BB935114 ( RCC07858 )

[UP]


[1][TOP]
>UniRef100_Q8I5S6 Eukaryotic translation initiation factor 3 subunit 10, putative n=1
            Tax=Plasmodium falciparum 3D7 RepID=Q8I5S6_PLAF7
          Length = 1377

 Score =  105 bits (261), Expect = 2e-21
 Identities = 67/172 (38%), Positives = 95/172 (55%), Gaps = 23/172 (13%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDR---------RGRYKD-----DSEEEFDRKRDRNGDRRHR 313
            +R+   R RDRD + +++RDR         R R +D     + + + DR+RDR+ DR HR
Sbjct: 1071 RRDWSGRDRDRDRERDRDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHR 1130

Query: 312  VD-------DRDGDNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFD 157
             D       DRD D E++RDR  + DR R    RR RD D E++RDR      D + E D
Sbjct: 1131 RDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERD 1190

Query: 156  RKRDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            R RDR  DR R R  +RD D +++RD +R  +D  ++ D K +RD R R+ S
Sbjct: 1191 RDRDRERDRDRDRERERDRDRDRDRDIKRSDRDHKKDRDDKLDRDSRRRERS 1242

 Score =  103 bits (258), Expect = 5e-21
 Identities = 69/150 (46%), Positives = 89/150 (59%), Gaps = 9/150 (6%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
            R+RDR R RDRD + +++RDR  R   D + E DR RDR  DR R R  DRD D E  RD
Sbjct: 1107 RDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRD 1166

Query: 273  RRGDNDRRGNGER-RHRDDDNEKERDR-RGRYKD---DSEEEFDRKRDRNGD--RRHRVD 115
            R  D DR  + +R R RD D ++ERDR R R +D   D E E DR RDR+ D  R  R  
Sbjct: 1167 R--DRDRERDRDRDRERDRDRDRERDRDRDRERDRDRDRERERDRDRDRDRDIKRSDRDH 1224

Query: 114  DRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
             +D D++ +RD RRR +    E+++KR  D
Sbjct: 1225 KKDRDDKLDRDSRRRERSGKPENEKKREND 1254

 Score =  102 bits (254), Expect = 1e-20
 Identities = 74/184 (40%), Positives = 98/184 (53%), Gaps = 30/184 (16%)
 Frame = -1

Query: 471  IQRKMIWKR-------NRDRRYRDRDD-------DNEKERDRRGRYKDDSEEEFDRKRDR 334
            I   + W+R       N D  YR  DD       D  + RDRR     D + + +R RDR
Sbjct: 1030 IDDDLTWRRGDKGGSQNGDDSYRRHDDHHDGTHRDRSEMRDRRDWSGRDRDRDRERDRDR 1089

Query: 333  NGDRRHRVD-----DRDGDNEKERDRRGDNDRRGNGERRHRDD-DNEKERDR-RGRYKDD 175
            + DR HR D     +RD D ++ERDR  D +R  + +R HR D D ++ERDR R R +D 
Sbjct: 1090 DRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERD- 1148

Query: 174  SEEEFDRKRDRNGDRRHRVD-------DRDGDNEKERDH-RRRYKDDSEEDDRKRNRDR- 22
               + DR+RDR+ DR HR D       DRD D E++RD  R R +D   E DR R+R+R 
Sbjct: 1149 --RDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDRERDRDRDRERE 1206

Query: 21   RYRD 10
            R RD
Sbjct: 1207 RDRD 1210

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 69/212 (32%), Positives = 95/212 (44%), Gaps = 70/212 (33%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDR-RGRYKD-----DSEEEFDRKRDRNGDRRHRVD-DRDG 295
            +R+RDR R RDRD D E  RDR R R +D     + + + DR+RDR+ DR HR D DRD 
Sbjct: 1112 ERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDRDRDR 1171

Query: 294  DNEKERDRRGDNDR-----RGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNG- 136
            + +++RDR  D DR     R     R RD D E+ERDR R R +D    + D K+DR+  
Sbjct: 1172 ERDRDRDRERDRDRDRERDRDRDRERDRDRDRERERDRDRDRDRDIKRSDRDHKKDRDDK 1231

Query: 135  -DRRHRVDDRDG--DNEKERDH-------------------------------------- 79
             DR  R  +R G  +NEK+R++                                      
Sbjct: 1232 LDRDSRRRERSGKPENEKKRENDISKRNGTTEERTKNAWNLKEDDDSKAKHETSEENTKS 1291

Query: 78   --------------RRRYKDDSEEDDRKRNRD 25
                            +YKD  ++D  K N+D
Sbjct: 1292 WRNNNKVIDNEIEKAEKYKDGEKKDGEK-NKD 1322

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 52/157 (33%), Positives = 81/157 (51%), Gaps = 10/157 (6%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKE 280
            R+RDR R RDRD + +++RDR  R   D + E DR RDR  DR   R R  DRD + +++
Sbjct: 1141 RDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDRERDRD 1200

Query: 279  RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG------DRRHRV 118
            RDR  + DR  + +R  +  D + ++DR     DD  +   R+R+R+G       R + +
Sbjct: 1201 RDRERERDRDRDRDRDIKRSDRDHKKDR-----DDKLDRDSRRRERSGKPENEKKRENDI 1255

Query: 117  DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
              R+G  E+   +    K+D   DD K   +    +T
Sbjct: 1256 SKRNGTTEERTKNAWNLKED---DDSKAKHETSEENT 1289

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 59/170 (34%), Positives = 89/170 (52%), Gaps = 18/170 (10%)
 Frame = -1

Query: 465  RKMIWKRNRDRRYRDRDDD-------NEKERDRRGRYKDDSEEEF-----DRKRDRNGDR 322
            RK + + ++ +R RD + D        E  R  R   K   +++      D+   +NGD 
Sbjct: 990  RKKLEEISKAQRERDLEMDLQMKRKKEESRRSERSHRKSSIDDDLTWRRGDKGGSQNGDD 1049

Query: 321  RHRVDDRDGDNEKERDRRGDNDRRG-NGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRD 145
             +R  D D  +   RDR    DRR  +G  R RD + +++RDR   ++ D +   DR+RD
Sbjct: 1050 SYRRHD-DHHDGTHRDRSEMRDRRDWSGRDRDRDRERDRDRDRDREHRRDRDR--DRERD 1106

Query: 144  RNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEED---DRKRNRDR-RYRD 10
            R+ DR R R  DR+ D +++R+HRR    D E D   DR+R+RDR R RD
Sbjct: 1107 RDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERD 1156

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 52/164 (31%), Positives = 84/164 (51%), Gaps = 17/164 (10%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            +R+RDR R RDRD D E++RDR            DR+RDR+ DR     DRD D E+ERD
Sbjct: 1164 RRDRDRDRERDRDRDRERDRDR------------DRERDRDRDRER---DRDRDRERERD 1208

Query: 273  RRGDNDRR-GNGERRHRDDDNEK------ERDRRGRYKDDSEEEFDRKRDRNGDRRHRV- 118
            R  D DR     +R H+ D ++K       R+R G+ +++ + E D  + RNG    R  
Sbjct: 1209 RDRDRDRDIKRSDRDHKKDRDDKLDRDSRRRERSGKPENEKKRENDISK-RNGTTEERTK 1267

Query: 117  --------DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
                    DD    +E   ++ + ++++++  D +  +  +Y+D
Sbjct: 1268 NAWNLKEDDDSKAKHETSEENTKSWRNNNKVIDNEIEKAEKYKD 1311

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 53/176 (30%), Positives = 81/176 (46%), Gaps = 19/176 (10%)
 Frame = -1

Query: 480  IRMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRD------------ 337
            IR ++ +   KR  +   R   ++ E+++    R K +   +  R+RD            
Sbjct: 957  IRKLKAEEERKRREEEEERLLKEEMERKKKEEARKKLEEISKAQRERDLEMDLQMKRKKE 1016

Query: 336  --RNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR---RGRYKDDS 172
              R  +R HR    D D    R  +G +    +  RRH D  +   RDR   R R +D S
Sbjct: 1017 ESRRSERSHRKSSIDDDLTWRRGDKGGSQNGDDSYRRHDDHHDGTHRDRSEMRDR-RDWS 1075

Query: 171  EEEFDRKRDRNGDRRHRVDDRDGDNEKERDH-RRRYKDDSEEDDRKRNRDR-RYRD 10
              + DR R+R+ DR     DRD ++ ++RD  R R +D   E DR R+R+R R RD
Sbjct: 1076 GRDRDRDRERDRDR-----DRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRD 1126

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 49/169 (28%), Positives = 76/169 (44%), Gaps = 23/169 (13%)
 Frame = -1

Query: 447  RNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG--DRRHRVDDRDGDNEK 283
            R+RDR   R RDR+ + +++RDR    +D    + D K+DR+   DR  R  +R G  E 
Sbjct: 1191 RDRDRERDRDRDRERERDRDRDRD---RDIKRSDRDHKKDRDDKLDRDSRRRERSGKPEN 1247

Query: 282  ERDRRGD-NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN----------- 139
            E+ R  D + R G  E R ++  N KE D      + SEE     R+ N           
Sbjct: 1248 EKKRENDISKRNGTTEERTKNAWNLKEDDDSKAKHETSEENTKSWRNNNKVIDNEIEKAE 1307

Query: 138  ----GDRR--HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
                G+++   +  D +    KE D      +++E D+ K+N D    D
Sbjct: 1308 KYKDGEKKDGEKNKDENSSKNKENDELANGNEENENDEVKKNDDEEASD 1356

[2][TOP]
>UniRef100_A2G2N0 Eukaryotic translation initiation factor 3 subunit 1, putative n=1
           Tax=Trichomonas vaginalis G3 RepID=A2G2N0_TRIVA
          Length = 535

 Score =  103 bits (257), Expect = 6e-21
 Identities = 63/163 (38%), Positives = 92/163 (56%), Gaps = 9/163 (5%)
 Frame = -1

Query: 480 IRMIQRKMIWKRNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDD 304
           +R    + +  R+ D R R RDD+  + RD  R R +D+ ++   R  DR+ DR     D
Sbjct: 376 VRTRSDERVRTRDEDERVRTRDDERVRTRDEDRVRSRDEDDKPRSRNDDRDRDR-----D 430

Query: 303 RDGDNEKERDRRGDNDRR--GNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRD 145
           RD D +++RDR  D +RR       R RDDD++++RDR     R R +D   ++ DR RD
Sbjct: 431 RDRDRDRDRDRDRDRERRRDDRDRERRRDDDDDRDRDRDRDRDRDRGRDRHRDDRDRDRD 490

Query: 144 RNGDRRHRVDDRDGDNEKERDH-RRRYKDDSEEDDRKRNRDRR 19
           R+ DR+ R  DRD D +++RD  R R +    + DR RNRDRR
Sbjct: 491 RDRDRKDRDRDRDRDRDRDRDRDRDRDRGRDRDRDRGRNRDRR 533

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 66/176 (37%), Positives = 87/176 (49%), Gaps = 34/176 (19%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKER-DRRGRYKDDS------------------------------E 361
           R RD R R RDD+  + R D R R +DD                               +
Sbjct: 346 RTRDDRVRTRDDERVRTRDDERVRTRDDEMVRTRSDERVRTRDEDERVRTRDDERVRTRD 405

Query: 360 EEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYK 181
           E+  R RD +   R R DDRD D +++RDR  D DR  + ERR  D D E+ RD      
Sbjct: 406 EDRVRSRDEDDKPRSRNDDRDRDRDRDRDRDRDRDRDRDRERRRDDRDRERRRD------ 459

Query: 180 DDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           DD + + DR RDR+ DR   RHR DDRD D +++RD + R +D   + DR R+RDR
Sbjct: 460 DDDDRDRDRDRDRDRDRGRDRHR-DDRDRDRDRDRDRKDRDRDRDRDRDRDRDRDR 514

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 66/158 (41%), Positives = 80/158 (50%), Gaps = 12/158 (7%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNE--KERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEK 283
           R+RD R R RDD  E  + RD R R +DD     D +R R  D    R R D+       
Sbjct: 322 RSRDDRERSRDDPVEPRRNRDERVRTRDDRVRTRDDERVRTRDDERVRTRDDEMVRTRSD 381

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDR---RGRYKDDS--EEEFDRKRDRNGDR-RHR 121
           ER R  D D R     R RDD+  + RD    R R +DD       DR RDR+ DR R R
Sbjct: 382 ERVRTRDEDERV----RTRDDERVRTRDEDRVRSRDEDDKPRSRNDDRDRDRDRDRDRDR 437

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
             DRD D E+ RD R R +   ++DDR R+RDR R RD
Sbjct: 438 DRDRDRDRERRRDDRDRERRRDDDDDRDRDRDRDRDRD 475

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 54/116 (46%), Positives = 70/116 (60%), Gaps = 7/116 (6%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYK---DDSEEEFDRKRDRNGDR---RHRVDDRDGDN 289
           R+RDR R RDRD D E+ RD R R +   DD + + DR RDR+ DR   RHR DDRD D 
Sbjct: 431 RDRDRDRDRDRDRDRERRRDDRDRERRRDDDDDRDRDRDRDRDRDRGRDRHR-DDRDRDR 489

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 121
           +++RDR+ D DR  +   R RD D +++RDR      D   + DR R RN DRR +
Sbjct: 490 DRDRDRK-DRDRDRD---RDRDRDRDRDRDR------DRGRDRDRDRGRNRDRRRK 535

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 60/167 (35%), Positives = 84/167 (50%), Gaps = 24/167 (14%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG------DN 289
           +R+RD   R RDD   + RD R R +DD  E    + +R   R  RV  RD       D+
Sbjct: 307 QRHRDDTPRTRDD-RPRSRDDRERSRDDPVEPRRNRDERVRTRDDRVRTRDDERVRTRDD 365

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKER---DRRGRYKDD----SEEEFDRKRDRNGDR 130
           E+ R R  +  R  + ER    D++E+ R   D R R +D+    S +E D+ R RN DR
Sbjct: 366 ERVRTRDDEMVRTRSDERVRTRDEDERVRTRDDERVRTRDEDRVRSRDEDDKPRSRNDDR 425

Query: 129 -RHRVDDRDGDNEKERDH----------RRRYKDDSEEDDRKRNRDR 22
            R R  DRD D +++RD           R R +DD ++ DR R+RDR
Sbjct: 426 DRDRDRDRDRDRDRDRDRDRERRRDDRDRERRRDDDDDRDRDRDRDR 472

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 11/127 (8%)
 Frame = -1

Query: 360 EEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDD------DNEKERD 199
           EEF++  ++N D +H   +R   +E+ ++ +   D+   GE+RHRDD      D  + RD
Sbjct: 270 EEFNKMSEQNRDEQH---ERSVHHEEVQEFKIP-DKPATGEQRHRDDTPRTRDDRPRSRD 325

Query: 198 RRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR-RYKDD----SEEDDRKR 34
            R R +DD  E    + +R   R  RV  RD +  + RD  R R +DD    +  D+R R
Sbjct: 326 DRERSRDDPVEPRRNRDERVRTRDDRVRTRDDERVRTRDDERVRTRDDEMVRTRSDERVR 385

Query: 33  NRDRRYR 13
            RD   R
Sbjct: 386 TRDEDER 392

[3][TOP]
>UniRef100_Q54QF2 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum
           RepID=Q54QF2_DICDI
          Length = 495

 Score =  103 bits (256), Expect = 8e-21
 Identities = 62/159 (38%), Positives = 89/159 (55%), Gaps = 15/159 (9%)
 Frame = -1

Query: 441 RDRRYRDRDD---------DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           RD RYRDRD          D+EKE++R  R  DD + + +R RD + DRR   DDRD D 
Sbjct: 268 RDDRYRDRDHSDRRDDRNRDSEKEKERERR--DDRDRDRERNRDSHYDRR---DDRDRDR 322

Query: 288 EKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
           +++RDRR + +RR + +R R+RD   +++RDRR    DD +   D+ RD      H   +
Sbjct: 323 DRDRDRRDERERRDDRDRERNRDHHYDRDRDRR----DDRDRRDDKDRDTYHHHHHHHQE 378

Query: 111 RDGDNEKERDHRRRYKDDSEEDDR-----KRNRDRRYRD 10
           R  D  ++RDH  RY D +  D++     K+  D RYRD
Sbjct: 379 RRDDRYRDRDHSDRYYDRNRRDEKDHHIDKKREDSRYRD 417

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 62/164 (37%), Positives = 83/164 (50%), Gaps = 23/164 (14%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRG------RYKD-----DSEEEFDRKRDRNGDRRHRVDDRDGDNE 286
           +Y+D+D +NEK ++  G       Y D     D E   DR RDR+   R    +RD + E
Sbjct: 232 KYKDKDKNNEKIQNSNGHTEKPKNYNDNGGRVDDERRDDRYRDRDHSDRRDDRNRDSEKE 291

Query: 285 KERDRRGDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR----- 130
           KER+RR D DR   R       R DD +++RDR    +D+ E   DR R+RN D      
Sbjct: 292 KERERRDDRDRDRERNRDSHYDRRDDRDRDRDRDRDRRDERERRDDRDRERNRDHHYDRD 351

Query: 129 RHRVDDRDGDNEKERD--HRRRYKDDSEEDDRKRNRDR--RYRD 10
           R R DDRD  ++K+RD  H   +      DDR R+RD   RY D
Sbjct: 352 RDRRDDRDRRDDKDRDTYHHHHHHHQERRDDRYRDRDHSDRYYD 395

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/151 (35%), Positives = 84/151 (55%), Gaps = 9/151 (5%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN------ 289
           ++ R+RR  DRD D E+ RD     +DD + + DR RDR  D R R DDRD +       
Sbjct: 291 EKERERR-DDRDRDRERNRDSHYDRRDDRDRDRDRDRDRR-DERERRDDRDRERNRDHHY 348

Query: 288 EKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
           +++RDRR D DRR + +R    H    +++ RD R R +D S+  +D  R+R  ++ H +
Sbjct: 349 DRDRDRRDDRDRRDDKDRDTYHHHHHHHQERRDDRYRDRDHSDRYYD--RNRRDEKDHHI 406

Query: 117 DDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
           D      +K  D R R +D ++  ++KR+R+
Sbjct: 407 D------KKREDSRYRDRDHNDSPNKKRDRN 431

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 59/155 (38%), Positives = 80/155 (51%), Gaps = 16/155 (10%)
 Frame = -1

Query: 450 KRNRDRRYRDRDD-DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           +RNRD  Y  RDD D +++RDR  R  D+ E   DR R+RN D  +   DRD D   +RD
Sbjct: 305 ERNRDSHYDRRDDRDRDRDRDRDRR--DERERRDDRDRERNRDHHY---DRDRDRRDDRD 359

Query: 273 RRGDNDRRGNGERRH----RDDDNEKERDRRGRY-----KDDSEEEFDRKRDRNGDRRHR 121
           RR D DR       H    R DD  ++RD   RY     +D+ +   D+KR+   D R+R
Sbjct: 360 RRDDKDRDTYHHHHHHHQERRDDRYRDRDHSDRYYDRNRRDEKDHHIDKKRE---DSRYR 416

Query: 120 VDDRDGDNEKERDHRRRYKDD------SEEDDRKR 34
             D +    K+RD R  Y++       SEE+ RKR
Sbjct: 417 DRDHNDSPNKKRD-RNDYENRPSNGGLSEEEKRKR 450

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 46/158 (29%), Positives = 80/158 (50%), Gaps = 13/158 (8%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K  ++++  D+     K++++  + +   ++E   K+++  D+ +  DD D D++   D 
Sbjct: 160 KLEKEKKESDKILKKLKKKEKNEKKEKKEKKEKKEKKEKKKDKNYSSDDDDDDDDDNNDS 219

Query: 270 RGDNDRRGNGERRHRDDD--NEKERDRRGR------YKD-----DSEEEFDRKRDRNGDR 130
             D ++    + +++D D  NEK ++  G       Y D     D E   DR RDR  D 
Sbjct: 220 ENDKEKTEKKKDKYKDKDKNNEKIQNSNGHTEKPKNYNDNGGRVDDERRDDRYRDR--DH 277

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRY 16
             R DDR+ D+EKE++  RR   D  + DR+RNRD  Y
Sbjct: 278 SDRRDDRNRDSEKEKERERR---DDRDRDRERNRDSHY 312

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/158 (29%), Positives = 82/158 (51%), Gaps = 10/158 (6%)
 Frame = -1

Query: 462 KMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           K + K+ ++ +   ++   +KE+  + + K+ S ++ D   D N D  +  +  +   +K
Sbjct: 173 KKLKKKEKNEKKEKKEKKEKKEKKEKKKDKNYSSDDDDDDDDDNNDSENDKEKTEKKKDK 232

Query: 282 ERDRRGDNDR----RGNGERRHRDDDN-----EKERDRRGRYKDDSEEEFDRKRDRNGDR 130
            +D+  +N++     G+ E+    +DN     ++ RD R R +D S+   DR RD   ++
Sbjct: 233 YKDKDKNNEKIQNSNGHTEKPKNYNDNGGRVDDERRDDRYRDRDHSDRRDDRNRDSEKEK 292

Query: 129 -RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            R R DDRD D E+ RD     +DD +  DR R+RDRR
Sbjct: 293 ERERRDDRDRDRERNRDSHYDRRDDRDR-DRDRDRDRR 329

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 49/163 (30%), Positives = 80/163 (49%), Gaps = 28/163 (17%)
 Frame = -1

Query: 447 RNRDRR-YRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD------- 292
           R+RDRR  R+R DD ++ER+R        +  +DR RDR  DR  R DD+D D       
Sbjct: 324 RDRDRRDERERRDDRDRERNR--------DHHYDRDRDRRDDRDRR-DDKDRDTYHHHHH 374

Query: 291 --NEKERDRRGDNDRRGNGERRHRDDDNEKERDRR---GRYKD-DSEEEFDRKRDRNG-- 136
              E+  DR  D D       R+R D+ +   D++    RY+D D  +  ++KRDRN   
Sbjct: 375 HHQERRDDRYRDRDHSDRYYDRNRRDEKDHHIDKKREDSRYRDRDHNDSPNKKRDRNDYE 434

Query: 135 -----------DRRHRVDD-RDGDNEKERDHRRRYKDDSEEDD 43
                      ++R R+++ +    ++E +  ++ K+D +E D
Sbjct: 435 NRPSNGGLSEEEKRKRIEEMKQSGLQREEERLKKSKNDEDEKD 477

[4][TOP]
>UniRef100_UPI00015B4177 PREDICTED: similar to S-antigen protein n=1 Tax=Nasonia vitripennis
            RepID=UPI00015B4177
          Length = 2656

