/162 (31%), Positives = 84/162 (51%), Gaps = 22/162 (13%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDN------------- 282
            E E++R  E+  G+  +++  D   +     +++    +     R+              
Sbjct: 732  EREKDRNKEKERGDHAEHHDRDRDRRKEKEREKEKEKEREREKEREREKVREKEREKERL 791

Query: 281  -DRESSKSREKDRENG---RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER 114
             DRE  + +EKDRE G   RERE+ R+K +DRD  +DR+ EK R++ERE+ R++ R+ ER
Sbjct: 792  RDREKERDKEKDRERGEKDREREKDRDKEKDRDMEKDREREKEREKEREKEREKEREKER 851

Query: 113  SKDRGRDGEK-----SKDRERDRDGEKERDRDRDHHHRDRHR 3
             K+R R+ +K     SK + RD   E  RDR +D   + R +
Sbjct: 852  EKERDREKDKDGKEVSKKKTRDSSDEDRRDRKKDRDKKKRKK 893

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 44/146 (30%), Positives = 84/146 (57%), Gaps = 6/146 (4%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E+E+  E+ +    +        +      E   D + +    + DRE  K R+K+
Sbjct: 761  EREKEKEKEREREKEREREKVREKEREKERLRDREKERDKEKDRERGEKDREREKDRDKE 820

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG-ERSKDRGRDG--EKSK 78
            ++   E++R+REK R+++R ++R+ E+ ++RE+ER R++ +DG E SK + RD   E  +
Sbjct: 821  KDRDMEKDREREKEREKEREKEREKEREKEREKERDREKDKDGKEVSKKKTRDSSDEDRR 880

Query: 77   DRERDRD---GEKERDRDRDHHHRDR 9
            DR++DRD    +KE++ ++  H ++R
Sbjct: 881  DRKKDRDKKKRKKEKEVEKRKHKKER 906

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 2/140 (1%)
 Frame = -2

Query: 416  EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            E   R  +  G G ++  +    +   +  +  ++    H  R  D      RE+ +E G
Sbjct: 648  ERSNRGSRSAGGGGEHERDKQDRKHQPSEKDKRSEPVDQHGRRGGDERDHHHRERGKERG 707

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVR-DGERSKDRGRDGEKSKDRERDR 60
             E ER  +  R+R+R RDRD ++ R+RE++R++++ R D     DR RD  K K+RE+++
Sbjct: 708  -ENERGGDHQRERERERDRDRQRDREREKDRNKEKERGDHAEHHDRDRDRRKEKEREKEK 766

Query: 59   DGEKERDRDRDHHH-RDRHR 3
            + E+ER+++R+    R++ R
Sbjct: 767  EKEREREKEREREKVREKER 786

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 45/147 (30%), Positives = 74/147 (50%), Gaps = 5/147 (3%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E+ER  ++ +   ++              D D    K      + DRE  K REK+
Sbjct: 783  EKEREKERLRDREKERDKEKDRERGEKDREREKDRD----KEKDRDMEKDREREKEREKE 838

Query: 248  RENGRERERKREKGRDRDRSRDRD-----SEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
            RE  RE+ER++E+ ++RDR +D+D      +K+RD   E  RDR +D ++ K   R  EK
Sbjct: 839  REKEREKEREKEREKERDREKDKDGKEVSKKKTRDSSDEDRRDRKKDRDKKK---RKKEK 895

Query: 83   SKDRERDRDGEKERDRDRDHHHRDRHR 3
              ++ + +   KE+D++R    R + R
Sbjct: 896  EVEKRKHKKERKEKDKERRSKDRRKER 922

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 44/153 (28%), Positives = 77/153 (50%), Gaps = 20/153 (13%)
 Frame = -2

Query: 428  EYEFEEERRYEQP-EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            E E E+ER  E+  E E E     D   +     D +  + K     +D D+E  +  EK
Sbjct: 769  EREREKEREREKVREKEREKERLRDREKERDKEKDRERGE-KDREREKDRDKEKDRDMEK 827

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRE-------------------RERSRDRV 129
            DRE  +ERE++REK R+++R ++R+ E+ R+++                   R+R +DR 
Sbjct: 828  DREREKEREKEREKEREKEREKEREKERDREKDKDGKEVSKKKTRDSSDEDRRDRKKDRD 887

Query: 128  RDGERSKDRGRDGEKSKDRERDRDGEKERDRDR 30
            +  +R K++  +  K K   +++D E+ R +DR
Sbjct: 888  KK-KRKKEKEVEKRKHKKERKEKDKER-RSKDR 918

[203][TOP]
>UniRef100_Q7S1G9 Predicted protein n=1 Tax=Neurospora crassa RepID=Q7S1G9_NEUCR
          Length = 856

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 68/191 (35%), Positives = 92/191 (48%), Gaps = 48/191 (25%)
 Frame = -2

Query: 431  GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKS-NHVSRDNDRESSKSR- 258
            GEY  E +RR E+ E     N       + P+  D D   S+  +   RD DR+ S+SR 
Sbjct: 646  GEYA-ERKRREEERENRRRSN-------RDPSRDDRDRDRSRHRDDKERDRDRDRSRSRV 697

Query: 257  ------------EKDRENGRE-----RERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
                        ++DR++ R+     R+R RE+ R+RDR RDRD    RDRERER RDR 
Sbjct: 698  RPRDLVGADLGRDRDRDHHRDPSRSRRDRDRERDRERDRERDRDLRDPRDRERERERDRD 757

Query: 128  RD-------------------GERSKDRGRDGEKSKDRERDRDG----------EKERDR 36
            RD                   GER +DR RD ++ +DRERDRD           +++RDR
Sbjct: 758  RDRERGDRDRDRDSRYRDGGGGERDRDRDRDRDRDRDRERDRDRGDRHRSSRHHDRDRDR 817

Query: 35   DRDHHHRDRHR 3
            +RD     R R
Sbjct: 818  ERDRERERRER 828

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 63/167 (37%), Positives = 83/167 (49%), Gaps = 41/167 (24%)
 Frame = -2

Query: 380  GEDNYHNDSSPQPPAAADED----LTDSKSNHV--SRDNDRESS-------KSREKDREN 240
            G+DN    SS   P+++       L +  +NHV   RD  +E S       K RE++REN
Sbjct: 601  GDDNSKISSSITSPSSSTTAPKPILKNKNTNHVRFGRDGPKEISPGEYAERKRREEEREN 660

Query: 239  -----------GRERERKR---EKGRDRDRSRDRDSEKSR-----DRERERSRDRVRDGE 117
                        R+R+R R   +K RDRDR R R   + R     D  R+R RD  RD  
Sbjct: 661  RRRSNRDPSRDDRDRDRSRHRDDKERDRDRDRSRSRVRPRDLVGADLGRDRDRDHHRDPS 720

Query: 116  RS-KDRGRDGEKSKDRERDRD--------GEKERDRDRDHHHRDRHR 3
            RS +DR R+ ++ +DRERDRD         E+ERDRDRD    DR R
Sbjct: 721  RSRRDRDRERDRERDRERDRDLRDPRDRERERERDRDRDRERGDRDR 767

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 42/100 (42%), Positives = 56/100 (56%), Gaps = 6/100 (6%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK------GRDRDRSRDRDSEK 168
            D DL D       RD +RE  + R++DRE G +R+R R+       G +RDR RDRD ++
Sbjct: 739  DRDLRDP------RDRERERERDRDRDRERG-DRDRDRDSRYRDGGGGERDRDRDRDRDR 791

Query: 167  SRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEK 48
             RDRER+R R       R  DR RD E+ ++RER    EK
Sbjct: 792  DRDRERDRDRGDRHRSSRHHDRDRDRERDRERERRERSEK 831

[204][TOP]
>UniRef100_Q86AH4 Putative uncharacterized protein DDB_G0271982 n=1 Tax=Dictyostelium
           discoideum RepID=Y8592_DICDI
          Length = 629

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 39/102 (38%), Positives = 71/102 (69%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           K   + ++ ++E  K +EK++E  +E E++REK ++R+R R+R+ E+ R+RERER R+R 
Sbjct: 302 KEKEIEKEKEKEKEKEKEKEKEKEKEIEKEREKEKERERERERERERERERERERERERE 361

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R+ E+ K+R R+ E+ ++RER+R+ E E++R      R+R +
Sbjct: 362 REKEKEKEREREREREREREREREKEFEKERREREKEREREK 403

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 37/90 (41%), Positives = 68/90 (75%)
 Frame = -2

Query: 296 VSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE 117
           V  + ++E  K  EK++E  +E+E+++EK ++++  ++R+ EK R+RERER R+R R+ E
Sbjct: 294 VKTEKEKEKEKEIEKEKEKEKEKEKEKEKEKEKEIEKEREKEKERERERERERERERERE 353

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
           R ++R R+ EK K++ER+R+ E+ER+R+R+
Sbjct: 354 REREREREREKEKEKERERERERERERERE 383

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 35/102 (34%), Positives = 73/102 (71%)
 Frame = -2

Query: 308 KSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV 129
           K     ++ ++E  K +EK++E  +E+E++ EK R++++ R+R+ E+ R+RERER R+R 
Sbjct: 298 KEKEKEKEIEKEKEKEKEKEKEKEKEKEKEIEKEREKEKERERERERERERERERERERE 357

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R+ ER K++ ++ E+ ++RER+R+ E+E++ +++   R++ R
Sbjct: 358 REREREKEKEKEREREREREREREREREKEFEKERREREKER 399

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 38/112 (33%), Positives = 72/112 (64%)
 Frame = -2

Query: 344 PPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKS 165
           P    +++    K     ++ ++E  K +EK++E   E+ER++EK R+R+R R+R+ E+ 
Sbjct: 292 PRVKTEKEKEKEKEIEKEKEKEKEKEKEKEKEKEKEIEKEREKEKERERERERERERERE 351

Query: 164 RDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           R+RERER R+R ++ E+ ++R R+ E+ ++RER+++ EKER        R++
Sbjct: 352 REREREREREREKEKEKEREREREREREREREREKEFEKERREREKEREREK 403

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 41/122 (33%), Positives = 74/122 (60%), Gaps = 3/122 (2%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
           E E E     +   +     +++    K   + ++ ++E  + RE++RE  RERER+RE+
Sbjct: 297 EKEKEKEKEIEKEKEKEKEKEKEKEKEKEKEIEKEREKEKERERERERERERERERERER 356

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER---DRDGEKERD 39
            R+R+R ++++ E+ R+RERER R+R R+ E  K+R R+ EK ++RE+    +D EK+  
Sbjct: 357 EREREREKEKEKEREREREREREREREREKEFEKER-REREKEREREKLNITKDKEKQVI 415

Query: 38  RD 33
           R+
Sbjct: 416 RE 417

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 43/130 (33%), Positives = 76/130 (58%)
 Frame = -2

Query: 392 PEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKRE 213
           P  + E     +   +     +++    K     ++ ++E  K +E++RE  RERER+RE
Sbjct: 292 PRVKTEKEKEKEKEIEKEKEKEKEKEKEKEKEKEKEIEKEREKEKERERERERERERERE 351

Query: 212 KGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRD 33
           + R+R+R R+R+ EK ++RERER R+R R+ ER        EK  ++ER R+ EKER+R+
Sbjct: 352 REREREREREREKEKEKERERERERERERERER--------EKEFEKER-REREKERERE 402

Query: 32  RDHHHRDRHR 3
           + +  +D+ +
Sbjct: 403 KLNITKDKEK 412

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 37/117 (31%), Positives = 70/117 (59%), Gaps = 1/117 (0%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E+ + ++ E E E     +   +     ++++   +     R+ +RE  + RE++RE  R
Sbjct: 297 EKEKEKEKEIEKEKEKEKEKEKEKEKEKEKEIEKEREKEKERERERERERERERERERER 356

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG-EKSKDRER 66
           ERER+REK ++++R R+R+ E+ R+RERE+  ++ R  ER K+R R+    +KD+E+
Sbjct: 357 EREREREKEKEKEREREREREREREREREKEFEKER-REREKEREREKLNITKDKEK 412

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 42/127 (33%), Positives = 71/127 (55%), Gaps = 3/127 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+E+  E+ E E E     +   +     +++    K     R+ +RE  + RE++
Sbjct: 297 EKEKEKEKEIEK-EKEKEKEKEKEKEKEKEKEIEKEREKEKERERERERERERERERERE 355

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR---GRDGEKSK 78
           RE  RERE+++EK R+R+R R+R+ E+ R++E E+ R R R+ ER +++    +D EK  
Sbjct: 356 REREREREKEKEKEREREREREREREREREKEFEKER-REREKEREREKLNITKDKEKQV 414

Query: 77  DRERDRD 57
            RE   D
Sbjct: 415 IRETTID 421

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 33/123 (26%), Positives = 67/123 (54%), Gaps = 3/123 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E+E+  E+ E E E     +   +     + +    +     R+ +RE  + +EK+
Sbjct: 309 EKEKEKEKEKEK-EKEKEKEIEKEREKEKEREREREREREREREREREREREREREKEKE 367

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV---RDGERSKDRGRDGEKSK 78
           +E  RERER+RE+ R+R++  +++    R+RE+ER R+++   +D E+   R    +++ 
Sbjct: 368 KEREREREREREREREREKEFEKE---RREREKEREREKLNITKDKEKQVIRETTIDETL 424

Query: 77  DRE 69
           ++E
Sbjct: 425 NKE 427

[205][TOP]
>UniRef100_UPI000186EC2B serine/threonine-protein kinase prp4, putative n=1 Tax=Pediculus
           humanus corporis RepID=UPI000186EC2B
          Length = 905

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/139 (38%), Positives = 80/139 (57%), Gaps = 19/139 (13%)
 Frame = -2

Query: 371 NYHNDSSPQPPAAADEDLTDS-KSNHVSRDNDRES-------SKSREKDRENGRERE--- 225
           N   DS  +      ED  +S +  H +RD DR+        S+ R +D++N R +E   
Sbjct: 240 NTSKDSKEKKVTKVKEDKRNSDRDRHRNRDRDRKDKSPVRSRSRDRTRDKKNDRRKEVDL 299

Query: 224 -----RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG---EKSKDRE 69
                R+REK R+R R R+R+ E+ R+RER+R R+R RD ER +DR RD    E+ +DR+
Sbjct: 300 RTEINREREKERERQRQRERERERERERERDRERERQRDRERDRDRDRDRLRRERERDRD 359

Query: 68  RDRDGEKERDRDRDHHHRD 12
           +DRD ++E +RDR    R+
Sbjct: 360 KDRDRDREHERDRSSSRRN 378

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 45/138 (32%), Positives = 76/138 (55%), Gaps = 6/138 (4%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           E++R  ++      D    D SP    + D             D   E ++ REK+RE  
Sbjct: 255 EDKRNSDRDRHRNRDRDRKDKSPVRSRSRDRTRDKKNDRRKEVDLRTEINREREKERERQ 314

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           R+RER+RE+ R+R+R R+R+ ++ R+R+R+R RDR+R  ER +DR +D ++ ++ ERDR 
Sbjct: 315 RQRERERERERERERDRERERQRDRERDRDRDRDRLR-RERERDRDKDRDRDREHERDRS 373

Query: 56  GEK------ERDRDRDHH 21
             +       R++D+  H
Sbjct: 374 SSRRNNVISSRNKDKSKH 391

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 44/115 (38%), Positives = 73/115 (63%), Gaps = 11/115 (9%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESSKSREKDRENGRERERKRE---KGRDRDRSRDRDSEKSRD----- 159
           DSK   V++   +E  ++ ++DR   R+R+RK +   + R RDR+RD+ +++ ++     
Sbjct: 244 DSKEKKVTKV--KEDKRNSDRDRHRNRDRDRKDKSPVRSRSRDRTRDKKNDRRKEVDLRT 301

Query: 158 ---RERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
              RERE+ R+R R  ER ++R R+ E+ ++RER RD E++RDRDRD   R+R R
Sbjct: 302 EINREREKERERQRQRERERERERERERDRERERQRDRERDRDRDRDRLRRERER 356

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 45/144 (31%), Positives = 76/144 (52%), Gaps = 13/144 (9%)
 Frame = -2

Query: 395 QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKR 216
           +P    ++    ++ P+  +  D+  +DS      + + R +SK   K+++  + +E KR
Sbjct: 202 EPLNSSKEKKETENKPELISLLDD--SDSGKESQIKSSGRNTSKD-SKEKKVTKVKEDKR 258

Query: 215 EKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSK----------DRGRDGEKSKDRER 66
              RDR R+RDRD  K +   R RSRDR RD +  +          +R R+ E+ + R+R
Sbjct: 259 NSDRDRHRNRDRD-RKDKSPVRSRSRDRTRDKKNDRRKEVDLRTEINREREKERERQRQR 317

Query: 65  DRDGEKERDRDRD---HHHRDRHR 3
           +R+ E+ER+R+RD      RDR R
Sbjct: 318 ERERERERERERDRERERQRDRER 341

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 29/86 (33%), Positives = 48/86 (55%), Gaps = 9/86 (10%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDR---------SRDRDSEKSRDRERERSR 138
           R+ +RE  + RE+DRE  R+R+R+R++ RDRDR          +DRD ++  +R+R  SR
Sbjct: 317 RERERERERERERDRERERQRDRERDRDRDRDRLRRERERDRDKDRDRDREHERDRSSSR 376

Query: 137 DRVRDGERSKDRGRDGEKSKDRERDR 60
                  R+KD+ +     K  + D+
Sbjct: 377 RNNVISSRNKDKSKHSLYRKKTKSDK 402

[206][TOP]
>UniRef100_UPI000155C6AF PREDICTED: hypothetical protein, partial n=1 Tax=Ornithorhynchus
           anatinus RepID=UPI000155C6AF
          Length = 221

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 50/138 (36%), Positives = 83/138 (60%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +E ++  + E + E      S P+      E     K     R  +R+  + RE+ RE  
Sbjct: 5   KERKKERKKERKKERKRERKSEPKK-----EKKEGKKERRKERKKERKKERKRERKRE-- 57

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
           R++ERK+E+ R+R+R R+R+ EK R++ERER R+R R+ ER ++R R+ E+ ++RER+R 
Sbjct: 58  RKKERKKERKREREREREREREKEREKERERERERERERERERERERERERERERERERK 117

Query: 56  GEKERDRDRDHHHRDRHR 3
            EKER R+R+   R++ R
Sbjct: 118 REKERKRERE-KEREKER 134

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 41/96 (42%), Positives = 67/96 (69%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+  RE  K R+K+R+  RERER+RE+ ++R++ R+R+ E+ R+RERER R+R R+ ER 
Sbjct: 52  RERKRERKKERKKERKREREREREREREKEREKERERERERERERERERERERERERERE 111

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ++R R  EK + RER+++ EKER ++R    +   +
Sbjct: 112 RERERKREKERKREREKEREKERKKERKKERKKERK 147

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 46/139 (33%), Positives = 81/139 (58%), Gaps = 2/139 (1%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADE--DLTDSKSNHVSRDNDRESSKSREKD 249
           E + E + E+ EG+ E         +     +   +    +     R+ +RE  + REK+
Sbjct: 22  ERKSEPKKEKKEGKKERRKERKKERKKERKRERKRERKKERKKERKREREREREREREKE 81

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           RE  RERER+RE+ R+R+R R+R+ E+ R+RERER R++ R  ER K+R ++ +K + +E
Sbjct: 82  REKERERERERERERERERERERERERERERERERKREKERKREREKEREKERKKERKKE 141

Query: 68  RDRDGEKERDRDRDHHHRD 12
           R ++ +KER ++R    ++
Sbjct: 142 RKKERKKERKKERKEGRKE 160

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 40/132 (30%), Positives = 80/132 (60%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E ++ER+ E+ +    +        +     +      K     R  +R+  + +E+ +E
Sbjct: 6   ERKKERKKERKKERKRERKSEPKKEKKEGKKERRKERKKERKKERKRERKRERKKERKKE 65

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             RERER+RE+ R+++R ++R+ E+ R+RERER R+R R+ ER ++R R+ ++ K+R+R+
Sbjct: 66  RKREREREREREREKEREKERERERERERERERERERERERERERERERERKREKERKRE 125

Query: 62  RDGEKERDRDRD 27
           R+ E+E++R ++
Sbjct: 126 REKEREKERKKE 137

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 47/143 (32%), Positives = 81/143 (56%)
 Frame = -2

Query: 440 PTMGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS 261
           P   + E ++ERR E+ +   ++        +      E     +     R+ +RE  K 
Sbjct: 27  PKKEKKEGKKERRKERKKERKKERKRERKRERKKERKKE-----RKREREREREREREKE 81

Query: 260 REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           REK+RE  RERER+RE+ R+R+R R+R+ E+ R+R+RE+ R R R+ ER K+R ++ +K 
Sbjct: 82  REKERERERERERERERERERERERERERERERERKREKERKREREKEREKERKKERKKE 141

Query: 80  KDRERDRDGEKERDRDRDHHHRD 12
           + +ER ++ +KER   R    ++
Sbjct: 142 RKKERKKERKKERKEGRKEGRKE 164

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 41/132 (31%), Positives = 80/132 (60%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E ++ER+ E+ +   ++      S       +      K     R  +R+  + RE+ +E
Sbjct: 2   ERKKERKKERKKERKKERKRERKSEPKKEKKEGKKERRKERKKERKKERKRERKRERKKE 61

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             +ER+R+RE+ R+R+R ++R+ E+ R+RERER R+R R+ ER ++R R+ E+ + RE++
Sbjct: 62  RKKERKREREREREREREKEREKERERERERERERERERERERERERERERERERKREKE 121

Query: 62  RDGEKERDRDRD 27
           R  E+E++R+++
Sbjct: 122 RKREREKEREKE 133

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 37/96 (38%), Positives = 68/96 (70%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           ++  +E  + RE++RE  RE+ER++E+ R+R+R R+R+ E+ R+RERER R+R R+ +R 
Sbjct: 60  KERKKERKREREREREREREKEREKERERERERERERERERERERERERERERERERKRE 119

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           K+R R+ EK +++ER ++ +KER ++R    +   +
Sbjct: 120 KERKREREKEREKERKKERKKERKKERKKERKKERK 155

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 35/96 (36%), Positives = 68/96 (70%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+  +E  K R+++RE  RERER++E+ ++R+R R+R+ E+ R+RERER R+R R+ ER 
Sbjct: 56  RERKKERKKERKREREREREREREKEREKERERERERERERERERERERERERERERERE 115

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           + R ++ ++ +++ER+++ +KER ++R    +   +
Sbjct: 116 RKREKERKREREKEREKERKKERKKERKKERKKERK 151

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 40/109 (36%), Positives = 70/109 (64%), Gaps = 13/109 (11%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERK-------------REKGRDRDRSRDRDSEKSRDRER 150
           ++  +E  K R+K+R+  R+RERK             R K R ++R ++R  E+ R+R++
Sbjct: 1   KERKKERKKERKKERKKERKRERKSEPKKEKKEGKKERRKERKKERKKERKRERKRERKK 60

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ER ++R R+ ER ++R R+ E+ K+RER+R+ E+ER+R+R+   R+R R
Sbjct: 61  ERKKERKREREREREREREKEREKERERERERERERERERE-RERERER 108

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 39/138 (28%), Positives = 74/138 (53%), Gaps = 1/138 (0%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           E +R  + E + E     +   +     + +    +     R+ +RE  + RE++RE  R
Sbjct: 53  ERKRERKKERKKERKREREREREREREKEREKERERERERERERERERERERERERERER 112

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR-DGEKSKDRERDRD 57
           ERERKREK R R+R ++R+ E+ ++R++ER ++R ++ ++ +  GR +G K   +E  ++
Sbjct: 113 ERERKREKERKREREKEREKERKKERKKERKKERKKERKKERKEGRKEGRKEGRKEGRKE 172

Query: 56  GEKERDRDRDHHHRDRHR 3
           G KE  +      R + R
Sbjct: 173 GRKEERKKERKKERKKER 190

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 37/139 (26%), Positives = 74/139 (53%), Gaps = 1/139 (0%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +E ++  + E + E         +     + +    K     R+ +RE  + RE++RE  
Sbjct: 44  KERKKERKRERKRERKKERKKERKREREREREREREKEREKERERERERERERERERERE 103

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR- 60
           RERER+RE+ R+R R ++R  E+ ++RE+ER ++R ++ ++ + + R  E+ + R+  R 
Sbjct: 104 RERERERERERERKREKERKREREKEREKERKKERKKERKKERKKERKKERKEGRKEGRK 163

Query: 59  DGEKERDRDRDHHHRDRHR 3
           +G KE  ++     R + R
Sbjct: 164 EGRKEGRKEGRKEERKKER 182

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 37/152 (24%), Positives = 76/152 (50%), Gaps = 14/152 (9%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +E +R  + E E E     +   +     + +    +     R+ +RE  + R++++E  
Sbjct: 64  KERKREREREREREREKEREKERERERERERERERERERERERERERERERERKREKERK 123

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRV--------------RDGERSKDRG 99
           RERE++REK R ++R ++R  E+ ++R++ER   R               R  ER K+R 
Sbjct: 124 REREKEREKERKKERKKERKKERKKERKKERKEGRKEGRKEGRKEGRKEGRKEERKKERK 183

Query: 98  RDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           ++ +K + +ER ++ +KER ++R    +   +
Sbjct: 184 KERKKERKKERKKERKKERKKERKKERKKERK 215

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 38/142 (26%), Positives = 77/142 (54%), Gaps = 10/142 (7%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E ++ER+ E+   E E     +   +     + +    +     R+ +RE  + RE++RE
Sbjct: 57  ERKKERKKERKR-EREREREREREKEREKERERERERERERERERERERERERERERERE 115

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR----------GRD 93
             RE+ERKRE+ ++R++ R ++ +K R +ER++ R + R   R + R          GR 
Sbjct: 116 RKREKERKREREKEREKERKKERKKERKKERKKERKKERKEGRKEGRKEGRKEGRKEGRK 175

Query: 92  GEKSKDRERDRDGEKERDRDRD 27
            E+ K+R+++R  E++++R ++
Sbjct: 176 EERKKERKKERKKERKKERKKE 197

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/133 (26%), Positives = 69/133 (51%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E     +   +       +    +     R+ +R+  + +E+ 
Sbjct: 85  ERERERERERER-ERERERERERERERERERERKREKERKREREKEREKERKKERKKERK 143

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           +E  +ER+++R++GR   R   R   +   R+ ER ++R +  ER K+R ++ +K + +E
Sbjct: 144 KERKKERKKERKEGRKEGRKEGRKEGRKEGRKEERKKERKK--ERKKERKKERKKERKKE 201

Query: 68  RDRDGEKERDRDR 30
           R ++ +KER ++R
Sbjct: 202 RKKERKKERKKER 214

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 35/132 (26%), Positives = 67/132 (50%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E     +   +     +++    +     ++  +E  K R+K+
Sbjct: 87  ERERERERERER-ERERERERERERERERERKREKERKREREKEREKERKKERKKERKKE 145

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R+  R++ERK  +   R   R    ++ R  ER++ R + R  ER K+R ++ +K + +E
Sbjct: 146 RKKERKKERKEGRKEGRKEGRKEGRKEGRKEERKKERKKERKKERKKERKKERKKERKKE 205

Query: 68  RDRDGEKERDRD 33
           R ++ +KER ++
Sbjct: 206 RKKERKKERKKE 217

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 35/130 (26%), Positives = 69/130 (53%), Gaps = 2/130 (1%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E         +     +++    +     ++  +E  K R+K+
Sbjct: 95  ERERERERERER-ERERERERERKREKERKREREKEREKERKKERKKERKKERKKERKKE 153

Query: 248 RENGRERERK--REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           R+ GR+  RK  R++GR   R  +R  E+ ++R++ER ++R +  ER K+R ++ +K + 
Sbjct: 154 RKEGRKEGRKEGRKEGRKEGRKEERKKERKKERKKERKKERKK--ERKKERKKERKKERK 211

Query: 74  RERDRDGEKE 45
           +ER ++  ++
Sbjct: 212 KERKKESAEK 221

[207][TOP]
>UniRef100_B0S5D8 Novel protein (Zgc:66359) n=1 Tax=Danio rerio RepID=B0S5D8_DANRE
          Length = 1759

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 52/147 (35%), Positives = 84/147 (57%), Gaps = 10/147 (6%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAAD--------EDLTDSKSNHVSRDNDRESSKSR 258
            +ERR    E +  DN   +     P            E+  D + N    D   + ++ R
Sbjct: 718  DERRGAHNERDRRDNREREQRAPSPVRQQNRGEDLEREERRDDRRNDRGDDRRDDRTRER 777

Query: 257  EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRD-GERSKDRGRDGEKS 81
            EK+R+  RERER+REK R+R++ R+R++E+ R+R RER R+R R+  ER ++R     + 
Sbjct: 778  EKERDREREREREREKEREREKEREREAERERERTREREREREREREEREREREERERER 837

Query: 80   KDRERDRDGE-KERDRDRDHHHRDRHR 3
            ++RER+R+ E KER+R+R+   R+R R
Sbjct: 838  EERERERERERKEREREREQRERERQR 864

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 51/144 (35%), Positives = 83/144 (57%), Gaps = 1/144 (0%)
 Frame = -2

Query: 431  GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            GE    EERR ++    G+D               +D T  +     R+ +RE  + +E+
Sbjct: 749  GEDLEREERRDDRRNDRGDDRR-------------DDRTREREKERDREREREREREKER 795

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEK-SRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
            +RE  RERE +RE+ R R+R R+R+ E+  R+RERE  R+R R+ ER ++R R+    K+
Sbjct: 796  EREKEREREAERERERTREREREREREREERERERE-ERERERE-ERERERERE---RKE 850

Query: 74   RERDRDGEKERDRDRDHHHRDRHR 3
            RER+R+ ++ER+R R+   R++ R
Sbjct: 851  RERERE-QRERERQREWDEREKGR 873

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 43/127 (33%), Positives = 74/127 (58%), Gaps = 3/127 (2%)
 Frame = -2

Query: 374  DNYHNDSSPQPPAAADEDLTDSKSNHVSRDND-RESSKSREKDRENGRERERKREKGRDR 198
            D Y +    + P        + +    +R+ + R  S  R+++R    ERE +R+  R+ 
Sbjct: 705  DRYDDRPRGEQPRDERRGAHNERDRRDNREREQRAPSPVRQQNRGEDLEREERRDDRRN- 763

Query: 197  DRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK--DRERDRDGEKERDRDRDH 24
            DR  DR  +++R+RE+ER R+R R+ ER K+R R+ E+ +  +RER+R  E+ER+R+R+ 
Sbjct: 764  DRGDDRRDDRTREREKERDREREREREREKEREREKEREREAERERERTRERERERERER 823

Query: 23   HHRDRHR 3
              R+R R
Sbjct: 824  EERERER 830

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 45/154 (29%), Positives = 74/154 (48%), Gaps = 18/154 (11%)
 Frame = -2

Query: 416  EEERRYEQP---EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            E E+R   P   +  GED    +          +D  D ++    ++ DRE  + RE+++
Sbjct: 734  EREQRAPSPVRQQNRGEDLEREERRDDRRNDRGDDRRDDRTREREKERDREREREREREK 793

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRE---------------RERSRDRVRDGERS 111
            E  RE+ER+RE  R+R+R+R+R+ E+ R+RE               RER R+R R     
Sbjct: 794  EREREKEREREAERERERTREREREREREREEREREREEREREREERERERERERKERER 853

Query: 110  KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
            +   R+ E+ ++ +    G +ER   RD    DR
Sbjct: 854  EREQRERERQREWDEREKGREERRERRDESREDR 887

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 52/155 (33%), Positives = 68/155 (43%), Gaps = 42/155 (27%)
 Frame = -2

Query: 341 PAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR-ERER-----------------KR 216
           PA+A    + S S+   R   RE  + RE+DR+ GR E+ER                 KR
Sbjct: 464 PASAPRRSSPSASH---RSQGRERERERERDRDRGRAEQERSPAVQERRHERRDESRGKR 520

Query: 215 EKGRDRDR----------SRDRDSEKSRDRERERSRDRV-------------RDGERSKD 105
           EK   RD             +RD   SRDR  ER R  V             RD   ++ 
Sbjct: 521 EKDSSRDERDYDIVQSSSREERDCRDSRDRRGERDRRDVREERQHRGDVKDTRDARAAET 580

Query: 104 RGRDG-EKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R R G E  + RERDRD E+ER+R+R+    + HR
Sbjct: 581 RERSGREPLEHRERDRDRERERERERERERTEMHR 615

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 42/145 (28%), Positives = 75/145 (51%), Gaps = 2/145 (1%)
 Frame = -2

Query: 431  GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
            G+   ++  R  + E + E     +   +     + +    +    +R+ +RE  + RE+
Sbjct: 766  GDDRRDDRTREREKERDREREREREREKEREREKEREREAERERERTREREREREREREE 825

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERE-RSRDRVRDGERSKDRGRDGEKSKD 75
                  ERER+RE+ R+R+R R+R   K R+RERE R R+R R+ +  +++GR+ E+ + 
Sbjct: 826  REREREEREREREE-RERERERER---KEREREREQRERERQREWD-EREKGRE-ERRER 879

Query: 74   RERDRDGEKERDRDRDHHH-RDRHR 3
            R+  R+    RD   D  + R RHR
Sbjct: 880  RDESREDRPPRDAHEDRKNIRKRHR 904

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 46/148 (31%), Positives = 70/148 (47%), Gaps = 24/148 (16%)
 Frame = -2

Query: 398  EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERK 219
            EQ  GE +         +P  +   D  DS+S H SR +  ES +       +   RER 
Sbjct: 1324 EQMVGERKSRIDQLRRGEPSRSTSSDRQDSRS-HSSRRSSPESERQARSRAGSYDSRERD 1382

Query: 218  REKGRD-----RDRSRDRDSEKSRDRERE------RSRDRVRDGERSKDRGRDGEKSKDR 72
            RE+ RD     R+++R   +++S+ RE E      R R+ +  G R   R RD  + ++R
Sbjct: 1383 RERDRDPLDREREKNRQLQNQQSQQREPEAREWGGRGREPLLRGNREPIRERDLREMRER 1442

Query: 71   ER------------DRD-GEKERDRDRD 27
            ER            DR+ GE++R+RDRD
Sbjct: 1443 ERLLPEGLLAHERMDRERGERDRERDRD 1470

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 41/133 (30%), Positives = 61/133 (45%), Gaps = 22/133 (16%)
 Frame = -2

Query: 335  AADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSR-- 162
            A+   L    +    RD+  +  +SR    + G  RER RE+ R+R+R R+RD ++ R  
Sbjct: 1262 ASSRRLRSPSNESAHRDDGPQGMRSRRGLLQGGNSRERDRERERERERERERDRDRERVV 1321

Query: 161  -----DRERERSRDRVRDGE------------RSKDRGRDGEKSKDRERDRDG---EKER 42
                   ER+   D++R GE            RS    R   +S+ + R R G    +ER
Sbjct: 1322 ANEQMVGERKSRIDQLRRGEPSRSTSSDRQDSRSHSSRRSSPESERQARSRAGSYDSRER 1381

Query: 41   DRDRDHHHRDRHR 3
            DR+RD    DR R
Sbjct: 1382 DRERDRDPLDRER 1394

[208][TOP]
>UniRef100_C5X6Q2 Putative uncharacterized protein Sb02g012970 n=1 Tax=Sorghum
           bicolor RepID=C5X6Q2_SORBI
          Length = 392

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 57/150 (38%), Positives = 80/150 (53%), Gaps = 8/150 (5%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYH---NDSSPQPPAAADEDLTDSKSNHVSRDN-DRESSKS 261
           ++E EEE + EQP    E N H   N     P    D D    +     R + DR+  + 
Sbjct: 187 DFEEEEEDKEEQPMEIDEPNGHENDNHRGRSPARERDRDRDRDRDRKPERHHRDRDYDRD 246

Query: 260 REKDRENGRERERKREKGRDRDRSRDRDSEKSR----DRERERSRDRVRDGERSKDRGRD 93
           R+ DR+ GR RER R++ R+RDR+RDRD ++ R    D  R+R RDR RDG   + R RD
Sbjct: 247 RDYDRDYGRGRERDRDRDRERDRNRDRDRDRHRLRDDDYNRDRDRDRERDGRERERRDRD 306

Query: 92  GEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             + + R R RD  ++RDR+   + R R R
Sbjct: 307 RGRHRSRSRSRD-RRDRDREDGEYRRRRGR 335

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 42/131 (32%), Positives = 71/131 (54%), Gaps = 4/131 (3%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           +++ +R Y++  G G +    D   +     D D    +  H  RD+D    + R+++R+
Sbjct: 242 DYDRDRDYDRDYGRGRER-DRDRDRERDRNRDRD----RDRHRLRDDDYNRDRDRDRERD 296

Query: 242 NGRERERK-REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS---KDRGRDGEKSKD 75
            GRERER+ R++GR R RSR RD    RDR+RE    R R G  S   + RG DG   ++
Sbjct: 297 -GRERERRDRDRGRHRSRSRSRD---RRDRDREDGEYRRRRGRGSASPRGRGEDGGPREE 352

Query: 74  RERDRDGEKER 42
            +R ++ ++++
Sbjct: 353 PKRKKEKKEKK 363

[209][TOP]
>UniRef100_C1FJ05 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FJ05_9CHLO
          Length = 468

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/117 (45%), Positives = 69/117 (58%)
 Frame = -2

Query: 359 DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDR 180
           D    PP+A D+   D       RD+DR+ S  R++D  +   RERKR   RDRDR RDR
Sbjct: 17  DDRDDPPSARDDRDRDR-----DRDSDRKRSH-RDRDESSDERRERKR---RDRDRDRDR 67

Query: 179 DSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           D ++ RDR+R+R RDR RD +R +DR  D      R+RDRD  +ERDR +   HR R
Sbjct: 68  DRDRDRDRDRDRDRDRDRDRDRDRDRDHD-----RRDRDRDRSRERDRKKSRRHRSR 119

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 47/99 (47%), Positives = 65/99 (65%), Gaps = 3/99 (3%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKG-RDRDRSRD-RDSEKSRDRERERSRDRVRDGE 117
           R +DR+   S   DR+  R+R+  R++  RDRD S D R   K RDR+R+R RDR RD +
Sbjct: 15  RRDDRDDPPSARDDRDRDRDRDSDRKRSHRDRDESSDERRERKRRDRDRDRDRDRDRDRD 74

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDRDH-HHRDRHR 3
           R +DR RD ++ +DR+RDRD ++ RDRDRD    RDR +
Sbjct: 75  RDRDRDRDRDRDRDRDRDRDHDR-RDRDRDRSRERDRKK 112

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 44/112 (39%), Positives = 67/112 (59%), Gaps = 2/112 (1%)
 Frame = -2

Query: 332 ADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRS-RDRDSEKSRDR 156
           + ++  + K     RD DR+  + R++DR+  R+R+R R++ RDRD   RDRD ++SR+R
Sbjct: 49  SSDERRERKRRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDHDRRDRDRDRSRER 108

Query: 155 ERERS-RDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +R++S R R R   RS  R R+    +   R R  E+ RDRDRD   R+R R
Sbjct: 109 DRKKSRRHRSRSHSRSDSRRRERSDRRRSSRSRSPERSRDRDRD-RGRERRR 159

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/124 (32%), Positives = 60/124 (48%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           + +R  +   E  D              D D    +     RD DR+  + R++DR++ R
Sbjct: 38  DRKRSHRDRDESSDERRERKRRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDHDR 97

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
            R+R R++ R+RDR + R   +SR   R  SR R R   R   R R  E+S+DR+RDR  
Sbjct: 98  -RDRDRDRSRERDRKKSR-RHRSRSHSRSDSRRRERSDRRRSSRSRSPERSRDRDRDRGR 155

Query: 53  EKER 42
           E+ R
Sbjct: 156 ERRR 159

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 39/120 (32%), Positives = 61/120 (50%), Gaps = 28/120 (23%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRD-----RDSEKSR 162
           ++ +D +     RD DR+  + R++DR+  R+R+R R++ RDRDR RD     RD ++SR
Sbjct: 47  DESSDERRERKRRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDHDRRDRDRDRSR 106

Query: 161 DRERERSR-----------------------DRVRDGERSKDRGRDGEKSKDRERDRDGE 51
           +R+R++SR                        R R  ERS+DR RD  + + R    D E
Sbjct: 107 ERDRKKSRRHRSRSHSRSDSRRRERSDRRRSSRSRSPERSRDRDRDRGRERRRPSGFDTE 166

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 33/74 (44%), Positives = 45/74 (60%)
 Frame = -2

Query: 224 RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
           R+R   RD   S   D ++ RDR+ +R R   RD + S D  R+  K +DR+RDRD +++
Sbjct: 13  RRRRDDRDDPPSARDDRDRDRDRDSDRKRSH-RDRDESSDERRE-RKRRDRDRDRDRDRD 70

Query: 44  RDRDRDHHHRDRHR 3
           RDRDRD   RDR R
Sbjct: 71  RDRDRD-RDRDRDR 83

[210][TOP]
>UniRef100_B9GPM8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GPM8_POPTR
          Length = 1112

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 51/145 (35%), Positives = 83/145 (57%), Gaps = 7/145 (4%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHND-----SSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E ++  +  E E E   H D        +   + D D   +K  +  RD DRE  K R+K
Sbjct: 59  ERDKSSDSDEKEREKEKHKDRDRDRDKDRAARSRDGDKERAKDRNRDRDKDREEKKDRDK 118

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERE-RSRDRVRDGERS-KDRGRDGEKSK 78
           DRE  R+R++ RE+ R+R + +++D E+ R+RERE R R+R RD ER  K+R R+  + +
Sbjct: 119 DREEKRDRDKDREEKRERAKEKEKDREREREREREKRERERERDRERERKERDREERERE 178

Query: 77  DRERDRDGEKERDRDRDHHHRDRHR 3
            RER+    ++R+R+R+   R+R +
Sbjct: 179 KREREEREREKRERERERRTREREK 203

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 53/145 (36%), Positives = 78/145 (53%), Gaps = 37/145 (25%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRER--------------------ERKREKG 207
           ED  DSK +H  RD DR+  + R  +R   RE+                    ER++EK 
Sbjct: 17  EDKEDSKRSHRDRDRDRDRDRDRNGERHRDREKRERESIRRSERDKSSDSDEKEREKEKH 76