 Score =  101 bits (252), Expect = 2e-20
 Identities = 68/153 (44%), Positives = 93/153 (60%), Gaps = 11/153 (7%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDD-NEK---ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
            RN+DR R +DRDD  N++   E+DR  RY+D S+   +R RDR+ D RHR  DRD D  K
Sbjct: 2426 RNKDRGRDKDRDDRYNDRIRSEKDRDDRYRD-SDRYSERSRDRDRDYRHRSSDRDRD--K 2482

Query: 282  ERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
             RD+  D DR    ER R R+ D +++RDR  RYKD  +   DR+ DR  DR+ R  D+D
Sbjct: 2483 SRDKDRDRDRERERERERERERDRDRDRDRDERYKDRDDRYKDRE-DRYKDRKDRSHDKD 2541

Query: 105  -GDNEKERDHRR----RYKDDSEEDDRKRNRDR 22
              D  K+R H +    R+KD S++D + RN D+
Sbjct: 2542 REDRHKDRGHDKDRDDRHKDRSDKDSKDRNADK 2574

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 59/156 (37%), Positives = 86/156 (55%), Gaps = 9/156 (5%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRR--GRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
            +++RD R +D+D+  E ++D R   R +D   ++ DR RD+N D+  R  DRD D  K+R
Sbjct: 2375 EKDRDERRKDKDERREMDKDERLHDRLRD---KDRDRDRDKNRDKE-RDKDRDKDRNKDR 2430

Query: 276  DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
             R  D D R N   R        E+DR  RY+D S+   +R RDR+ D RHR  DRD D 
Sbjct: 2431 GRDKDRDDRYNDRIR-------SEKDRDDRYRD-SDRYSERSRDRDRDYRHRSSDRDRDK 2482

Query: 96   EKERD-------HRRRYKDDSEEDDRKRNRDRRYRD 10
             +++D        R R ++   + DR R+RD RY+D
Sbjct: 2483 SRDKDRDRDRERERERERERERDRDRDRDRDERYKD 2518

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/145 (35%), Positives = 84/145 (57%), Gaps = 2/145 (1%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            +++RD RYRD D  +E+ RDR   Y+   S+ + D+ RD++ DR     DR+ + E+ER+
Sbjct: 2447 EKDRDDRYRDSDRYSERSRDRDRDYRHRSSDRDRDKSRDKDRDR-----DRERERERERE 2501

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKR-DRNGDRRHRVDDRDGDN 97
            R  D DR  + + R++D D ++ +DR  RYKD  +   D+ R DR+ DR H         
Sbjct: 2502 RERDRDRDRDRDERYKDRD-DRYKDREDRYKDRKDRSHDKDREDRHKDRGH--------- 2551

Query: 96   EKERDHRRRYKDDSEEDDRKRNRDR 22
            +K+RD R + + D +  DR  ++DR
Sbjct: 2552 DKDRDDRHKDRSDKDSKDRNADKDR 2576

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 62/164 (37%), Positives = 87/164 (53%), Gaps = 16/164 (9%)
 Frame = -1

Query: 447  RNRDR---RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
            R+RDR   R ++RD D +K+R++ RGR KD  +   DR R    DR  R  D D  +E+ 
Sbjct: 2406 RDRDRDKNRDKERDKDRDKDRNKDRGRDKDRDDRYNDRIRSEK-DRDDRYRDSDRYSERS 2464

Query: 279  RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
            RDR  D D R     R RD   +K+RDR    + + E E +R RDR+ DR  R  DRD  
Sbjct: 2465 RDR--DRDYRHRSSDRDRDKSRDKDRDRDRERERERERERERDRDRDRDRDERYKDRD-- 2520

Query: 99   NEKERDHRRRYKD------DSEEDDR------KRNRDRRYRDTS 4
             ++ +D   RYKD      D + +DR       ++RD R++D S
Sbjct: 2521 -DRYKDREDRYKDRKDRSHDKDREDRHKDRGHDKDRDDRHKDRS 2563

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 51/142 (35%), Positives = 77/142 (54%), Gaps = 5/142 (3%)
 Frame = -1

Query: 447  RNRDRRY----RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
            R+RD R+    RDRD   +K+RDR    + + E E +R RDR+ DR  R  DRD   +  
Sbjct: 2467 RDRDYRHRSSDRDRDKSRDKDRDRDRERERERERERERDRDRDRDRDERYKDRDDRYKDR 2526

Query: 279  RDRRGD-NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
             DR  D  DR  + +R  R  D   ++DR  R+KD S+++    +DRN D+     DRD 
Sbjct: 2527 EDRYKDRKDRSHDKDREDRHKDRGHDKDRDDRHKDRSDKD---SKDRNADK-----DRDE 2578

Query: 102  DNEKERDHRRRYKDDSEEDDRK 37
             NEK++D R +    +++ D +
Sbjct: 2579 KNEKDKDMRIKPDKSADKKDEE 2600

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 44/144 (30%), Positives = 71/144 (49%), Gaps = 9/144 (6%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDD-NEKERDRRGRYKDDSEEEFDRK---RDRNGDRRHRVDDRDGDNE 286
            +R R+R R RDRD D +E+ +DR  RYKD  +   DRK    D++ + RH+    D D +
Sbjct: 2497 ERERERERDRDRDRDRDERYKDRDDRYKDREDRYKDRKDRSHDKDREDRHKDRGHDKDRD 2556

Query: 285  KERDRRGDNDRRGNGERRHRDDDNEKERDRR---GRYKDDSEEEFDR-KRDRNGDRRHRV 118
                 R D D +     + RD+ NEK++D R    +  D  +EE    ++  + D+    
Sbjct: 2557 DRHKDRSDKDSKDRNADKDRDEKNEKDKDMRIKPDKSADKKDEEIAAGEKSSSPDKNKEA 2616

Query: 117  DDRDGDNEKERDHRRRYKDDSEED 46
            +++D   E E+   R     S +D
Sbjct: 2617 EEKDKSKENEKVEDRSKGSVSWQD 2640

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 39/120 (32%), Positives = 55/120 (45%), Gaps = 12/120 (10%)
 Frame = -1

Query: 327  DRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKR 148
            D R    DRD +  K++D R + D+      R RD D +++RD+      D E + DR +
Sbjct: 2370 DIRESEKDRD-ERRKDKDERREMDKDERLHDRLRDKDRDRDRDKNR----DKERDKDRDK 2424

Query: 147  DRNGDRRHRVDDRDGDNEKERDHR------------RRYKDDSEEDDRKRNRDRRYRDTS 4
            DRN DR           +K+RD R             RY+D     +R R+RDR YR  S
Sbjct: 2425 DRNKDR---------GRDKDRDDRYNDRIRSEKDRDDRYRDSDRYSERSRDRDRDYRHRS 2475

[5][TOP]
>UniRef100_Q7RG05 Eukaryotic translation initiation factor 3 subunit 10 n=1
            Tax=Plasmodium yoelii yoelii RepID=Q7RG05_PLAYO
          Length = 1268

 Score =  100 bits (248), Expect = 7e-20
 Identities = 60/150 (40%), Positives = 86/150 (57%), Gaps = 4/150 (2%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            R+RDR R RDRD + +++RDR  +Y+ + E   DR +DR  DR     +RD + ++ERDR
Sbjct: 1022 RDRDRERDRDRDRERDRDRDRDRKYRREKEYRRDRSKDRERDRDR---ERDRERDRERDR 1078

Query: 270  RGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
              D DR  + ER   R RD D E+ERDR      D E + +R RDR   R +R  D+D  
Sbjct: 1079 ERDRDRERDRERDRDRERDRDRERERDR------DRERDRERDRDRERGRDYR-KDKDHR 1131

Query: 99   NEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             ++ERD  R Y+ D E ++R+ +  R   D
Sbjct: 1132 RDRERDRERDYRKDGERENRRGDTRRSEND 1161

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 64/160 (40%), Positives = 89/160 (55%), Gaps = 18/160 (11%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDR-------------RGRYKD---DSEEEFDRKRDRNGDR 322
            +R+RDR R RDRD D E++RDR             R R KD   D + E DR+RDR  D 
Sbjct: 1019 ERDRDRDRERDRDRDRERDRDRDRDRKYRREKEYRRDRSKDRERDRDRERDRERDRERD- 1077

Query: 321  RHRVDDRDGDNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRD 145
            R R  DR+ D E++RDR  D DR    +R R RD + +++R+R   Y+ D +   DR+RD
Sbjct: 1078 RERDRDRERDRERDRDRERDRDRERERDRDRERDRERDRDRERGRDYRKDKDHRRDRERD 1137

Query: 144  RNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
            R  D R     +DG+ E  R   RR ++D E   +KR++D
Sbjct: 1138 RERDYR-----KDGERENRRGDTRRSENDRE---KKRDKD 1169

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 63/168 (37%), Positives = 86/168 (51%), Gaps = 29/168 (17%)
 Frame = -1

Query: 447  RNRDRRYR-----------DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRV 310
            R+RDR+YR           DR+ D ++ERDR    + D E + DR+RDR  DR   R R 
Sbjct: 1040 RDRDRKYRREKEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRERDRDRERDRD 1099

Query: 309  DDRDGDNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD 133
             +R+ D ++ERDR  D DR RG   R+ +D   ++ERDR   Y+ D E E     +R GD
Sbjct: 1100 RERERDRDRERDRERDRDRERGRDYRKDKDHRRDRERDRERDYRKDGERE-----NRRGD 1154

Query: 132  RRHRVDDRD------------GDNEKERDHRRRYKDDS--EEDDRKRN 31
             R   +DR+             DNEKER+      DD   E D+ K+N
Sbjct: 1155 TRRSENDREKKRDKDDYTPNNSDNEKERNAWNIRNDDGGIESDENKKN 1202

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 60/173 (34%), Positives = 89/173 (51%), Gaps = 26/173 (15%)
 Frame = -1

Query: 453  WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRK----RDRNGDR---RHRVDDRDG 295
            W+R+     +  DD+ ++  +    +  D+ E+ DRK    RDR  DR   R R  +RD 
Sbjct: 971  WRRHETGTSQYDDDNYKRHHENNDDHYRDASEKKDRKTWSGRDRERDRERDRDRDRERDR 1030

Query: 294  DNEKERDRRGDNDRRGNGER-----------RHRDDDNEKERDRRGRYKDDSEEEFDRKR 148
            D ++ERDR  D DR+   E+           R RD + ++ERDR    + D + E DR+R
Sbjct: 1031 DRDRERDRDRDRDRKYRREKEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRER 1090

Query: 147  DRNGDR---RHRVDDRDGDNEKERDHRRR-----YKDDSEEDDRKRNRDRRYR 13
            DR+ +R   R R  DRD + ++ERD  R       KD     DR+R+R+R YR
Sbjct: 1091 DRDRERDRDRERERDRDRERDRERDRDRERGRDYRKDKDHRRDRERDRERDYR 1143

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 57/160 (35%), Positives = 84/160 (52%), Gaps = 18/160 (11%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDR---RGR-YKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 286
            +R+RDR R RDRD + ++ERDR   RGR Y+ D +   DR+RDR  D R     +DG+ E
Sbjct: 1095 ERDRDRERERDRDRERDRERDRDRERGRDYRKDKDHRRDRERDRERDYR-----KDGERE 1149

Query: 285  KER--DRRGDNDRRGNGERRHRDD------DNEKERDRRGRYKDDSEEEFDRKRDRN--G 136
              R   RR +NDR    ++R +DD      DNEKER+      DD   E D  +  N  G
Sbjct: 1150 NRRGDTRRSENDRE---KKRDKDDYTPNNSDNEKERNAWNIRNDDGGIESDENKKNNIEG 1206

Query: 135  D---RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
            D      + + RDG+  K+ ++    K + + D++ +  D
Sbjct: 1207 DDNGNNLKGNKRDGEKNKDNENANNDKREEKGDEKGQGSD 1246

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 46/152 (30%), Positives = 77/152 (50%), Gaps = 6/152 (3%)
 Frame = -1

Query: 447  RNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
            R RDR   R R+RD D E+ERDR      + + + +R RD   D+ HR   RD + ++ER
Sbjct: 1084 RERDRERDRDRERDRDRERERDRDRERDRERDRDRERGRDYRKDKDHR---RDRERDRER 1140

Query: 276  DRRGDNDRRG-NGERRHRDDDNEKERDRRGRYKDDSEEEFDRK--RDRNGDRRHRVDDRD 106
            D R D +R    G+ R  ++D EK+RD+     ++S+ E +R     RN D     D+  
Sbjct: 1141 DYRKDGERENRRGDTRRSENDREKKRDKDDYTPNNSDNEKERNAWNIRNDDGGIESDENK 1200

Query: 105  GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             +N +  D+    K +  + ++ ++ +    D
Sbjct: 1201 KNNIEGDDNGNNLKGNKRDGEKNKDNENANND 1232

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 58/176 (32%), Positives = 84/176 (47%), Gaps = 30/176 (17%)
 Frame = -1

Query: 450  KRNRDRRYRD-RDDDNEKERDRRGRYKDD-SEEEFDRKRDRNGDRRHRVDD-----RDGD 292
            +R RDRR +  R    E+ER RR   ++   +EE +RK+     ++ ++D+     R+ D
Sbjct: 881  QRARDRREQHIRKLKAEEERKRREEEEERLRKEEIERKKKEEAHKK-KLDEISRIQRERD 939

Query: 291  NEKERDRRGDNDRRGNGE--------------RRHR------DDDNEKERDRRG--RYKD 178
             E E+     N+   +GE              RRH       DDDN K         Y+D
Sbjct: 940  LEIEQQLLKQNEESRSGEKSLRKSSADDEFTWRRHETGTSQYDDDNYKRHHENNDDHYRD 999

Query: 177  DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
             SE++ DRK     DR R R  DRD D E++RD R R +D   + DRK  R++ YR
Sbjct: 1000 ASEKK-DRKTWSGRDRERDRERDRDRDRERDRD-RDRERDRDRDRDRKYRREKEYR 1053

[6][TOP]
>UniRef100_Q4YT27 Putative uncharacterized protein (Fragment) n=1 Tax=Plasmodium
           berghei RepID=Q4YT27_PLABE
          Length = 476

 Score =  100 bits (248), Expect = 7e-20
 Identities = 65/146 (44%), Positives = 88/146 (60%), Gaps = 5/146 (3%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           R+RDR R RDRD D ++ERDR  +Y+ + E   DR +DR  DR R R  DR+ D E+ERD
Sbjct: 338 RDRDRDRERDRDRDRDRERDRDRKYRREKEYRRDRSKDRERDRDRDRERDRERDRERERD 397

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDR-RGR-YKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
           R  + DR  + ER R RD D E++RDR RGR Y+ D +   DR+RDR  D R     +D 
Sbjct: 398 RDRERDRDRDRERDRERDRDRERDRDRERGRDYRKDKDCRRDRERDRERDYR-----KDS 452

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRD 25
           + E  +   RR + D E   +KR++D
Sbjct: 453 ERENRKGDTRRSEHDRE---KKRDKD 475

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 58/154 (37%), Positives = 86/154 (55%), Gaps = 6/154 (3%)
 Frame = -1

Query: 453 WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-----DRDGDN 289
           W      R RDR+ D E++RDR    + D + + DR+RDR  DR++R +     DR  D 
Sbjct: 319 WSGRDRERERDRERDRERDRDRDRDRERDRDRDRDRERDR--DRKYRREKEYRRDRSKDR 376

Query: 288 EKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
           E++RDR  + DR  + ER R RD + +++RDR    + D + E DR R+R  D R    D
Sbjct: 377 ERDRDRDRERDRERDRERERDRDRERDRDRDRERDRERDRDRERDRDRERGRDYR---KD 433

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           +D   ++ERD  R Y+ DSE ++RK +  R   D
Sbjct: 434 KDCRRDRERDRERDYRKDSERENRKGDTRRSEHD 467

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 66/159 (41%), Positives = 89/159 (55%), Gaps = 15/159 (9%)
 Frame = -1

Query: 435 RRYRDRDDDNEKE----RDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDNEK 283
           +RY + + D+ ++    +DR+     D E E DR+RDR  DR     R R  DRD D E+
Sbjct: 297 KRYHENNGDHYRDASEKKDRKTWSGRDRERERDRERDRERDRDRDRDRERDRDRDRDRER 356

Query: 282 ERD---RRGDNDRRGNGERRHRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDR-RHR 121
           +RD   RR    RR   + R RD D ++ERDR R R ++ D + E DR RDR  DR R R
Sbjct: 357 DRDRKYRREKEYRRDRSKDRERDRDRDRERDRERDRERERDRDRERDRDRDRERDRERDR 416

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
             +RD D E+ RD+R   KD     DR+R+R+R YR  S
Sbjct: 417 DRERDRDRERGRDYR---KDKDCRRDRERDRERDYRKDS 452

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 66/163 (40%), Positives = 87/163 (53%), Gaps = 12/163 (7%)
 Frame = -1

Query: 453 WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRK------RDRNGDR-RHRVDDRDG 295
           W+R+     +  DD+ ++  +  G +  D+ E+ DRK      R+R  DR R R  DRD 
Sbjct: 281 WRRHETGTSQYDDDNYKRYHENNGDHYRDASEKKDRKTWSGRDRERERDRERDRERDRDR 340

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRV 118
           D ++ERDR  D DR  + +R++R    EKE  RR R KD    E DR RDR  DR R R 
Sbjct: 341 DRDRERDRDRDRDRERDRDRKYR---REKEY-RRDRSKD---RERDRDRDRERDRERDRE 393

Query: 117 DDRDGDNEKERD---HRRRYKDDSEEDDRKRNRDRRYR-DTSC 1
            +RD D E++RD    R R +D   E DR R R R YR D  C
Sbjct: 394 RERDRDRERDRDRDRERDRERDRDRERDRDRERGRDYRKDKDC 436

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 50/126 (39%), Positives = 68/126 (53%), Gaps = 8/126 (6%)
 Frame = -1

Query: 450 KRNRDRRYR-------DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDG 295
           +R+RDR+YR       DR  D E++RDR      + + E +R RDR  DR R R  DR+ 
Sbjct: 355 ERDRDRKYRREKEYRRDRSKDRERDRDRDRERDRERDRERERDRDRERDRDRDRERDRER 414

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
           D ++ERDR   +  RG   R+ +D   ++ERDR   Y+ DSE E +RK D       R  
Sbjct: 415 DRDRERDR---DRERGRDYRKDKDCRRDRERDRERDYRKDSERE-NRKGDTRRSEHDREK 470

Query: 114 DRDGDN 97
            RD DN
Sbjct: 471 KRDKDN 476

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 49/170 (28%), Positives = 81/170 (47%), Gaps = 14/170 (8%)
 Frame = -1

Query: 480 IRMIQRKMIWKRNRDRRYRDRDDDNE-KERDRRGRYKDDSEEEFDRKRDRNGDR---RHR 313
           IR ++ +   KR  +   R R ++ E K+++   + K D      R+RD   ++   +  
Sbjct: 201 IRKLKAEEERKRREEEEERLRKEEIERKKKEEAHKKKLDEISRIQRERDLEIEQQLLKQN 260

Query: 312 VDDRDGDNEKERDRRGDN---DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK--- 151
            + R GD    +    D     R   G  ++ DD+ ++  +  G +  D+ E+ DRK   
Sbjct: 261 EESRSGDKTLGKSSADDEFTWRRHETGTSQYDDDNYKRYHENNGDHYRDASEKKDRKTWS 320

Query: 150 ---RDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
              R+R  DR R R  DRD D ++ERD R R +D   + DRK  R++ YR
Sbjct: 321 GRDRERERDRERDRERDRDRDRDRERD-RDRDRDRERDRDRKYRREKEYR 369

[7][TOP]
>UniRef100_A5C811 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5C811_VITVI
          Length = 1499

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 66/145 (45%), Positives = 87/145 (60%), Gaps = 3/145 (2%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDR 271
           RNRDR  RDRD + E+ERD    Y  D + + DR RD + DR R R  +RD D E++RDR
Sbjct: 307 RNRDRN-RDRDHEKERERD----YDRDWDRDRDRDRDHDRDRDRDRERERDRDRERDRDR 361

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNE 94
             D DR  +   R RD D E++RDR      D E + DR+RDR+ DR R R  DRD D E
Sbjct: 362 ERDRDRERD---RDRDRDRERDRDR------DRERDRDRERDRDRDRDRERDRDRDRDRE 412

Query: 93  KERD-HRRRYKDDSEEDDRKRNRDR 22
           ++RD  + R +D + + DR  +RDR
Sbjct: 413 RDRDLDQGRERDRNRDWDRDGHRDR 437

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 58/149 (38%), Positives = 77/149 (51%), Gaps = 7/149 (4%)
 Frame = -1

Query: 453 WKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           W R+RDR     RDRD D E+ERDR      D E + DR+RDR+ D R R  DRD D E+
Sbjct: 329 WDRDRDRDRDHDRDRDRDRERERDRDRERDRDRERDRDRERDRDRD-RDRERDRDRDRER 387

Query: 282 ERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
           +RDR  D DR  + ER R RD D E++RD     + D   ++DR   R+ D    +DDR 
Sbjct: 388 DRDRERDRDRDRDRERDRDRDRDRERDRDLDQGRERDRNRDWDRDGHRDRDHSSHLDDRS 447

Query: 105 GDNEK---ERDHRRRYKDDSEEDDRKRNR 28
             + K       ++ +     E D  R R
Sbjct: 448 SKSAKGNYSDMEKKSWSSSKVESDADRGR 476

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 58/159 (36%), Positives = 80/159 (50%), Gaps = 11/159 (6%)
 Frame = -1

Query: 447 RNRDRRYR-------DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGD 292
           RNRDR +        DRD D +++RDR      D + E +R RDR  DR R R  DR+ D
Sbjct: 311 RNRDRDHEKERERDYDRDWDRDRDRDRDHDRDRDRDRERERDRDRERDRDRERDRDRERD 370

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN---GDRRHR 121
            +++RDR  D DR      R RD D E++RDR    + D + + DR+RDR+   G  R R
Sbjct: 371 RDRDRDRERDRDR-----DRERDRDRERDRDRDRDRERDRDRDRDRERDRDLDQGRERDR 425

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
             D D D  ++RDH     D S +  +    D   +  S
Sbjct: 426 NRDWDRDGHRDRDHSSHLDDRSSKSAKGNYSDMEKKSWS 464

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 58/163 (35%), Positives = 83/163 (50%), Gaps = 20/163 (12%)
 Frame = -1