Query: 206 RDRDRSRDRD-SEKSRD----RERERSRDRVRDGERSKDRGRDGEKSKDRERDR------ 60
           +DRDR RD+D + +SRD    R ++R+RDR +D E  KDR +D E+ +DR++DR      
Sbjct: 77  KDRDRDRDKDRAARSRDGDKERAKDRNRDRDKDREEKKDRDKDREEKRDRDKDREEKRER 136

Query: 59  ------DGEKERDRDRDHHHRDRHR 3
                 D E+ER+R+R+   R+R R
Sbjct: 137 AKEKEKDREREREREREKRERERER 161

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/139 (34%), Positives = 81/139 (58%), Gaps = 1/139 (0%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E  RR E+ +    D    +         D D   +     SRD D+E +K R +DR+
Sbjct: 51  ERESIRRSERDKSSDSDEKEREKEKHKDRDRDRDKDRAAR---SRDGDKERAKDRNRDRD 107

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             ++RE K+++ +DR+  RDRD  K R+ +RER++++ +D ER ++R R+    ++RER+
Sbjct: 108 --KDREEKKDRDKDREEKRDRD--KDREEKRERAKEKEKDRERERERERE---KRERERE 160

Query: 62  RDGEKER-DRDRDHHHRDR 9
           RD E+ER +RDR+   R++
Sbjct: 161 RDRERERKERDREEREREK 179

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 44/126 (34%), Positives = 68/126 (53%), Gaps = 25/126 (19%)
 Frame = -2

Query: 311 SKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR-------------------- 192
           S+ +   R  D+E SK   +DR+  R+R+R R   R RDR                    
Sbjct: 8   SRKDDSERKEDKEDSKRSHRDRDRDRDRDRDRNGERHRDREKRERESIRRSERDKSSDSD 67

Query: 191 SRDRDSEKSRDRERERSRDRV---RDG--ERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
            ++R+ EK +DR+R+R +DR    RDG  ER+KDR RD +K ++ ++DRD ++E  RDRD
Sbjct: 68  EKEREKEKHKDRDRDRDKDRAARSRDGDKERAKDRNRDRDKDREEKKDRDKDREEKRDRD 127

Query: 26  HHHRDR 9
               ++
Sbjct: 128 KDREEK 133

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 51/143 (35%), Positives = 77/143 (53%), Gaps = 5/143 (3%)
 Frame = -2

Query: 416 EEERRYEQPEGEGED----NYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           +++R     +G+ E     N   D   +     D+D  + +     R+  RE +K +EKD
Sbjct: 84  DKDRAARSRDGDKERAKDRNRDRDKDREEKKDRDKDREEKRDRDKDREEKRERAKEKEKD 143

Query: 248 RENGRERERKREKGRDRDRSRDRDSE-KSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           RE  RERER+REK R+R+R RDR+ E K RDRE ER R++    ER +++     + + R
Sbjct: 144 RE--REREREREK-RERERERDRERERKERDRE-EREREKREREEREREKRERERERRTR 199

Query: 71  ERDRDGEKERDRDRDHHHRDRHR 3
           ER++  E   D D D   RD+ R
Sbjct: 200 EREKCRELSSDSDDDSKDRDKKR 222

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 44/145 (30%), Positives = 74/145 (51%), Gaps = 6/145 (4%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSK--SNHVSRDNDRESSKSR 258
           G+ E  ++R  ++ + + E+    D   +     D+D  + +  +    +D +RE  + R
Sbjct: 94  GDKERAKDRNRDRDK-DREEKKDRDKDREEKRDRDKDREEKRERAKEKEKDRERERERER 152

Query: 257 EK---DRENGRERERKREKGRDRDR-SRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG 90
           EK   +RE  RERERK     +R+R  R+R+  +   RERER R R R+ E+ ++   D 
Sbjct: 153 EKRERERERDRERERKERDREEREREKREREEREREKRERERER-RTREREKCRELSSD- 210

Query: 89  EKSKDRERDRDGEKERDRDRDHHHR 15
             S D  +DRD ++ R  D D+  R
Sbjct: 211 --SDDDSKDRDKKRRRRDDDDYKER 233

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 36/91 (39%), Positives = 49/91 (53%), Gaps = 16/91 (17%)
 Frame = -2

Query: 227 ERKREKGRDRDRSRDRDSEKS----RDRERERSRDRVRDGERSKDRGR---------DGE 87
           E  + K R  D  R  D E S    RDR+R+R RDR R+GER +DR +         + +
Sbjct: 2   EDVKHKSRKDDSERKEDKEDSKRSHRDRDRDRDRDRDRNGERHRDREKRERESIRRSERD 61

Query: 86  KSKD---RERDRDGEKERDRDRDHHHRDRHR 3
           KS D   +ER+++  K+RDRDRD     R R
Sbjct: 62  KSSDSDEKEREKEKHKDRDRDRDKDRAARSR 92

[211][TOP]
>UniRef100_B8ANW8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8ANW8_ORYSI
          Length = 567

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/144 (36%), Positives = 77/144 (53%), Gaps = 4/144 (2%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E   R     G G D   +D   +   +  E+         +RD D++  + R +DR+
Sbjct: 30  EKERSSRRRSGGGGGGDEERDDGERRSKRSRSEE---------NRDRDKDKDRDRHRDRD 80

Query: 242 NGRERERKREKGRDRDRSRDRDS---EKSRDRERER-SRDRVRDGERSKDRGRDGEKSKD 75
             R+R R   + RDRDR RDRD    EK RD+++ER SRDR ++ E+ K+R R+ E+ KD
Sbjct: 81  KDRDRHRSSRERRDRDRDRDRDEKDREKERDKDKERRSRDREKEKEKEKEREREREREKD 140

Query: 74  RERDRDGEKERDRDRDHHHRDRHR 3
           RER      ER RD +   R+R+R
Sbjct: 141 RERRSRSRSERRRDDEERDRERYR 164

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 50/133 (37%), Positives = 72/133 (54%), Gaps = 1/133 (0%)
 Frame = -2

Query: 410 ERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRE 231
           ERR ++   E   +   D         D+D    +S+   RD DR+  +  EKDRE  R+
Sbjct: 53  ERRSKRSRSEENRDRDKDKDRDRHRDRDKDRDRHRSSRERRDRDRDRDRD-EKDREKERD 111

Query: 230 RERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGE 51
           ++++R   R RDR ++++ EK R+RERER +DR R      +R RD     D ERDR+  
Sbjct: 112 KDKER---RSRDREKEKEKEKEREREREREKDRERRSRSRSERRRD-----DEERDRERY 163

Query: 50  KERD-RDRDHHHR 15
           +ERD RDRD   R
Sbjct: 164 RERDYRDRDVRRR 176

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 48/147 (32%), Positives = 78/147 (53%), Gaps = 12/147 (8%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +E  Y +   EG     N ++   P + +++ +  + +      D E      + + +  
Sbjct: 4   DEYDYLEKTVEGSGAPSNGAAA--PRSEEKERSSRRRSGGGGGGDEERDDGERRSKRSRS 61

Query: 233 ERERKREKGRDRDRSRDRD--------SEKSRDRERERSRD-RVRDGERSKD---RGRDG 90
           E  R R+K +DRDR RDRD        S + RDR+R+R RD + R+ ER KD   R RD 
Sbjct: 62  EENRDRDKDKDRDRHRDRDKDRDRHRSSRERRDRDRDRDRDEKDREKERDKDKERRSRDR 121

Query: 89  EKSKDRERDRDGEKERDRDRDHHHRDR 9
           EK K++E++R+ E+ER++DR+   R R
Sbjct: 122 EKEKEKEKEREREREREKDRERRSRSR 148

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 46/126 (36%), Positives = 67/126 (53%), Gaps = 7/126 (5%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRES-SKSREKDREN 240
           +++ R    + + + + H  S  +     D D  D K     RD D+E  S+ REK++E 
Sbjct: 69  KDKDRDRHRDRDKDRDRHRSSRERRDRDRDRD-RDEKDREKERDKDKERRSRDREKEKEK 127

Query: 239 GRERERKREKGRDRD-----RSRDRDSEKSRDRERERSRD-RVRDGERSKDRGRDGEKSK 78
            +ERER+RE+ +DR+     RS  R  ++ RDRER R RD R RD  R K+    GE   
Sbjct: 128 EKEREREREREKDRERRSRSRSERRRDDEERDRERYRERDYRDRDVRRRKEEA--GEPEA 185

Query: 77  DRERDR 60
           D ERD+
Sbjct: 186 DPERDQ 191

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 35/101 (34%), Positives = 51/101 (50%), Gaps = 9/101 (8%)
 Frame = -2

Query: 278 RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
           R   K R   R +G       E+     RS+   SE++RDR++++ RDR RD    +D+ 
Sbjct: 27  RSEEKERSSRRRSGGGGGGDEERDDGERRSKRSRSEENRDRDKDKDRDRHRD----RDKD 82

Query: 98  RDGEKSKDRERDRDG---------EKERDRDRDHHHRDRHR 3
           RD  +S    RDRD          EKERD+D++   RDR +
Sbjct: 83  RDRHRSSRERRDRDRDRDRDEKDREKERDKDKERRSRDREK 123

[212][TOP]
>UniRef100_Q7SD01 Putative uncharacterized protein n=1 Tax=Neurospora crassa
            RepID=Q7SD01_NEUCR
          Length = 901

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 57/144 (39%), Positives = 84/144 (58%), Gaps = 5/144 (3%)
 Frame = -2

Query: 419  FEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKS---NHVS-RDNDRESSKSREK 252
            +E +RR  +   E E N+   S       A+  L+D +S   +H S RD DR+  + R++
Sbjct: 651  YEADRR--KAIAERERNFRKSSM------AESLLSDRRSVDGHHDSIRDRDRDRDRERDR 702

Query: 251  DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDG-ERSKDRGRDGEKSKD 75
            DR + R+R+R+RE+ RDRDR R+RD ++ RDR+RER R+R RD  +R +DR RD ++  D
Sbjct: 703  DRRDYRDRDRERERDRDRDRDRERDRDRDRDRDRERDRERDRDHRDRDRDRERDRDRDYD 762

Query: 74   RERDRDGEKERDRDRDHHHRDRHR 3
            R    D     DR+R     DR R
Sbjct: 763  RRPRHDELNHYDRERRSRDEDRER 786

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 56/159 (35%), Positives = 82/159 (51%), Gaps = 18/159 (11%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGE-----GEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK 264
            E E E +R   +  G+     GE ++ + +      + + D  ++       + +R   K
Sbjct: 609  EEEAERDRLRRRDRGDLYRDRGERSHRSSARSVRSRSPEHDPYEADRRKAIAERERNFRK 668

Query: 263  SR--EKDRENGRERERKREKGRDRDRSRDRDSE------KSRDRERERSRDRVRDGERSK 108
            S   E    + R  +   +  RDRDR RDR+ +      + RDRERER RDR RD ER +
Sbjct: 669  SSMAESLLSDRRSVDGHHDSIRDRDRDRDRERDRDRRDYRDRDRERERDRDRDRDRERDR 728

Query: 107  DRGRDGEKSKDRE-----RDRDGEKERDRDRDHHHRDRH 6
            DR RD ++ +DRE     RDRD ++ERDRDRD+  R RH
Sbjct: 729  DRDRDRDRERDRERDRDHRDRDRDRERDRDRDYDRRPRH 767

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 48/145 (33%), Positives = 71/145 (48%), Gaps = 5/145 (3%)
 Frame = -2

Query: 422  EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESS-KSREKDR 246
            E EEE   ++       + + D   +   ++   +      H   + DR  +   RE++ 
Sbjct: 607  EKEEEAERDRLRRRDRGDLYRDRGERSHRSSARSVRSRSPEHDPYEADRRKAIAERERNF 666

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRD----RVRDGERSKDRGRDGEKSK 78
                  E      R  D   D   ++ RDR+RER RD    R RD ER +DR RD ++ +
Sbjct: 667  RKSSMAESLLSDRRSVDGHHDSIRDRDRDRDRERDRDRRDYRDRDRERERDRDRDRDRER 726

Query: 77   DRERDRDGEKERDRDRDHHHRDRHR 3
            DR+RDRD ++ERDR+RD  HRDR R
Sbjct: 727  DRDRDRDRDRERDRERDRDHRDRDR 751

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 3/116 (2%)
 Frame = -2

Query: 365  HNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSR 186
            H+DS        D +    + ++  RD +RE  + R++DRE  R+R+R R++ RDR+R R
Sbjct: 685  HHDSIRDRDRDRDRERDRDRRDYRDRDRERERDRDRDRDRERDRDRDRDRDRERDRERDR 744

Query: 185  D---RDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
            D   RD ++ RDR+R+  R    D     DR R   +S+D +R+R   + R  DRD
Sbjct: 745  DHRDRDRDRERDRDRDYDRRPRHDELNHYDRER---RSRDEDRERI-YRRRVMDRD 796

[213][TOP]
>UniRef100_A4QR81 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea
           RepID=A4QR81_MAGGR
          Length = 627

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 55/109 (50%), Positives = 64/109 (58%), Gaps = 2/109 (1%)
 Frame = -2

Query: 323 DLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER 144
           D  DS+  H  R  DRE  + RE+DR+  R     R+  RDRDR RDRD EK RD +RER
Sbjct: 450 DSDDSRERHRRRRRDRERERERERDRDRDRA---DRDHHRDRDRDRDRDREKGRDDDRER 506

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKER--DRDRDHHHRDRHR 3
              R RD  R +DR RD E+ +DRERDRD E ER  DR R  H  D  R
Sbjct: 507 RTPRDRD--RDRDRERDRERDRDRERDRDRELERYGDRARYTHRPDAQR 553

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 44/125 (35%), Positives = 68/125 (54%), Gaps = 15/125 (12%)
 Frame = -2

Query: 332 ADEDLTDSKSNHV--SRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRD 159
           ++E+L  S  +H    R+    S  +R    +   +     +  R+R R R RD E+ R+
Sbjct: 411 SNENLRSSARSHNRHGRETPSGSKLNRAWVHDEDYDSYPDSDDSRERHRRRRRDRERERE 470

Query: 158 RERERSRDRV---------RDGERSKDRGRDGEKS----KDRERDRDGEKERDRDRDHHH 18
           RER+R RDR          RD +R +++GRD ++     +DR+RDRD E++R+RDRD   
Sbjct: 471 RERDRDRDRADRDHHRDRDRDRDRDREKGRDDDRERRTPRDRDRDRDRERDRERDRD-RE 529

Query: 17  RDRHR 3
           RDR R
Sbjct: 530 RDRDR 534

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 47/151 (31%), Positives = 69/151 (45%), Gaps = 13/151 (8%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E ER  ++     + ++H D           D    +     RD+DRE    R++DR+
Sbjct: 466 ERERERERDRDRDRADRDHHRD----------RDRDRDRDREKGRDDDRERRTPRDRDRD 515

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSR-------------DRVRDGERSKDR 102
             RER+R+R++ R+RD  RDR+ E+  DR R   R             DR R  +     
Sbjct: 516 RDRERDRERDRDRERD--RDRELERYGDRARYTHRPDAQRRTSSHADVDRWRGVDLEDFN 573

Query: 101 GRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
            R+  + + RERDRD +  RDRD     R R
Sbjct: 574 FREQREEQPRERDRDRDSPRDRDSPREERRR 604

[214][TOP]
>UniRef100_UPI0001A5E7F8 PREDICTED: hypothetical protein n=1 Tax=Homo sapiens
           RepID=UPI0001A5E7F8
          Length = 202

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 48/143 (33%), Positives = 74/143 (51%), Gaps = 1/143 (0%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E +R+ E+      +N H             D    +     RD  R+  +  E++
Sbjct: 16  ETERERDRQRERENQTERENRHRQRDRHRERDRQTDREKERERQKERDRQRQRERETERE 75

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            E  RER+R+RE+ R  DR RD+D ++ R RE +R+R+R R G R +D+  + E+ ++RE
Sbjct: 76  TERQRERQRQRERKRQTDRERDKDRDRERKRETDRNRERNRKGGRERDKQTERERDRERE 135

Query: 68  RDRDGEKERDRDRDH-HHRDRHR 3
           R R  E+ER R R+     DR R
Sbjct: 136 RQRQRERERQRQRERKRETDRER 158

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 51/148 (34%), Positives = 84/148 (56%), Gaps = 8/148 (5%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E + ER+ E   G+  +   +    +      E+ T+ ++ H  RD  RE  + R+ DRE
Sbjct: 2   ERQRERKRETDRGKETERERDRQRER------ENQTERENRHRQRDRHRE--RDRQTDRE 53

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             RER+++R++ R R+R  +R++E+ R+R+R+R R R  D ER KDR R+ ++  DR R+
Sbjct: 54  KERERQKERDRQRQRERETERETERQRERQRQRERKRQTDRERDKDRDRERKRETDRNRE 113

Query: 62  R--------DGEKERDRDRDHHHRDRHR 3
           R        D + ER+RDR+   R+R R
Sbjct: 114 RNRKGGRERDKQTERERDRE---RERQR 138

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 42/144 (29%), Positives = 77/144 (53%), Gaps = 2/144 (1%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E + E E R+ Q +   E +   D   +     + D    +     R+ +R+  + R+++
Sbjct: 28  ENQTERENRHRQRDRHRERDRQTDREKERERQKERDRQRQRERETERETERQRERQRQRE 87

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSR--DRERERSRDRVRDGERSKDRGRDGEKSKD 75
           R+   +RER +++ R+R R  DR+ E++R   RER++  +R RD ER + R R+ E+ + 
Sbjct: 88  RKRQTDRERDKDRDRERKRETDRNRERNRKGGRERDKQTERERDRERERQRQRERERQRQ 147

Query: 74  RERDRDGEKERDRDRDHHHRDRHR 3
           RER R+ ++ER R  +   R + R
Sbjct: 148 RERKRETDRERQRWAEREERKKER 171

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 45/140 (32%), Positives = 76/140 (54%), Gaps = 2/140 (1%)
 Frame = -2

Query: 428 EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E ++ER R  Q E E E         Q            +     R+  RE+ ++RE+
Sbjct: 55  ERERQKERDRQRQRERETERETERQRERQRQRERKRQTDRERDKDRDRERKRETDRNRER 114

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR-GRDGEKSKD 75
           +R+ GRER+++ E+ RDR+R R R  E+ R R+RER R+  R+ +R  +R  R  E+ K+
Sbjct: 115 NRKGGRERDKQTERERDRERERQRQRERERQRQRERKRETDRERQRWAEREERKKERKKE 174

Query: 74  RERDRDGEKERDRDRDHHHR 15
           R+++R  +K+ ++ R+   R
Sbjct: 175 RKKERKEKKKEEKRREDKKR 194

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 40/130 (30%), Positives = 66/130 (50%), Gaps = 5/130 (3%)
 Frame = -2

Query: 416 EEERRYE-QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD--- 249
           + ER  E + E + E     +   Q     D+D    +     R+ +R     RE+D   
Sbjct: 67  QRERETERETERQRERQRQRERKRQTDRERDKDRDRERKRETDRNRERNRKGGRERDKQT 126

Query: 248 -RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
            RE  RERER+R++ R+R R R+R  E  R+R+R   R+  R  ER K+R ++ ++ K  
Sbjct: 127 ERERDRERERQRQRERERQRQRERKRETDRERQRWAEREE-RKKERKKERKKERKEKKKE 185

Query: 71  ERDRDGEKER 42
           E+ R+ +K +
Sbjct: 186 EKRREDKKRK 195

[215][TOP]
>UniRef100_UPI00005BF4AA PREDICTED: similar to splicing factor, arginine/serine-rich 12
           isoform 2 n=1 Tax=Bos taurus RepID=UPI00005BF4AA
          Length = 632

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 45/125 (36%), Positives = 75/125 (60%), Gaps = 4/125 (3%)
 Frame = -2

Query: 365 HNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRE---RERKREKGRDRD 195
           H   S     +  +D   SKS H  R   RE  KSR + R   +    RE+ +EK R ++
Sbjct: 333 HRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRSRSRDKRKDTREKIKEKERVKE 392

Query: 194 RSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHH-H 18
           + R+++ EK RDRE+ER +++ R   + KDR ++ EK +D+++D++ +KER+RD+DH   
Sbjct: 393 KDREKEREKERDREKEREKEKERGKNKDKDRDKEREKDRDKDKDKEKDKERERDKDHEKE 452

Query: 17  RDRHR 3
           RD+ +
Sbjct: 453 RDKEK 457

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 41/119 (34%), Positives = 75/119 (63%), Gaps = 11/119 (9%)
 Frame = -2

Query: 353 SPQPPAAADEDLTDSKSNHVSRDN-----------DRESSKSREKDRENGRERERKREKG 207
           SP    +   +   S+S   SRD            +R   K REK+RE  R+RE++REK 
Sbjct: 353 SPHKKRSKSRERRKSRSRSRSRDKRKDTREKIKEKERVKEKDREKEREKERDREKEREKE 412

Query: 206 RDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDR 30
           ++R +++D+D +K R+++R++ +D+ +D ER +D+  + E+ K++E+++D EKER++DR
Sbjct: 413 KERGKNKDKDRDKEREKDRDKDKDKEKDKERERDKDHEKERDKEKEKEQDKEKEREKDR 471

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 35/92 (38%), Positives = 63/92 (68%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERS 111
           R+ +RE  + REK+RE  +ER + ++K RD++R +DRD +K +++++ER RD+  + ER 
Sbjct: 395 REKEREKERDREKEREKEKERGKNKDKDRDKEREKDRDKDKDKEKDKERERDKDHEKERD 454

Query: 110 KDRGRDGEKSKDRERDRDGEKERDRDRDHHHR 15
           K++ ++ +K K+RE+DR  E +  R +D   R
Sbjct: 455 KEKEKEQDKEKEREKDRSKEIDEKRKKDKKSR 486

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 39/131 (29%), Positives = 81/131 (61%), Gaps = 1/131 (0%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDL-TDSKSNHVSRDNDRESSKSREKDREN 240
           ++ RR + P  +   +     S     + D+   T  K     R  +++  K REK+R+ 
Sbjct: 346 KDRRRSKSPHKKRSKSRERRKSRSRSRSRDKRKDTREKIKEKERVKEKDREKEREKERDR 405

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
            +ERE+++E+G+++D+ RD++ EK RD+++++ +D+ R  ER KD  ++ +K K++E+D+
Sbjct: 406 EKEREKEKERGKNKDKDRDKEREKDRDKDKDKEKDKER--ERDKDHEKERDKEKEKEQDK 463

Query: 59  DGEKERDRDRD 27
           + E+E+DR ++
Sbjct: 464 EKEREKDRSKE 474

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 31/98 (31%), Positives = 67/98 (68%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           +++    K     R+ +R+  K REK++E G+ +++ R+K R++DR +D+D EK ++RER
Sbjct: 386 EKERVKEKDREKEREKERDREKEREKEKERGKNKDKDRDKEREKDRDKDKDKEKDKERER 445

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDR 36
           ++  ++ RD E+ K++ ++ E+ KDR ++ D ++++D+
Sbjct: 446 DKDHEKERDKEKEKEQDKEKEREKDRSKEIDEKRKKDK 483

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 35/96 (36%), Positives = 66/96 (68%), Gaps = 2/96 (2%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKR--EKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE 117
           ++ DRE  + +E+DRE  RE+E++R   K +DRD+ R++D +K +D+E+++ R+R +D E
Sbjct: 391 KEKDREKEREKERDREKEREKEKERGKNKDKDRDKEREKDRDKDKDKEKDKERERDKDHE 450

Query: 116 RSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           + +D+ ++ E+ K++ER++D  KE D  R    + R
Sbjct: 451 KERDKEKEKEQDKEKEREKDRSKEIDEKRKKDKKSR 486

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 37/112 (33%), Positives = 61/112 (54%), Gaps = 5/112 (4%)
 Frame = -2

Query: 347 QPPAAADEDLTDSKSNHVSRDNDRESSKSREK-----DRENGRERERKREKGRDRDRSRD 183
           +P +    +    +S   +R   R SSKSR +      +   R   R R + +DR RS+ 
Sbjct: 294 EPESGKSNERKGGRSRSHTRSKSRSSSKSRSRRKRSQSKHRSRSHNRSRSRQKDRRRSKS 353

Query: 182 RDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRD 27
              ++S+ RER +SR R R  ++ KD  R+  K K+R +++D EKER+++RD
Sbjct: 354 PHKKRSKSRERRKSRSRSRSRDKRKDT-REKIKEKERVKEKDREKEREKERD 404

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 43/160 (26%), Positives = 73/160 (45%), Gaps = 20/160 (12%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E + E+ER  E+  G+ +D    D   +     D+D    K     RD D E  + +EK+
Sbjct: 402 ERDREKEREKEKERGKNKDK---DRDKEREKDRDKDKDKEKDKERERDKDHEKERDKEKE 458

Query: 248 RENGRERERKREKGRDRDRSRDRD------------SEKSRDRERERSRDRVRDGERSKD 105
           +E  +E+ER++++ ++ D  R +D            S +SR   RER R R R   RS  
Sbjct: 459 KEQDKEKEREKDRSKEIDEKRKKDKKSRTPPRSYNASRRSRSSSRERRRRRSRSSSRSPR 518

Query: 104 RGRDGEKSKDR--------ERDRDGEKERDRDRDHHHRDR 9
             +  ++   R        ++D+  EKE+D   +   R+R
Sbjct: 519 TSKTIKRKSSRSPSPRSRNKKDKKREKEKDHISERRERER 558

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 47/165 (28%), Positives = 73/165 (44%), Gaps = 23/165 (13%)
 Frame = -2

Query: 428 EYEFEEER-RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E+ER R ++ E E E   + D         D D    K     +D +RE  K  EK
Sbjct: 396 EKEREKERDREKEREKEKERGKNKDKDRDKEREKDRD----KDKDKEKDKERERDKDHEK 451

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEK----------------------SRDRERERSR 138
           +R+  +E+E+ +EK R++DRS++ D ++                      SR+R R RSR
Sbjct: 452 ERDKEKEKEQDKEKEREKDRSKEIDEKRKKDKKSRTPPRSYNASRRSRSSSRERRRRRSR 511

Query: 137 DRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
              R    SK   R   +S         +K+R++++DH    R R
Sbjct: 512 SSSRSPRTSKTIKRKSSRSPSPRSRNKKDKKREKEKDHISERRER 556

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 34/133 (25%), Positives = 72/133 (54%), Gaps = 2/133 (1%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           + +E+ R ++ + E E     D   +       +    +  +  +D D+E  K R+KD++
Sbjct: 383 KIKEKERVKEKDREKEREKERDREKE------REKEKERGKNKDKDRDKEREKDRDKDKD 436

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKD-RGRDGEKSKD-RE 69
             +++ER+R+K  +++R ++++ E+ +++ERE+ R +  D +R KD + R   +S +   
Sbjct: 437 KEKDKERERDKDHEKERDKEKEKEQDKEKEREKDRSKEIDEKRKKDKKSRTPPRSYNASR 496

Query: 68  RDRDGEKERDRDR 30
           R R   +ER R R
Sbjct: 497 RSRSSSRERRRRR 509

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 36/134 (26%), Positives = 61/134 (45%), Gaps = 11/134 (8%)
 Frame = -2

Query: 371 NYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDR 192
           N+ N++  +PP    +         + R  + +S  S   + E+G+  ERK  + R   R
Sbjct: 254 NHSNNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPESGKSNERKGGRSRSHTR 313

Query: 191 SRDRDSEKSRDRERE-----------RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKE 45
           S+ R S KSR R +            RSR R +D  RSK   +   KS++R + R   + 
Sbjct: 314 SKSRSSSKSRSRRKRSQSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRSRS 373

Query: 44  RDRDRDHHHRDRHR 3
           RD+ +D   + + +
Sbjct: 374 RDKRKDTREKIKEK 387

[216][TOP]
>UniRef100_C3SA99 U2AF large subunit n=1 Tax=Brachypodium distachyon
           RepID=C3SA99_BRADI
          Length = 569

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 47/108 (43%), Positives = 64/108 (59%)
 Frame = -2

Query: 326 EDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERE 147
           ED+      H  R+     S+ R+++++  R R+R R++GRDRDR RDRD +K RDR+++
Sbjct: 14  EDVRAEADTH-PREEGLSKSRDRDREKDKDRHRDRDRDRGRDRDRGRDRDVDKDRDRDKD 72

Query: 146 RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           R  DR R   R K   RD     DR R RD E+ RDR+RD H R R R
Sbjct: 73  R--DRHRSHHREKREHRDRPDDHDRHRSRDSERRRDRERDGHRRHRSR 118

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 43/109 (39%), Positives = 57/109 (52%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D D    K  H  RD DR   + R +DR+   +++R R+K RDR RS  R+  + RDR  
Sbjct: 34  DRDREKDKDRHRDRDRDRGRDRDRGRDRD--VDKDRDRDKDRDRHRSHHREKREHRDRPD 91

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           +  R R RD ER +DR RDG +     R R   +ER RDR    R R +
Sbjct: 92  DHDRHRSRDSERRRDRERDGHR-----RHRSRSRERGRDRRSRSRSRSK 135

[217][TOP]
>UniRef100_B8AJ67 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8AJ67_ORYSI
          Length = 548

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 2/107 (1%)
 Frame = -2

Query: 317 TDSKSNHVS--RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER 144
           T S+ + +S  RD DRE  K ++++R   R+R+R R++ RD+D+ +DRD E+ RDR+R++
Sbjct: 21  THSREDGLSKPRDKDREREKDKDRERHRDRDRDRGRDRDRDKDKEKDRDKERDRDRDRDK 80

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            RDR     R +   RD     DR R RD E+ RD +RD   R R R
Sbjct: 81  DRDRHHRHHRERREHRDRSDDHDRHRSRDSERRRDHERDGRRRHRSR 127

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 41/120 (34%), Positives = 67/120 (55%), Gaps = 11/120 (9%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRE- 153
           ++ L+  +     R+ D++  + R++DR+ GR+R+R ++K +DRD+ RDRD ++ +DR+ 
Sbjct: 25  EDGLSKPRDKDREREKDKDRERHRDRDRDRGRDRDRDKDKEKDRDKERDRDRDRDKDRDR 84

Query: 152 -----RERSRDRVRDGERSKDRGRDGEKSKDRERD-----RDGEKERDRDRDHHHRDRHR 3
                RER   R R  +  + R RD E+ +D ERD     R   + R R RD   R R R
Sbjct: 85  HHRHHRERREHRDRSDDHDRHRSRDSERRRDHERDGRRRHRSRSRSRSRGRDRRSRSRSR 144

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 40/110 (36%), Positives = 54/110 (49%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
           E + +   H D         D D    K     RD DR+  K R++   + RER   R++
Sbjct: 39  EKDKDRERHRDRDRDRGRDRDRDKDKEKDRDKERDRDRDRDKDRDRHHRHHRERREHRDR 98

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
             D DR R RDSE+ RD ER+  R R R   RS+ RGRD  +S+ R R +
Sbjct: 99  SDDHDRHRSRDSERRRDHERD-GRRRHRSRSRSRSRGRD-RRSRSRSRSK 146

[218][TOP]
>UniRef100_A7PUY1 Chromosome chr4 scaffold_32, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PUY1_VITVI
          Length = 538

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 53/103 (51%), Positives = 67/103 (65%), Gaps = 4/103 (3%)
 Frame = -2

Query: 299 HVSRDNDRESSKSREKDRENGR----ERERKREKGRDRDRSRDRDSEKSRDRERERSRDR 132
           H SR+  RESSKSRE++RE GR    ER+R RE+ ++RDR RDRD E+ RDR R+R RDR
Sbjct: 17  HGSREYQRESSKSREREREKGRDKDRERDRDRERDKERDRDRDRDKERDRDR-RDRYRDR 75

Query: 131 VRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
               ER++DR  D      R RD D  ++ DRDRD  H+ R R
Sbjct: 76  SDRRERTRDRDDD---DFHRSRDYDRRRDFDRDRDDRHKRRSR 115

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 37/117 (31%), Positives = 59/117 (50%), Gaps = 5/117 (4%)
 Frame = -2

Query: 365 HNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSR 186
           H     Q  ++   +    K     R+ DR+  + +E+DR+  R++ER R++ RDR R R
Sbjct: 17  HGSREYQRESSKSREREREKGRDKDRERDRDRERDKERDRDRDRDKERDRDR-RDRYRDR 75

Query: 185 DRDSEKSRDRE-----RERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDR 30
               E++RDR+     R R  DR RD +R +D   D  K + R R +   ++R R R
Sbjct: 76  SDRRERTRDRDDDDFHRSRDYDRRRDFDRDRD---DRHKRRSRSRSKGRSEQRSRSR 129

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 37/113 (32%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = -2

Query: 380 GEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERK---REK 210
           G   Y  +SS       + +    K     RD +R+  + R++DR+  R+R+R+   R++
Sbjct: 18  GSREYQRESSKS--REREREKGRDKDRERDRDRERDKERDRDRDRDKERDRDRRDRYRDR 75

Query: 209 GRDRDRSRDRDSE---KSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
              R+R+RDRD +   +SRD +R R  DR RD +R K R R   K +  +R R
Sbjct: 76  SDRRERTRDRDDDDFHRSRDYDRRRDFDRDRD-DRHKRRSRSRSKGRSEQRSR 127

[219][TOP]
>UniRef100_B3LCC3 Eukaryotic translation initiation factor 3 subunit 10, putative n=1
            Tax=Plasmodium knowlesi strain H RepID=B3LCC3_PLAKH
          Length = 1283

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 56/148 (37%), Positives = 84/148 (56%), Gaps = 9/148 (6%)
 Frame = -2

Query: 419  FEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRD---NDRESSKSREKD 249
            +E++  +++ +  G  +  + +  +   A D    D       RD    DRE    RE+D
Sbjct: 1015 YEDDFSWKRGDKAGSQHDEDSNYKRLDDAQDSSYIDRSDRRERRDWPGRDRE----RERD 1070

Query: 248  RENGRERERKREKGRDRDRSRDRD--SEKSRDRERERSRDRVRDGERSKD----RGRDGE 87
            RE  R+RER+RE+ RDR   +DRD   ++S+DRERERSRDR R+  + +D    R R+  
Sbjct: 1071 RERDRDRERERERDRDRIFRKDRDYRRDRSKDRERERSRDRDREYRKERDYRGDRDREYR 1130

Query: 86   KSKDRERDRDGEKERDRDRDHHHRDRHR 3
              +D+ERDRD +  RDRDRD+   D +R
Sbjct: 1131 SYRDKERDRDRDYRRDRDRDYRRDDDYR 1158

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 40/111 (36%), Positives = 58/111 (52%), Gaps = 2/111 (1%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
            D +    +     RD DR   K R+  R+  ++RER+R + RDR+  ++RD    RDRE 
Sbjct: 1070 DRERDRDRERERERDRDRIFRKDRDYRRDRSKDRERERSRDRDREYRKERDYRGDRDREY 1129

Query: 149  ERSRDRVRDGERS--KDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
               RD+ RD +R   +DR RD  +  D  RDRD + +RD   D  +R   R
Sbjct: 1130 RSYRDKERDRDRDYRRDRDRDYRRDDDYRRDRDYKNDRDDKLDRDYRKVER 1180

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 43/137 (31%), Positives = 62/137 (45%), Gaps = 4/137 (2%)
 Frame = -2

Query: 416  EEERRYEQPEGEGED-NYHNDSSP--QPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
            E ER  ++     +D +Y  D S   +   + D D    K      D DRE    R+K  
Sbjct: 1078 ERERERDRDRIFRKDRDYRRDRSKDRERERSRDRDREYRKERDYRGDRDREYRSYRDK-- 1135

Query: 245  ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE-RSKDRGRDGEKSKDRE 69
                ER+R R+  RDRDR   RD +  RDR+ +  RD   D + R  +R   GE  + R+
Sbjct: 1136 ----ERDRDRDYRRDRDRDYRRDDDYRRDRDYKNDRDDKLDRDYRKVERSGKGEHERRRD 1191

Query: 68   RDRDGEKERDRDRDHHH 18
            RD +  +  D D   +H
Sbjct: 1192 RDEEEYERNDLDVKKNH 1208

[220][TOP]
>UniRef100_Q2QZL4 Splicing factor U2af large subunit B n=2 Tax=Oryza sativa Japonica
           Group RepID=U2A2B_ORYSJ
          Length = 548

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 2/107 (1%)
 Frame = -2

Query: 317 TDSKSNHVS--RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER 144
           T S+ + +S  RD DRE  K ++++R   R+R+R R++ RD+D+ +DRD E+ RDR+R++
Sbjct: 21  THSREDGLSKPRDKDREREKDKDRERHRDRDRDRGRDRDRDKDKEKDRDKERDRDRDRDK 80

Query: 143 SRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            RDR     R +   RD     DR R RD E+ RD +RD   R R R
Sbjct: 81  DRDRHHRHHRERREHRDRSDDHDRHRSRDSERRRDHERDGRRRHRSR 127

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 41/120 (34%), Positives = 67/120 (55%), Gaps = 11/120 (9%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRE- 153
           ++ L+  +     R+ D++  + R++DR+ GR+R+R ++K +DRD+ RDRD ++ +DR+ 
Sbjct: 25  EDGLSKPRDKDREREKDKDRERHRDRDRDRGRDRDRDKDKEKDRDKERDRDRDRDKDRDR 84

Query: 152 -----RERSRDRVRDGERSKDRGRDGEKSKDRERD-----RDGEKERDRDRDHHHRDRHR 3
                RER   R R  +  + R RD E+ +D ERD     R   + R R RD   R R R
Sbjct: 85  HHRHHRERREHRDRSDDHDRHRSRDSERRRDHERDGRRRHRSRSRSRSRGRDRRSRSRSR 144

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 40/110 (36%), Positives = 54/110 (49%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
           E + +   H D         D D    K     RD DR+  K R++   + RER   R++
Sbjct: 39  EKDKDRERHRDRDRDRGRDRDRDKDKEKDRDKERDRDRDRDKDRDRHHRHHRERREHRDR 98

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
             D DR R RDSE+ RD ER+  R R R   RS+ RGRD  +S+ R R +
Sbjct: 99  SDDHDRHRSRDSERRRDHERD-GRRRHRSRSRSRSRGRD-RRSRSRSRSK 146

[221][TOP]
>UniRef100_Q8C9B9 Death-inducer obliterator 1 n=1 Tax=Mus musculus RepID=DIDO1_MOUSE
          Length = 2256

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 57/148 (38%), Positives = 83/148 (56%), Gaps = 10/148 (6%)
 Frame = -2

Query: 422  EFEEER--RYEQP--EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK--- 264
            EF E +   Y  P  EG   + +   S  +P    +    +S+      D  RE  +   
Sbjct: 2081 EFREGKGHEYRSPAFEGRQRERFEAGSKEKPLDEPEAQGLESRQGRAFEDRRRERERGRN 2140

Query: 263  -SREKDRENGRERERKRE--KGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD 93
             SRE+D E  R+ +R RE  KGRDR  +RDR+ +  R +E +RSR+R R+ +R ++R RD
Sbjct: 2141 WSRERDWERSRDWDRHREWDKGRDRSSNRDRERDNDRAKEWDRSRERSRNRDRDRERRRD 2200

Query: 92   GEKSKDRERDRDGEKERDRDRDHHHRDR 9
             ++S+ R+RDRD E+ RDRDRD   RDR
Sbjct: 2201 RDRSRSRDRDRDRERARDRDRD-RGRDR 2227

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 47/137 (34%), Positives = 77/137 (56%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            +E+  ++PE +G +      S Q  A  D      +  + SR+ D E S+  ++ RE  +
Sbjct: 2108 KEKPLDEPEAQGLE------SRQGRAFEDRRRERERGRNWSRERDWERSRDWDRHREWDK 2161

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
             R+R   + R+RD  R ++ ++SR+R R R RDR    ER +D  RD  +S+DR+RDR+ 
Sbjct: 2162 GRDRSSNRDRERDNDRAKEWDRSRERSRNRDRDR----ERRRD--RDRSRSRDRDRDRER 2215

Query: 53   EKERDRDRDHHHRDRHR 3
             ++RDRDR    +DR +
Sbjct: 2216 ARDRDRDRGRDRKDRSK 2232

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 48/125 (38%), Positives = 69/125 (55%), Gaps = 2/125 (1%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
            E+RR E+  G       + + S       + D    +S++  R+ D + +K  ++ RE  
Sbjct: 2129 EDRRRERERGRNWSRERDWERSRDWDRHREWDKGRDRSSNRDRERDNDRAKEWDRSRERS 2188

Query: 236  RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD-GEKSKDRERDR 60
            R R+R RE+ RDRDRSR RD    RDR+RER+RD      R +DRGRD  ++SK RE  R
Sbjct: 2189 RNRDRDRERRRDRDRSRSRD----RDRDRERARD------RDRDRGRDRKDRSKSRESPR 2238

Query: 59   DGEKE 45
            D + E
Sbjct: 2239 DQKPE 2243

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 36/110 (32%), Positives = 57/110 (51%), Gaps = 3/110 (2%)
 Frame = -2

Query: 428  EYEFEEERRYEQPE--GEGEDNYHN-DSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
            E ++E  R +++     +G D   N D       A + D +  +S +  RD DRE  + R
Sbjct: 2144 ERDWERSRDWDRHREWDKGRDRSSNRDRERDNDRAKEWDRSRERSRN--RDRDRERRRDR 2201

Query: 257  EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSK 108
            ++ R   R+R+R+R + RDRDR RDR   K R + RE  RD+  +   S+
Sbjct: 2202 DRSRSRDRDRDRERARDRDRDRGRDR---KDRSKSRESPRDQKPEARTSE 2248

[222][TOP]
>UniRef100_UPI0001982F92 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982F92
          Length = 1019

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/139 (32%), Positives = 88/139 (63%), Gaps = 3/139 (2%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +E++ + +      +   +D   +       D  D +    SRD++R+ ++ R KDRE  
Sbjct: 32  KEKKEHRESRRSEREKSSDDKHREKERDKHRDKRDKERTRSSRDDERDRARERTKDREKE 91

Query: 236 RERERK-REKGRDRDRSRDRDS-EKSRDRERE-RSRDRVRDGERSKDRGRDGEKSKDRER 66
           R+R+ + R+  R+++R RD++S E++R++ERE R R+R R+ ER +++ R+ E+ K+RER
Sbjct: 92  RDRDHEGRDAEREKERERDKESRERAREKEREDREREREREKEREREKAREREREKERER 151