Query: 438 DRRYRDRD--DDNEKERDRRGRYKDDSEEEFDRKRDRNG--DRRHRVDDRDG-------- 295
           D RY+D    D   ++ DR  R++DD + +    RDR    D +H  DD++         
Sbjct: 241 DGRYKDEKYTDKYPEDLDRDNRHRDDKQRDERLVRDRTSRLDDKHLRDDKETVEIQQKKS 300

Query: 294 ---DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-R 127
              D+++ RDR  D D     + R RD D + +RDR      D + + DR+R+R+ DR R
Sbjct: 301 EPPDSDRNRDRNRDRDHE---KERERDYDRDWDRDRDRDRDHDRDRDRDRERERDRDRER 357

Query: 126 HRVDDRDGDNEKERDH---RRRYKDDSEEDDRKRNRDR-RYRD 10
            R  +RD D E++RD    R R +D   E DR R RDR R RD
Sbjct: 358 DRDRERDRDRERDRDRDRDRERDRDRDRERDRDRERDRDRDRD 400

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 56/157 (35%), Positives = 78/157 (49%), Gaps = 9/157 (5%)
 Frame = -1

Query: 453 WKRNRD--RRYRDRDDDNEKERDRRGRYKDDS-EEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           W ++ D  R + DR   +  +    GRYKD+   +++    DR  D RHR D       K
Sbjct: 217 WDKHEDNIRDFSDRQLSSRDDTAIDGRYKDEKYTDKYPEDLDR--DNRHRDD-------K 267

Query: 282 ERDRRGDNDRRGNGERRH-RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDR 109
           +RD R   DR    + +H RDD    E  ++     DS+   DR RDR+ ++ R R  DR
Sbjct: 268 QRDERLVRDRTSRLDDKHLRDDKETVEIQQKKSEPPDSDRNRDRNRDRDHEKERERDYDR 327

Query: 108 DGDNEKERDH---RRRYKDDSEEDDRKRNRDR-RYRD 10
           D D +++RD    R R +D   E DR R RDR R RD
Sbjct: 328 DWDRDRDRDRDHDRDRDRDRERERDRDRERDRDRERD 364

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 68/200 (34%), Positives = 90/200 (45%), Gaps = 62/200 (31%)
 Frame = -1

Query: 423 DRDDDNEKE-RDRRGRYKDDS-------EEEF----------------DRKRDRN--GDR 322
           D+ +DN ++  DR+   +DD+       +E++                D++RD     DR
Sbjct: 218 DKHEDNIRDFSDRQLSSRDDTAIDGRYKDEKYTDKYPEDLDRDNRHRDDKQRDERLVRDR 277

Query: 321 RHRVDD-----------------------------RDGDNEKER----DRRGDNDR-RGN 244
             R+DD                             RD D+EKER    DR  D DR R  
Sbjct: 278 TSRLDDKHLRDDKETVEIQQKKSEPPDSDRNRDRNRDRDHEKERERDYDRDWDRDRDRDR 337

Query: 243 GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR-RY 67
              R RD D E+ERDR      D E + DR+RDR+ D R R  DRD D E++RD  R R 
Sbjct: 338 DHDRDRDRDRERERDRDRERDRDRERDRDRERDRDRD-RDRERDRDRDRERDRDRERDRD 396

Query: 66  KDDSEEDDRKRNRDR-RYRD 10
           +D   E DR R+RDR R RD
Sbjct: 397 RDRDRERDRDRDRDRERDRD 416

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 54/196 (27%), Positives = 83/196 (42%), Gaps = 46/196 (23%)
 Frame = -1

Query: 471 IQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR------- 313
           + RKM      + +   R+ + + + +RR R + D   ++D+  D   D   R       
Sbjct: 178 VARKMAENTELNLQDELRNPEPDNQLERRIRKRRDGSGDWDKHEDNIRDFSDRQLSSRDD 237

Query: 312 ----------------VDDRDGDN----EKERDRRGDNDRRGNGERRHRDDDNE------ 211
                            +D D DN    +K+RD R   DR    + +H  DD E      
Sbjct: 238 TAIDGRYKDEKYTDKYPEDLDRDNRHRDDKQRDERLVRDRTSRLDDKHLRDDKETVEIQQ 297

Query: 210 -----------KERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRY 67
                      ++R+R   ++ + E ++DR  DR+ DR R    DRD D E+ERD  R  
Sbjct: 298 KKSEPPDSDRNRDRNRDRDHEKERERDYDRDWDRDRDRDRDHDRDRDRDRERERDRDRER 357

Query: 66  KDDSEED-DRKRNRDR 22
             D E D DR+R+RDR
Sbjct: 358 DRDRERDRDRERDRDR 373

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 53/150 (35%), Positives = 68/150 (45%), Gaps = 20/150 (13%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDR-----RHRVDDRDGD 292
           R+RDR R RDRD D E++RDR R R +D D E + DR RDR  DR     R R  +RD D
Sbjct: 371 RDRDRDRERDRDRDRERDRDRERDRDRDRDRERDRDRDRDRERDRDLDQGRERDRNRDWD 430

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKD-------DSEEEFDRKRDRNGD 133
            +  RDR             H DD + K    +G Y D        S+ E D  R R+  
Sbjct: 431 RDGHRDR---------DHSSHLDDRSSK--SAKGNYSDMEKKSWSSSKVESDADRGRSHS 479

Query: 132 RRHRVDD-----RDGDNEKERDHRRRYKDD 58
           R  +VD        G + +  D  R  K +
Sbjct: 480 RPAQVDTTARRASPGSSSQVMDENRYIKQE 509

[8][TOP]
>UniRef100_UPI00019850D8 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019850D8
          Length = 1281

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 65/154 (42%), Positives = 82/154 (53%), Gaps = 8/154 (5%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDR 271
           RNRDR  RDRD + E+ERD    Y  D + + DR RD + DR R R  +RD D E++RDR
Sbjct: 345 RNRDRN-RDRDHEKERERD----YDRDWDRDRDRDRDHDRDRDRDRERERDRDRERDRDR 399

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD---DRDGD 100
             D DR  +   R RD D E++RDR      D E + DR RDR  DR H  D   DRD D
Sbjct: 400 ERDRDRERD---RDRDRDRERDRDRDRERDRDRERDRDRDRDRERDRDHHRDRDRDRDLD 456

Query: 99  NEKERDHRRRYKDDSEED----DRKRNRDRRYRD 10
             +ERD  R +  D   D        +R  +Y+D
Sbjct: 457 QGRERDRNRDWDRDGHRDRDHSSHLDDRSSKYKD 490

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 59/151 (39%), Positives = 84/151 (55%), Gaps = 6/151 (3%)
 Frame = -1

Query: 453 WKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           W R+RDR     RDRD D E+ERDR      D E + DR+RDR+ D R R  DRD D E+
Sbjct: 367 WDRDRDRDRDHDRDRDRDRERERDRDRERDRDRERDRDRERDRDRD-RDRERDRDRDRER 425

Query: 282 ERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
           +RDR  D DR  + ER    HRD D +++ D +GR + D   ++DR   R+ D    +DD
Sbjct: 426 DRDRERDRDRDRDRERDRDHHRDRDRDRDLD-QGRER-DRNRDWDRDGHRDRDHSSHLDD 483

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           R    + +R  +++  DD EE    ++R  +
Sbjct: 484 RSSKYKDDRG-KKKSPDDYEEHSITKSRSAK 513

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 59/153 (38%), Positives = 79/153 (51%), Gaps = 13/153 (8%)
 Frame = -1

Query: 447 RNRDRRYR-------DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGD 292
           RNRDR +        DRD D +++RDR      D + E +R RDR  DR R R  DR+ D
Sbjct: 349 RNRDRDHEKERERDYDRDWDRDRDRDRDHDRDRDRDRERERDRDRERDRDRERDRDRERD 408

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN---GDRRHR 121
            +++RDR  D DR      R RD D E++RDR    + D +   DR RDR+   G  R R
Sbjct: 409 RDRDRDRERDRDR-----DRERDRDRERDRDRDRDRERDRDHHRDRDRDRDLDQGRERDR 463

Query: 120 VDDRDGDNEKERDHRRRYKDDSE--EDDRKRNR 28
             D D D  ++RDH     D S   +DDR + +
Sbjct: 464 NRDWDRDGHRDRDHSSHLDDRSSKYKDDRGKKK 496

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 58/163 (35%), Positives = 83/163 (50%), Gaps = 20/163 (12%)
 Frame = -1

Query: 438 DRRYRDRD--DDNEKERDRRGRYKDDSEEEFDRKRDRNG--DRRHRVDDRDG-------- 295
           D RY+D    D   ++ DR  R++DD + +    RDR    D +H  DD++         
Sbjct: 279 DGRYKDEKYTDKYPEDLDRDNRHRDDKQRDERLVRDRTSRLDDKHLRDDKETVEIQQKKS 338

Query: 294 ---DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-R 127
              D+++ RDR  D D     + R RD D + +RDR      D + + DR+R+R+ DR R
Sbjct: 339 EPPDSDRNRDRNRDRDHE---KERERDYDRDWDRDRDRDRDHDRDRDRDRERERDRDRER 395

Query: 126 HRVDDRDGDNEKERDH---RRRYKDDSEEDDRKRNRDR-RYRD 10
            R  +RD D E++RD    R R +D   E DR R RDR R RD
Sbjct: 396 DRDRERDRDRERDRDRDRDRERDRDRDRERDRDRERDRDRDRD 438

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 58/151 (38%), Positives = 78/151 (51%), Gaps = 8/151 (5%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDGDNE--K 283
           +R+RDR R RDRD D E++RDR      D E + DR RDR  DR H  D DRD D +  +
Sbjct: 400 ERDRDRERDRDRDRDRERDRDRDRERDRDRERDRDRDRDRERDRDHHRDRDRDRDLDQGR 459

Query: 282 ERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVD 115
           ERDR  D DR G+ +R    H DD + K +D RG+ K  D  EE    + R+    +   
Sbjct: 460 ERDRNRDWDRDGHRDRDHSSHLDDRSSKYKDDRGKKKSPDDYEEHSITKSRSAKGNY--- 516

Query: 114 DRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
               D EK+     + + D+   DR R+  R
Sbjct: 517 ---SDMEKKSWSSSKVESDA---DRGRSHSR 541

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 56/157 (35%), Positives = 79/157 (50%), Gaps = 9/157 (5%)
 Frame = -1

Query: 453 WKRNRD--RRYRDRDDDNEKERDRRGRYKDDS-EEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           W +++D  R + DR   +  +    GRYKD+   +++    DR  D RHR D       K
Sbjct: 255 WDKHQDNIRDFSDRQLSSRDDTAIDGRYKDEKYTDKYPEDLDR--DNRHRDD-------K 305

Query: 282 ERDRRGDNDRRGNGERRH-RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDR 109
           +RD R   DR    + +H RDD    E  ++     DS+   DR RDR+ ++ R R  DR
Sbjct: 306 QRDERLVRDRTSRLDDKHLRDDKETVEIQQKKSEPPDSDRNRDRNRDRDHEKERERDYDR 365

Query: 108 DGDNEKERDH---RRRYKDDSEEDDRKRNRDR-RYRD 10
           D D +++RD    R R +D   E DR R RDR R RD
Sbjct: 366 DWDRDRDRDRDHDRDRDRDRERERDRDRERDRDRERD 402

[9][TOP]
>UniRef100_Q4SR86 Chromosome 11 SCAF14528, whole genome shotgun sequence n=1
            Tax=Tetraodon nigroviridis RepID=Q4SR86_TETNG
          Length = 2196

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 62/162 (38%), Positives = 96/162 (59%), Gaps = 13/162 (8%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-------RHRVDDRDGD 292
            + +RDRR RDR+ + E+++ R      D + + DR RDR  DR       R R  DRD +
Sbjct: 2004 EHDRDRRNRDRERERERDKRRDRSRSRDRDRDRDRDRDRGKDRGRDRDRDRDRDRDRDRE 2063

Query: 291  NEKERDRRGDNDRRGNGER-RHRDDDNEKERDR---RGRYKD-DSEEEFDRKRDRNGDR- 130
             +K+RDR  D DR  + +R R +D D ++E+D+   R R KD D E++ DR R+++ DR 
Sbjct: 2064 RDKDRDRDRDKDREKDKDRDREKDKDRDREKDKDKDRDREKDKDREKDKDRDREKDKDRD 2123

Query: 129  RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            R +  DRD D ++E+D  R   D  ++ DR++++DR  RD S
Sbjct: 2124 REKDKDRDKDKDREKDKDR---DKDKDRDREKDKDRDRRDGS 2162

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 71/168 (42%), Positives = 98/168 (58%), Gaps = 25/168 (14%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDR-RGRYKDDSEE---EFDRKRDRNGDR-------RHRVD 307
            +++RDR + +DRD D  KE+DR R R K+   E   E +R R + G+R       RHR  
Sbjct: 1921 EKDRDRSKEKDRDQDRNKEKDRDRDRSKEKDRERSRERERSRGKEGERQRETEGERHRDQ 1980

Query: 306  D----RDGDNEKERDRRGDNDRRGNG-ERRHRDDDNEKERD-RRGRYKD-DSEEEFDRKR 148
            D    RD D E++RDR  D+DRR +  +RR+RD + E+ERD RR R +  D + + DR R
Sbjct: 1981 DGEKRRDRDRERDRDRTKDSDRREHDRDRRNRDRERERERDKRRDRSRSRDRDRDRDRDR 2040

Query: 147  DRNGDR---RHRVDDRDGDNEKERD---HRRRYKDDSEEDDRKRNRDR 22
            DR  DR   R R  DRD D ++ERD    R R KD  ++ DR R +D+
Sbjct: 2041 DRGKDRGRDRDRDRDRDRDRDRERDKDRDRDRDKDREKDKDRDREKDK 2088

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 63/156 (40%), Positives = 89/156 (57%), Gaps = 14/156 (8%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDR---RGRYKD---DSEEEFDRKRDRNGDR---RHRVDDRD 298
            R++DR + +DRD D  KE+DR   R + KD   D  +E DR R +  DR   R++  DRD
Sbjct: 1884 RDQDRSKEKDRDQDRNKEKDRDQDRNKEKDRDQDRNKEKDRDRSKEKDRDQDRNKEKDRD 1943

Query: 297  GDNEKERDRRGDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR 127
             D  KE+DR    +R   RG    R R+ + E+ RD+ G  + D + E DR R ++ DRR
Sbjct: 1944 RDRSKEKDRERSRERERSRGKEGERQRETEGERHRDQDGEKRRDRDRERDRDRTKDSDRR 2003

Query: 126  -HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             H  D R+ D E+ER+  +R +D S   DR R+RDR
Sbjct: 2004 EHDRDRRNRDRERERERDKR-RDRSRSRDRDRDRDR 2038

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 61/163 (37%), Positives = 93/163 (57%), Gaps = 15/163 (9%)
 Frame = -1

Query: 453  WKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
            W R+RDR R RD D   E+ERDR    + D +++  +++DR+ DR ++  DRD D  KE+
Sbjct: 1854 WSRDRDRSRDRDADRSRERERDRDRSKEKDRDQDRSKEKDRDQDR-NKEKDRDQDRNKEK 1912

Query: 276  DRRGDNDRRGNGER-----RHRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDR---- 130
            DR  D ++  + +R     R +D + EK+RDR R + KD +   E +R R + G+R    
Sbjct: 1913 DRDQDRNKEKDRDRSKEKDRDQDRNKEKDRDRDRSKEKDRERSRERERSRGKEGERQRET 1972

Query: 129  ---RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
               RHR  D+DG+  ++RD  R      + D R+ +RDRR RD
Sbjct: 1973 EGERHR--DQDGEKRRDRDRERDRDRTKDSDRREHDRDRRNRD 2013

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 63/158 (39%), Positives = 87/158 (55%), Gaps = 16/158 (10%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDGDNEKERD 274
            R++DR + +DRD D  KE+DR    + D +++ ++++DR+ DR    D +R  + E+ R 
Sbjct: 1904 RDQDRNKEKDRDQDRNKEKDRDRSKEKDRDQDRNKEKDRDRDRSKEKDRERSRERERSRG 1963

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGD-------- 133
            + G+  R   GER HRD D EK RDR     R R KD    E DR R RN D        
Sbjct: 1964 KEGERQRETEGER-HRDQDGEKRRDRDRERDRDRTKDSDRREHDRDR-RNRDRERERERD 2021

Query: 132  -RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             RR R   RD D +++RD R R KD   + DR R+RDR
Sbjct: 2022 KRRDRSRSRDRDRDRDRD-RDRGKDRGRDRDRDRDRDR 2058

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 60/150 (40%), Positives = 84/150 (56%), Gaps = 7/150 (4%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 283
            +     R+RD+D +  ++RDR   R R KD    E DR R RN DR R R  D+  D  +
Sbjct: 1970 RETEGERHRDQDGEKRRDRDRERDRDRTKDSDRREHDRDR-RNRDRERERERDKRRDRSR 2028

Query: 282  ERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDR 109
             RDR  D DR R  G+ R RD D +++RDR    + D + + DR +DR  D+ R R  D+
Sbjct: 2029 SRDRDRDRDRDRDRGKDRGRDRDRDRDRDRDRDRERDKDRDRDRDKDREKDKDRDREKDK 2088

Query: 108  DGDNEKERD-HRRRYKDDSEEDDRKRNRDR 22
            D D EK++D  R R KD   E D+ R+R++
Sbjct: 2089 DRDREKDKDKDRDREKDKDREKDKDRDREK 2118

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 57/145 (39%), Positives = 88/145 (60%), Gaps = 10/145 (6%)
 Frame = -1

Query: 426  RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR-HRVDDRDGDNEKERDRRGDNDRR 250
            R R+ + E+ RD+ G  + D + E DR R ++ DRR H  D R+ D E+ER+R   + RR
Sbjct: 1968 RQRETEGERHRDQDGEKRRDRDRERDRDRTKDSDRREHDRDRRNRDRERERER---DKRR 2024

Query: 249  GNGERRHRDDDNEKERDR---RGRYKD---DSEEEFDRKRDRNGDR---RHRVDDRDGDN 97
                 R RD D +++RDR   RGR +D   D + + DR+RD++ DR   + R  D+D D 
Sbjct: 2025 DRSRSRDRDRDRDRDRDRGKDRGRDRDRDRDRDRDRDRERDKDRDRDRDKDREKDKDRDR 2084

Query: 96   EKERDHRRRYKDDSEEDDRKRNRDR 22
            EK++D R R KD  ++ DR++++DR
Sbjct: 2085 EKDKD-RDREKDKDKDRDREKDKDR 2108

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 57/145 (39%), Positives = 85/145 (58%), Gaps = 2/145 (1%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRN-GDRRHRVDDRDGDNEKERD 274
            +R  DR  R+RD + E+ERD+R       + + DR RDR+ G  R R  DRD D +++RD
Sbjct: 2002 RREHDRDRRNRDRERERERDKRRDRSRSRDRDRDRDRDRDRGKDRGRDRDRDRDRDRDRD 2061

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDN 97
            R  D DR      R RD D EK++DR      D E++ DR R+++ D+ R R  D+D + 
Sbjct: 2062 RERDKDRD-----RDRDKDREKDKDR------DREKDKDRDREKDKDKDRDREKDKDREK 2110

Query: 96   EKERDHRRRYKDDSEEDDRKRNRDR 22
            +K+RD R + KD   E D+ R++D+
Sbjct: 2111 DKDRD-REKDKDRDREKDKDRDKDK 2134

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 59/159 (37%), Positives = 91/159 (57%), Gaps = 10/159 (6%)
 Frame = -1

Query: 468  QRKMIWKRNRD-----RRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH---R 313
            QR+   +R+RD     RR RDR+ D ++ +D   R  D      DR+R+R  D+R    R
Sbjct: 1969 QRETEGERHRDQDGEKRRDRDRERDRDRTKDSDRREHDRDRRNRDRERERERDKRRDRSR 2028

Query: 312  VDDRDGDNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
              DRD D +++RDR  D  R  + +R R RD D E+++DR      D E++ DR R+++ 
Sbjct: 2029 SRDRDRDRDRDRDRGKDRGRDRDRDRDRDRDRDRERDKDRDRDRDKDREKDKDRDREKDK 2088

Query: 135  DR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            DR R +  D+D D EK++D R + KD   E D+ R+R++
Sbjct: 2089 DRDREKDKDKDRDREKDKD-REKDKDRDREKDKDRDREK 2126

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 67/161 (41%), Positives = 96/161 (59%), Gaps = 18/161 (11%)
 Frame = -1

Query: 450  KRNRDRRYRDRD-----DDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDN 289
            +R+RDR  RDRD     D  E +RDRR R ++  E E D++RDR+  R R R  DRD D 
Sbjct: 1985 RRDRDRE-RDRDRTKDSDRREHDRDRRNRDRE-RERERDKRRDRSRSRDRDRDRDRDRDR 2042

Query: 288  ------EKERDRRGDNDR---RGNGERRHRDDDNEKERDR-RGRYKD-DSEEEFDRKRDR 142
                  +++RDR  D DR   R     R RD D EK++DR R + KD D E++ D+ RDR
Sbjct: 2043 GKDRGRDRDRDRDRDRDRDRERDKDRDRDRDKDREKDKDRDREKDKDRDREKDKDKDRDR 2102

Query: 141  NGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
              D+ R +  DRD + +K+RD R + KD  ++ DR++++DR
Sbjct: 2103 EKDKDREKDKDRDREKDKDRD-REKDKDRDKDKDREKDKDR 2142

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 60/150 (40%), Positives = 87/150 (58%), Gaps = 8/150 (5%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDR-RGRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDGDNE 286
            R+RDR R RDRD D  K+R R R R +D   D + E D+ RDR+ D+ R +  DRD + +
Sbjct: 2028 RSRDRDRDRDRDRDRGKDRGRDRDRDRDRDRDRDRERDKDRDRDRDKDREKDKDRDREKD 2087

Query: 285  KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DR 109
            K+RDR  D D+      R +D D EK++DR      D + E D+ RD++ DR    D D+
Sbjct: 2088 KDRDREKDKDK---DRDREKDKDREKDKDRDREKDKDRDREKDKDRDKDKDREKDKDRDK 2144

Query: 108  DGDNEKERDHRRRYKDDSE-EDDRKRNRDR 22
            D D ++E+D  R  +D S  +D R+  RD+
Sbjct: 2145 DKDRDREKDKDRDRRDGSRGKDKREEKRDK 2174

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 56/146 (38%), Positives = 84/146 (57%), Gaps = 9/146 (6%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDR---RGRYKD-DSEEEFDRKRDRNGDR---RHRVDDRDGD 292
            R+RDR R RDRD + +K+RDR   + R KD D + E D+ RDR  D+   R R  D+D +
Sbjct: 2050 RDRDRDRDRDRDRERDKDRDRDRDKDREKDKDRDREKDKDRDREKDKDKDRDREKDKDRE 2109