Query: 65  DRDGEKERDRDRDHHHRDR 9
           +++ E+ER+R+R+   R+R
Sbjct: 152 EKEREREREREREKRDRER 170

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/149 (36%), Positives = 90/149 (60%), Gaps = 9/149 (6%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E  E RR E+ E   +D +      +     D++ T S S    RD  RE +K REK+R+
Sbjct: 36  EHRESRRSER-EKSSDDKHREKERDKHRDKRDKERTRS-SRDDERDRARERTKDREKERD 93

Query: 242 N---GRERERKREKGRD---RDRSRDR---DSEKSRDRERERSRDRVRDGERSKDRGRDG 90
               GR+ ER++E+ RD   R+R+R++   D E+ R+RE+ER R++ R+ ER K+R R+ 
Sbjct: 94  RDHEGRDAEREKERERDKESRERAREKEREDREREREREKEREREKAREREREKEREREK 153

Query: 89  EKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           E+ ++RER+R+   +RDR+R+   R++ R
Sbjct: 154 ERERERERERE---KRDREREDREREKER 179

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/147 (35%), Positives = 82/147 (55%), Gaps = 7/147 (4%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E +R +E  + E E     D   +  A   E   + +     R+ +RE  K+RE++RE
Sbjct: 89  EKERDRDHEGRDAEREKERERDKESRERAREKE--REDREREREREKEREREKARERERE 146

Query: 242 NGRERERKREKGRDRDRSR------DRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
             RERE++RE+ R+R+R +      DR+ EK RDRER R R++ R+ +R+     D  + 
Sbjct: 147 KEREREKEREREREREREKRDREREDREREKERDRERLREREKRREPDRNDSSDGDDVRD 206

Query: 80  KDRERDRDGEKERDRDRDHHHR-DRHR 3
           +DR+R R  +  +DR+RD   R +RHR
Sbjct: 207 RDRKRRRRDDDYKDRERDRSGRSNRHR 233

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/142 (34%), Positives = 79/142 (55%), Gaps = 3/142 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E +   ER  ++ +    D+   D+  +     D++  +        D +RE  + +E++
Sbjct: 77  ERDRARERTKDREKERDRDHEGRDAEREKERERDKESRERAREKEREDREREREREKERE 136

Query: 248 RENGRERERKREKGRDRDRSRDRDSEK-SRDRERERSRDRVRDGERSKDRGRDGEKSK-- 78
           RE  RERER++E+ R+++R R+R+ E+  RDRERE   DR R+ ER ++R R+ EK +  
Sbjct: 137 REKAREREREKEREREKEREREREREREKRDRERE---DREREKERDRERLREREKRREP 193

Query: 77  DRERDRDGEKERDRDRDHHHRD 12
           DR    DG+  RDRDR    RD
Sbjct: 194 DRNDSSDGDDVRDRDRKRRRRD 215

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 47/133 (35%), Positives = 83/133 (62%), Gaps = 2/133 (1%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD-R 246
           E E ++  ++ + E   +  +D   +      +   +   +H  RD +RE  + R+K+ R
Sbjct: 55  EKERDKHRDKRDKERTRSSRDDERDRARERTKDREKERDRDHEGRDAEREKERERDKESR 114

Query: 245 ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
           E  RE+ER+ ++ R+R+R ++R+ EK+R+RERE+ R+R ++ ER ++R R+    +DRER
Sbjct: 115 ERAREKERE-DREREREREKEREREKAREREREKEREREKERERERERERE---KRDRER 170

Query: 65  -DRDGEKERDRDR 30
            DR+ EKERDR+R
Sbjct: 171 EDREREKERDRER 183

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 47/123 (38%), Positives = 75/123 (60%), Gaps = 18/123 (14%)
 Frame = -2

Query: 317 TDSKSNHVSRDNDRESSKSREKDRENGRERERKRE----------KGRDRDRSRD-RDSE 171
           +D K +H  RD + E  + RE+D+E    RE +R           + ++RD+ RD RD E
Sbjct: 9   SDLKKSHRDRDRNGERHRERERDKEKKEHRESRRSEREKSSDDKHREKERDKHRDKRDKE 68

Query: 170 K---SRDRERERSRDRVRDGERSKDR---GRDGEKSKDRERDRDG-EKERDRDRDHHHRD 12
           +   SRD ER+R+R+R +D E+ +DR   GRD E+ K+RERD++  E+ R+++R+   R+
Sbjct: 69  RTRSSRDDERDRARERTKDREKERDRDHEGRDAEREKERERDKESRERAREKEREDRERE 128

Query: 11  RHR 3
           R R
Sbjct: 129 RER 131

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 48/116 (41%), Positives = 69/116 (59%), Gaps = 12/116 (10%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESS---KSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER 144
           + K +  SR ++RE S   K REK+R+  R++  K      RD  RDR  E+++DRE+ER
Sbjct: 33  EKKEHRESRRSEREKSSDDKHREKERDKHRDKRDKERTRSSRDDERDRARERTKDREKER 92

Query: 143 SRDRV-RDGERSKDRGRDGE--------KSKDRERDRDGEKERDRDRDHHHRDRHR 3
            RD   RD ER K+R RD E        + +DRER+R+ EKER+R++    R+R R
Sbjct: 93  DRDHEGRDAEREKERERDKESRERAREKEREDREREREREKEREREK---ARERER 145

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 48/136 (35%), Positives = 67/136 (49%), Gaps = 4/136 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E  E    +    D   +     + +   ++     ++ +RE  + RE++
Sbjct: 102 EREKERERDKESRE-RAREKEREDREREREREKEREREKAREREREKEREREKERERERE 160

Query: 248 RE---NGRERE-RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           RE     RERE R+REK RDR+R R+R+  +  DR      D VRD  R + R R  +  
Sbjct: 161 REREKRDREREDREREKERDRERLREREKRREPDRNDSSDGDDVRD--RDRKRRRRDDDY 218

Query: 80  KDRERDRDGEKERDRD 33
           KDRERDR G   R RD
Sbjct: 219 KDRERDRSGRSNRHRD 234

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 44/101 (43%), Positives = 63/101 (62%), Gaps = 4/101 (3%)
 Frame = -2

Query: 293 SRDNDRESSKS-REKDRENGRERERKREKGRDRDR-SRDRDSEKSR-DRERERSRDRVRD 123
           SR  D +  KS R++DR   R RER+R+K +   R SR  + EKS  D+ RE+ RD+ RD
Sbjct: 4   SRREDSDLKKSHRDRDRNGERHRERERDKEKKEHRESRRSEREKSSDDKHREKERDKHRD 63

Query: 122 GERSKDRGRDG-EKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +R K+R R   +  +DR R+R  ++E++RDRDH  RD  R
Sbjct: 64  -KRDKERTRSSRDDERDRARERTKDREKERDRDHEGRDAER 103

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 44/152 (28%), Positives = 68/152 (44%), Gaps = 16/152 (10%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK------SRE 255
           E  R  E+ + E E     +   +     + +    +     R+ +RE  K       RE
Sbjct: 115 ERAREKEREDREREREREKEREREKAREREREKEREREKEREREREREREKRDREREDRE 174

Query: 254 KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSR------DRVRD----GERSKD 105
           +++E  RER R+REK R+ DR+   D +  RDR+R+R R      DR RD      R +D
Sbjct: 175 REKERDRERLREREKRREPDRNDSSDGDDVRDRDRKRRRRDDDYKDRERDRSGRSNRHRD 234

Query: 104 RGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
            G D  + K  + D D ++ R R+ D     R
Sbjct: 235 EGEDSPRKKSDDDDLDKKERRTREEDLEEEQR 266

[223][TOP]
>UniRef100_A7P8T9 Chromosome chr3 scaffold_8, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7P8T9_VITVI
          Length = 971

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/139 (32%), Positives = 88/139 (63%), Gaps = 3/139 (2%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           +E++ + +      +   +D   +       D  D +    SRD++R+ ++ R KDRE  
Sbjct: 32  KEKKEHRESRRSEREKSSDDKHREKERDKHRDKRDKERTRSSRDDERDRARERTKDREKE 91

Query: 236 RERERK-REKGRDRDRSRDRDS-EKSRDRERE-RSRDRVRDGERSKDRGRDGEKSKDRER 66
           R+R+ + R+  R+++R RD++S E++R++ERE R R+R R+ ER +++ R+ E+ K+RER
Sbjct: 92  RDRDHEGRDAEREKERERDKESRERAREKEREDREREREREKEREREKAREREREKERER 151

Query: 65  DRDGEKERDRDRDHHHRDR 9
           +++ E+ER+R+R+   R+R
Sbjct: 152 EKEREREREREREKRDRER 170

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/149 (36%), Positives = 90/149 (60%), Gaps = 9/149 (6%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E  E RR E+ E   +D +      +     D++ T S S    RD  RE +K REK+R+
Sbjct: 36  EHRESRRSER-EKSSDDKHREKERDKHRDKRDKERTRS-SRDDERDRARERTKDREKERD 93

Query: 242 N---GRERERKREKGRD---RDRSRDR---DSEKSRDRERERSRDRVRDGERSKDRGRDG 90
               GR+ ER++E+ RD   R+R+R++   D E+ R+RE+ER R++ R+ ER K+R R+ 
Sbjct: 94  RDHEGRDAEREKERERDKESRERAREKEREDREREREREKEREREKAREREREKEREREK 153

Query: 89  EKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           E+ ++RER+R+   +RDR+R+   R++ R
Sbjct: 154 ERERERERERE---KRDREREDREREKER 179

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/147 (35%), Positives = 82/147 (55%), Gaps = 7/147 (4%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E E +R +E  + E E     D   +  A   E   + +     R+ +RE  K+RE++RE
Sbjct: 89  EKERDRDHEGRDAEREKERERDKESRERAREKE--REDREREREREKEREREKARERERE 146

Query: 242 NGRERERKREKGRDRDRSR------DRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
             RERE++RE+ R+R+R +      DR+ EK RDRER R R++ R+ +R+     D  + 
Sbjct: 147 KEREREKEREREREREREKRDREREDREREKERDRERLREREKRREPDRNDSSDGDDVRD 206

Query: 80  KDRERDRDGEKERDRDRDHHHR-DRHR 3
           +DR+R R  +  +DR+RD   R +RHR
Sbjct: 207 RDRKRRRRDDDYKDRERDRSGRSNRHR 233

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/142 (34%), Positives = 79/142 (55%), Gaps = 3/142 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E +   ER  ++ +    D+   D+  +     D++  +        D +RE  + +E++
Sbjct: 77  ERDRARERTKDREKERDRDHEGRDAEREKERERDKESRERAREKEREDREREREREKERE 136

Query: 248 RENGRERERKREKGRDRDRSRDRDSEK-SRDRERERSRDRVRDGERSKDRGRDGEKSK-- 78
           RE  RERER++E+ R+++R R+R+ E+  RDRERE   DR R+ ER ++R R+ EK +  
Sbjct: 137 REKAREREREKEREREKEREREREREREKRDRERE---DREREKERDRERLREREKRREP 193

Query: 77  DRERDRDGEKERDRDRDHHHRD 12
           DR    DG+  RDRDR    RD
Sbjct: 194 DRNDSSDGDDVRDRDRKRRRRD 215

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 47/133 (35%), Positives = 83/133 (62%), Gaps = 2/133 (1%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD-R 246
           E E ++  ++ + E   +  +D   +      +   +   +H  RD +RE  + R+K+ R
Sbjct: 55  EKERDKHRDKRDKERTRSSRDDERDRARERTKDREKERDRDHEGRDAEREKERERDKESR 114

Query: 245 ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
           E  RE+ER+ ++ R+R+R ++R+ EK+R+RERE+ R+R ++ ER ++R R+    +DRER
Sbjct: 115 ERAREKERE-DREREREREKEREREKAREREREKEREREKERERERERERE---KRDRER 170

Query: 65  -DRDGEKERDRDR 30
            DR+ EKERDR+R
Sbjct: 171 EDREREKERDRER 183

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 47/123 (38%), Positives = 75/123 (60%), Gaps = 18/123 (14%)
 Frame = -2

Query: 317 TDSKSNHVSRDNDRESSKSREKDRENGRERERKRE----------KGRDRDRSRD-RDSE 171
           +D K +H  RD + E  + RE+D+E    RE +R           + ++RD+ RD RD E
Sbjct: 9   SDLKKSHRDRDRNGERHRERERDKEKKEHRESRRSEREKSSDDKHREKERDKHRDKRDKE 68

Query: 170 K---SRDRERERSRDRVRDGERSKDR---GRDGEKSKDRERDRDG-EKERDRDRDHHHRD 12
           +   SRD ER+R+R+R +D E+ +DR   GRD E+ K+RERD++  E+ R+++R+   R+
Sbjct: 69  RTRSSRDDERDRARERTKDREKERDRDHEGRDAEREKERERDKESRERAREKEREDRERE 128

Query: 11  RHR 3
           R R
Sbjct: 129 RER 131

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 48/116 (41%), Positives = 69/116 (59%), Gaps = 12/116 (10%)
 Frame = -2

Query: 314 DSKSNHVSRDNDRESS---KSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERER 144
           + K +  SR ++RE S   K REK+R+  R++  K      RD  RDR  E+++DRE+ER
Sbjct: 33  EKKEHRESRRSEREKSSDDKHREKERDKHRDKRDKERTRSSRDDERDRARERTKDREKER 92

Query: 143 SRDRV-RDGERSKDRGRDGE--------KSKDRERDRDGEKERDRDRDHHHRDRHR 3
            RD   RD ER K+R RD E        + +DRER+R+ EKER+R++    R+R R
Sbjct: 93  DRDHEGRDAEREKERERDKESRERAREKEREDREREREREKEREREK---ARERER 145

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 48/136 (35%), Positives = 67/136 (49%), Gaps = 4/136 (2%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E  E    +    D   +     + +   ++     ++ +RE  + RE++
Sbjct: 102 EREKERERDKESRE-RAREKEREDREREREREKEREREKAREREREKEREREKERERERE 160

Query: 248 RE---NGRERE-RKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS 81
           RE     RERE R+REK RDR+R R+R+  +  DR      D VRD  R + R R  +  
Sbjct: 161 REREKRDREREDREREKERDRERLREREKRREPDRNDSSDGDDVRD--RDRKRRRRDDDY 218

Query: 80  KDRERDRDGEKERDRD 33
           KDRERDR G   R RD
Sbjct: 219 KDRERDRSGRSNRHRD 234

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 44/101 (43%), Positives = 63/101 (62%), Gaps = 4/101 (3%)
 Frame = -2

Query: 293 SRDNDRESSKS-REKDRENGRERERKREKGRDRDR-SRDRDSEKSR-DRERERSRDRVRD 123
           SR  D +  KS R++DR   R RER+R+K +   R SR  + EKS  D+ RE+ RD+ RD
Sbjct: 4   SRREDSDLKKSHRDRDRNGERHRERERDKEKKEHRESRRSEREKSSDDKHREKERDKHRD 63

Query: 122 GERSKDRGRDG-EKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +R K+R R   +  +DR R+R  ++E++RDRDH  RD  R
Sbjct: 64  -KRDKERTRSSRDDERDRARERTKDREKERDRDHEGRDAER 103

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 44/152 (28%), Positives = 68/152 (44%), Gaps = 16/152 (10%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK------SRE 255
           E  R  E+ + E E     +   +     + +    +     R+ +RE  K       RE
Sbjct: 115 ERAREKEREDREREREREKEREREKAREREREKEREREKEREREREREREKRDREREDRE 174

Query: 254 KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSR------DRVRD----GERSKD 105
           +++E  RER R+REK R+ DR+   D +  RDR+R+R R      DR RD      R +D
Sbjct: 175 REKERDRERLREREKRREPDRNDSSDGDDVRDRDRKRRRRDDDYKDRERDRSGRSNRHRD 234

Query: 104 RGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
            G D  + K  + D D ++ R R+ D     R
Sbjct: 235 EGEDSPRKKSDDDDLDKKERRTREEDLEEEQR 266

[224][TOP]
>UniRef100_Q7RP86 Putative uncharacterized protein PY01573 n=1 Tax=Plasmodium yoelii
           yoelii RepID=Q7RP86_PLAYO
          Length = 554

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 55/142 (38%), Positives = 88/142 (61%), Gaps = 8/142 (5%)
 Frame = -2

Query: 428 EYEFEEER-RYEQPEGEGED-NYHNDSSPQPPAAADED-----LTDSKSNHVSRDNDRES 270
           +YE  E   R  +  G+ ED  Y ND + +   + D        TD +S+H  +  D+  
Sbjct: 338 DYEMNESNYRDRKHSGDEEDYTYENDDNYRKRNSYDSRERKYRKTD-RSHHRDKKYDKYK 396

Query: 269 SKSREKDRENG-RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRD 93
            KS+EK R++  R+R+R R++ +DRD+ RD+D  + +DR+R+R RDR RD +R KDR R+
Sbjct: 397 IKSKEKSRKDKTRDRDRDRDRDKDRDKDRDKDRGRDKDRDRDRDRDRDRDRDRDKDRDRN 456

Query: 92  GEKSKDRERDRDGEKERDRDRD 27
            EK+K++E+    EKE+D+D+D
Sbjct: 457 REKTKEKEK----EKEKDKDKD 474

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 48/139 (34%), Positives = 81/139 (58%), Gaps = 4/139 (2%)
 Frame = -2

Query: 425 YEFEEERRYEQPEGEGEDNYHNDSS--PQPPAAADEDLTDSKSNHVSRDN--DRESSKSR 258
           Y   E        G  ED   N+S+   +  +  +ED T    ++  + N  D    K R
Sbjct: 321 YNSRERADMHNMYGHDEDYEMNESNYRDRKHSGDEEDYTYENDDNYRKRNSYDSRERKYR 380

Query: 257 EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
           + DR + R+++  + K + +++SR    +K+RDR+R+R RD+ RD +R KDRGRD ++ +
Sbjct: 381 KTDRSHHRDKKYDKYKIKSKEKSR---KDKTRDRDRDRDRDKDRDKDRDKDRGRDKDRDR 437

Query: 77  DRERDRDGEKERDRDRDHH 21
           DR+RDRD +++RD+DRD +
Sbjct: 438 DRDRDRDRDRDRDKDRDRN 456

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 45/141 (31%), Positives = 79/141 (56%), Gaps = 7/141 (4%)
 Frame = -2

Query: 425 YEFEEERRYEQPEGEGEDNYHN-DSSPQPPAAADEDLTDSKS-NHVSRDNDRESSKSREK 252
           YE ++  R        E  Y   D S       D+    SK  +   +  DR+  + R+K
Sbjct: 360 YENDDNYRKRNSYDSRERKYRKTDRSHHRDKKYDKYKIKSKEKSRKDKTRDRDRDRDRDK 419

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           DR+  R+++R R+K RDRDR RDRD ++ RD++R+R+R++ ++ E+ K++ +D +K K++
Sbjct: 420 DRDKDRDKDRGRDKDRDRDRDRDRDRDRDRDKDRDRNREKTKEKEKEKEKDKDKDKMKNK 479

Query: 71  ERDRDGEK-----ERDRDRDH 24
            + +  EK     +RD D D+
Sbjct: 480 YKSKTKEKTKGKGKRDSDYDN 500

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 46/151 (30%), Positives = 81/151 (53%), Gaps = 15/151 (9%)
 Frame = -2

Query: 410 ERRYEQPEGEGE-----DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
           ER+Y + +         D Y   S  +       D    +     RD DR+  + R+KDR
Sbjct: 376 ERKYRKTDRSHHRDKKYDKYKIKSKEKSRKDKTRDRDRDRDRDKDRDKDRDKDRGRDKDR 435

Query: 245 ENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR-E 69
           +  R+R+R R++ RD+D  RDR+ EK++++E+E+ +D+ +D  ++K + +  EK+K + +
Sbjct: 436 DRDRDRDRDRDRDRDKD--RDRNREKTKEKEKEKEKDKDKDKMKNKYKSKTKEKTKGKGK 493

Query: 68  RDRD--------GEKERDRDRD-HHHRDRHR 3
           RD D         +K+  +DRD + HRD  R
Sbjct: 494 RDSDYDNSNYSESKKKNIKDRDSNDHRDFSR 524

[225][TOP]
>UniRef100_A8WTM0 Putative uncharacterized protein n=1 Tax=Caenorhabditis briggsae
           RepID=A8WTM0_CAEBR
          Length = 197

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 43/101 (42%), Positives = 72/101 (71%), Gaps = 3/101 (2%)
 Frame = -2

Query: 296 VSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGE 117
           V +   RE  + RE++RE  RERER+RE+ R+R+R R+R+ E+ R+RERER R+R R+ E
Sbjct: 10  VGKFRARERERERERERERERERERERERERERERERERERERERERERERERERERERE 69

Query: 116 RSKDRGRDGEKSKDR---ERDRDGEKERDRDRDHHHRDRHR 3
           R ++R R+ E+ ++R    R+R+ E+ER+++R++   + HR
Sbjct: 70  RERERERETERERERXXXXREREREREREKERENAAGETHR 110

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 46/106 (43%), Positives = 72/106 (67%), Gaps = 10/106 (9%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGER- 114
           R+ +RE  + RE++RE  RERER+RE+ R+R+R R+R+ E+ R+RERER R+  R+ ER 
Sbjct: 26  RERERERERERERERERERERERERERERERERERERERERERERERERERETERERERX 85

Query: 113 --SKDRGRDGEKSKDRE-------RDRDGEKERDRDRDHHHRDRHR 3
              ++R R+ E+ K+RE       RD + E+ER+R+R+   R+R R
Sbjct: 86  XXXREREREREREKERENAAGETHRDTETERERERERE-RERERER 130

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 44/112 (39%), Positives = 72/112 (64%), Gaps = 16/112 (14%)
 Frame = -2

Query: 290 RDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDR-----ERERSRDRV- 129
           R+ +RE  + RE++RE  RERER+RE+ R+R+R R+R++E+ R+R     ERER R+R  
Sbjct: 40  RERERERERERERERERERERERERERERERERERERETERERERXXXXREREREREREK 99

Query: 128 ----------RDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
                     RD E  ++R R+ E+ ++RER+R+ E+ER+R+R+    +  R
Sbjct: 100 ERENAAGETHRDTETERERERERERERERERERERERERERERERERENGGR 151

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 47/150 (31%), Positives = 82/150 (54%), Gaps = 10/150 (6%)
 Frame = -2

Query: 434 MGEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSRE 255
           +G++   E  R  + E E E     +         + +    +     R+ +RE  + RE
Sbjct: 10  VGKFRARERERERERERERERERERER--------ERERERERERERERERERERERERE 61

Query: 254 KDRENGRERERKREKGRDRDRSR---DRDSEKSRDRERERS-------RDRVRDGERSKD 105
           ++RE  RERER+RE+  +R+R R    R+ E+ R+RE+ER        RD   + ER ++
Sbjct: 62  RERERERERERERERETERERERXXXXREREREREREKERENAAGETHRDTETERERERE 121

Query: 104 RGRDGEKSKDRERDRDGEKERDRDRDHHHR 15
           R R+ E+ ++RER+R+ E+ER+R+R++  R
Sbjct: 122 RERERERERERERERERERERERERENGGR 151

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 47/153 (30%), Positives = 73/153 (47%), Gaps = 22/153 (14%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E E ER  E+ E E E     +   +     + +    +     R+ +RE  + RE++
Sbjct: 17  ERERERERERER-ERERERERERERERERERERERERERERERERERERERERERERERE 75

Query: 248 RENGRERER-----KREKGRDRD-----------------RSRDRDSEKSRDRERERSRD 135
           RE  RERER     +RE+ R+R+                 R R+R+ E+ R+RERER R+
Sbjct: 76  RETERERERXXXXREREREREREKERENAAGETHRDTETERERERERERERERERERERE 135

Query: 134 RVRDGERSKDRGRDGEKSKDRERDRDGEKERDR 36
           R R+ ER ++R   G K KD   +   E+  +R
Sbjct: 136 RERERERERERENGGRKYKDSINEVSVEELAER 168

[226][TOP]
>UniRef100_UPI000186E4F1 Chromo domain protein, putative n=1 Tax=Pediculus humanus corporis
            RepID=UPI000186E4F1
          Length = 1795

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 57/142 (40%), Positives = 80/142 (56%), Gaps = 1/142 (0%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            +Y+ +++RR  +     E ++    +PQ P  +            S  +D     SR   
Sbjct: 1576 DYKIKDDRRSHK-----ESHHGAPLTPQRPGGSQN----------SSRHDYSPGDSRTTL 1620

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
              +GR     RE+ RDRDR RDRD    RDRER+R RDR RD +R +DR RD E+ +DR+
Sbjct: 1621 SPHGRNH---RERDRDRDRDRDRD----RDRERDRDRDRDRDRDRDRDRDRDRERDRDRD 1673

Query: 68   RDRDGEKERDRDR-DHHHRDRH 6
            RDRD ++ERDRDR + H RDR+
Sbjct: 1674 RDRDKDRERDRDRYNDHKRDRY 1695

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 51/133 (38%), Positives = 74/133 (55%), Gaps = 1/133 (0%)
 Frame = -2

Query: 398  EQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERK 219
            ++P G    + H+ S    P  +   L+    NH  RD DR+  + R++DRE  R+R+R 
Sbjct: 1598 QRPGGSQNSSRHDYS----PGDSRTTLSPHGRNHRERDRDRDRDRDRDRDRE--RDRDRD 1651

Query: 218  REKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERD 39
            R++ RDRDR RDRD E+ RDR+R+R +DR RD +R  D  RD      R  +      RD
Sbjct: 1652 RDRDRDRDRDRDRDRERDRDRDRDRDKDRERDRDRYNDHKRDRYDGYSRIPNSLYRDSRD 1711

Query: 38   -RDRDHHHRDRHR 3
             R+R +H R  H+
Sbjct: 1712 SRERINHRRPYHQ 1724

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 55/157 (35%), Positives = 70/157 (44%), Gaps = 53/157 (33%)
 Frame = -2

Query: 314  DSKSNHVSRDNDRESSKS-REKDRENGRERERKREKGRDRDRSRDRD------------- 177
            D  SN    D+DRESS S  +K    G+ R R+    RDR RSRD D             
Sbjct: 1530 DRISNKRRIDDDRESSLSPAKKPYHEGKSRGREDWMERDRSRSRDLDYKIKDDRRSHKES 1589

Query: 176  ------------------------------------SEKSRDRERERSRDRVRDGERSKD 105
                                                + + RDR+R+R RDR RD ER +D
Sbjct: 1590 HHGAPLTPQRPGGSQNSSRHDYSPGDSRTTLSPHGRNHRERDRDRDRDRDRDRDRERDRD 1649

Query: 104  RGRDGEKSKDRERDRDGEKERDRDRDH---HHRDRHR 3
            R RD ++ +DR+RDRD E++RDRDRD      RDR R
Sbjct: 1650 RDRDRDRDRDRDRDRDRERDRDRDRDRDKDRERDRDR 1686

[227][TOP]
>UniRef100_UPI00015B5A05 PREDICTED: similar to CG32705-PA n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B5A05
          Length = 742

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 44/107 (41%), Positives = 73/107 (68%), Gaps = 2/107 (1%)
 Frame = -2

Query: 356 SSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD--RENGRERERKREKGRDRDRSRD 183
           SS    +++    +   S+  SRD  R+ S+S+  +  R + +E+ER+R+K RDR+R R+
Sbjct: 425 SSRSSSSSSSSSSSSGSSSGSSRDRGRKRSRSKSPEVRRHDPKEKERERDKERDRERERE 484

Query: 182 RDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKER 42
           R+ E+ R+RERER RDR RD +R +DR RD ++ ++RER+R+ EK++
Sbjct: 485 RERERERERERERERDRERDRDRDRDRDRDRDREREREREREREKKK 531

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 42/115 (36%), Positives = 70/115 (60%), Gaps = 6/115 (5%)
 Frame = -2

Query: 341 PAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERER------KREKGRDRDRSRDR 180
           P A    +  S+S+  S  +   S  S    R+ GR+R R      +R   ++++R RD+
Sbjct: 416 PLAISSPIRSSRSSSSSSSSSSSSGSSSGSSRDRGRKRSRSKSPEVRRHDPKEKERERDK 475

Query: 179 DSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHR 15
           + ++ R+RERER R+R R+ ER +DR RD ++ +DR+RDRD E+ER+R+R+   +
Sbjct: 476 ERDRERERERERERERERERERERDRERDRDRDRDRDRDRDREREREREREREKK 530

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 40/123 (32%), Positives = 69/123 (56%), Gaps = 3/123 (2%)
 Frame = -2

Query: 362 NDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRD 183
           + SS    + +  D    +S   S +  R   K +E++R+  R+RER+RE+ R+R+R R+
Sbjct: 435 SSSSSGSSSGSSRDRGRKRSRSKSPEVRRHDPKEKERERDKERDRERERERERERERERE 494

Query: 182 RDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER---DRDGEKERDRDRDHHHRD 12
           R+ E+ R+R+R+R RDR RD +R ++R R+ E+ K +     ++   K R R      + 
Sbjct: 495 RERERDRERDRDRDRDRDRDRDREREREREREREKKKPNAVPEKPKPKPRSRTPSPRRKR 554

Query: 11  RHR 3
           R R
Sbjct: 555 RER 557

[228][TOP]
>UniRef100_UPI00016E2E1A UPI00016E2E1A related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E2E1A
          Length = 627

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 46/135 (34%), Positives = 79/135 (58%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +E+   + +GE E +   + S +      E  T  KS+   RD +++ ++SREKDRE  R
Sbjct: 182 KEQDSRRRDGEKEHHRGRERSDKHQRREQEGHTKDKSHEQERDKEKDKARSREKDRE--R 239

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
             ER ++K RDR   RD+D E+ R+R  ER +D+ +D +R  D     E+ KD++R R  
Sbjct: 240 HHERDKDKERDRHHERDKDEERDRERHHERDKDKEKDRDRHHDSHAAPERDKDKQRGRGK 299

Query: 53  EKERDRDRDHHHRDR 9
           E++R+R+++   R++
Sbjct: 300 ERQRERNKEPEERNK 314

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 44/138 (31%), Positives = 76/138 (55%), Gaps = 4/138 (2%)
 Frame = -2

Query: 407 RRYEQPEGEGED-NYHNDSSPQPPAAADEDLTDSKSNHVSRDNDR-ESSKSREKDRENGR 234
           R  ++   EG + N   +   +  A  D+      ++H  +D+ R +  K   + RE   
Sbjct: 144 RSQDKENREGRELNLDKEEKKKITANNDKGEQKDPAHHKEQDSRRRDGEKEHHRGRERSD 203

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDG--EKSKDRERDR 60
           + +R+ ++G  +D+S +++ +K +D+ R R +DR R  ER KD+ RD   E+ KD ERDR
Sbjct: 204 KHQRREQEGHTKDKSHEQERDKEKDKARSREKDRERHHERDKDKERDRHHERDKDEERDR 263

Query: 59  DGEKERDRDRDHHHRDRH 6
           +   ERD+D++   RDRH
Sbjct: 264 ERHHERDKDKE-KDRDRH 280

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 39/133 (29%), Positives = 67/133 (50%), Gaps = 4/133 (3%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           EE+++      +GE         Q     D +    +    S  + R   +   KD+ + 
Sbjct: 161 EEKKKITANNDKGEQKDPAHHKEQDSRRRDGEKEHHRGRERSDKHQRREQEGHTKDKSHE 220

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRER----ERSRDRVRDGERSKDRGRDGEKSKDRE 69
           +ER+++++K R R++ R+R  E+ +D+ER    ER +D  RD ER  +R +D EK +DR 
Sbjct: 221 QERDKEKDKARSREKDRERHHERDKDKERDRHHERDKDEERDRERHHERDKDKEKDRDRH 280

Query: 68  RDRDGEKERDRDR 30
            D     ERD+D+
Sbjct: 281 HDSHAAPERDKDK 293

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 38/129 (29%), Positives = 66/129 (51%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           G    ++ +R EQ EG  +D  H     +    A     D + +H  RD D+E  +  E+
Sbjct: 198 GRERSDKHQRREQ-EGHTKDKSHEQERDKEKDKARSREKDRERHH-ERDKDKERDRHHER 255

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDR 72
           D++  R+RER  E+ +D+++ RDR  +     ER++ + R R  ER ++R ++ E     
Sbjct: 256 DKDEERDRERHHERDKDKEKDRDRHHDSHAAPERDKDKQRGRGKERQRERNKEPE----- 310

Query: 71  ERDRDGEKE 45
           ER++  E E
Sbjct: 311 ERNKSEEAE 319

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 34/110 (30%), Positives = 58/110 (52%), Gaps = 14/110 (12%)
 Frame = -2

Query: 293 SRDNDRESSKSREK--DRENGRERERKREKGRDRDRSRDRDSEKSR---DRERERSRDRV 129
           SR  D+E+ + RE   D+E  ++     +KG  +D +  ++ +  R   ++E  R R+R 
Sbjct: 143 SRSQDKENREGRELNLDKEEKKKITANNDKGEQKDPAHHKEQDSRRRDGEKEHHRGRERS 202

Query: 128 RDGERSKDRGRDGEKSKDRERDRDGEKERDR--DRDHHH-------RDRH 6
              +R +  G   +KS ++ERD++ +K R R  DR+ HH       RDRH
Sbjct: 203 DKHQRREQEGHTKDKSHEQERDKEKDKARSREKDRERHHERDKDKERDRH 252

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 34/134 (25%), Positives = 61/134 (45%), Gaps = 8/134 (5%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E + ER +E+ + +  D +H           D+D    +  H  RD D+E  + R  D  
Sbjct: 234 EKDRERHHERDKDKERDRHHE---------RDKDEERDRERHHERDKDKEKDRDRHHDSH 284

Query: 242 NGRERERKREKGRDRDRSRDRDSE-----KSRDRERERSRDRVRDGERSKDRG---RDGE 87
              ER++ +++GR ++R R+R+ E     KS + E ++     R    S  +G   R   
Sbjct: 285 AAPERDKDKQRGRGKERQRERNKEPEERNKSEEAETQQPSSPARIPRPSSAKGQRRRPKN 344

Query: 86  KSKDRERDRDGEKE 45
           ++   E D +G+ E
Sbjct: 345 QASTEESDSEGDGE 358

[229][TOP]
>UniRef100_UPI00016E2E19 UPI00016E2E19 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E2E19
          Length = 649

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 46/135 (34%), Positives = 79/135 (58%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +E+   + +GE E +   + S +      E  T  KS+   RD +++ ++SREKDRE  R
Sbjct: 155 KEQDSRRRDGEKEHHRGRERSDKHQRREQEGHTKDKSHEQERDKEKDKARSREKDRE--R 212

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
             ER ++K RDR   RD+D E+ R+R  ER +D+ +D +R  D     E+ KD++R R  
Sbjct: 213 HHERDKDKERDRHHERDKDEERDRERHHERDKDKEKDRDRHHDSHAAPERDKDKQRGRGK 272

Query: 53  EKERDRDRDHHHRDR 9
           E++R+R+++   R++
Sbjct: 273 ERQRERNKEPEERNK 287

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 41/115 (35%), Positives = 69/115 (60%), Gaps = 5/115 (4%)
 Frame = -2

Query: 335 AADEDLTDSK--SNHVSRDNDR-ESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKS 165
           A + D  + K  ++H  +D+ R +  K   + RE   + +R+ ++G  +D+S +++ +K 
Sbjct: 140 ATNNDKGEQKDPAHHKEQDSRRRDGEKEHHRGRERSDKHQRREQEGHTKDKSHEQERDKE 199

Query: 164 RDRERERSRDRVRDGERSKDRGRDG--EKSKDRERDRDGEKERDRDRDHHHRDRH 6
           +D+ R R +DR R  ER KD+ RD   E+ KD ERDR+   ERD+D++   RDRH
Sbjct: 200 KDKARSREKDRERHHERDKDKERDRHHERDKDEERDRERHHERDKDKE-KDRDRH 253

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 35/116 (30%), Positives = 60/116 (51%), Gaps = 1/116 (0%)
 Frame = -2

Query: 365 HNDSSPQP-PAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRS 189
           +ND   Q  PA   E  +  +         RE S   ++  + G  +++  E+ RD+++ 
Sbjct: 142 NNDKGEQKDPAHHKEQDSRRRDGEKEHHRGRERSDKHQRREQEGHTKDKSHEQERDKEKD 201

Query: 188 RDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHH 21
           + R  EK R+R  ER +D+ RD    +D+  + ++ +  ERD+D EK+RDR  D H
Sbjct: 202 KARSREKDRERHHERDKDKERDRHHERDKDEERDRERHHERDKDKEKDRDRHHDSH 257

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 39/124 (31%), Positives = 66/124 (53%), Gaps = 4/124 (3%)
 Frame = -2

Query: 389 EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREK 210
           +GE +D  H+    Q     D +    +    S  + R   +   KD+ + +ER+++++K
Sbjct: 145 KGEQKDPAHHKE--QDSRRRDGEKEHHRGRERSDKHQRREQEGHTKDKSHEQERDKEKDK 202

Query: 209 GRDRDRSRDRDSEKSRDRER----ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKER 42
            R R++ R+R  E+ +D+ER    ER +D  RD ER  +R +D EK +DR  D     ER
Sbjct: 203 ARSREKDRERHHERDKDKERDRHHERDKDEERDRERHHERDKDKEKDRDRHHDSHAAPER 262

Query: 41  DRDR 30
           D+D+
Sbjct: 263 DKDK 266

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 41/143 (28%), Positives = 71/143 (49%), Gaps = 6/143 (4%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHV-SRDNDRESSKSRE 255
           G    ++ +R EQ EG  +D  H     +    A     D + +H   +D +R+    R+
Sbjct: 171 GRERSDKHQRREQ-EGHTKDKSHEQERDKEKDKARSREKDRERHHERDKDKERDRHHERD 229

Query: 254 KDRENGRERERKREKGRDRDRSRDRDSEKS--RDRERERSRDRVRDGERSK---DRGRDG 90
           KD E  RER  +R+K +++DR R  DS  +  RD++++R R + R  ER+K   +R + G
Sbjct: 230 KDEERDRERHHERDKDKEKDRDRHHDSHAAPERDKDKQRGRGKERQRERNKEPEERNKSG 289

Query: 89  EKSKDRERDRDGEKERDRDRDHH 21
           E S  +    +  ++R    + H
Sbjct: 290 ESSNSKTNLPERAQKRSSPEELH 312

[230][TOP]
>UniRef100_UPI00016E2E18 UPI00016E2E18 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E2E18
          Length = 690

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 46/135 (34%), Positives = 79/135 (58%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
           +E+   + +GE E +   + S +      E  T  KS+   RD +++ ++SREKDRE  R
Sbjct: 176 KEQDSRRRDGEKEHHRGRERSDKHQRREQEGHTKDKSHEQERDKEKDKARSREKDRE--R 233

Query: 233 ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
             ER ++K RDR   RD+D E+ R+R  ER +D+ +D +R  D     E+ KD++R R  
Sbjct: 234 HHERDKDKERDRHHERDKDEERDRERHHERDKDKEKDRDRHHDSHAAPERDKDKQRGRGK 293

Query: 53  EKERDRDRDHHHRDR 9
           E++R+R+++   R++
Sbjct: 294 ERQRERNKEPEERNK 308

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 41/114 (35%), Positives = 69/114 (60%), Gaps = 5/114 (4%)
 Frame = -2

Query: 332 ADEDLTDSK--SNHVSRDNDR-ESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSR 162
           A+ D  + K  ++H  +D+ R +  K   + RE   + +R+ ++G  +D+S +++ +K +
Sbjct: 162 ANNDKGEQKDPAHHKEQDSRRRDGEKEHHRGRERSDKHQRREQEGHTKDKSHEQERDKEK 221

Query: 161 DRERERSRDRVRDGERSKDRGRDG--EKSKDRERDRDGEKERDRDRDHHHRDRH 6
           D+ R R +DR R  ER KD+ RD   E+ KD ERDR+   ERD+D++   RDRH
Sbjct: 222 DKARSREKDRERHHERDKDKERDRHHERDKDEERDRERHHERDKDKE-KDRDRH 274

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 39/133 (29%), Positives = 67/133 (50%), Gaps = 4/133 (3%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           EE+++      +GE         Q     D +    +    S  + R   +   KD+ + 
Sbjct: 155 EEKKKITANNDKGEQKDPAHHKEQDSRRRDGEKEHHRGRERSDKHQRREQEGHTKDKSHE 214

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRER----ERSRDRVRDGERSKDRGRDGEKSKDRE 69
           +ER+++++K R R++ R+R  E+ +D+ER    ER +D  RD ER  +R +D EK +DR 
Sbjct: 215 QERDKEKDKARSREKDRERHHERDKDKERDRHHERDKDEERDRERHHERDKDKEKDRDRH 274

Query: 68  RDRDGEKERDRDR 30
            D     ERD+D+
Sbjct: 275 HDSHAAPERDKDK 287

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/133 (27%), Positives = 67/133 (50%), Gaps = 1/133 (0%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQP-PAAADEDLTDSKSNHVSRDNDRESSKSREKDREN 240
           +++   E  E + +   +ND   Q  PA   E  +  +         RE S   ++  + 
Sbjct: 146 QDKENREGREEKKKITANNDKGEQKDPAHHKEQDSRRRDGEKEHHRGRERSDKHQRREQE 205

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDR 60
           G  +++  E+ RD+++ + R  EK R+R  ER +D+ RD    +D+  + ++ +  ERD+
Sbjct: 206 GHTKDKSHEQERDKEKDKARSREKDRERHHERDKDKERDRHHERDKDEERDRERHHERDK 265

Query: 59  DGEKERDRDRDHH 21
           D EK+RDR  D H
Sbjct: 266 DKEKDRDRHHDSH 278

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 39/126 (30%), Positives = 65/126 (51%), Gaps = 6/126 (4%)
 Frame = -2

Query: 431 GEYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHV-SRDNDRESSKSRE 255
           G    ++ +R EQ EG  +D  H     +    A     D + +H   +D +R+    R+
Sbjct: 192 GRERSDKHQRREQ-EGHTKDKSHEQERDKEKDKARSREKDRERHHERDKDKERDRHHERD 250