Query: 291  NEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
             +K+RDR  D DR R   + R +D D EK++DR      D +++ DR++D++ DR     
Sbjct: 2110 KDKDRDREKDKDRDREKDKDRDKDKDREKDKDR------DKDKDRDREKDKDRDR----- 2158

Query: 114  DRDGDNEKERDHRRRYKDDSEEDDRK 37
             RDG   K++   +R K  S ++  K
Sbjct: 2159 -RDGSRGKDKREEKRDKHSSSKESEK 2183

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 59/153 (38%), Positives = 83/153 (54%), Gaps = 14/153 (9%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDR-----------RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
            + R R+  +D  +ER+R           RG+ K  S +  DR RDR+ DR  R  +RD D
Sbjct: 1820 EERTREASEDRRREREREAPHGGRALWDRGQGKRWSRDR-DRSRDRDADRS-RERERDRD 1877

Query: 291  NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHR 121
              KE+DR  D DR    + + RD D  KE+DR      D  +E DR +DRN ++   R +
Sbjct: 1878 RSKEKDR--DQDR---SKEKDRDQDRNKEKDR----DQDRNKEKDRDQDRNKEKDRDRSK 1928

Query: 120  VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
              DRD D  KE+D   R +D S+E DR+R+R+R
Sbjct: 1929 EKDRDQDRNKEKD---RDRDRSKEKDRERSRER 1958

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 42/105 (40%), Positives = 67/105 (63%), Gaps = 6/105 (5%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 283
            ++++DR R +D+D D EK++D+ R R KD D E++ DR R+++ DR R +  DRD D ++
Sbjct: 2077 EKDKDRDREKDKDRDREKDKDKDRDREKDKDREKDKDRDREKDKDRDREKDKDRDKDKDR 2136

Query: 282  ERDRRGDNDRRGNGERRHRDDDNEKERDRR--GRYKDDSEEEFDR 154
            E+D+  D D       + RD + +K+RDRR   R KD  EE+ D+
Sbjct: 2137 EKDKDRDKD-------KDRDREKDKDRDRRDGSRGKDKREEKRDK 2174

[10][TOP]
>UniRef100_Q55G70 Initiation factor eIF-4 gamma middle domain-containing protein n=1
           Tax=Dictyostelium discoideum RepID=Q55G70_DICDI
          Length = 925

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 67/175 (38%), Positives = 94/175 (53%), Gaps = 27/175 (15%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR---RGRYKD---------DSEEEFDRKRDRNGDRRHRVDD 304
           RNR  R R+RD + E+ERDR   R R +D         D + + +R RDRN DR H   D
Sbjct: 54  RNRYDRDRERDLEKERERDRDHDRNRDRDRDRDRNRDRDRDHDRNRDRDRNRDRDHD-RD 112

Query: 303 RDGDNEKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD 133
           RD + EK+R+R  D DR GN ER   R R+ D ++ERDR    + + E E +R RDR GD
Sbjct: 113 RDREREKDRERDRDRDRYGNKERDRDRDRERDRDRERDREREREKERERERERDRDRYGD 172

Query: 132 R---RHRVD---------DRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           R   R R D         D D  N++++D  +  + ++  DDR  +RD   R ++
Sbjct: 173 RSTSRDRKDTPTKTENDQDNDNTNKEDKDKNKDIESNNTRDDRSTSRDDSKRKST 227

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 63/161 (39%), Positives = 96/161 (59%), Gaps = 15/161 (9%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDR-----------RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRD 298
           R+R Y+D  D+  K+R+R           R RY  D E + +++R+R+ D  R+R  DRD
Sbjct: 25  RERDYKDSYDNKSKDRERSKSRSRSRDRDRNRYDRDRERDLEKERERDRDHDRNRDRDRD 84

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHR 121
            D  ++RDR  D+DR  + + R+RD D++++RDR        E E DR+RDR+ DR  ++
Sbjct: 85  RDRNRDRDR--DHDRNRDRD-RNRDRDHDRDRDR--------EREKDRERDRDRDRYGNK 133

Query: 120 VDDRDGDNEKERDHRR-RYKDDSEEDDRKRNRDR-RYRDTS 4
             DRD D E++RD  R R ++  +E +R+R RDR RY D S
Sbjct: 134 ERDRDRDRERDRDRERDREREREKERERERERDRDRYGDRS 174

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 52/139 (37%), Positives = 70/139 (50%), Gaps = 15/139 (10%)
 Frame = -1

Query: 381 RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKER 202
           +Y+   + E+D +R+R+    +    +D +  K R R  D DR      R RD + E+ER
Sbjct: 12  QYQRGRDSEYDSRRERDYKDSYDNKSKDRERSKSRSRSRDRDRNRYDRDRERDLEKERER 71

Query: 201 DR---RGRYKD---DSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERDHRR-----RYK 64
           DR   R R +D   D   + DR  DRN DR   R R  DRD D E+E+D  R     RY 
Sbjct: 72  DRDHDRNRDRDRDRDRNRDRDRDHDRNRDRDRNRDRDHDRDRDREREKDRERDRDRDRYG 131

Query: 63  DDSEEDDRKRNRDR-RYRD 10
           +   + DR R RDR R RD
Sbjct: 132 NKERDRDRDRERDRDRERD 150

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 48/154 (31%), Positives = 79/154 (51%), Gaps = 5/154 (3%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           +R+RDR R RDRD + ++ER+R    + + E E +R RDR GDR    D +D   + E D
Sbjct: 134 ERDRDRDRERDRDRERDRERER----EKERERERERDRDRYGDRSTSRDRKDTPTKTEND 189

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEE----FDRKRDRNGDRRHRVDDRD 106
           +  DN  + + + +++D ++   RD R   +DDS+ +        R R   +++   + D
Sbjct: 190 QDNDNTNKEDKD-KNKDIESNNTRDDRSTSRDDSKRKSTSGSSSSRRRGSRKKYSSSEDD 248

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
             +  + D        S EDDRK+ R  R R +S
Sbjct: 249 TSSSDDDDSSSEDSSSSSEDDRKKKRKERRRKSS 282

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/166 (28%), Positives = 79/166 (47%), Gaps = 22/166 (13%)
 Frame = -1

Query: 447 RNRDR-----RYRDRDDDNEKERDR-RGRYKD-----DSEEEFDRKRDRNGDR------- 322
           RNRDR     R RDRD D+++ RDR R R +D     D E E DR+RDR+ DR       
Sbjct: 77  RNRDRDRDRDRNRDRDRDHDRNRDRDRNRDRDHDRDRDREREKDRERDRDRDRYGNKERD 136

Query: 321 ----RHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDR 154
               R R  DR+ D E+ER++  + +R  + +R      +   +D   + ++D + +   
Sbjct: 137 RDRDRERDRDRERDREREREKERERERERDRDRYGDRSTSRDRKDTPTKTENDQDNDNTN 196

Query: 153 KRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRY 16
           K D++ ++    ++   D    RD  +R         R+R   ++Y
Sbjct: 197 KEDKDKNKDIESNNTRDDRSTSRDDSKRKSTSGSSSSRRRGSRKKY 242

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 56/190 (29%), Positives = 73/190 (38%), Gaps = 53/190 (27%)
 Frame = -1

Query: 447 RNRDR-------RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVD--- 307
           R+RDR       R RDR+ D ++ERDR    + + E E +R RDR GDR   R R D   
Sbjct: 125 RDRDRYGNKERDRDRDRERDRDRERDREREREKERERERERDRDRYGDRSTSRDRKDTPT 184

Query: 306 ----DRDGDNEKERDRRGDNDRRGNGER----RHRDDDNEKERD------RRGRYK---- 181
               D+D DN  + D+  + D   N  R      RDD   K         RRG  K    
Sbjct: 185 KTENDQDNDNTNKEDKDKNKDIESNNTRDDRSTSRDDSKRKSTSGSSSSRRRGSRKKYSS 244

Query: 180 ----------DDSEEEF-------DRK-----RDRNGDRRHRVDDRDGDNEKERDHRRRY 67
                     DDS  E        DRK     R R   +R R   +  + ++E       
Sbjct: 245 SEDDTSSSDDDDSSSEDSSSSSEDDRKKKRKERRRKSSKRSRSPQKSKEEKEETSSNNNN 304

Query: 66  KDDSEEDDRK 37
           K +  E   K
Sbjct: 305 KKEQSEKSIK 314

[11][TOP]
>UniRef100_C1GJ14 Putative uncharacterized protein n=1 Tax=Paracoccidioides
            brasiliensis Pb18 RepID=C1GJ14_PARBD
          Length = 1036

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 64/155 (41%), Positives = 92/155 (59%), Gaps = 4/155 (2%)
 Frame = -1

Query: 471  IQRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRD 298
            I+ K   +R+RDR R RDRD D +++RDR      D + + DR RDR+ DR R R  DRD
Sbjct: 771  IEGKPSRQRDRDRDRDRDRDRDRDRDRDR------DRDRDRDRDRDRDRDRDRDRDRDRD 824

Query: 297  GDNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 121
             D ++++DR  D DR R   + R RD D +++RDR      D + + DR RD++ DR   
Sbjct: 825  RDRDRDKDRDRDKDRDRDRDKDRDRDKDRDRDRDR------DRDRDKDRDRDKDKDR--- 875

Query: 120  VDDRDGDNEKERDHRR-RYKDDSEEDDRKRNRDRR 19
              DRD D +K++D  R R +D   E D+ R+RDR+
Sbjct: 876  --DRDRDRDKDKDRERVRERDPKRERDKDRDRDRK 908

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 69/170 (40%), Positives = 94/170 (55%), Gaps = 20/170 (11%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-RYRDRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDR---RHRVD 307
            QR     R+RDR R RDRD D +++RDR R R +D D + + DR RDR+ DR   R R  
Sbjct: 778  QRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDKDRDRDK 837

Query: 306  DRDGDNEKERDRRGDNDRRGNGER---RHRDDDNEKERDR-RGRYKDDSEEEF------- 160
            DRD D +K+RDR  D DR  + +R   + RD D +K+RDR R R KD   E         
Sbjct: 838  DRDRDRDKDRDRDKDRDRDRDRDRDRDKDRDRDKDKDRDRDRDRDKDKDRERVRERDPKR 897

Query: 159  DRKRDRNGDRRHRVDDRDG---DNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            +R +DR+ DR+    DR G   D E  R H RR K +  E+    +R+++
Sbjct: 898  ERDKDRDRDRKRSRRDRSGSREDTEHSRRHARRLKRNEAEEQMAIDREKK 947

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 50/156 (32%), Positives = 80/156 (51%), Gaps = 10/156 (6%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            ++RDR + RDRD D +++RD+      D + + DR RDR+ DR     D+D D +++RDR
Sbjct: 831  KDRDRDKDRDRDRDKDRDRDK------DRDRDRDRDRDRDKDRDR---DKDKDRDRDRDR 881

Query: 270  RGDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFD------RKRDRNGDRRHRV 118
              D DR   R    +R RD D +++R R  R +  S E+ +      R+  RN       
Sbjct: 882  DKDKDRERVRERDPKRERDKDRDRDRKRSRRDRSGSREDTEHSRRHARRLKRNEAEEQMA 941

Query: 117  DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             DR+  + + R+ R   KD    +   RNR+R  ++
Sbjct: 942  IDREKKSTEHRESRLHEKDPHTLEREARNRERLLKE 977

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 45/120 (37%), Positives = 67/120 (55%), Gaps = 5/120 (4%)
 Frame = -1

Query: 366  SEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRG 190
            S+   ++ R     +  R  DRD D +++RDR  D DR  + +R R RD D +++RDR  
Sbjct: 760  SDHRSNKGRSGIEGKPSRQRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDR 819

Query: 189  RYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDH---RRRYKDDSEEDDRKRNRDR 22
                D + + D+ RDR+ DR R R  DRD D +++RD    R R KD   + D+ R+RDR
Sbjct: 820  DRDRDRDRDRDKDRDRDKDRDRDRDKDRDRDKDRDRDRDRDRDRDKDRDRDKDKDRDRDR 879

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 47/125 (37%), Positives = 68/125 (54%), Gaps = 6/125 (4%)
 Frame = -1

Query: 366  SEEEFD---RKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER-RHRDDDNEKERD 199
            SEE+ D   R  D   ++     +     +++RDR  D DR  + +R R RD D +++RD
Sbjct: 749  SEEKLDLAIRSSDHRSNKGRSGIEGKPSRQRDRDRDRDRDRDRDRDRDRDRDRDRDRDRD 808

Query: 198  RRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            R      D + + DR RDR+ D+ R R  DRD D +K+RD   R KD   + DR R+RD+
Sbjct: 809  RDRDRDRDRDRDRDRDRDRDRDKDRDRDKDRDRDRDKDRD---RDKDRDRDRDRDRDRDK 865

Query: 21   -RYRD 10
             R RD
Sbjct: 866  DRDRD 870

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 50/159 (31%), Positives = 73/159 (45%), Gaps = 21/159 (13%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDR-RGRYKDDS-EEEFDRKRDRNGDRRHRVDDRDGD----- 292
            R+RD+ + RDRD D +K++DR R R +D   E + DR RDR   RR R   R+       
Sbjct: 867  RDRDKDKDRDRDRDRDKDKDRERVRERDPKRERDKDRDRDRKRSRRDRSGSREDTEHSRR 926

Query: 291  -------NEKERDRRGDNDRRGNGERR---HRDDDNEKERDRRGRYKDDSEEEFDRKRDR 142
                   NE E     D +++    R    H  D +  ER+ R R +   E++  R+   
Sbjct: 927  HARRLKRNEAEEQMAIDREKKSTEHRESRLHEKDPHTLEREARNRERLLKEQQ--RREAM 984

Query: 141  NGDRRHRVDDRDGDNEKERDHRRR---YKDDSEEDDRKR 34
            N DR  R   R  ++ + R    R   YK + EE D+ R
Sbjct: 985  NADREGRC-SRSRESRQGRTLGGRHLSYKYEDEESDQAR 1022

[12][TOP]
>UniRef100_Q4Y8M2 Putative uncharacterized protein (Fragment) n=1 Tax=Plasmodium
           chabaudi RepID=Q4Y8M2_PLACH
          Length = 635

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 64/146 (43%), Positives = 83/146 (56%), Gaps = 3/146 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           KR R+R   DRD + E +RDR   +  D   EFDR R+R  DR R+R  DRD + E +RD
Sbjct: 485 KRARNREM-DRDRNREMDRDRNRDFDRDRNREFDRDRNREFDRDRNREFDRDRNREFDRD 543

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDN 97
           R  + DR  N E   RD + E +RDR      D   E DR R+R  DR R+R  DRD + 
Sbjct: 544 RNREMDRDRNREM-DRDRNREMDRDRNREMDRDRNREMDRDRNREVDRDRNREFDRDRNR 602

Query: 96  EKERDHRRRY-KDDSEEDDRKRNRDR 22
           E +RD  R + +D + E DR RNR+R
Sbjct: 603 EFDRDRNREFDRDRNREMDRDRNRER 628

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 65/149 (43%), Positives = 81/149 (54%), Gaps = 2/149 (1%)
 Frame = -1

Query: 465 RKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDN 289
           R+M   RNRD    DRD + E +RDR   +  D   EFDR R+R  DR R+R  DRD + 
Sbjct: 498 REMDRDRNRDF---DRDRNREFDRDRNREFDRDRNREFDRDRNREFDRDRNREMDRDRNR 554

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDD 112
           E +RDR  + DR  N E   RD + E +RDR      D   EFDR R+R  DR R+R  D
Sbjct: 555 EMDRDRNREMDRDRNREM-DRDRNREMDRDRNREVDRDRNREFDRDRNREFDRDRNREFD 613

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
           RD + E +RD  R       E DR RNR+
Sbjct: 614 RDRNREMDRDRNR-------ERDRDRNRE 635

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 56/142 (39%), Positives = 79/142 (55%), Gaps = 2/142 (1%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           N D++ R+R  D ++++D       +++ E D+KR RN     R  DRD + E +RDR  
Sbjct: 453 NHDKK-RERGKDKDEKQDSHIDGHKETDSERDKKRARN-----REMDRDRNREMDRDRNR 506

Query: 264 DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKE 88
           D DR  N E   RD + E +RDR   +  D   EFDR R+R  DR R+R  DRD + E +
Sbjct: 507 DFDRDRNREF-DRDRNREFDRDRNREFDRDRNREFDRDRNREMDRDRNREMDRDRNREMD 565

Query: 87  RDHRRRY-KDDSEEDDRKRNRD 25
           RD  R   +D + E DR RNR+
Sbjct: 566 RDRNREMDRDRNREMDRDRNRE 587

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 52/166 (31%), Positives = 80/166 (48%), Gaps = 24/166 (14%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERD--------RRGRYKDDSEEEFDRKRDRNGDRR-------- 319
           K N +    + D +++K +         +R      S    D+KR+R  D+         
Sbjct: 414 KENNNTNSHNTDHNHDKSKGMSNHHTPAKRHSLHIPSSHNHDKKRERGKDKDEKQDSHID 473

Query: 318 -HRVDDRDGDNEKERDRRGDNDRRGNGER-RHRDDDNEK----ERDRRGRYKDDSEEEFD 157
            H+  D + D ++ R+R  D DR    +R R+RD D ++    +RDR   +  D   EFD
Sbjct: 474 GHKETDSERDKKRARNREMDRDRNREMDRDRNRDFDRDRNREFDRDRNREFDRDRNREFD 533

Query: 156 RKRDRNGDR-RHRVDDRDGDNEKERDHRRRY-KDDSEEDDRKRNRD 25
           R R+R  DR R+R  DRD + E +RD  R   +D + E DR RNR+
Sbjct: 534 RDRNREFDRDRNREMDRDRNREMDRDRNREMDRDRNREMDRDRNRE 579

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 46/154 (29%), Positives = 79/154 (51%), Gaps = 17/154 (11%)
 Frame = -1

Query: 435 RRYRDRDDDNEKERDRRGRYKDDSEEE-FDRKRDRNGD--------RRHRVDDRDGDN-E 286
           ++Y  +D D + +++  G+  +++     D   D++          +RH +      N +
Sbjct: 396 KQYLTKDKDRDPKKNDHGKENNNTNSHNTDHNHDKSKGMSNHHTPAKRHSLHIPSSHNHD 455

Query: 285 KERDRRGDNDRRGNGE-RRHRDDDNEKERDR---RGRYKD-DSEEEFDRKRDRNGDR-RH 124
           K+R+R  D D + +     H++ D+  ERD+   R R  D D   E DR R+R+ DR R+
Sbjct: 456 KKRERGKDKDEKQDSHIDGHKETDS--ERDKKRARNREMDRDRNREMDRDRNRDFDRDRN 513

Query: 123 RVDDRDGDNEKERDHRRRY-KDDSEEDDRKRNRD 25
           R  DRD + E +RD  R + +D + E DR RNR+
Sbjct: 514 REFDRDRNREFDRDRNREFDRDRNREFDRDRNRE 547

[13][TOP]
>UniRef100_UPI000186D269 conserved hypothetical protein n=1 Tax=Pediculus humanus corporis
           RepID=UPI000186D269
          Length = 2110

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 66/155 (42%), Positives = 94/155 (60%), Gaps = 6/155 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDS-EEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           +R+ DR +R++ +  E  R R   Y++ S + E DR+RDR+ DR  R  DRD D E++RD
Sbjct: 414 ERSTDRSWREKSESTEI-RHRAPAYRETSWDRERDRERDRDRDR-DRDRDRDRDRERDRD 471

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGD 100
           R  D DR    ER R R+ + E+ER+R      + + E DR+RDR+ DR R R  DR+ D
Sbjct: 472 RDRDRDRERERERERERERERERERERDRERDRERDRERDRERDRDRDRERDRDRDRERD 531

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDR---RYRDTS 4
            E+ER+ R R KD  +E +R+R R+R   R RD S
Sbjct: 532 RERERE-RERDKDREKERERERERERPKDRERDRS 565

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 63/150 (42%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 465 RKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDN 289
           R+  W R RDR  RDRD D +++RDR      D + E DR RDR+ DR R R  +R+ + 
Sbjct: 438 RETSWDRERDRE-RDRDRDRDRDRDR------DRDRERDRDRDRDRDRERERERERERER 490

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDD 112
           E+ER+R  D +R      R RD + ++ERDR      D + E DR RDR  DR R R  +
Sbjct: 491 ERERERERDRER-----DRERDRERDRERDR------DRDRERDRDRDRERDRERERERE 539

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           RD D EKER+  R       E  + R RDR
Sbjct: 540 RDKDREKERERER-----ERERPKDRERDR 564

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 71/200 (35%), Positives = 95/200 (47%), Gaps = 58/200 (29%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFD-------------------------- 349
           R+RDR R RDRD D E++RDR  R KD  E E                            
Sbjct: 346 RDRDRERDRDRDRDRERDRDRYVRDKDRKEREGSIKDDVGRDRNKVTKDRERSSVREERG 405

Query: 348 -----RKRDRNGDR-----------RHRVD-------DRDGDNEKERDRRGDNDRRGNGE 238
                R+R+R+ DR           RHR         DR+ D E++RDR  D DR  + +
Sbjct: 406 NVRGRRERERSTDRSWREKSESTEIRHRAPAYRETSWDRERDRERDRDRDRDRDRDRDRD 465

Query: 237 R-------RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 82
           R       R RD + E+ER+R    + + E E DR+RDR  DR R R  DRD D E++RD
Sbjct: 466 RERDRDRDRDRDRERERERERERERERERERERDRERDRERDRERDRERDRDRDRERDRD 525

Query: 81  HRRRYKDDSEEDDRKRNRDR 22
            R R +D   E +R+R++DR
Sbjct: 526 -RDRERDRERERERERDKDR 544

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 63/187 (33%), Positives = 85/187 (45%), Gaps = 43/187 (22%)
 Frame = -1

Query: 453 WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEK 283
           W+R  +   R+RD D ++ERDR      + + E DR RDR  DR   R R  DRD D E+
Sbjct: 303 WRRREEGEERERDRDRDRERDRERDRDREKDRERDRDRDRERDRDRDRERDRDRDRDRER 362

Query: 282 ERDRRGDNDRRGNGERRHRDD----------------------------DNEKERDRRGR 187
           +RDR   +  R   E   +DD                            + E+  DR  R
Sbjct: 363 DRDRYVRDKDRKEREGSIKDDVGRDRNKVTKDRERSSVREERGNVRGRRERERSTDRSWR 422