Query: 254 KDRENGRERERKREKGRDRDRSRDRDSEKS--RDRERERSRDRVRDGERSK---DRGRDG 90
           KD E  RER  +R+K +++DR R  DS  +  RD++++R R + R  ER+K   +R + G
Sbjct: 251 KDEERDRERHHERDKDKEKDRDRHHDSHAAPERDKDKQRGRGKERQRERNKEPEERNKSG 310

Query: 89  EKSKDR 72
           E S  +
Sbjct: 311 ESSNSK 316

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 34/101 (33%), Positives = 56/101 (55%), Gaps = 11/101 (10%)
 Frame = -2

Query: 272 SSKSREKDRENGRERERK----REKGRDRDR-------SRDRDSEKSRDRERERSRDRVR 126
           +S+S++K+   GRE ++K     +KG  +D        SR RD EK   R RERS    R
Sbjct: 142 TSRSQDKENREGREEKKKITANNDKGEQKDPAHHKEQDSRRRDGEKEHHRGRERSDKHQR 201

Query: 125 DGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
             +    + +  E+ +D+E+D+   +E+DR+R HH RD+ +
Sbjct: 202 REQEGHTKDKSHEQERDKEKDKARSREKDRER-HHERDKDK 241

[231][TOP]
>UniRef100_UPI00016E26B1 UPI00016E26B1 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E26B1
          Length = 479

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 53/147 (36%), Positives = 81/147 (55%), Gaps = 7/147 (4%)
 Frame = -2

Query: 428 EYEFEEERRYE-QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK 252
           E E E+ER  E + E E E     D             + S S H SR +DR+ S+SR++
Sbjct: 271 EKEKEKEREKEREKERERERERERDRERDREKERRGRRSHSNSRHSSRTSDRKRSRSRDR 330

Query: 251 DRENGRERERKREKGRDRDRSRDRDSEKSRDR------ERERSRDRVRDGERSKDRGRDG 90
            R   R+++R+RE+ R R RS+DR+  +SR+R       R R R R R  ER   R R  
Sbjct: 331 RRSRSRDKDRERERRRSRTRSKDRERRRSRERSDRKRHSRSRERRRSRSSERKSHRHRSR 390

Query: 89  EKSKDRERDRDGEKERDRDRDHHHRDR 9
           ++ ++R+R++D ++ERDR+R    +DR
Sbjct: 391 DRDRERDRNQDRDRERDRERSSKDKDR 417

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/155 (34%), Positives = 79/155 (50%), Gaps = 15/155 (9%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRE 243
           E +E+ R    + +GE+         P    D +  + +     +    E  K +EK+RE
Sbjct: 229 ELKEKLRRRSEDRQGEN---------PVVRKDREDREREREEREKKRKEEEEKEKEKERE 279

Query: 242 NGRERERKREKGRDRDRSRDRDSE--------------KSRDRERERSRDRVRDGERSKD 105
             RE+ER+RE+ R+RDR RDR+ E              ++ DR+R RSRDR R   R KD
Sbjct: 280 KEREKERERERERERDRERDREKERRGRRSHSNSRHSSRTSDRKRSRSRDRRRSRSRDKD 339

Query: 104 RGRDGEKSKDRERDRDGEKERDR-DRDHHHRDRHR 3
           R R+  +S+ R +DR+  + R+R DR  H R R R
Sbjct: 340 RERERRRSRTRSKDRERRRSRERSDRKRHSRSRER 374

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 49/144 (34%), Positives = 75/144 (52%), Gaps = 6/144 (4%)
 Frame = -2

Query: 416 EEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENG 237
           EEE + ++ E E E     +   +     + D    +    S  N R SS++ ++ R   
Sbjct: 268 EEEEKEKEKEREKEREKERERERERERDRERDREKERRGRRSHSNSRHSSRTSDRKRSRS 327

Query: 236 RERERKREKGRDRDRSRDRDSEKSRDRERERSRDR------VRDGERSKDRGRDGEKSKD 75
           R+R R R + +DR+R R R   +S+DRER RSR+R       R  ER + R  + +  + 
Sbjct: 328 RDRRRSRSRDKDRERERRRSRTRSKDRERRRSRERSDRKRHSRSRERRRSRSSERKSHRH 387

Query: 74  RERDRDGEKERDRDRDHHHRDRHR 3
           R RDRD E++R++DRD   RDR R
Sbjct: 388 RSRDRDRERDRNQDRD-RERDRER 410

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 48/139 (34%), Positives = 69/139 (49%), Gaps = 2/139 (1%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E + E+ERR  +         H+  +     +   D   S+S    R+ +R  S++R KD
Sbjct: 297 ERDREKERRGRRSHSNSR---HSSRTSDRKRSRSRDRRRSRSRDKDRERERRRSRTRSKD 353

Query: 248 RENGRERERKREK--GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           RE  R RER   K   R R+R R R SE+   R R R RDR RD  + +DR RD E+S  
Sbjct: 354 RERRRSRERSDRKRHSRSRERRRSRSSERKSHRHRSRDRDRERDRNQDRDRERDRERS-S 412

Query: 74  RERDRDGEKERDRDRDHHH 18
           +++DR   +ER   +   H
Sbjct: 413 KDKDRKMTEERSSSKKDKH 431

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 29/80 (36%), Positives = 50/80 (62%), Gaps = 1/80 (1%)
 Frame = -2

Query: 245 ENGRERERKREKGRDRDRSRDRDSEKSRDRERE-RSRDRVRDGERSKDRGRDGEKSKDRE 69
           E  +E+ R+R + R  +    R   + R+RERE R + R  + E+ K++ R+ E+ K+RE
Sbjct: 228 EELKEKLRRRSEDRQGENPVVRKDREDREREREEREKKRKEEEEKEKEKEREKEREKERE 287

Query: 68  RDRDGEKERDRDRDHHHRDR 9
           R+R+ E++R+RDR+   R R
Sbjct: 288 RERERERDRERDREKERRGR 307

[232][TOP]
>UniRef100_Q4QRG7 RNA binding motif protein, X-linked 2 n=1 Tax=Danio rerio
           RepID=Q4QRG7_DANRE
          Length = 434

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 47/134 (35%), Positives = 78/134 (58%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E E  +E+  E+ EG+  D  H ++  +      E   D +     RD  R+    R+++
Sbjct: 226 EQEQLKEKEREREEGKKTDRRHAETQQRERDREGEREGDKERE---RDRGRQRDGERQRE 282

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R+ GR+R+ ++++ R+RD  R RD E+ R+R+  R RD  RD ER +D GR  +  +DRE
Sbjct: 283 RDGGRQRDGEKDRERERDGGRQRDGERQRERDGGRQRDGERDRERERDGGRQRDGDRDRE 342

Query: 68  RDRDGEKERDRDRD 27
           ++RDG ++RD +RD
Sbjct: 343 QERDGGRQRDVERD 356

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 58/139 (41%), Positives = 78/139 (56%), Gaps = 20/139 (14%)
 Frame = -2

Query: 383 EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS----------REKDRENGR 234
           E ED  +   S + PAA   D  D +     ++ +RE  K           RE+DRE  R
Sbjct: 202 EKEDVAYEKYSVKGPAANRRDRADEQEQLKEKEREREEGKKTDRRHAETQQRERDREGER 261

Query: 233 E--RERKREKGRDRD--RSRDRDSEKSR----DRERERSRDRVRDGERSKDR--GRDGEK 84
           E  +ER+R++GR RD  R R+RD  + R    DRERER   R RDGER ++R  GR  + 
Sbjct: 262 EGDKERERDRGRQRDGERQRERDGGRQRDGEKDRERERDGGRQRDGERQRERDGGRQRDG 321

Query: 83  SKDRERDRDGEKERDRDRD 27
            +DRER+RDG ++RD DRD
Sbjct: 322 ERDRERERDGGRQRDGDRD 340

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 51/145 (35%), Positives = 77/145 (53%), Gaps = 14/145 (9%)
 Frame = -2

Query: 395 QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRE--------SSKSREKDREN 240
           Q +GE +     D   Q       +    +     RD +RE          + RE++R+ 
Sbjct: 288 QRDGEKDRERERDGGRQRDGERQRERDGGRQRDGERDRERERDGGRQRDGDRDREQERDG 347

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERE--RSRDRVRDGERSKDRGRDGEKSKDRER 66
           GR+R+ +R++ R+RD  R RD E+ R+RER+  R RD VRD +R +D GR  ++ + RER
Sbjct: 348 GRQRDVERDQERERDGGRQRDGERDRERERDGGRQRDGVRDRKRERDGGRQRDEERVRER 407

Query: 65  DRDGEKERDR----DRDHHHRDRHR 3
           +RD ++ERDR     RDH     HR
Sbjct: 408 ERDRDRERDRGNGKHRDHSREREHR 432

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/155 (34%), Positives = 82/155 (52%), Gaps = 15/155 (9%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD-- 249
           E ++  R  + E EG+     D   Q       +    +     +D +RE    R++D  
Sbjct: 249 ETQQRERDREGEREGDKERERDRGRQRDGERQRERDGGRQRDGEKDRERERDGGRQRDGE 308

Query: 248 ----RENGRERERKREKGRDRDRSRDRDSEKSRDRERE--RSRDRVRDGERSKDRGR--D 93
               R+ GR+R+ +R++ R+RD  R RD ++ R++ER+  R RD  RD ER +D GR  D
Sbjct: 309 RQRERDGGRQRDGERDRERERDGGRQRDGDRDREQERDGGRQRDVERDQERERDGGRQRD 368

Query: 92  GEKSKDRERD----RDGEKERDRDRD-HHHRDRHR 3
           GE+ ++RERD    RDG ++R R+RD    RD  R
Sbjct: 369 GERDRERERDGGRQRDGVRDRKRERDGGRQRDEER 403

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 51/141 (36%), Positives = 72/141 (51%), Gaps = 7/141 (4%)
 Frame = -2

Query: 416 EEERRYEQPEG---EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDR 246
           E++R  E+  G   +GE     D   Q     D +           D DRE  +   + R
Sbjct: 292 EKDRERERDGGRQRDGERQRERDGGRQRDGERDRERERDGGRQRDGDRDREQERDGGRQR 351

Query: 245 ENGRERERKREKGRDRDRSRDRDSEKSRDRERE--RSRDRVRDGERSKD--RGRDGEKSK 78
           +  R++ER+R+ GR RD  RDR+ E+   R+R+  R R R RDG R +D  R R+ E+ +
Sbjct: 352 DVERDQERERDGGRQRDGERDRERERDGGRQRDGVRDRKRERDGGRQRDEERVRERERDR 411

Query: 77  DRERDRDGEKERDRDRDHHHR 15
           DRERDR   K RD  R+  HR
Sbjct: 412 DRERDRGNGKHRDHSREREHR 432

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 55/158 (34%), Positives = 85/158 (53%), Gaps = 18/158 (11%)
 Frame = -2

Query: 422 EFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSK-------SNHVSRDNDRESSK 264
           E ++  + E+ EG  E +    SSP       ED+   K       +N   R +++E  K
Sbjct: 175 EKKKALKEEKREGRSESSA---SSPVRVKKEKEDVAYEKYSVKGPAANRRDRADEQEQLK 231

Query: 263 SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDR--GRDG 90
            +E++RE G++ +R+  + + R+R  DR+ E+  D+ERER R R RDGER ++R  GR  
Sbjct: 232 EKEREREEGKKTDRRHAETQQRER--DREGEREGDKERERDRGRQRDGERQRERDGGRQR 289

Query: 89  EKSKDRERDRDGEKERDRDRDHH---------HRDRHR 3
           +  KDRER+RDG ++RD +R             RDR R
Sbjct: 290 DGEKDRERERDGGRQRDGERQRERDGGRQRDGERDRER 327

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 43/117 (36%), Positives = 61/117 (52%), Gaps = 4/117 (3%)
 Frame = -2

Query: 395 QPEGEGEDNYHNDSSPQPPAAAD--EDLTDSKSNHVSRDNDRESSKSREKDRENGRERER 222
           Q +GE +     D   Q     D  ++    +   V RD +RE    R++D E  RERER
Sbjct: 318 QRDGERDRERERDGGRQRDGDRDREQERDGGRQRDVERDQERERDGGRQRDGERDRERER 377

Query: 221 KREKGRD--RDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRD 57
              + RD  RDR R+RD  + RD ER R R+R RD ER +  G+  + S++RE  R+
Sbjct: 378 DGGRQRDGVRDRKRERDGGRQRDEERVRERERDRDRERDRGNGKHRDHSREREHRRN 434

[233][TOP]
>UniRef100_B2BWH3 Elipsa n=1 Tax=Danio rerio RepID=B2BWH3_DANRE
          Length = 629

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 51/143 (35%), Positives = 84/143 (58%), Gaps = 8/143 (5%)
 Frame = -2

Query: 407 RRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDND-RESSKSREKDREN--- 240
           R  ++   EG + +H D   +          + K     +D + +   K R +D E    
Sbjct: 144 RSQDKENREGRE-HHRDREERKGIKESSGSREQKDPDQPKDQESKRDDKDRRRDAERSDK 202

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS----KDR 72
           GRERER +++ RD+D+SRDR+ +K+R++ERER +DR R+ ER +D+ RD +K     KDR
Sbjct: 203 GRERERTKDRDRDKDKSRDREKDKTREKEREREKDRNREKERERDKDRDKKKERESHKDR 262

Query: 71  ERDRDGEKERDRDRDHHHRDRHR 3
           ERD+D E+E+ R+++   +D+ R
Sbjct: 263 ERDKDREREKRREKE---KDKER 282

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 38/140 (27%), Positives = 82/140 (58%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E+  + E R    E  G     +   P+   +  +D  D + +    D  RE  +++++D
Sbjct: 155 EHHRDREERKGIKESSGSREQKDPDQPKDQESKRDD-KDRRRDAERSDKGRERERTKDRD 213

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R+  + R+R+++K R+++R R++D  + ++RER++ RD+ ++ E  KDR RD ++ +++ 
Sbjct: 214 RDKDKSRDREKDKTREKEREREKDRNREKERERDKDRDKKKERESHKDRERDKDREREKR 273

Query: 68  RDRDGEKERDRDRDHHHRDR 9
           R+++ +KER R+ +   +DR
Sbjct: 274 REKEKDKERPRETEEKLKDR 293

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/138 (37%), Positives = 82/138 (59%), Gaps = 14/138 (10%)
 Frame = -2

Query: 374 DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDR---ESSKSRE-KDRENGRERERKREKG 207
           D       P    + D++  + + +H  R+  +   ESS SRE KD +  +++E KR+  
Sbjct: 132 DKLDQKGKPSTSRSQDKENREGREHHRDREERKGIKESSGSREQKDPDQPKDQESKRD-- 189

Query: 206 RDRDRSRDRDSEKS-RDRERERSRDRVRDGERSKDRGRD--GEKSKDRERDRDGEKERDR 36
              D+ R RD+E+S + RERER++DR RD ++S+DR +D   EK ++RE+DR+ EKER+R
Sbjct: 190 ---DKDRRRDAERSDKGRERERTKDRDRDKDKSRDREKDKTREKEREREKDRNREKERER 246

Query: 35  DRD-------HHHRDRHR 3
           D+D         H+DR R
Sbjct: 247 DKDRDKKKERESHKDRER 264

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 32/104 (30%), Positives = 50/104 (48%), Gaps = 2/104 (1%)
 Frame = -2

Query: 383 EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE--RKREK 210
           E E     D         ++D T  K     +D +RE  + R+KDR+  +ERE  + RE+
Sbjct: 205 ERERTKDRDRDKDKSRDREKDKTREKEREREKDRNREKERERDKDRDKKKERESHKDRER 264

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            +DR+R + R+ EK ++R RE        G+R      +  KSK
Sbjct: 265 DKDREREKRREKEKDKERPRETEEKLKDRGDRKIKAAEEISKSK 308

[234][TOP]
>UniRef100_B0S7L7 Novel protein similar to vertebrate TNF receptor-associated factor
           3 interacting protein 1 (TRAF3IP1, zgc:63522) n=1
           Tax=Danio rerio RepID=B0S7L7_DANRE
          Length = 629

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 51/143 (35%), Positives = 84/143 (58%), Gaps = 8/143 (5%)
 Frame = -2

Query: 407 RRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDND-RESSKSREKDREN--- 240
           R  ++   EG + +H D   +          + K     +D + +   K R +D E    
Sbjct: 144 RSQDKENREGRE-HHRDREERKGIKESSGSREQKDPDQPKDQESKRDDKDRRRDAERSDK 202

Query: 239 GRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKS----KDR 72
           GRERER +++ RD+D+SRDR+ +K+R++ERER +DR R+ ER +D+ RD +K     KDR
Sbjct: 203 GRERERTKDRDRDKDKSRDREKDKTREKEREREKDRNREKERERDKDRDKKKERESHKDR 262

Query: 71  ERDRDGEKERDRDRDHHHRDRHR 3
           ERD+D E+E+ R+++   +D+ R
Sbjct: 263 ERDKDREREKRREKE---KDKER 282

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 38/140 (27%), Positives = 82/140 (58%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E+  + E R    E  G     +   P+   +  +D  D + +    D  RE  +++++D
Sbjct: 155 EHHRDREERKGIKESSGSREQKDPDQPKDQESKRDD-KDRRRDAERSDKGRERERTKDRD 213

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
           R+  + R+R+++K R+++R R++D  + ++RER++ RD+ ++ E  KDR RD ++ +++ 
Sbjct: 214 RDKDKSRDREKDKTREKEREREKDRNREKERERDKDRDKKKERESHKDRERDKDREREKR 273

Query: 68  RDRDGEKERDRDRDHHHRDR 9
           R+++ +KER R+ +   +DR
Sbjct: 274 REKEKDKERPRETEEKLKDR 293

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/138 (37%), Positives = 82/138 (59%), Gaps = 14/138 (10%)
 Frame = -2

Query: 374 DNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDR---ESSKSRE-KDRENGRERERKREKG 207
           D       P    + D++  + + +H  R+  +   ESS SRE KD +  +++E KR+  
Sbjct: 132 DKLDQKGKPSTSRSQDKENREGREHHRDREERKGIKESSGSREQKDPDQPKDQESKRD-- 189

Query: 206 RDRDRSRDRDSEKS-RDRERERSRDRVRDGERSKDRGRD--GEKSKDRERDRDGEKERDR 36
              D+ R RD+E+S + RERER++DR RD ++S+DR +D   EK ++RE+DR+ EKER+R
Sbjct: 190 ---DKDRRRDAERSDKGRERERTKDRDRDKDKSRDREKDKTREKEREREKDRNREKERER 246

Query: 35  DRD-------HHHRDRHR 3
           D+D         H+DR R
Sbjct: 247 DKDRDKKKERESHKDRER 264

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 32/104 (30%), Positives = 50/104 (48%), Gaps = 2/104 (1%)
 Frame = -2

Query: 383 EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERE--RKREK 210
           E E     D         ++D T  K     +D +RE  + R+KDR+  +ERE  + RE+
Sbjct: 205 ERERTKDRDRDKDKSRDREKDKTREKEREREKDRNREKERERDKDRDKKKERESHKDRER 264

Query: 209 GRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            +DR+R + R+ EK ++R RE        G+R      +  KSK
Sbjct: 265 DKDREREKRREKEKDKERPRETEEKLKDRGDRKIKAAEEISKSK 308

[235][TOP]
>UniRef100_A3KMT0 Novel protein similar to LUC7-like (S. cerevisiae) (Luc7l,
           zgc:158803) n=1 Tax=Danio rerio RepID=A3KMT0_DANRE
          Length = 417

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 43/92 (46%), Positives = 61/92 (66%)
 Frame = -2

Query: 278 RESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRG 99
           R   + RE++R    E ER+RE+ R+R+R R+R+ E+ RDRER+R R R R GER ++ G
Sbjct: 243 RREERDREEERAREWEMERERERERERERERERERERERDRERDRRRSRSRSGERYREGG 302

Query: 98  RDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
                   R R+ DGE+ER+R+R H H+DRHR
Sbjct: 303 SSSSHRSRRHRE-DGERERERERKHRHKDRHR 333

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 47/144 (32%), Positives = 68/144 (47%), Gaps = 10/144 (6%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           E+E E ER  E+   E E     +   +     D   + S+S    R+    SS    + 
Sbjct: 256 EWEMERERERER---ERERERERERERERDRERDRRRSRSRSGERYREGGSSSSHRSRRH 312

Query: 248 RENG---RERERK-REKGRDRDRSRDRDSEK-----SRDRERERSRDRVRDGERSKDRGR 96
           RE+G   RERERK R K R R RS    S++     +RD+ER  S +  R+    ++R R
Sbjct: 313 REDGERERERERKHRHKDRHRSRSHSHRSKRKRSSHTRDQERPPSEELWRESCAVEERWR 372

Query: 95  -DGEKSKDRERDRDGEKERDRDRD 27
            DG +  +RER    E  R R+R+
Sbjct: 373 DDGRRDTERERSPSTELSRMRERE 396

[236][TOP]
>UniRef100_A2Q158 PRP38 n=1 Tax=Medicago truncatula RepID=A2Q158_MEDTR
          Length = 385

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 56/151 (37%), Positives = 81/151 (53%), Gaps = 16/151 (10%)
 Frame = -2