Query: 186 YKDDS-----------EEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDD 43
            K +S           E  +DR+RDR  DR R R  DRD D ++ERD R R +D   E +
Sbjct: 423 EKSESTEIRHRAPAYRETSWDRERDRERDRDRDRDRDRDRDRDRERD-RDRDRDRDRERE 481

Query: 42  RKRNRDR 22
           R+R R+R
Sbjct: 482 RERERER 488

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 69/193 (35%), Positives = 95/193 (49%), Gaps = 47/193 (24%)
 Frame = -1

Query: 447 RNRDRR------YRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDN 289
           RNRDRR      +R R++  E+ERDR    + D E + DR++DR  DR R R  DRD D 
Sbjct: 291 RNRDRRSDKDREWRRREEGEERERDRDRDRERDRERDRDREKDRERDRDRDRERDRDRDR 350

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFD---------------- 157
           E++RDR  D DR  + +R  RD D    ++R G  KDD   + +                
Sbjct: 351 ERDRDR--DRDRERDRDRYVRDKDR---KEREGSIKDDVGRDRNKVTKDRERSSVREERG 405

Query: 156 -----RKRDRNGDR-----------RHRVD-------DRDGDNEKERDHRRRYKDDSEED 46
                R+R+R+ DR           RHR         DR+ D E++RD R R +D   + 
Sbjct: 406 NVRGRRERERSTDRSWREKSESTEIRHRAPAYRETSWDRERDRERDRD-RDRDRDRDRDR 464

Query: 45  DRKRNRDR-RYRD 10
           DR+R+RDR R RD
Sbjct: 465 DRERDRDRDRDRD 477

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 58/153 (37%), Positives = 79/153 (51%), Gaps = 15/153 (9%)
 Frame = -1

Query: 423 DRDDDNEKERDRR--GRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKERDRRGDND- 256
           +R+++ EK RD+   G      E E  + RD R   R  +  +RD   ++ RDRR D D 
Sbjct: 245 ERNEEKEKSRDKYWDGNIDGKDERELPKVRDDRPAIRNEKEFERD---DRNRDRRSDKDR 301

Query: 255 ---RRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNE 94
              RR  GE R RD D ++ERDR      + + E DR RDR  DR   R R  DRD D E
Sbjct: 302 EWRRREEGEERERDRDRDRERDRERDRDREKDRERDRDRDRERDRDRDRERDRDRDRDRE 361

Query: 93  KERDHRRRYKDDSE-----EDDRKRNRDRRYRD 10
           ++RD   R KD  E     +DD  R+R++  +D
Sbjct: 362 RDRDRYVRDKDRKEREGSIKDDVGRDRNKVTKD 394

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 38/93 (40%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           +R+   +R R+R R RDR+ D E++R+R      D E + DR R+R+ DR     DR+ D
Sbjct: 483 ERERERERERERERERDRERDRERDRER------DRERDRDRDRERDRDR-----DRERD 531

Query: 291 NEKERDRRGDNDRRGNGER-RHRDDDNEKERDR 196
            E+ER+R  D DR    ER R R+   ++ERDR
Sbjct: 532 RERERERERDKDREKERERERERERPKDRERDR 564

[14][TOP]
>UniRef100_Q54TL3 SWAP/Surp domain-containing protein n=1 Tax=Dictyostelium
           discoideum RepID=Q54TL3_DICDI
          Length = 951

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 61/153 (39%), Positives = 84/153 (54%), Gaps = 4/153 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K +R    RDRD D +     R R +D    + DR RD  GDR     DRD D E++RDR
Sbjct: 154 KDHRCGNDRDRDMDRDSRDSYRDRDRDRDSRDRDRDRDYRGDR-----DRDRDRERDRDR 208

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD-NE 94
             + DR    +R  RD D +++R+R      D E + DR+RDR+ D R R  DRD D  +
Sbjct: 209 DRERDRDRERDRGDRDRDRDRDRERERDRDRDRERDRDRERDRDRD-RERERDRDRDYRD 267

Query: 93  KERDHRRRYKDDSEEDDRKRNRDR---RYRDTS 4
           ++RD+R R +D   + DR R+RDR   RY  +S
Sbjct: 268 RDRDYRDRDRDRDRDRDRDRDRDRDRDRYSSSS 300

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 64/149 (42%), Positives = 81/149 (54%), Gaps = 4/149 (2%)
 Frame = -1

Query: 444 NRDRRYR--DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           NRD +      D D + +RD R  Y+D   +   R RDR+ D R    DRD D ++ERDR
Sbjct: 150 NRDTKDHRCGNDRDRDMDRDSRDSYRDRDRDRDSRDRDRDRDYR---GDRDRDRDRERDR 206

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
             D +R  + ER   D D +++RDR        E E DR RDR  D R R  DRD D E+
Sbjct: 207 DRDRERDRDRERDRGDRDRDRDRDR--------ERERDRDRDRERD-RDRERDRDRDRER 257

Query: 90  ERDHRRRYKD-DSEEDDRKRNRDR-RYRD 10
           ERD  R Y+D D +  DR R+RDR R RD
Sbjct: 258 ERDRDRDYRDRDRDYRDRDRDRDRDRDRD 286

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 57/149 (38%), Positives = 80/149 (53%), Gaps = 11/149 (7%)
 Frame = -1

Query: 423 DRDDDNEKERDRRGRYKDDSEEEFDRK---------RDRNGDRRHRVDDRDGDNEKE-RD 274
           D D++N    +      +   +E +R          RDR+ DR  R   RD D +++ RD
Sbjct: 126 DDDNNNNNNNNNNNETSNQPPKELNRDTKDHRCGNDRDRDMDRDSRDSYRDRDRDRDSRD 185

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           R  D D RG+   R RD D E++RDR R R +D   +  DR RDR+ DR  R  DRD D 
Sbjct: 186 RDRDRDYRGD---RDRDRDRERDRDRDRERDRDRERDRGDRDRDRDRDRE-RERDRDRDR 241

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           E++RD   R +D   + +R+R+RDR YRD
Sbjct: 242 ERDRD---RERDRDRDRERERDRDRDYRD 267

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 40/122 (32%), Positives = 57/122 (46%), Gaps = 1/122 (0%)
 Frame = -1

Query: 372 DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRR 193
           DD  ++ D   + N +  +   ++     KE +R   + R GN      D D + +RD R
Sbjct: 121 DDINDDDDNNNNNNNNNNNETSNQP---PKELNRDTKDHRCGN------DRDRDMDRDSR 171

Query: 192 GRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH-RRRYKDDSEEDDRKRNRDRRY 16
             Y+D         RDR+ D R R  DRD   +++RD  R R +D   E DR R RDR  
Sbjct: 172 DSYRD---------RDRDRDSRDRDRDRDYRGDRDRDRDRERDRDRDRERDRDRERDRGD 222

Query: 15  RD 10
           RD
Sbjct: 223 RD 224

[15][TOP]
>UniRef100_UPI00004E3D56 SWAP/Surp domain-containing protein n=1 Tax=Dictyostelium
           discoideum AX4 RepID=UPI00004E3D56
          Length = 944

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 59/131 (45%), Positives = 75/131 (57%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           R+RD R RDRD D   +RDR    + D + + +R RDR  DR  R  DRD D E+ERDR 
Sbjct: 172 RDRDSRDRDRDRDYRGDRDRDRDRERDRDRDRERDRDRERDRGDRDRDRDRDRERERDRD 231

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
            D +R  + ER  RD D E+ERDR   Y+D   +  DR RDR+ DR     DRD D +++
Sbjct: 232 RDRERDRDRER-DRDRDRERERDRDRDYRDRDRDYRDRDRDRDRDR-----DRDRDRDRD 285

Query: 87  RDHRRRYKDDS 55
           RD   RY   S
Sbjct: 286 RD---RYSSSS 293

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 60/146 (41%), Positives = 83/146 (56%), Gaps = 5/146 (3%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDGDNEKERDRRGDNDRR 250
           RD  D    +RD R  Y+D   +   R RDR  DR +R D DRD D E++RDR  + DR 
Sbjct: 151 RDTKDHRCVDRDSRDSYRDRDRDRDSRDRDR--DRDYRGDRDRDRDRERDRDRDRERDRD 208

Query: 249 GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD-NEKERDHRR 73
              +R  RD D +++R+R      D E + DR+RDR+ D R R  DRD D  +++RD+R 
Sbjct: 209 RERDRGDRDRDRDRDRERERDRDRDRERDRDRERDRDRD-RERERDRDRDYRDRDRDYRD 267

Query: 72  RYKDDSEEDDRKRNRDR---RYRDTS 4
           R +D   + DR R+RDR   RY  +S
Sbjct: 268 RDRDRDRDRDRDRDRDRDRDRYSSSS 293

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 61/154 (39%), Positives = 82/154 (53%), Gaps = 18/154 (11%)
 Frame = -1

Query: 417 DDDNEKERDRRGRYKDDSEEEFDRKRD----RNGDRRHRVDDRDGDNEKE-RDRRGDNDR 253
           DDDN    +     +  ++   +  RD    R  DR  R   RD D +++ RDR  D D 
Sbjct: 126 DDDNNNNNNNNNNNETSNQPPKELNRDTKDHRCVDRDSRDSYRDRDRDRDSRDRDRDRDY 185

Query: 252 RGNGER---RHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR---RHRVDDRD 106
           RG+ +R   R RD D ++ERDR     RG    D + + +R+RDR+ DR   R R  DRD
Sbjct: 186 RGDRDRDRDRERDRDRDRERDRDRERDRGDRDRDRDRDRERERDRDRDRERDRDRERDRD 245

Query: 105 GDNEKERDHRRRYKD-DSEEDDRKRNRDR-RYRD 10
            D E+ERD  R Y+D D +  DR R+RDR R RD
Sbjct: 246 RDRERERDRDRDYRDRDRDYRDRDRDRDRDRDRD 279

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 37/100 (37%), Positives = 48/100 (48%), Gaps = 4/100 (4%)
 Frame = -1

Query: 309 DDRDGDNEKERDRRGDNDRRGNGE-RRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD 133
           DD D +N    +   +   +   E  R   D    +RD R  Y+D   +   R RDR  D
Sbjct: 125 DDDDNNNNNNNNNNNETSNQPPKELNRDTKDHRCVDRDSRDSYRDRDRDRDSRDRDR--D 182

Query: 132 RRHRVD-DRDGDNEKERDHRRRYKDDSEED--DRKRNRDR 22
           R +R D DRD D E++RD  R    D E D  DR R+RDR
Sbjct: 183 RDYRGDRDRDRDRERDRDRDRERDRDRERDRGDRDRDRDR 222

[16][TOP]
>UniRef100_UPI0000E49549 PREDICTED: similar to RNA binding motif protein, X-linked 2 n=1
           Tax=Strongylocentrotus purpuratus RepID=UPI0000E49549
          Length = 598

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 60/145 (41%), Positives = 75/145 (51%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           NRDRR  DRD + E++RD R R  +  +    R RDR  +R+    DR G+ E  RDRR 
Sbjct: 330 NRDRR--DRDRERERQRDSRDRGGEREDNRDRRDRDRERERQQDSRDRGGEREDNRDRR- 386

Query: 264 DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
           D DR    +R  RD   E+E +R  R +D   E     RDR G+R    D RD D E+ER
Sbjct: 387 DRDRERERQRDSRDRGGEREDNRDRRDRDRERERQQDSRDRGGEREDNRDRRDRDRERER 446

Query: 84  DHRRRYKDDSEEDDRKRNRDRRYRD 10
               R +    ED    NRDRR RD
Sbjct: 447 QRDSRDRGGERED----NRDRRDRD 467

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 58/145 (40%), Positives = 78/145 (53%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           NRDRR RDR+ + +++   RG  ++D+ +  DR R+R  +R+    DR G+ E  RDRR 
Sbjct: 278 NRDRRDRDRERERQQDSRDRGGEREDNRDRRDRDRER--ERQQDSRDRGGEREDNRDRR- 334

Query: 264 DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
           D DR    +R  RD   E+E +R  R +D   E     RDR G+R    D RD D E+ER
Sbjct: 335 DRDRERERQRDSRDRGGEREDNRDRRDRDRERERQQDSRDRGGEREDNRDRRDRDRERER 394

Query: 84  DHRRRYKDDSEEDDRKRNRDRRYRD 10
               R +    ED    NRDRR RD
Sbjct: 395 QRDSRDRGGERED----NRDRRDRD 415

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 58/147 (39%), Positives = 75/147 (51%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R+R+ +  DR  + E  RDRR R  +   E  DR+R+R  D R    DR G+ E  RDR
Sbjct: 226 RRDREGQRNDRSGEREDSRDRRDRVGEKGRERRDRERERQQDSR----DRGGEREDNRDR 281

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
           R D DR    ++  RD   E+E +R  R +D   E     RDR G+R    D RD D E+
Sbjct: 282 R-DRDRERERQQDSRDRGGEREDNRDRRDRDRERERQQDSRDRGGEREDNRDRRDRDRER 340

Query: 90  ERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           ER    R +    ED    NRDRR RD
Sbjct: 341 ERQRDSRDRGGERED----NRDRRDRD 363

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 58/152 (38%), Positives = 78/152 (51%), Gaps = 7/152 (4%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           NRDRR RDR+ + +++   RG  ++D+ +  DR R+R   R  R  DR G+ E  RDRR 
Sbjct: 356 NRDRRDRDRERERQQDSRDRGGEREDNRDRRDRDRERERQRDSR--DRGGEREDNRDRR- 412

Query: 264 DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
           D DR    ++  RD   E+E +R  R +D   E     RDR G+R    D RD D E+ER
Sbjct: 413 DRDRERERQQDSRDRGGEREDNRDRRDRDRERERQRDSRDRGGEREDNRDRRDRDRERER 472

Query: 84  DHRRRYKDDSEED-------DRKRNRDRRYRD 10
               R +    ED       DR+R R R  RD
Sbjct: 473 QQDSRDRGGEREDNSDRRDRDRERERQRDSRD 504

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 57/147 (38%), Positives = 76/147 (51%), Gaps = 2/147 (1%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           NRDRR  DRD + E++RD R R  +  +    R RDR  +R+    DR G+ E  RDRR 
Sbjct: 382 NRDRR--DRDRERERQRDSRDRGGEREDNRDRRDRDRERERQQDSRDRGGEREDNRDRR- 438

Query: 264 DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD--DRDGDNEK 91
           D DR    +R  RD   E+E +R  R +D   E     RDR G+R    D  DRD + E+
Sbjct: 439 DRDRERERQRDSRDRGGEREDNRDRRDRDRERERQQDSRDRGGEREDNSDRRDRDRERER 498

Query: 90  ERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           +RD R R +     D   R+ DR Y +
Sbjct: 499 QRDSRDREQGIDPADIGARHEDRYYNN 525

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 62/164 (37%), Positives = 82/164 (50%), Gaps = 11/164 (6%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           QR   ++ +R R  + R D  E+ER RR     D E E + +RDR G R    +DR G+ 
Sbjct: 188 QRDRNYRWDRKREDKPRMDKRERERGRRDL---DGESESEGRRDREGQR----NDRSGER 240

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGR--YKDDSEEEFDR---------KRDR 142
           E  RDRR   DR G   R  RD + E+++D R R   ++D+ +  DR          RDR
Sbjct: 241 EDSRDRR---DRVGEKGRERRDRERERQQDSRDRGGEREDNRDRRDRDRERERQQDSRDR 297

Query: 141 NGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            G+R    D RD D E+ER    R +    ED    NRDRR RD
Sbjct: 298 GGEREDNRDRRDRDRERERQQDSRDRGGERED----NRDRRDRD 337

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 60/155 (38%), Positives = 82/155 (52%), Gaps = 2/155 (1%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEE-EFDRKRDRNGDRRHRVDDRDGD 292
           +R  + ++ R+RR R+R+   +  RDR G  +D+ +  + DR+R+R  D R R  +R+ D
Sbjct: 246 RRDRVGEKGRERRDRERERQQDS-RDRGGEREDNRDRRDRDRERERQQDSRDRGGERE-D 303

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDR-KRDRNGDRRHRVD 115
           N   RDR  D +R    + R R  + E  RDRR R   D E E  R  RDR G+R    D
Sbjct: 304 NRDRRDR--DRERERQQDSRDRGGEREDNRDRRDR---DRERERQRDSRDRGGEREDNRD 358

Query: 114 DRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            RD D E+ER    R +    ED    NRDRR RD
Sbjct: 359 RRDRDRERERQQDSRDRGGERED----NRDRRDRD 389

[17][TOP]
>UniRef100_Q8I1T4 Cyclin-dependent kinase, putative n=1 Tax=Plasmodium falciparum 3D7
            RepID=Q8I1T4_PLAF7
          Length = 1339

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 64/160 (40%), Positives = 87/160 (54%), Gaps = 9/160 (5%)
 Frame = -1

Query: 471  IQRKMIWKRNRDRRY-------RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 313
            + R  I  R+R+R +       R RD D E++RDR          E DR+RDR  DR   
Sbjct: 1181 VYRDRISHRSREREWYKKPYGRRSRDRDRERDRDR----------ERDRERDRERDR--- 1227

Query: 312  VDDRDGDNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
              DR+ D E+ERDR  D DR R     R RD + ++ERDR      D + + DR RDR+ 
Sbjct: 1228 --DRERDRERERDRDRDRDRERDRNRERDRDRERDRERDRNRERDRDRDRDRDRDRDRDR 1285

Query: 135  DR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            DR R R  DRD D EKE   R+R KD  +E+D+ ++ D++
Sbjct: 1286 DRDRDRDRDRDRDREKE---RKRDKDKDKENDKSKDADQK 1322

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 56/141 (39%), Positives = 85/141 (60%), Gaps = 7/141 (4%)
 Frame = -1

Query: 450  KRNRDR---RYRDRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGDN 289
            +R+RDR   R RDR+ D ++ERDR R R +D D + E DR R+R+ DR R R  DR+ + 
Sbjct: 1210 ERDRDRERDRERDRERDRDRERDRERERDRDRDRDRERDRNRERDRDRERDRERDRNRER 1269

Query: 288  EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
            +++RDR  D DR      R RD D +++RDR      D + E +RKRD+         D+
Sbjct: 1270 DRDRDRDRDRDR-----DRDRDRDRDRDRDR------DRDREKERKRDK---------DK 1309

Query: 108  DGDNEKERD-HRRRYKDDSEE 49
            D +N+K +D  ++++K D+EE
Sbjct: 1310 DKENDKSKDADQKKHKLDTEE 1330

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 50/125 (40%), Positives = 71/125 (56%), Gaps = 4/125 (3%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKE 280
            R RDR R RDRD D ++ERDR    + D + E DR+RDRN +R   R R  DRD D +++
Sbjct: 1229 RERDRERERDRDRDRDRERDRNR--ERDRDRERDRERDRNRERDRDRDRDRDRDRDRDRD 1286

Query: 279  RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
            RDR  D D         RD D EKER R      D ++E D+ +D +  ++H++D  +  
Sbjct: 1287 RDRDRDRD---------RDRDREKERKR----DKDKDKENDKSKDAD-QKKHKLDTEELR 1332

Query: 99   NEKER 85
             EK++
Sbjct: 1333 VEKKK 1337

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 56/171 (32%), Positives = 81/171 (47%), Gaps = 28/171 (16%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKR-------------DRNGDR-RHR 313
            K N ++R +++  +    R     Y   S E  D +R             D   DR  HR
Sbjct: 1130 KYNNEKREKEKKIEGIDNRRESNNYFRRSREGIDDRRRYSTICKTGYNNADVYRDRISHR 1189

Query: 312  VDDRD------GDNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDR 154
              +R+      G   ++RDR  D DR  + ER R RD D E++R+R      D + E DR
Sbjct: 1190 SREREWYKKPYGRRSRDRDRERDRDRERDRERDRERDRDRERDRERERDRDRDRDRERDR 1249

Query: 153  KRDRNGDR-------RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             R+R+ DR       R+R  DRD D +++RD R R +D   + DR R+RDR
Sbjct: 1250 NRERDRDRERDRERDRNRERDRDRDRDRDRD-RDRDRDRDRDRDRDRDRDR 1299

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 55/164 (33%), Positives = 82/164 (50%), Gaps = 16/164 (9%)
 Frame = -1

Query: 453  WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEE---FDRKRDRNGDRR-HRVDDRDGDNE 286
            +  NR   +  + ++ ++E++++    D+  E    F R R+   DRR +    + G N 
Sbjct: 1119 YNHNRSPSHAKKYNNEKREKEKKIEGIDNRRESNNYFRRSREGIDDRRRYSTICKTGYNN 1178

Query: 285  KE--RDRRGDNDRRGNGE-----RRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR- 130
             +  RDR     R          RR RD D E++RDR    + D E + DR+RDR  +R 
Sbjct: 1179 ADVYRDRISHRSREREWYKKPYGRRSRDRDRERDRDRERDRERDRERDRDRERDRERERD 1238

Query: 129  RHRVDDRDGDNEKERD---HRRRYKDDSEEDDRKRNRDR-RYRD 10
            R R  DR+ D  +ERD    R R +D + E DR R+RDR R RD
Sbjct: 1239 RDRDRDRERDRNRERDRDRERDRERDRNRERDRDRDRDRDRDRD 1282

[18][TOP]
>UniRef100_B9GPM8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GPM8_POPTR
          Length = 1112

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 53/155 (34%), Positives = 89/155 (57%), Gaps = 12/155 (7%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRG--RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN--EKERDR 271
           D +++ R DD+E++ D+    R   D + + DR RDRNG+R    + R+ ++    ERD+
Sbjct: 3   DVKHKSRKDDSERKEDKEDSKRSHRDRDRDRDRDRDRNGERHRDREKRERESIRRSERDK 62

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
             D+D +   + +H+D D ++++DR  R +D D E   DR RDR+ DR  +  DRD D E
Sbjct: 63  SSDSDEKEREKEKHKDRDRDRDKDRAARSRDGDKERAKDRNRDRDKDREEK-KDRDKDRE 121

Query: 93  KERDH-------RRRYKDDSEEDDRKRNRDRRYRD 10
           ++RD        R R K+  ++ +R+R R+R  R+
Sbjct: 122 EKRDRDKDREEKRERAKEKEKDREREREREREKRE 156

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 56/157 (35%), Positives = 85/157 (54%), Gaps = 10/157 (6%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRG-RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           K +  R +RDRD D +++RDR G R++D  + E +  R    D+    D+++ + EK +D
Sbjct: 19  KEDSKRSHRDRDRDRDRDRDRNGERHRDREKRERESIRRSERDKSSDSDEKEREKEKHKD 78

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDR------KRDRNGDR---RHR 121
           R  D DR  +   R RD D E+ +DR      D EE+ DR      KRDR+ DR   R R
Sbjct: 79  R--DRDRDKDRAARSRDGDKERAKDRNRDRDKDREEKKDRDKDREEKRDRDKDREEKRER 136

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             +++ D E+ER+  R  ++   E DR+R R  R R+
Sbjct: 137 AKEKEKDREREREREREKRERERERDRERERKERDRE 173

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 62/177 (35%), Positives = 94/177 (53%), Gaps = 31/177 (17%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKD------------------DSEEEFDRKRDRNGD 325
           R+RDR R RDRD + E+ RDR  R ++                  + E+  DR RDR+ D
Sbjct: 27  RDRDRDRDRDRDRNGERHRDREKRERESIRRSERDKSSDSDEKEREKEKHKDRDRDRDKD 86

Query: 324 RRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR----RGRYKDDSEEEFD 157
           R  R   RDGD E+ +DR  D D+    E++ RD D E++RDR      + +   E+E D
Sbjct: 87  RAAR--SRDGDKERAKDRNRDRDK-DREEKKDRDKDREEKRDRDKDREEKRERAKEKEKD 143

Query: 156 RKRDRNGDRRHRVDDRDGDNEKERDHR--------RRYKDDSEEDDRKRNRDRRYRD 10
           R+R+R  +R  R  +R+ D E+ER  R        +R +++ E + R+R R+RR R+
Sbjct: 144 REREREREREKRERERERDRERERKERDREEREREKREREEREREKRERERERRTRE 200

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 50/149 (33%), Positives = 84/149 (56%), Gaps = 3/149 (2%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKER 277
           R++DR  R RD D E+ +DR      D EE+ DR +DR   R   + R + R+   EKE+
Sbjct: 83  RDKDRAARSRDGDKERAKDRNRDRDKDREEKKDRDKDREEKRDRDKDREEKRERAKEKEK 142

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           DR  + +R    E+R R+ + ++ER+R+ R +++ E E   + +R  ++R R  +R    
Sbjct: 143 DRERERERER--EKRERERERDRERERKERDREEREREKREREEREREKRERERER---R 197

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            +ER+  R    DS++D + R++ RR RD
Sbjct: 198 TREREKCRELSSDSDDDSKDRDKKRRRRD 226

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 50/160 (31%), Positives = 84/160 (52%), Gaps = 13/160 (8%)
 Frame = -1

Query: 450 KRNRDRRYRDRD-------------DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 310
           +R+RDR  R+R+             D+ E+E+          E+  DR RDR+ DR  R 
Sbjct: 42  ERHRDREKRERESIRRSERDKSSDSDEKEREK----------EKHKDRDRDRDKDRAAR- 90

Query: 309 DDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
             RDGD E+ +DR  D D +   E++ RD D E++RDR    ++  E   ++++DR  +R
Sbjct: 91  -SRDGDKERAKDRNRDRD-KDREEKKDRDKDREEKRDRDKDREEKRERAKEKEKDRERER 148

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
               + R+ + E++R+  R+ +D  E +  KR R+ R R+
Sbjct: 149 EREREKRERERERDRERERKERDREEREREKREREERERE 188

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 50/149 (33%), Positives = 80/149 (53%), Gaps = 11/149 (7%)
 Frame = -1

Query: 447 RNRDR---------RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           RNRDR         R +DR++  ++++DR  + +   E+E DR+R+R  +R  R  +R+ 
Sbjct: 102 RNRDRDKDREEKKDRDKDREEKRDRDKDREEKRERAKEKEKDREREREREREKRERERER 161

Query: 294 DNEKERDRRGDNDR-RGNGERRHRD-DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 121
           D E+ER  R   +R R   ER  R+ +  E+ER+RR R ++   E      D + DR  +
Sbjct: 162 DRERERKERDREEREREKREREEREREKRERERERRTREREKCRELSSDSDDDSKDRDKK 221

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKR 34
              RD D+ KER  + + K D E + R+R
Sbjct: 222 RRRRDDDDYKERLEQEQKKLDEEMEKRRR 250

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 40/145 (27%), Positives = 78/145 (53%), Gaps = 4/145 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV-DDRDGDNEKERD 274
           +R R+R  R+R+ + ++ER+R+ R +++ E E   + +R  ++R R  + R  + EK R+
Sbjct: 147 EREREREKRERERERDRERERKERDREEREREKREREEREREKRERERERRTREREKCRE 206

Query: 273 RRGDND---RRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
              D+D   +  + +RR RDDD+ KER  + + K D E E  R+R +      R      
Sbjct: 207 LSSDSDDDSKDRDKKRRRRDDDDYKERLEQEQKKLDEEMEKRRRRVQEWQELRR------ 260

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNR 28
             +KE   R ++ ++++ ++ K  +
Sbjct: 261 --KKEETEREKHGEEADVNEPKTGK 283

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 14/105 (13%)
 Frame = -1

Query: 294 DNEKERDRRGDNDRRGNGE---RRHRDDDNEKERDR-------RGRYKDDSE----EEFD 157
           ++ K + R+ D++R+ + E   R HRD D +++RDR       R R K + E     E D
Sbjct: 2   EDVKHKSRKDDSERKEDKEDSKRSHRDRDRDRDRDRDRNGERHRDREKRERESIRRSERD 61

Query: 156 RKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           +  D +   R +   +D D ++++D   R +D  +E  + RNRDR
Sbjct: 62  KSSDSDEKEREKEKHKDRDRDRDKDRAARSRDGDKERAKDRNRDR 106

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 41/158 (25%), Positives = 76/158 (48%), Gaps = 22/158 (13%)
 Frame = -1

Query: 450 KRNRDRRYRDRD--DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           ++ RDR  R+R+  +  E+ER++R R ++    E ++ R+ + D     DD   D +K+R
Sbjct: 167 RKERDREEREREKREREEREREKRERERERRTREREKCRELSSDS----DDDSKDRDKKR 222

Query: 276 DRRGDND--RRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR--------- 130
            RR D+D   R   E++  D++ EK R R   +++   ++ + +R+++G+          
Sbjct: 223 RRRDDDDYKERLEQEQKKLDEEMEKRRRRVQEWQELRRKKEETEREKHGEEADVNEPKTG 282

Query: 129 -----RHRVDDRD----GDNEKERDHRRRYKDDSEEDD 43
                    DD +    G +E + D     K D EE D
Sbjct: 283 KTWTLEGESDDEEAPPTGKSETDMDLEENAKPDEEEID 320

[19][TOP]
>UniRef100_Q7RXW5 Predicted protein n=1 Tax=Neurospora crassa RepID=Q7RXW5_NEUCR
          Length = 1015

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 66/156 (42%), Positives = 86/156 (55%), Gaps = 9/156 (5%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            +R R+R  RDR+ D +K R    RY  D   +   +RDR+ DRR R  DRD D +++RDR
Sbjct: 819  ERERERE-RDRERDRDKPRPGPDRYDGDRGRDERGERDRDRDRRDRDRDRDRDRDRDRDR 877

Query: 270  RGDNDRRGNGER-RHRDDDNEKERDRR-GRYKDDSEEEFDRKR---DRNGDR---RHRVD 115
                DR  N +R R RD D +++RD R  R +        R R   DR GDR   RHR  
Sbjct: 878  ----DRERNRDRDRDRDRDRDRDRDMRDDRRRSSIVRRRSRSRSRGDRGGDRERDRHRDR 933

Query: 114  DRDGDNEKERDHRR-RYKDDSEEDDRKRNRDRRYRD 10
            DRD   E+ RD RR R +D  ++ DR R+RDR  RD
Sbjct: 934  DRDSRRERSRDSRRERSRDRDKDRDRDRDRDRESRD 969

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 59/149 (39%), Positives = 80/149 (53%), Gaps = 6/149 (4%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
            +R+RDR  RDRD D +++RDR R R ++ + + + DR RDR+ DR  R D R     + R
Sbjct: 853  ERDRDRDRRDRDRDRDRDRDRDRDRDRERNRDRDRDRDRDRDRDRDMRDDRRRSSIVRRR 912

Query: 276  DR-RGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
             R R   DR G+ ER   R RD D+ +ER R  R +   + + DR RDR+ DR  R D R
Sbjct: 913  SRSRSRGDRGGDRERDRHRDRDRDSRRERSRDSRRERSRDRDKDRDRDRDRDRESR-DHR 971

Query: 108  DGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             GD  +   H  R         R R+RDR
Sbjct: 972  GGDLHRNSHHHSRRDRSLSTSRRDRDRDR 1000

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 56/171 (32%), Positives = 79/171 (46%), Gaps = 24/171 (14%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR-------DGD 292
            +R  DR  RD   D+    +       ++    +R+ +R GDR  R  +R       D D
Sbjct: 731  RRGNDRDARDTPQDSRDNNNNNNNNNYNNSSSSNREHNRAGDRGDRDREREREAPLIDSD 790

Query: 291  NE----------KERDRRGDNDRRGNGERRHRDDDNEKERDRR------GRYKDDSEEEF 160
            N            ERDR  D + R   E R R+ + ++ERDR        RY  D   + 
Sbjct: 791  NRYVPSTAARVVAERDRERDREAREAREERERERERDRERDRDKPRPGPDRYDGDRGRDE 850

Query: 159  DRKRDRNGDRRHRVDDRDGDNEKERDH-RRRYKDDSEEDDRKRNRDRRYRD 10
              +RDR+ DRR R  DRD D +++RD  R R +D   + DR R+RDR  RD
Sbjct: 851  RGERDRDRDRRDRDRDRDRDRDRDRDRDRERNRDRDRDRDRDRDRDRDMRD 901

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 55/158 (34%), Positives = 76/158 (48%), Gaps = 11/158 (6%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKER---DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
            + NR     DRD + E+E    D   RY   +      +RDR  DR  R    + + E+E
Sbjct: 766  EHNRAGDRGDRDREREREAPLIDSDNRYVPSTAARVVAERDRERDREAREAREERERERE 825

Query: 279  RDRRGDNDRRGNGERRHRDDDNEKERDRRG-RYKDDSEEEFDRKRDRNGDR-----RHRV 118
            RDR  D D+   G  R+   D ++ RD RG R +D    + DR RDR+ DR     R R 
Sbjct: 826  RDRERDRDKPRPGPDRY---DGDRGRDERGERDRDRDRRDRDRDRDRDRDRDRDRDRERN 882

Query: 117  DDRDGDNEKERDHRRRYKDDSEEDD--RKRNRDRRYRD 10
             DRD D +++RD  R  +DD       R+R+R R   D
Sbjct: 883  RDRDRDRDRDRDRDRDMRDDRRRSSIVRRRSRSRSRGD 920

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 50/136 (36%), Positives = 62/136 (45%), Gaps = 26/136 (19%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERD------------RRGRYKDDSEEEFDRKRDRNGDR----- 322
            +RNRDR  RDRD D +++RD            RR R +   +   DR+RDR+ DR     
Sbjct: 880  ERNRDRD-RDRDRDRDRDRDMRDDRRRSSIVRRRSRSRSRGDRGGDRERDRHRDRDRDSR 938

Query: 321  --------RHRVDDRDGDNEKERDR-RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSE 169
                    R R  DRD D +++RDR R   D RG    R     N     RR R    S 
Sbjct: 939  RERSRDSRRERSRDRDKDRDRDRDRDRESRDHRGGDLHR-----NSHHHSRRDRSLSTSR 993

Query: 168  EEFDRKRDRNGDRRHR 121
             + DR RDR G RR R
Sbjct: 994  RDRDRDRDRGGGRRDR 1009

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 46/155 (29%), Positives = 83/155 (53%), Gaps = 3/155 (1%)
 Frame = -1

Query: 480 IRMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 301
           +R+++ K   KR  +R  +++++   +E  R+ + ++D+  E +R+     +RR R + R
Sbjct: 189 LRLVEEK---KRRLEREIKEKEEQKRREERRKKQLEEDAIREKERE-----ERRARREQR 240

Query: 300 DGDNEKERDRRG-DNDRRGNGER-RHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR 130
           + + E  R+RR  + DR  + +R RHRD D +++RDR RGR +D S     R RDR   R
Sbjct: 241 ERERELSRERRHRERDRNRSRDRDRHRDRDRDRDRDRGRGRSRDRS-----RGRDRRLSR 295

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
             +   R+     E    +  K+D+E  +R+   D
Sbjct: 296 DAKA--RNDHGRPEDVKTQLSKEDNERLEREALAD 328

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 44/139 (31%), Positives = 63/139 (45%), Gaps = 3/139 (2%)
 Frame = -1

Query: 411 DNEKERDRRGRYKDDSEEEFDRKR--DRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGE 238
           D EKE+DR G  + D   ++DR+R  +R+   R R  +R   + +E  R    DRR    
Sbjct: 433 DKEKEKDREG--EKDRGRDYDRRRKDNRSASPRARRIERSRSHRREDSRSRLRDRRERSR 490

Query: 237 RRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDD 58
            R R D  +  R+   R +  S      +RDR+   R R+ DR  D  + R   R  +D 
Sbjct: 491 SRPRLDRRDDRREDHVRDRSRSRRRATDRRDRSRS-RVRITDRRDDTRRARSRSRATRDG 549

Query: 57  SEEDDRKRNR-DRRYRDTS 4
            +     R R DRR R  S
Sbjct: 550 RDRSRSPRPRVDRRDRSRS 568

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 41/123 (33%), Positives = 57/123 (46%), Gaps = 6/123 (4%)
 Frame = -1

Query: 369 DSEEEFDRKRDRN---GDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERD 199
           ++    D +R ++   G R HR  +++ D E E+DR  D DRR    R         ER 
Sbjct: 411 ETASRVDSRRSKSPSPGTRGHRDKEKEKDREGEKDRGRDYDRRRKDNRSASPRARRIERS 470

Query: 198 RRGRYKDDSEEEFDRK-RDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNR-- 28
           R  R +D      DR+ R R+  R  R DDR  D+ ++R   RR   D  +  R R R  
Sbjct: 471 RSHRREDSRSRLRDRRERSRSRPRLDRRDDRREDHVRDRSRSRRRATDRRDRSRSRVRIT 530

Query: 27  DRR 19
           DRR
Sbjct: 531 DRR 533

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 42/146 (28%), Positives = 75/146 (51%), Gaps = 4/146 (2%)
 Frame = -1

Query: 435 RRYRDRDDDNEKERDRRGRYKDDSEEEFDRKR---DRNGDRRHRVDDRDGDNEKERDRRG 265
           RR    D+  E+ER R  +  +D   E   +R   +R  +    V+++    E+E   + 
Sbjct: 148 RRAEIGDEAAEEERIRGSKTDEDYAAETAARRAERERVREELRLVEEKKRRLEREIKEKE 207

Query: 264 DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
           +  RR    ++  ++D  +E++R  R      E+ +R+R+ + +RRHR  DR+   +++R
Sbjct: 208 EQKRREERRKKQLEEDAIREKEREERRA--RREQRERERELSRERRHRERDRNRSRDRDR 265

Query: 84  DHRRRYKDDSEEDDRKRNRDR-RYRD 10
            HR R +D   +  R R+RDR R RD
Sbjct: 266 -HRDRDRDRDRDRGRGRSRDRSRGRD 290

[20][TOP]
>UniRef100_UPI000194C58B PREDICTED: similar to RNA binding motif protein 25 n=1
           Tax=Taeniopygia guttata RepID=UPI000194C58B
          Length = 839

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 53/146 (36%), Positives = 89/146 (60%), Gaps = 2/146 (1%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRR 268
           ++RR R+R+ + E+ER  R R ++ + E+E +R+R+R  DR R R  DRD D E++RDR 
Sbjct: 308 KERRERERERERERERREREREREREREKEKERERERERDRDRDRTKDRDRDRERDRDR- 366

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
            D DR  + +R+ R    EK RDR    + + E E +R+R+R    R R  +R+ + E+E
Sbjct: 367 -DRDRERSSDRKDRSRSREKSRDRERERERERERERERERER---ERERERERERERERE 422

Query: 87  RDHRRRYKDDSEEDDRKRNRDRRYRD 10
           +D +R  ++D E+   +R  +R+ R+
Sbjct: 423 KDKKRDREEDEEDAYERRKLERKLRE 448

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 46/143 (32%), Positives = 83/143 (58%), Gaps = 2/143 (1%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
           RD   +  ++  +KE++R+   K+  E E +R+R+R    R R  +R+ + EKER+R  +
Sbjct: 286 RDTHKKLEEEKGKKEKERQEIEKERRERERERERERERREREREREREREKEKERERERE 345

Query: 261 NDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKE 88
            D R     + RD D E++RDR R R +    ++  R R+++ DR R R  +R+ + E+E
Sbjct: 346 RD-RDRDRTKDRDRDRERDRDRDRDRERSSDRKDRSRSREKSRDRERERERERERERERE 404

Query: 87  RDHRRRYKDDSEEDDRKRNRDRR 19
           R+ R R ++   E +R+R +D++
Sbjct: 405 RE-REREREREREREREREKDKK 426

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 53/148 (35%), Positives = 82/148 (55%), Gaps = 6/148 (4%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
           +R R+R R ++++ + E+ERDR R R KD D + E DR RDR+ +R     DR    EK 
Sbjct: 327 EREREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRKDRSRSREKS 386

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           RDR  + +R      R R+ + E+ER+R    + + E E D+KRDR  D     + R  +
Sbjct: 387 RDRERERERE---REREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLE 443

Query: 99  ---NEKERDHRRRYKDDSEEDDRKRNRD 25
               EKE  ++ R K + E  +RK++R+
Sbjct: 444 RKLREKEAAYQERLK-NWEIRERKKSRE 470

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 52/182 (28%), Positives = 88/182 (48%), Gaps = 27/182 (14%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +R+   +R R+R  RDRD D  K+RDR      D + + +R  DR    R R   RD + 
Sbjct: 333 EREKEKERERERE-RDRDRDRTKDRDRDRERDRDRDRDRERSSDRKDRSRSREKSRDRER 391

Query: 288 EKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRK----------- 151
           E+ER+R  + +R    ER   R R+ + E+E+D++   ++D E+ ++R+           
Sbjct: 392 EREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEA 451

Query: 150 ----RDRNGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRD 10
               R +N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR 
Sbjct: 452 AYQERLKNWEIRERKKSREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRG 511

Query: 9   TS 4
           ++
Sbjct: 512 SA 513

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 42/125 (33%), Positives = 63/125 (50%), Gaps = 7/125 (5%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD------RRGDNDRRGNGERRHRDDDN 214
           ++D  +   R+  +  D   ++++  G  EKER       R  + +R    ERR R+   
Sbjct: 271 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERE--R 328

Query: 213 EKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRK 37
           E+ER+R    + + E E DR RDR  DR R R  DRD D ++ER   R+ +  S E  R 
Sbjct: 329 EREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRKDRSRSREKSRD 388

Query: 36  RNRDR 22
           R R+R
Sbjct: 389 RERER 393

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 53/203 (26%), Positives = 91/203 (44%), Gaps = 63/203 (31%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR---RHRVDD 304
           +R+   +R+RDR R +DRD D E++RDR R R +    ++  R R+++ DR   R R  +
Sbjct: 339 ERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRKDRSRSREKSRDRERERERERE 398

Query: 303 RDGDNEKERDRRGDNDRRGNGER-----RHRDDDNE------------------------ 211
           R+ + E+ER+R  + +R    ER     R R++D E                        
Sbjct: 399 REREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLK 458

Query: 210 ----KERDRRGRYKDDSEEEFDRKR--------------DRNGDR-----------RHRV 118
               +ER +   Y+ ++E E +R+R              D + DR           + R+
Sbjct: 459 NWEIRERKKSREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRL 518

Query: 117 DDRDGDNEKERDHRRRYKDDSEE 49
            DR+ + E +   R+R K++ EE
Sbjct: 519 RDREKEMEADERDRKREKEELEE 541

[21][TOP]
>UniRef100_Q18401 Putative uncharacterized protein n=1 Tax=Caenorhabditis elegans
           RepID=Q18401_CAEEL
          Length = 390

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 37/147 (25%), Positives = 91/147 (61%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K+ +D++  D DD++E ++ +  + K D +++ + + D+  D++ + DD++ D++ E ++
Sbjct: 199 KKKKDKKKDDDDDEDENDKKKDKKKKKDDKDDDENEDDKKKDKKKKKDDKEKDDDDEEEK 258

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
               D++   ++++ DD+ +K++D++ +  DD +E+ D K+     ++   DD D + EK
Sbjct: 259 ----DKKKKDKKKNDDDEEDKKKDKKKKKDDDDDEDEDNKKKDKKKKKDDKDDEDEEKEK 314

Query: 90  ERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           ++  + + KDD ++DD K  +D++ +D
Sbjct: 315 DKKKKDKKKDDDDDDDEKEKKDKKKKD 341

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 39/147 (26%), Positives = 96/147 (65%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K+   ++ +D +D+ EKE+D++ + K   +++ + + D+  D++ + DD+D D+E E D+
Sbjct: 179 KKKDKKKKKDDNDEEEKEKDKKKKDKKKDDDDDEDENDKKKDKKKKKDDKD-DDENEDDK 237

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
           + D  ++ + + +  DD+ EK++ ++ + K+D +EE D+K+D+   ++ + DD D D + 
Sbjct: 238 KKDKKKKKDDKEKDDDDEEEKDKKKKDKKKNDDDEE-DKKKDK---KKKKDDDDDEDEDN 293

Query: 90  ERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           ++  +++ KDD +++D ++ +D++ +D
Sbjct: 294 KKKDKKKKKDDKDDEDEEKEKDKKKKD 320

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 41/145 (28%), Positives = 90/145 (62%), Gaps = 3/145 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K+ +D + +D DD+ EK++ ++ + K+D +EE D+K+D+   ++   DD D DN+K+  +
Sbjct: 242 KKKKDDKEKDDDDEEEKDKKKKDKKKNDDDEE-DKKKDKK-KKKDDDDDEDEDNKKKDKK 299

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
           +  +D+         D+D EKE+D++ + K   +++ D ++++   ++   DD+D D ++
Sbjct: 300 KKKDDKD--------DEDEEKEKDKKKKDKKKDDDDDDDEKEKKDKKKK--DDKDDDEDE 349

Query: 90  ERDHRRRYKDDSEED---DRKRNRD 25
           ++D +++ KDD ++D   D+K+  D
Sbjct: 350 DKDDKKKKKDDVDDDMKKDKKKKED 374

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 41/151 (27%), Positives = 96/151 (63%), Gaps = 4/151 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYK--DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           K+ +D++ ++ DD+ E+++D++ + +  DD +EE     D+  D++ + DD D + EKE+
Sbjct: 145 KKKKDKK-KEEDDEEEEQKDKKKKDEKNDDDDEE-----DKKKDKKKKKDDND-EEEKEK 197