Query: 410 ERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESS----KSREKDRE 243
           E R    E + E+   N+ + QP    ++D    +S    RD DR       + R+ DRE
Sbjct: 178 EPRQSALEEDFEEEEENEDNEQPAEEPEKDYNRGRSPARERDRDRRRDSHRHRDRDYDRE 237

Query: 242 NGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
             R+ +R+R +GRDRDR RDR+ E+ RDRER+R R R+R+ E+   R R+G + + R+RD
Sbjct: 238 YDRDYDRERGRGRDRDRDRDREKERDRDRERDRDRYRLRE-EKDYGREREGRERERRDRD 296

Query: 62  RD--------GEKERDRDRDHH----HRDRH 6
           RD          + R RDR  H    +R RH
Sbjct: 297 RDRGRRRSYSRSRSRSRDRKDHDGGDYRKRH 327

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 60/148 (40%), Positives = 76/148 (51%), Gaps = 13/148 (8%)
 Frame = -2

Query: 428 EYEFEEERRYE---QPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
           E +FEEE   E   QP  E E +Y+   SP    A + D    + +H  RD D +    R
Sbjct: 185 EEDFEEEEENEDNEQPAEEPEKDYNRGRSP----ARERDRDRRRDSHRHRDRDYDREYDR 240

Query: 257 EKDRENGR----ERERKREKGRDRDRSRDRD-----SEKSRDRERE-RSRDRVRDGERSK 108
           + DRE GR    +R+R REK RDRDR RDRD      EK   RERE R R+R RD +R +
Sbjct: 241 DYDRERGRGRDRDRDRDREKERDRDRERDRDRYRLREEKDYGREREGRERER-RDRDRDR 299

Query: 107 DRGRDGEKSKDRERDRDGEKERDRDRDH 24
            R R   +S+ R RDR      D  + H
Sbjct: 300 GRRRSYSRSRSRSRDRKDHDGGDYRKRH 327

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 45/120 (37%), Positives = 61/120 (50%), Gaps = 8/120 (6%)
 Frame = -2

Query: 338 AAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRD 159
           +A +ED  + + N  +     E  K   + R   RER+R R +   R R RD D E  RD
Sbjct: 182 SALEEDFEEEEENEDNEQPAEEPEKDYNRGRSPARERDRDRRRDSHRHRDRDYDREYDRD 241

Query: 158 RERE----RSRDRVRDGERSKDRGRDGEKSKDRERDRD----GEKERDRDRDHHHRDRHR 3
            +RE    R RDR RD  R K+R RD E+ +DR R R+    G +   R+R+   RDR R
Sbjct: 242 YDRERGRGRDRDRDRD--REKERDRDRERDRDRYRLREEKDYGREREGRERERRDRDRDR 299

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 46/146 (31%), Positives = 63/146 (43%), Gaps = 11/146 (7%)
 Frame = -2

Query: 428 EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
           +Y+ E +R Y++  G G D              D D    K     R+ DR+  + RE +
Sbjct: 233 DYDREYDRDYDRERGRGRDR-------------DRDRDREKERDRDRERDRDRYRLRE-E 278

Query: 248 RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSK-----------DR 102
           ++ GRERE +  + RDRDR R R    SR R R R R     G+  K           D 
Sbjct: 279 KDYGREREGRERERRDRDRDRGRRRSYSRSRSRSRDRKDHDGGDYRKRHARSSVSPRRDG 338

Query: 101 GRDGEKSKDRERDRDGEKERDRDRDH 24
             DGE  K +E+    EK +D   DH
Sbjct: 339 AEDGEPKKKKEKKEKKEK-KDDGTDH 363

[237][TOP]
>UniRef100_Q8IBU0 Putative uncharacterized protein n=1 Tax=Plasmodium falciparum 3D7
           RepID=Q8IBU0_PLAF7
          Length = 1125

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 47/102 (46%), Positives = 66/102 (64%)
 Frame = -2

Query: 329 DEDLTDSKSNHVSRDNDRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRER 150
           D + +DSK     R+  R+  K R +D    R++ER R+K R R+R RDRD    RDR+R
Sbjct: 386 DSEESDSKWRRRKRERSRDKYKERRRDSIRDRDKERYRDKERYRERERDRD----RDRDR 441

Query: 149 ERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH 24
           ER RDR R+ ER + R R+ E+ +DRERDRD E+ER+R + +
Sbjct: 442 ERDRDRDRERERERHRHRERERERDRERDRDRERERERRKSY 483

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 44/106 (41%), Positives = 68/106 (64%), Gaps = 2/106 (1%)
 Frame = -2

Query: 320 LTDSKSNHVSRDNDRESSKSREKDRENGRER--ERKREKGRDRDRSRDRDSEKSRDRERE 147
           + +   N    D++   SK R + RE  R++  ER+R+  RDRD+ R RD E+ R+RER+
Sbjct: 375 IKEKHRNIEDEDSEESDSKWRRRKRERSRDKYKERRRDSIRDRDKERYRDKERYRERERD 434

Query: 146 RSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDR 9
           R RDR R+ +R +DR R+ E+ + RER+R+ ++ERDRDR+     R
Sbjct: 435 RDRDRDRERDRDRDRERERERHRHRERERERDRERDRDRERERERR 480

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 48/97 (49%), Positives = 62/97 (63%), Gaps = 4/97 (4%)
 Frame = -2

Query: 281 DRESSKSREKDRENGRERERKREKGRDRDRSRDRDSEKSRD----RERERSRDRVRDGER 114
           D +S +S  K R   RER R + K R RD  RDRD E+ RD    RERER RDR RD ER
Sbjct: 384 DEDSEESDSKWRRRKRERSRDKYKERRRDSIRDRDKERYRDKERYRERERDRDRDRDRER 443

Query: 113 SKDRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
            +DR R+ E+ + R R+R+ E++R+RDRD   R+R R
Sbjct: 444 DRDRDRERERERHRHRERERERDRERDRD-RERERER 479

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 47/116 (40%), Positives = 65/116 (56%)
 Frame = -2

Query: 410 ERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGRE 231
           ERR ++     ED    +S  +      E   D K     RD+ R+  K R +D+E  RE
Sbjct: 372 ERRIKEKHRNIEDEDSEESDSKWRRRKRERSRD-KYKERRRDSIRDRDKERYRDKERYRE 430

Query: 230 RERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERD 63
           RER R++ RDR+R RDRD E+ R+R R R R+R RD ER +DR R+ E+ K  + D
Sbjct: 431 RERDRDRDRDRERDRDRDRERERERHRHRERERERDRERDRDRERERERRKSYKFD 486

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 51/144 (35%), Positives = 78/144 (54%), Gaps = 18/144 (12%)
 Frame = -2

Query: 380 GEDNYHNDSSPQPPAAAD--EDLTDSKSNHVSRDNDRESSKSR----------------E 255
           G +NY + SS Q         +++ S S    R N R+  +SR                +
Sbjct: 325 GSNNYSDYSSTQKSRRNKLIRNVSSSASISERRRNKRKRRRSRSISIERRIKEKHRNIED 384

Query: 254 KDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
           +D E    + R+R++ R RD+ ++R  +  RDR++ER RD+ R  ER +DR RD    +D
Sbjct: 385 EDSEESDSKWRRRKRERSRDKYKERRRDSIRDRDKERYRDKERYRERERDRDRD----RD 440

Query: 74  RERDRDGEKERDRDRDHHHRDRHR 3
           RERDRD ++ER+R+R H HR+R R
Sbjct: 441 RERDRDRDRERERER-HRHRERER 463

[238][TOP]
>UniRef100_Q8IBL1 Putative uncharacterized protein n=1 Tax=Plasmodium falciparum 3D7
            RepID=Q8IBL1_PLAF7
          Length = 1003

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 10/152 (6%)
 Frame = -2

Query: 428  EYEFEEER-----RYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK 264
            E E E ER     R +Q E + E     D   Q     ++ +   +   + +D ++E  +
Sbjct: 592  EREKERERNKNKEREKQIERDKEKQMERDKEKQMERDREKQMERDREKQMEKDREKEWDR 651

Query: 263  SREKDRENGRERERKREKGRDRDRSRDRDSEK----SRDRERERSRDRVRDGERSKDRGR 96
             RE++RE   E+ R+REK  DR+R  DR+ EK     R+RE ER+ +R+R+ ER  +R R
Sbjct: 652  DRERNRERHMEKNREREKEMDRERDMDRNREKERNMDREREMERNMERIREREREMERNR 711

Query: 95   DGEKSKDRERDRDGEKERDRDRD-HHHRDRHR 3
            + E+  DRER+R+  + R+  RD   HR+R R
Sbjct: 712  ERERDMDREREREINRNRESLRDIDRHRERER 743

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/145 (35%), Positives = 84/145 (57%), Gaps = 9/145 (6%)
 Frame = -2

Query: 410  ERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK----DRE 243
            ER+ +Q E E E     +         ++ +   K   + RD +++  + REK    DRE
Sbjct: 579  ERKEKQAEMEREREREKERERNKNKEREKQIERDKEKQMERDKEKQMERDREKQMERDRE 638

Query: 242  NGRERERKREKGRDRDRSRDRDSEKSRDRE----RERSRDRVRDGERSKDRGRDGEKSKD 75
               E++R++E  RDR+R+R+R  EK+R+RE    RER  DR R+ ER+ DR R+ E++ +
Sbjct: 639  KQMEKDREKEWDRDRERNRERHMEKNREREKEMDRERDMDRNREKERNMDREREMERNME 698

Query: 74   RERDRDGEKERDRDRDHH-HRDRHR 3
            R R+R+ E ER+R+R+    R+R R
Sbjct: 699  RIREREREMERNRERERDMDRERER 723

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 56/145 (38%), Positives = 78/145 (53%), Gaps = 5/145 (3%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E E ER  E+ E E E N   +         + +    +   ++R+ +      R +D
Sbjct: 750  EREREMERNRER-EREMERNREREREMDRERERERERNMDREREMNRNRESLRDIDRHRD 808

Query: 248  RENGRER--ERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKD 75
             E  RER  ER R++ RDRDR  DR+ +  RDR R+  RDR RD ER ++R R  E+  D
Sbjct: 809  IERYRERNIERDRDRDRDRDRYMDRERDIERDRNRDIERDRNRDMERDRERERYRERDID 868

Query: 74   RERDRDGEKERDRDRDHH---HRDR 9
            RERDR+ ++ERDR+RD      RDR
Sbjct: 869  RERDRERDRERDRNRDRDMDIERDR 893

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 52/148 (35%), Positives = 82/148 (55%), Gaps = 6/148 (4%)
 Frame = -2

Query: 428  EYEFEEERRYEQP---EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
            E E E  R  E+    E E E N + +S        + +    ++    R+ +R   + R
Sbjct: 704  EREMERNRERERDMDREREREINRNRESLRDIDRHRERERDIERNREREREMERNRERER 763

Query: 257  EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            E +R   RERE  RE+ R+R+R+ DR+ E +R+RE  R  DR RD ER ++R  + ++ +
Sbjct: 764  EMERNREREREMDRERERERERNMDREREMNRNRESLRDIDRHRDIERYRERNIERDRDR 823

Query: 77   DRERDRDGEKERDRDRDHH---HRDRHR 3
            DR+RDR  ++ERD +RD +    RDR+R
Sbjct: 824  DRDRDRYMDRERDIERDRNRDIERDRNR 851

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/147 (33%), Positives = 83/147 (56%), Gaps = 5/147 (3%)
 Frame = -2

Query: 428  EYEFEEERRYEQP-----EGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSK 264
            E++ + ER  E+      E E E +   D         + D       ++ R  +RE   
Sbjct: 648  EWDRDRERNRERHMEKNREREKEMDRERDMDRNREKERNMDREREMERNMERIREREREM 707

Query: 263  SREKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEK 84
             R ++RE   +RER+RE  R+R+  RD D  + R+R+ ER+R+R R+ ER+++R R+ E+
Sbjct: 708  ERNRERERDMDREREREINRNRESLRDIDRHRERERDIERNREREREMERNREREREMER 767

Query: 83   SKDRERDRDGEKERDRDRDHHHRDRHR 3
            +++RER+ D E+ER+R+R   + DR R
Sbjct: 768  NREREREMDRERERERER---NMDRER 791

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 48/135 (35%), Positives = 74/135 (54%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKD 249
            E E   ER  E       +   N    +      E L D   +   RD +R   ++ E+D
Sbjct: 764  EMERNREREREMDRERERERERNMDREREMNRNRESLRDIDRH---RDIERYRERNIERD 820

Query: 248  RENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRE 69
            R+  R+R+R  ++ RD +R R+RD E+ R+R+ ER R+R R  ER  DR RD E+ ++R+
Sbjct: 821  RDRDRDRDRYMDRERDIERDRNRDIERDRNRDMERDRERERYRERDIDRERDRERDRERD 880

Query: 68   RDRDGEKERDRDRDH 24
            R+RD + + +RDRDH
Sbjct: 881  RNRDRDMDIERDRDH 895

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 48/127 (37%), Positives = 73/127 (57%), Gaps = 30/127 (23%)
 Frame = -2

Query: 293  SRDNDRESSKSREKDRENGRERERKREKGRDRDRS------------------------- 189
            +R+ +RE  ++RE++RE  RERER+RE+  DR+R                          
Sbjct: 758  NREREREMERNREREREMDRERERERERNMDREREMNRNRESLRDIDRHRDIERYRERNI 817

Query: 188  -RDRDSEKSR----DRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDGEKERDRDRDH 24
             RDRD ++ R    DRER+  RDR RD ER ++R  + ++ ++R R+RD ++ERDR+RD 
Sbjct: 818  ERDRDRDRDRDRYMDRERDIERDRNRDIERDRNRDMERDRERERYRERDIDRERDRERD- 876

Query: 23   HHRDRHR 3
              RDR+R
Sbjct: 877  RERDRNR 883

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 48/138 (34%), Positives = 72/138 (52%), Gaps = 1/138 (0%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R +Q E + E  +  D         +++    K     RD DR   K R  DRE   
Sbjct: 634  ERDREKQMEKDREKEWDRDRERNRERHMEKNREREKEMDRERDMDRNREKERNMDREREM 693

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRERDRDG 54
            ER  +R + R+R+  R+R+ E+  DRERER  +R R+  R  DR R+ E+  +R R+R+ 
Sbjct: 694  ERNMERIREREREMERNRERERDMDREREREINRNRESLRDIDRHRERERDIERNRERER 753

Query: 53   EKERDRDRDHH-HRDRHR 3
            E ER+R+R+    R+R R
Sbjct: 754  EMERNREREREMERNRER 771

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 48/142 (33%), Positives = 79/142 (55%), Gaps = 5/142 (3%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            E  R +Q E + E     D   +     D D   ++  H+ ++ +RE    RE+D +  R
Sbjct: 626  ERDREKQMERDREKQMEKDREKE----WDRDRERNRERHMEKNREREKEMDRERDMDRNR 681

Query: 233  ERER----KREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSKDRER 66
            E+ER    +RE  R+ +R R+R+ E  R+RERER  DR R+ E +++R    +  + RER
Sbjct: 682  EKERNMDREREMERNMERIREREREMERNRERERDMDREREREINRNRESLRDIDRHRER 741

Query: 65   DRDGEKERDRDRD-HHHRDRHR 3
            +RD E+ R+R+R+   +R+R R
Sbjct: 742  ERDIERNREREREMERNRERER 763

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 52/137 (37%), Positives = 75/137 (54%), Gaps = 3/137 (2%)
 Frame = -2

Query: 428  EYEFEEERRYEQPEG---EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSR 258
            E E + ER  E+      E E N + +S          D+   +  ++ RD DR+    R
Sbjct: 772  EREMDRERERERERNMDREREMNRNRESLRD--IDRHRDIERYRERNIERDRDRD----R 825

Query: 257  EKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGRDGEKSK 78
            ++DR   RER+ +R++ RD +R R+RD E+ R+RER R RD  R+ +R +DR R      
Sbjct: 826  DRDRYMDRERDIERDRNRDIERDRNRDMERDRERERYRERDIDRERDRERDRER------ 879

Query: 77   DRERDRDGEKERDRDRD 27
            DR RDRD + ERDRD D
Sbjct: 880  DRNRDRDMDIERDRDHD 896

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 44/127 (34%), Positives = 72/127 (56%), Gaps = 8/127 (6%)
 Frame = -2

Query: 383 EGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREK----DRENGRERERKR 216
           E + N   +  P+     ++     +     ++ +R  +K REK    D+E   ER++++
Sbjct: 564 ERDKNREREKEPEKYERKEKQAEMEREREREKERERNKNKEREKQIERDKEKQMERDKEK 623

Query: 215 EKGRDRDRSRDRDSEKS--RDRERERSRDRVRDGERSKDRGRDGEKSKDRERD--RDGEK 48
           +  RDR++  +RD EK   +DRE+E  RDR R+ ER  ++ R+ EK  DRERD  R+ EK
Sbjct: 624 QMERDREKQMERDREKQMEKDREKEWDRDRERNRERHMEKNREREKEMDRERDMDRNREK 683

Query: 47  ERDRDRD 27
           ER+ DR+
Sbjct: 684 ERNMDRE 690

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 43/148 (29%), Positives = 78/148 (52%), Gaps = 11/148 (7%)
 Frame = -2

Query: 413  EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKSREKDRENGR 234
            ++ R  + E E  +     +  +     +++   +K+    +  +R+  K  E+D+E   
Sbjct: 566  DKNREREKEPEKYERKEKQAEMEREREREKERERNKNKEREKQIERDKEKQMERDKEKQM 625

Query: 233  ERERKREKGRDRDRSRDRDSEKSRDRERERSRDR----------VRDGERSKDRGRDGEK 84
            ER+R+++  RDR++  ++D EK  DR+RER+R+R            D ER  DR R+ E+
Sbjct: 626  ERDREKQMERDREKQMEKDREKEWDRDRERNRERHMEKNREREKEMDRERDMDRNREKER 685

Query: 83   SKDRERDRDGEKERDRDRDHH-HRDRHR 3
            + DRER+ +   ER R+R+    R+R R
Sbjct: 686  NMDREREMERNMERIREREREMERNRER 713

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 42/155 (27%), Positives = 79/155 (50%), Gaps = 18/155 (11%)
 Frame = -2

Query: 413 EERRYEQPEGEGEDNYHNDSSPQPPAAADEDLTDSKSNHVSRDNDRESSKS--------- 261
           E  ++E  +     N ++  +    A       +  ++HV RD +RE  K          
Sbjct: 524 ESIKFEDKKKNNNSNNYSHYNNVHGAFKKHTHNNDNNHHVERDKNREREKEPEKYERKEK 583

Query: 260 ---------REKDRENGRERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSK 108
                    REK+RE  + +ER+++  RD+++  +RD EK  +R+RE+  +R R+ +  K
Sbjct: 584 QAEMEREREREKERERNKNKEREKQIERDKEKQMERDKEKQMERDREKQMERDREKQMEK 643

Query: 107 DRGRDGEKSKDRERDRDGEKERDRDRDHHHRDRHR 3
           DR ++ ++ ++R R+R  EK R+R+++    DR R
Sbjct: 644 DREKEWDRDRERNRERHMEKNREREKE---MDRER 675

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 33/126 (26%), Positives = 61/126 (48%), Gaps = 17/126 (13%)
 Frame = -2

Query: 329  DEDLTDSKSNHVSRDNDRESSKSREKDR----ENGRERERKREKGRDRDRSRDRDSEKSR 162
            + D+   ++  + RD +R+  + RE++R    +  RER+R+R++ RDR+R RD D E+ R
Sbjct: 834  ERDIERDRNRDIERDRNRDMERDRERERYRERDIDRERDRERDRERDRNRDRDMDIERDR 893

Query: 161  DRERERSRDRVR-----DGERSKDRGRDGEKSKDRERDRDG--------EKERDRDRDHH 21
            D +   S   ++     D  + +  G D   +K R    +         +K  D +  + 
Sbjct: 894  DHDLNSSFKSIKNFNSFDISKKRCNGIDSNVNKKRSYINENNNNNNYSVKKIHDENTHYE 953

Query: 20   HRDRHR 3
            H D+ R
Sbjct: 954  HTDKDR 959

[239][TOP]
>UniRef100_Q55AK9 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum
           RepID=Q55AK9_DICDI
          Length = 853

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 46/150 (30%), Positives = 85/150 (56%), Gaps = 12/150 (8%)
 Frame = -2

Query: 419 FEEERRYEQPEGEGEDNYHNDS---------SPQPPAAADEDLTDSKSNHVSRDNDRESS 267
           +    R + P  E  +N+ NDS         SP    +     T S  N+ +++N+  ++
Sbjct: 194 YNNTNREDSPSSEQTNNFENDSTIKILNQLNSPSSSHSTPNTTTVSVQNNNNKNNNNNNN 253

Query: 266 KSREKDRENG---RERERKREKGRDRDRSRDRDSEKSRDRERERSRDRVRDGERSKDRGR 96
            +   +  N    + +ER R++ R+R+R R+R+ E+ R+RERER R+R R+ ER +DR R
Sbjct: 254 NNNNNNNYNNSPNQSKERDRDRERERERERERERERERERERERERERERERERDRDRDR 313

Query: 95  DGEKSKDRERDRDGEKERDRDRDHHHRDRH 6
           + E+ +DRERDRD ++E + + + ++ + +
Sbjct: 314 ERERDRDRERDRDRDREFNTNNNSYNNNNN 343

[240][TOP]
>