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRY--KDDSEEEFDRKRDRNGDRRHRVDDRDG 103
           D++  + ++ + +    +D+N+K++D++ +   KDD E E D+K+D+   +  +  D D 
Sbjct: 198 DKKKKDKKKDDDD---DEDENDKKKDKKKKKDDKDDDENEDDKKKDKKKKKDDKEKDDDD 254

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           + EK++  + + K+D +E+D+K+++ ++  D
Sbjct: 255 EEEKDKKKKDKKKNDDDEEDKKKDKKKKKDD 285

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 46/145 (31%), Positives = 91/145 (62%), Gaps = 2/145 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG-DNEKERD 274
           K+ +D++  D DD+ +K++D++ +  DD +E+ D K+    D++ + DD+D  D EKE+D
Sbjct: 260 KKKKDKKKND-DDEEDKKKDKKKKKDDDDDEDEDNKKK---DKKKKKDDKDDEDEEKEKD 315

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
           ++  + ++ +      DDD+EKE+  + + KDD +++ D  +D   D++ + DD D D +
Sbjct: 316 KKKKDKKKDDD-----DDDDEKEKKDK-KKKDDKDDDEDEDKD---DKKKKKDDVDDDMK 366

Query: 93  KERDHRRRYKDDSE-EDDRKRNRDR 22
           K  D +++  DD E EDD+K+++ +
Sbjct: 367 K--DKKKKEDDDKEDEDDKKKDKKK 389

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/151 (27%), Positives = 86/151 (56%), Gaps = 4/151 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRG-RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           +RN+     D  D +E ++ R+  R K   EEE  +K +   D++ +   ++ D+E+E  
Sbjct: 102 RRNKSGSDSDSSDSSEDKKKRKQMRDKKKQEEEDKKKEEEEKDKKKKDKKKEEDDEEEEQ 161

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
           +    D++   E+   DD+ +K++D++ + KDD++EE   K  +  D++   DD + +N+
Sbjct: 162 K----DKKKKDEKNDDDDEEDKKKDKK-KKKDDNDEEEKEKDKKKKDKKKDDDDDEDEND 216

Query: 93  KERDHRRR---YKDDSEEDDRKRNRDRRYRD 10
           K++D +++     DD  EDD+K+++ ++  D
Sbjct: 217 KKKDKKKKKDDKDDDENEDDKKKDKKKKKDD 247

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 39/161 (24%), Positives = 93/161 (57%), Gaps = 14/161 (8%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKE---RDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD--NE 286
           K   D    D  +D +K    RD++ + ++D ++E + K  +  D++   DD + +  ++
Sbjct: 105 KSGSDSDSSDSSEDKKKRKQMRDKKKQEEEDKKKEEEEKDKKKKDKKKEEDDEEEEQKDK 164

Query: 285 KERDRRGDND-----RRGNGERRHRDDDNEKERDRRGRYK----DDSEEEFDRKRDRNGD 133
           K++D + D+D     ++   +++  +D+ EKE+D++ + K    DD E+E D+K+D+   
Sbjct: 165 KKKDEKNDDDDEEDKKKDKKKKKDDNDEEEKEKDKKKKDKKKDDDDDEDENDKKKDKK-K 223

Query: 132 RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           ++   DD + +++K++D +++  D  ++DD +  +D++ +D
Sbjct: 224 KKDDKDDDENEDDKKKDKKKKKDDKEKDDDDEEEKDKKKKD 264

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 25/130 (19%), Positives = 71/130 (54%), Gaps = 1/130 (0%)
 Frame = -1

Query: 405 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD-NDRRGNGERRH 229
           ++ R+ RGR+         R        +   D    D+ +++ +R    D++   E   
Sbjct: 77  QEHRENRGRHGHHGRHGMGRHGGHGRRNKSGSDSDSSDSSEDKKKRKQMRDKKKQEEEDK 136

Query: 228 RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEE 49
           + ++ EK++ ++ + K++ +EE ++K  +  D ++   D D + +K++D +++ KDD++E
Sbjct: 137 KKEEEEKDKKKKDKKKEEDDEEEEQKDKKKKDEKN---DDDDEEDKKKDKKKK-KDDNDE 192

Query: 48  DDRKRNRDRR 19
           +++++++ ++
Sbjct: 193 EEKEKDKKKK 202

[22][TOP]
>UniRef100_A2E2A9 Eukaryotic translation initiation factor 3 subunit 10, putative n=1
           Tax=Trichomonas vaginalis G3 RepID=A2E2A9_TRIVA
          Length = 311

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 66/143 (46%), Positives = 84/143 (58%), Gaps = 2/143 (1%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERD-RRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           R+RDR  RDRD D+  +RD RR R +DD ++ + R RDR  DR    DDRD D+   RDR
Sbjct: 188 RDRDRSRRDRDRDDRDDRDDRRDRDRDDRDDGYRRDRDR--DR----DDRDRDDRDRRDR 241

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
             D DRR   +RR RD D+   RDRR R +DD +     +RDR+ DRRH   DRD D ++
Sbjct: 242 --DRDRR---DRRDRDRDDRDRRDRRDRDRDDRD-----RRDRDRDRRH---DRDRDRDR 288

Query: 90  ERDHRRRYKDDSEEDDR-KRNRD 25
           +R       D S +DDR  R RD
Sbjct: 289 KRGSSVSRYDYSSDDDRYYRRRD 311

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 50/122 (40%), Positives = 70/122 (57%)
 Frame = -1

Query: 381 RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKER 202
           + K DS+ + D  RD+  D R R  DR    +++RD R D D R + +R  RDD   ++R
Sbjct: 166 KVKSDSKSKKDDSRDKGRDDRGRDRDRSR-RDRDRDDRDDRDDRRDRDRDDRDDGYRRDR 224

Query: 201 DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           DR    +DD + +   +RDR+ DRR R  DRD D+   RD R R +DD   D R R+RDR
Sbjct: 225 DRD---RDDRDRDDRDRRDRDRDRRDR-RDRDRDDRDRRDRRDRDRDD--RDRRDRDRDR 278

Query: 21  RY 16
           R+
Sbjct: 279 RH 280

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 54/135 (40%), Positives = 74/135 (54%), Gaps = 2/135 (1%)
 Frame = -1

Query: 420 RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR--RG 247
           + D   K+ D R + +DD      R RDR+  RR    DRD D+  +RD R D DR  R 
Sbjct: 168 KSDSKSKKDDSRDKGRDD------RGRDRDRSRR----DRDRDDRDDRDDRRDRDRDDRD 217

Query: 246 NGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRY 67
           +G RR RD D + +RDR  R + D + +   +RDR+ D R R D RD D + +RD R R 
Sbjct: 218 DGYRRDRDRDRD-DRDRDDRDRRDRDRDRRDRRDRDRDDRDRRDRRDRDRD-DRDRRDRD 275

Query: 66  KDDSEEDDRKRNRDR 22
           +D   + DR R+R R
Sbjct: 276 RDRRHDRDRDRDRKR 290

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 52/128 (40%), Positives = 70/128 (54%), Gaps = 5/128 (3%)
 Frame = -1

Query: 378 YKDDSE---EEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG-DNDRRGNGERRHRDDDNE 211
           Y+D+S     E  R +  +  +      +D   +K RD RG D DR     RR RD D+ 
Sbjct: 147 YEDESSPIPSELFRFKPEDKVKSDSKSKKDDSRDKGRDDRGRDRDR----SRRDRDRDDR 202

Query: 210 KERD-RRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKR 34
            +RD RR R +DD ++ + R RDR+ D R R DDRD    ++RD  RR + D + DDR R
Sbjct: 203 DDRDDRRDRDRDDRDDGYRRDRDRDRDDRDR-DDRD---RRDRDRDRRDRRDRDRDDRDR 258

Query: 33  NRDRRYRD 10
            RDRR RD
Sbjct: 259 -RDRRDRD 265

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 48/128 (37%), Positives = 62/128 (48%)
 Frame = -1

Query: 453 WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           ++R+RDR   DRD D   +RDRR           DR RDR  DRR    DRD D+   RD
Sbjct: 220 YRRDRDRDRDDRDRD---DRDRR-----------DRDRDRR-DRR----DRDRDDRDRRD 260

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
           RR           R RDD + ++RDR  R+        DR RDR+  R   V   D  ++
Sbjct: 261 RRD----------RDRDDRDRRDRDRDRRH--------DRDRDRDRKRGSSVSRYDYSSD 302

Query: 93  KERDHRRR 70
            +R +RRR
Sbjct: 303 DDRYYRRR 310

[23][TOP]
>UniRef100_Q54JM6 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum
           RepID=Q54JM6_DICDI
          Length = 1447

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 63/158 (39%), Positives = 92/158 (58%), Gaps = 15/158 (9%)
 Frame = -1

Query: 450 KRNRDRRYRDRD--DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           K  +DR Y+DRD  D + KE+DR  + KD   +  DR RDR+ DR     DRD D +++R
Sbjct: 483 KDYKDRDYKDRDYKDRDYKEKDRDYKEKDRDYKSIDRDRDRDRDR-----DRDRDRDRDR 537

Query: 276 DRRGDNDRRG-----------NGERRHRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNG 136
           DR  D D +              + R RD D +++RDR R R +D D + + DR+RDR+ 
Sbjct: 538 DRDRDRDYKDYKDYKDYKLSEKDKERDRDRDRDRDRDRDRDRDRDRDRDRDRDRERDRDR 597

Query: 135 DRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           D R R  DR+ D EKERD + R KD  +E ++++++DR
Sbjct: 598 D-RDRDRDREKDREKERD-KERDKDKDKEKEKEKDKDR 633

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 58/145 (40%), Positives = 88/145 (60%), Gaps = 8/145 (5%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGR----YKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           R+RDR R RDRD D +++RDR  +    YKD    E D++RDR+ DR     DRD D ++
Sbjct: 523 RDRDRDRDRDRDRDRDRDRDRDYKDYKDYKDYKLSEKDKERDRDRDR-----DRDRDRDR 577

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDD 112
           +RDR  D DR  + ER  RD D +++RDR    + D E+E D++RD++ D+   + +  D
Sbjct: 578 DRDRDRDRDRDRDRER-DRDRDRDRDRDR----EKDREKERDKERDKDKDKEKEKEKDKD 632

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRK 37
           RD + EKE+D  +  + D ++D  K
Sbjct: 633 RDKEKEKEKDKEKEKEKDKDKDKEK 657

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 63/157 (40%), Positives = 80/157 (50%), Gaps = 7/157 (4%)
 Frame = -1

Query: 453 WKRNRDR---RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 286
           + R+RDR   R RDR  D ++ RDR R R +D S     R RDR+   R R  DRD D +
Sbjct: 272 YMRDRDRSRDRSRDRIRDRDRSRDRIRDRVRDRSRS---RSRDRDRYYRDRDRDRDRDRD 328

Query: 285 KERDRRGDNDRRGN---GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
           ++RDR  D  R G    G  R RD D +++RDRR R +D S     R RDR+ D R R  
Sbjct: 329 RDRDRERDIGRSGGSSGGLDRDRDRDRDRDRDRR-RDRDRS-----RSRDRSRD-RSRDR 381

Query: 114 DRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           DRD    +ERD            DR R +DR    +S
Sbjct: 382 DRDRSRSRERDR-----------DRDRGKDRNKLSSS 407

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 53/154 (34%), Positives = 77/154 (50%), Gaps = 15/154 (9%)
 Frame = -1

Query: 447 RNRDRRYRD---------------RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 313
           R+RDR Y+D               RD D +++RDR            DR RDR+ DR   
Sbjct: 539 RDRDRDYKDYKDYKDYKLSEKDKERDRDRDRDRDR------------DRDRDRDRDR--- 583

Query: 312 VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD 133
             DRD D ++ERDR  D DR      R R+ D EKERD+      D E+E ++ +DR+  
Sbjct: 584 --DRDRDRDRERDRDRDRDR-----DRDREKDREKERDKERDKDKDKEKEKEKDKDRD-- 634

Query: 132 RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRN 31
            + +  ++D + EKE+D     KD  +E D+ +N
Sbjct: 635 -KEKEKEKDKEKEKEKD-----KDKDKEKDKPKN 662

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 52/141 (36%), Positives = 69/141 (48%), Gaps = 2/141 (1%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGD 262
           D+  RDRD   ++ RDR             R RDR+ DR R RV DR     ++RDR   
Sbjct: 270 DKYMRDRDRSRDRSRDRI------------RDRDRSRDRIRDRVRDRSRSRSRDRDRYYR 317

Query: 261 NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 82
           +  R     R RD D E++  R G      + + DR RDR+ DRR R  DR    ++ RD
Sbjct: 318 DRDRDRDRDRDRDRDRERDIGRSGGSSGGLDRDRDRDRDRDRDRR-RDRDRSRSRDRSRD 376

Query: 81  HRR-RYKDDSEEDDRKRNRDR 22
             R R +D S   +R R+RDR
Sbjct: 377 RSRDRDRDRSRSRERDRDRDR 397

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 47/119 (39%), Positives = 62/119 (52%), Gaps = 3/119 (2%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRD--RNGDRRHRVD- 307
           R+  R     R+RDR YRDRD D +++RDR          + DR+RD  R+G     +D 
Sbjct: 300 RVRDRSRSRSRDRDRYYRDRDRDRDRDRDR----------DRDRERDIGRSGGSSGGLDR 349

Query: 306 DRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
           DRD D +++RDRR D D R     R RD   +++RDR          E DR RDR  DR
Sbjct: 350 DRDRDRDRDRDRRRDRD-RSRSRDRSRDRSRDRDRDR------SRSRERDRDRDRGKDR 401

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 52/159 (32%), Positives = 73/159 (45%), Gaps = 16/159 (10%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDN 259
           D+ Y+DRD    K+RD    YKD   +E DR   +  DR ++  DRD D +++RDR    
Sbjct: 482 DKDYKDRD---YKDRD----YKDRDYKEKDRDY-KEKDRDYKSIDRDRDRDRDRDR---- 529

Query: 258 DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN---------------GDRRH 124
                        D +++RDR            DR RDR+                  R 
Sbjct: 530 -------------DRDRDRDR------------DRDRDRDYKDYKDYKDYKLSEKDKERD 564

Query: 123 RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
           R  DRD D +++RD R R +D   + DR+R+RDR R RD
Sbjct: 565 RDRDRDRDRDRDRD-RDRDRDRDRDRDRERDRDRDRDRD 602

[24][TOP]
>UniRef100_B9SW84 Dead box ATP-dependent RNA helicase, putative n=1 Tax=Ricinus
           communis RepID=B9SW84_RICCO
          Length = 1173

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/167 (32%), Positives = 92/167 (55%), Gaps = 20/167 (11%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDS----EEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           +R+   +  D DD  EKER+++ + K       ++E +R +DR  DR  R  DRD D + 
Sbjct: 51  RRSEREKSTDSDDKYEKEREKKDKEKHKDRRSRDDERERTKDRKRDREERGKDRDRDRDS 110

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDR-----KRDRNGDRRHRV 118
           ERDR  + ++R     + R+ + ++ER+RR R +++ E E +R     +R+R+ + R + 
Sbjct: 111 ERDRERE-EKRERAREKERERERDRERERREREREERERERERERERERRERDKEEREKE 169

Query: 117 DDRDGDNEKERDHRRRYK-----------DDSEEDDRKRNRDRRYRD 10
            +R+ + E+ERD  RR +           D+SE+D R  +R RR RD
Sbjct: 170 RERERERERERDRERRAREKEKRREISSDDNSEDDSRGHDRKRRRRD 216

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 57/161 (35%), Positives = 99/161 (61%), Gaps = 14/161 (8%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDR----RGRYKD------DSEEEFDRKRDRNGDRRHRVDD 304
           + +RDR R RD++ + E+ RDR    RG  +       DS+++++++R++    +H+ D 
Sbjct: 22  RSHRDRERERDKERNGERHRDREKKDRGSRRSEREKSTDSDDKYEKEREKKDKEKHK-DR 80

Query: 303 RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
           R  D+E+ER +    DR   G+ R RD D+E++R+R  + +   E+E +R+RDR  +RR 
Sbjct: 81  RSRDDERERTKDRKRDREERGKDRDRDRDSERDREREEKRERAREKERERERDRERERRE 140

Query: 123 RV-DDRDGDNEKERDHRRRYKDDSE-EDDRKRNRDR-RYRD 10
           R  ++R+ + E+ER+  RR +D  E E +R+R R+R R RD
Sbjct: 141 REREERERERERERERERRERDKEEREKERERERERERERD 181

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 54/154 (35%), Positives = 84/154 (54%), Gaps = 14/154 (9%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDD--SEEEFDRKRDRNGDRRHR---VDDRDGDNE 286
           KR+R+ R +DRD D + ERDR    K +   E+E +R+RDR  +RR R     +R+ + E
Sbjct: 94  KRDREERGKDRDRDRDSERDREREEKRERAREKERERERDRERERREREREERERERERE 153

Query: 285 KERDRR-GDNDRRGNGERRHRDDDNEKERDRRGRYK--------DDSEEEFDRKRDRNGD 133
           +ER+RR  D + R     R R+ + E++R+RR R K        DD+ E+  R  DR   
Sbjct: 154 RERERRERDKEEREKERERERERERERDRERRAREKEKRREISSDDNSEDDSRGHDRKRR 213

Query: 132 RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRN 31
           RR   D R+   E+      R++D+S+   RK++
Sbjct: 214 RRDEDDYRERAREQSTSRSSRHRDESDGSPRKKS 247

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 52/154 (33%), Positives = 86/154 (55%), Gaps = 7/154 (4%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN--EKER 277
           K++ D +   RD + E++++R G    D E     K+DR   R  R    D D+  EKER
Sbjct: 15  KKDEDSKRSHRDRERERDKERNGERHRDRE-----KKDRGSRRSEREKSTDSDDKYEKER 69

Query: 276 ---DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDR 109
              D+    DRR   + R R  D +++R+ RG+ +D D + E DR+R+   +R  R  +R
Sbjct: 70  EKKDKEKHKDRRSRDDERERTKDRKRDREERGKDRDRDRDSERDREREEKRERA-REKER 128

Query: 108 DGDNEKERDHRRRYKDDSE-EDDRKRNRDRRYRD 10
           + + ++ER+ R R +++ E E +R+R R+RR RD
Sbjct: 129 ERERDRERERREREREERERERERERERERRERD 162

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 52/147 (35%), Positives = 80/147 (54%), Gaps = 4/147 (2%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD-GDNEKERDRRGD 262
           D + + R +++EK+ +   R   D E E  R ++RNG+R    + +D G    ER++  D
Sbjct: 3   DVKLKSRKEESEKKDEDSKRSHRDRERE--RDKERNGERHRDREKKDRGSRRSEREKSTD 60

Query: 261 NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 82
           +D +   ER  +D   EK +DRR R  D+ E   DRKRDR    + R  DRD + ++ER+
Sbjct: 61  SDDKYEKEREKKD--KEKHKDRRSR-DDERERTKDRKRDREERGKDRDRDRDSERDRERE 117

Query: 81  HRR---RYKDDSEEDDRKRNRDRRYRD 10
            +R   R K+   E DR+R R  R R+
Sbjct: 118 EKRERAREKERERERDRERERRERERE 144

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 50/162 (30%), Positives = 86/162 (53%), Gaps = 18/162 (11%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKD--DSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           +R R+R  R+R+ + E+ER+RR R K+  + E E +R+R+R  DR  R  +++   E   
Sbjct: 138 RREREREERERERERERERERRERDKEEREKERERERERERERDRERRAREKEKRREISS 197

Query: 276 DRRGDNDRRGNG-ERRHRDDDNEKER------DRRGRYKDDS---------EEEFDRKRD 145
           D   ++D RG+  +RR RD+D+ +ER       R  R++D+S         E+E D+K  
Sbjct: 198 DDNSEDDSRGHDRKRRRRDEDDYRERAREQSTSRSSRHRDESDGSPRKKSGEDELDKKEK 257

Query: 144 RNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           +   R   ++D     ++E + RRR   + +E  RK+    R
Sbjct: 258 KT--REEELEDEQKRLDEEMEKRRRRVQEWQELRRKKEESER 297

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 50/160 (31%), Positives = 85/160 (53%), Gaps = 21/160 (13%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +   ++R R R+ + E+ERDR    ++   EE +R+R+R  +R  R  D++ + EKER+R
Sbjct: 114 REREEKRERAREKERERERDRERERREREREERERERERERERERRERDKE-EREKERER 172

Query: 270 RGDNDRRGNGERRHRD---------DDNEKE------RDRRGRYKDDSEEEFDRKRDRNG 136
             + +R  + ERR R+         DDN ++      R RR R +DD  E   R++  + 
Sbjct: 173 ERERERERDRERRAREKEKRREISSDDNSEDDSRGHDRKRRRRDEDDYRER-AREQSTSR 231

Query: 135 DRRHRVDDRDG-----DNEKERDHR-RRYKDDSEEDDRKR 34
             RHR D+ DG       E E D + ++ +++  ED++KR
Sbjct: 232 SSRHR-DESDGSPRKKSGEDELDKKEKKTREEELEDEQKR 270

[25][TOP]
>UniRef100_A2QI13 Similarity: some blast hits result from repetitive sequences n=1
           Tax=Aspergillus niger CBS 513.88 RepID=A2QI13_ASPNC
          Length = 548

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 56/156 (35%), Positives = 79/156 (50%), Gaps = 24/156 (15%)
 Frame = -1

Query: 453 WKRNRDRRYRDRDDDNEKERDRRGR-YKDDSEEEFDRKR-------------DRNGDRRH 316
           WK+ RDR       D +++RD R R Y DD  + +DR+R             DR+  RR 
Sbjct: 394 WKQRRDRNLEKSGRDRDRDRDSRRRDYDDDETDRYDRRRTGSSRRDRSLSSSDRHSRRRR 453

Query: 315 RVDD----------RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEE 166
             D+          RD D +++RD R D DR G+ ER  RD D +++RDR  RY+DD   
Sbjct: 454 YEDEDSDSRDDRYYRDRDRDRDRDYRRDRDRNGDRERE-RDRDRDRDRDRSRRYRDDDRH 512

Query: 165 EFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDD 58
              R    +   RHR  DRD + + +RD RRR +D+
Sbjct: 513 SSSRHSSSHTSSRHR--DRDRERDSDRDSRRRRRDE 546

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 51/139 (36%), Positives = 65/139 (46%), Gaps = 25/139 (17%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG--------------------RYKDDSEEEFD----RKR 340
           R+RD R RD DDD     DRR                     RY+D+  +  D    R R
Sbjct: 411 RDRDSRRRDYDDDETDRYDRRRTGSSRRDRSLSSSDRHSRRRRYEDEDSDSRDDRYYRDR 470

Query: 339 DRNGDRRHRVD-DRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEE 163
           DR+ DR +R D DR+GD E+ERDR  D DR  +  RR+RDDD          +      +
Sbjct: 471 DRDRDRDYRRDRDRNGDRERERDRDRDRDR--DRSRRYRDDDRHSSSRHSSSHTSSRHRD 528

Query: 162 FDRKRDRNGDRRHRVDDRD 106
            DR+RD + D R R  D D
Sbjct: 529 RDRERDSDRDSRRRRRDED 547

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 4/71 (5%)
 Frame = -1

Query: 453 WKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           ++R+RDR   R R+RD D +++RDR  RY+DD      R    +   RHR  DR+ D+++
Sbjct: 478 YRRDRDRNGDRERERDRDRDRDRDRSRRYRDDDRHSSSRHSSSHTSSRHRDRDRERDSDR 537

Query: 282 E-RDRRGDNDR 253
           + R RR D DR
Sbjct: 538 DSRRRRRDEDR 548

[26][TOP]
>UniRef100_Q66II8 U1 small nuclear ribonucleoprotein 70 kDa n=1 Tax=Xenopus
           (Silurana) tropicalis RepID=RU17_XENTR
          Length = 471

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 64/175 (36%), Positives = 92/175 (52%), Gaps = 31/175 (17%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKER------DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +R RDRR R R+ D E+ER      +RR R +   +EE  R R+R+ D+  +  D+D D 
Sbjct: 227 ERERDRRERSRERDKERERRRSRSRERRRRSRSREKEERKRSRERSRDK-DKDKDKDKDK 285

Query: 288 EKERDRRGDNDRRGNG--ERRHRDDDNEKERDR-RGRY-------KDDSE---------- 169
           EK++D+  D  RR      +R RD D EK+ DR  G         +DD++          
Sbjct: 286 EKDKDKDRDRKRRSRSRERKRERDRDREKKEDRVEGEVPESVDVPQDDAQTGDLGIDGIE 345

Query: 168 -----EEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
                EE +R RDR  DR     DRD D +++RD RR ++D   + DR+R+RDRR
Sbjct: 346 LKQEPEEKNRDRDRERDRE---KDRDKDRDRDRDRRRSHRDRERDKDRERDRDRR 397

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 57/175 (32%), Positives = 80/175 (45%), Gaps = 26/175 (14%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKD-----DSEEEFDRKRDRNGDRRHRVDD 304
           +R+    R R RR R R+ +  K    R R KD     D ++E D+ +DR  DR+ R   
Sbjct: 244 ERRRSRSRERRRRSRSREKEERKRSRERSRDKDKDKDKDKDKEKDKDKDR--DRKRRSRS 301

Query: 303 RDGDNEKERDRRGDNDR--------------------RGNGERRHRDDDNEKERDRRGRY 184
           R+   E++RDR    DR                     G      + +  EK RDR    
Sbjct: 302 RERKRERDRDREKKEDRVEGEVPESVDVPQDDAQTGDLGIDGIELKQEPEEKNRDRDRER 361

Query: 183 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR-RYKDDSEEDDRKRNRDR 22
             + + + DR RDR+  R HR  +RD D E++RD RR R +D   + D KR RDR
Sbjct: 362 DREKDRDKDRDRDRDRRRSHRDRERDKDRERDRDRRRDRDRDRDRDRDHKRERDR 416

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 40/107 (37%), Positives = 55/107 (51%)
 Frame = -1

Query: 342 RDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEE 163
           R    D   R D+RD D E+ERDRR  +  R     R R    E+ R  R R K++ +  
Sbjct: 209 RHSGRDDTSRYDERDRDRERERDRRERSRERDKERERRRSRSRERRRRSRSREKEERKRS 268

Query: 162 FDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            +R RD++ D+     D+D D EK++D  R  K  S   +RKR RDR
Sbjct: 269 RERSRDKDKDK-----DKDKDKEKDKDKDRDRKRRSRSRERKRERDR 310

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 53/170 (31%), Positives = 77/170 (45%), Gaps = 23/170 (13%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDS-----EEEFDRKRD--RNGD------------ 325
           ++RDR+ R R  + ++ERDR    K+D       E  D  +D  + GD            
Sbjct: 291 KDRDRKRRSRSRERKRERDRDREKKEDRVEGEVPESVDVPQDDAQTGDLGIDGIELKQEP 350

Query: 324 -RRHRVDDRDGDNEKER--DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDR 154
             ++R  DR+ D EK+R  DR  D DRR +   R RD D E++RDRR     D + + D 
Sbjct: 351 EEKNRDRDRERDREKDRDKDRDRDRDRRRSHRDRERDKDRERDRDRRRDRDRDRDRDRDH 410

Query: 153 KRDRN-GDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
           KR+R+ GDR  + ++R  DN    +       D   D         Y  T
Sbjct: 411 KRERDRGDRGEKREERVPDNGMVMEQAEETSQDMYLDQESMQSGDGYLST 460

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 39/88 (44%), Positives = 51/88 (57%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           ++NRDR   DR+ D EK+RD+            DR RDR+  R HR  +RD D E++RDR
Sbjct: 352 EKNRDR---DRERDREKDRDK------------DRDRDRDRRRSHRDRERDKDRERDRDR 396

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGR 187
           R D DR      R RD D+++ERDR  R
Sbjct: 397 RRDRDR-----DRDRDRDHKRERDRGDR 419

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 48/156 (30%), Positives = 67/156 (42%), Gaps = 22/156 (14%)
 Frame = -1

Query: 405 EKERDRRGRYKDDSEEEFD---------RKRDRNGDRRHRVDDRDGDNEKERDRRGDND- 256
           E ERD    YK    ++ D         R R   G R  R+    G       RRG  D 
Sbjct: 152 EHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGT-----RRGGADV 206

Query: 255 ------RRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
                 R        RD D E+ERDRR R + + ++E +R+R R+ +RR R   R+ +  
Sbjct: 207 NIRHSGRDDTSRYDERDRDRERERDRRERSR-ERDKERERRRSRSRERRRRSRSREKEER 265

Query: 93  KERDHRRR------YKDDSEEDDRKRNRDRRYRDTS 4
           K    R R       KD  +E D+ ++RDR+ R  S
Sbjct: 266 KRSRERSRDKDKDKDKDKDKEKDKDKDRDRKRRSRS 301

[27][TOP]
>UniRef100_B3L1H1 Protein kinase, putative n=1 Tax=Plasmodium knowlesi strain H
            RepID=B3L1H1_PLAKH
          Length = 1367

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 59/155 (38%), Positives = 89/155 (57%), Gaps = 11/155 (7%)
 Frame = -1

Query: 435  RRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-----DRDGDNEKERDR 271
            R Y +R  D  +ERDR+   + + E E D++RD   DR  +       DRD D E+ER+R
Sbjct: 1186 RDYAERGRDMGRERDRKRDREREREWERDKRRDMGRDRERKERNEWDRDRDRDRERERER 1245

Query: 270  RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNE 94
              D +R  + ER  ++ + EKER+R    + D E E +R+++R  +R R R  DRD D +
Sbjct: 1246 ERDRERERDRERE-KEREREKERERERYREKDRERERNREKERERERERERDRDRDRDRD 1304

Query: 93   KERDHRRRYKDDSEEDDRKRNRD-----RRYRDTS 4
            K+RD R+RY+D   + +R R+R+     RR RD S
Sbjct: 1305 KDRD-RKRYRDQERDRERDRHREREPHKRRSRDNS 1338

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 52/146 (35%), Positives = 87/146 (59%), Gaps = 4/146 (2%)
 Frame = -1

Query: 453  WKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
            W R+RDR   R R+R+ D E+ERDR    + + E+E +R+R R  DR     +R+ + EK
Sbjct: 1231 WDRDRDRDRERERERERDRERERDREREKEREREKERERERYREKDR-----ERERNREK 1285

Query: 282  ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRD 106
            ER+R  + +R      R RD D +K+RDR+ RY+D + + E DR R+R   +R   D+ +
Sbjct: 1286 ERERERERER-----DRDRDRDRDKDRDRK-RYRDQERDRERDRHREREPHKRRSRDNSN 1339

Query: 105  GDNEKERDHRRRYKDDSEEDDRKRNR 28
             + E +   ++++K DS++ +R+  R
Sbjct: 1340 RNQEHQLKEQKKHKLDSQDANRELKR 1365

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 45/163 (27%), Positives = 71/163 (43%), Gaps = 16/163 (9%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFD-----RKRDRNGDRRHRVDDRDGDNE 286
            K  + + Y+ ++   E++  R G+Y    +  F      R+ + +G  RH    R+G   
Sbjct: 1093 KEKKGKTYKMKEQHMEEDHGRYGKYGTQRDGSFRGDSRWRREESSGRSRHS-STREGGGY 1151

Query: 285  KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKD------DSEEEFDRKRDRNGDRRH 124
                 RG   R  +   R     +++ R+R    +D      D   E DRKRDR  +R  
Sbjct: 1152 HTNSYRGRVGRIRDSSSRAERSMHDRSREREWYKRDYAERGRDMGRERDRKRDREREREW 1211

Query: 123  RVDD-RDGDNEKERDHRRRYKDDSEED---DRKRNRDR-RYRD 10
              D  RD   ++ER  R  +  D + D   +R+R RDR R RD
Sbjct: 1212 ERDKRRDMGRDRERKERNEWDRDRDRDRERERERERDRERERD 1254

[28][TOP]
>UniRef100_Q6C6F8 YALI0E09889p n=1 Tax=Yarrowia lipolytica RepID=Q6C6F8_YARLI
          Length = 601

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 62/145 (42%), Positives = 79/145 (54%), Gaps = 3/145 (2%)
 Frame = -1

Query: 447 RNRDRRYRDRD-DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           R+ D R  +RD  D E+ERDR  R   D + E DR+RDR  ++R R  D   D E+ER+R
Sbjct: 25  RSHDSRDTERDVRDRERERDRDFR---DRDRERDRERDRYRNQRWRRRDDSVDRERERER 81

Query: 270 RGDNDRRGNGERRHRDDDNEKE--RDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
             D D R  G+R  R D   ++  RDRR R  DD   +  R RDR+ D R R  DRD D 
Sbjct: 82  HRDRDYRDRGDRGDRRDRYSRDGGRDRRDRRDDDRTRDRPRDRDRDRD-RDRDRDRDRDR 140

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDR 22
           +++RD  R   D     DR R RDR
Sbjct: 141 DRDRDRDRDRGDRERARDRTRERDR 165

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 58/149 (38%), Positives = 76/149 (51%), Gaps = 5/149 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDR----RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           +R RDR +RDRD + ++ERDR    R R +DDS +  +R+R+R+ DR +R     GD   
Sbjct: 40  ERERDRDFRDRDRERDRERDRYRNQRWRRRDDSVDR-ERERERHRDRDYRDRGDRGDRRD 98

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
              R G  DRR       RDDD  ++R R R R   D + + DR RDR+ DR    D   
Sbjct: 99  RYSRDGGRDRRDR-----RDDDRTRDRPRDRDR---DRDRDRDRDRDRDRDRDRDRDRDR 150

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           GD E+ RD  R    D   DD     D R
Sbjct: 151 GDRERARDRTRERDRDVSIDDSVVPLDER 179

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 57/157 (36%), Positives = 73/157 (46%), Gaps = 20/157 (12%)
 Frame = -1

Query: 414 DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD--------RRGDN 259
           D  +  R R    +D   +  DR+R+R+ D R    DRD + ++ERD        RR D+
Sbjct: 17  DTQQPPRPRSHDSRDTERDVRDRERERDRDFR----DRDRERDRERDRYRNQRWRRRDDS 72

Query: 258 DRRGNGERRHRD---DDNEKERDRRGRYKDD------SEEEFDRKRDRNGDRRHRVDDRD 106
             R     RHRD    D     DRR RY  D         + DR RDR  D R R  DRD
Sbjct: 73  VDRERERERHRDRDYRDRGDRGDRRDRYSRDGGRDRRDRRDDDRTRDRPRD-RDRDRDRD 131

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRDR---RYRDTS 4
            D +++RD  R    D +  DR+R RDR   R RD S
Sbjct: 132 RDRDRDRDRDRDRDRDRDRGDRERARDRTRERDRDVS 168

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 39/99 (39%), Positives = 52/99 (52%), Gaps = 8/99 (8%)
 Frame = -1

Query: 471 IQRKMIWKRNRDRRYRDRDDDNEKE--------RDRRGRYKDDSEEEFDRKRDRNGDRRH 316
           + R+   +R+RDR YRDR D  ++         RDRR R  DD   +  R RDR+ DR  
Sbjct: 73  VDRERERERHRDRDYRDRGDRGDRRDRYSRDGGRDRRDRRDDDRTRDRPRDRDRDRDR-- 130

Query: 315 RVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERD 199
              DRD D +++RDR  D DR      R RD   E++RD
Sbjct: 131 ---DRDRDRDRDRDRDRDRDRDRGDRERARDRTRERDRD 166

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 50/131 (38%), Positives = 70/131 (53%), Gaps = 10/131 (7%)
 Frame = -1

Query: 372 DDSEEEFDRKRDRNGDRRHRVDDRDGDN-EKERDRRGDNDRRGNGERRHRDDDNEKERDR 196
           ++S EEF  +  R  D +     R  D+ + ERD R D +R  + + R RD + ++ERDR
Sbjct: 2   NNSVEEFLAQTQRGLDTQQPPRPRSHDSRDTERDVR-DRERERDRDFRDRDRERDRERDR 60

Query: 195 ----RGRYKDDS-EEEFDRKRDRNGDRRHRVDDRDGDNEKERD---HRRRYKDDSEEDDR 40
               R R +DDS + E +R+R R+ D R R D  D  +   RD    RR  +DD    DR
Sbjct: 61  YRNQRWRRRDDSVDRERERERHRDRDYRDRGDRGDRRDRYSRDGGRDRRDRRDDDRTRDR 120

Query: 39  KRNRDR-RYRD 10
            R+RDR R RD
Sbjct: 121 PRDRDRDRDRD 131

[29][TOP]
>UniRef100_UPI000155C9E6 PREDICTED: similar to RIKEN cDNA 3110050K21 n=1 Tax=Ornithorhynchus
            anatinus RepID=UPI000155C9E6
          Length = 1592

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 57/150 (38%), Positives = 86/150 (57%), Gaps = 11/150 (7%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRR----GRY--KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
            +RR+ +RD  + +ERD+R    GR+  ++D  E  +R+ DR   R  R DDR  D  +ER
Sbjct: 620  ERRHGERDRRDNRERDQRPSSPGRHQGRNDDLERDERREDR---RVERADDRRDDRARER 676

Query: 276  DRRGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            +R  + DR    ER     R R+ + E ERDR    + + E E DR+RDR+ DR H   D
Sbjct: 677  ERERERDRERERERERERDREREKERELERDRAREREREREREKDRERDRDRDREH---D 733

Query: 111  RDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            RD + E+ER+  +  + + EE +R+R R+R
Sbjct: 734  RDREREREREREKEREREREERERERERER 763

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 57/151 (37%), Positives = 85/151 (56%), Gaps = 7/151 (4%)
 Frame = -1

Query: 450  KRNRDRRYR---DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDGDNEK 283
            +R  DRR     DR DD  +ER+R      + E E +R+RDR  ++   ++ DR  + E+
Sbjct: 655  ERREDRRVERADDRRDDRARERERERERDRERERERERERDREREKERELERDRARERER 714

Query: 282  ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRD 106
            ER+R  D +R  + +R H D D E+ER+R  R K+   E  +R+R+R  +R R R  +R 
Sbjct: 715  EREREKDRERDRDRDREH-DRDRERERERE-REKEREREREERERERERERERERERERG 772

Query: 105  GDNEKERDHRRRY--KDDSEEDDRKRNRDRR 19
             D EKERD +R +  KD   ED R++  D R
Sbjct: 773  RDREKERDRQRDWEDKDKGREDRREKREDTR 803

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 58/157 (36%), Positives = 88/157 (56%), Gaps = 13/157 (8%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            +R R+R R R+R+ + E ERDR    + + E E DR+RDR+ DR H   DRD + E+ER+
Sbjct: 687  ERERERERDREREKERELERDRAREREREREREKDRERDRDRDREH---DRDRERERERE 743

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRD-------RNGDRRHRV 118
            R  + +R      R R+ + E+ER+R RGR   D E+E DR+RD       R   R  R 
Sbjct: 744  REKEREREREERERERERERERERERERGR---DREKERDRQRDWEDKDKGREDRREKRE 800

Query: 117  DDRDGDNEK----ERDHRRRYKDDSEEDDRKRNRDRR 19
            D R+  N +    ER  ++R++++S    R+  + RR
Sbjct: 801  DTREDRNPRDVHDERKSKKRHRNESSPSPRQSPKRRR 837

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 45/163 (27%), Positives = 82/163 (50%), Gaps = 8/163 (4%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR-----RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 313
            R ++R    +R R+R     R RDRD D E +RDR      + E E +R+++R  +R  R
Sbjct: 702  RELERDRAREREREREREKDRERDRDRDREHDRDR------EREREREREKEREREREER 755

Query: 312  VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEE---FDRKRDR 142
              +R+ + E+ER+R    DR    +R+   +D +K R+ R   ++D+ E+    D   +R
Sbjct: 756  ERERERERERERERERGRDREKERDRQRDWEDKDKGREDRREKREDTREDRNPRDVHDER 815

Query: 141  NGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
               +RHR +      +  +  RR +  DS+  +   ++  ++R
Sbjct: 816  KSKKRHRNESSPSPRQSPK-RRREHSPDSDAYNSGEDKSEKHR 857

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 49/136 (36%), Positives = 73/136 (53%), Gaps = 13/136 (9%)
 Frame = -1

Query: 390 RRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNG-----ERRHR 226
           R G  + D  +  ++ RD + +RRH   +RD  + +ERD+R  +  R  G     ER  R
Sbjct: 599 RSGYPERDRYDSREQARDSSFERRH--GERDRRDNRERDQRPSSPGRHQGRNDDLERDER 656

Query: 225 DDDNEKER--DRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD-----HRRR 70
            +D   ER  DRR    DD   E +R+R+R+ +R R R  +RD + EKER+      R R
Sbjct: 657 REDRRVERADDRR----DDRARERERERERDRERERERERERDREREKERELERDRARER 712

Query: 69  YKDDSEEDDRKRNRDR 22
            ++   E DR+R+RDR
Sbjct: 713 EREREREKDRERDRDR 728

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 53/161 (32%), Positives = 73/161 (45%), Gaps = 18/161 (11%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDD--NEKERDRRGRYKDD---SEEEFDRKRDRNG-DRRHRVDDRDGDN 289
            + +R  R R R  D   +  R  RG   D    S    D    R+G   R R D R+   
Sbjct: 556  RSDRTGRSRGRGPDLPEKGSRGTRGTQVDSHSSSGNYHDSWESRSGYPERDRYDSREQAR 615

Query: 288  EKERDRR-GDNDRRGNGER--------RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
            +   +RR G+ DRR N ER        RH+  +++ ERD R   +D   E  D +RD   
Sbjct: 616  DSSFERRHGERDRRDNRERDQRPSSPGRHQGRNDDLERDERR--EDRRVERADDRRDDRA 673

Query: 135  DRRHRVDDRDGDNEKERDH---RRRYKDDSEEDDRKRNRDR 22
              R R  +RD + E+ER+    R R K+   E DR R R+R
Sbjct: 674  RERERERERDRERERERERERDREREKERELERDRARERER 714

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 52/159 (32%), Positives = 76/159 (47%), Gaps = 20/159 (12%)
 Frame = -1

Query: 438  DRRYRDRDDD-NEKERDRRGRYKD---DSEEEFDR--------KRDRNGDRRHRVDDRDG 295
            D R   R++  NE   DR GR +    D  E+  R            +G+     + R G
Sbjct: 542  DTRNDSRNESRNETRSDRTGRSRGRGPDLPEKGSRGTRGTQVDSHSSSGNYHDSWESRSG 601

Query: 294  DNEKERDRRGDNDRRGNGERRH--RDDDNEKERDRR----GRY--KDDSEEEFDRKRDRN 139
              E++R    +  R  + ERRH  RD  + +ERD+R    GR+  ++D  E  +R+ DR 
Sbjct: 602  YPERDRYDSREQARDSSFERRHGERDRRDNRERDQRPSSPGRHQGRNDDLERDERREDR- 660

Query: 138  GDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
              R  R DDR  D  +ER+ R R +D   E +R+R RDR
Sbjct: 661  --RVERADDRRDDRARERE-RERERDRERERERERERDR 696

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 40/152 (26%), Positives = 67/152 (44%), Gaps = 5/152 (3%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEK-ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD----GDNEK 283
           ++ DRR+  R+D   K +R++  R + D +++ +  RD   DR  R D RD     DN  
Sbjct: 408 QSHDRRHERREDTRGKRDREKDTREERDYDQDQNSSRDHRDDRESR-DGRDRREARDNRD 466

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
            R+ R   D R + + R    DN+  RD+R         ++   RDR     HR +D   
Sbjct: 467 RREPRESRDTRDSRDTRDYSRDNKDSRDQRDSRSTRDTHDY---RDRESRDTHRKEDTYQ 523

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
           +  +        ++ S  D R  +R+    +T
Sbjct: 524 EEPRSYGRNHGREESSRTDTRNDSRNESRNET 555

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 43/152 (28%), Positives = 73/152 (48%), Gaps = 6/152 (3%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK--ERDRR 268
           R++   DR+  ++   DRR   ++D+      KRDR  D R   ++RD D ++   RD R
Sbjct: 396 REKGRHDRECTSQSH-DRRHERREDTRG----KRDREKDTR---EERDYDQDQNSSRDHR 447

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR--NGDRRHRVDDRDGDNE 94
            D + R   +RR   D+ ++   R  R   DS +  D  RD   + D+R     RD  + 
Sbjct: 448 DDRESRDGRDRREARDNRDRREPRESRDTRDSRDTRDYSRDNKDSRDQRDSRSTRDTHDY 507

Query: 93  KERDHR--RRYKDDSEEDDRKRNRDRRYRDTS 4
           ++R+ R   R +D  +E+ R   R+    ++S
Sbjct: 508 RDRESRDTHRKEDTYQEEPRSYGRNHGREESS 539

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 47/143 (32%), Positives = 59/143 (41%), Gaps = 3/143 (2%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRG 247
           R R    EK R  R       +   +R+ D  G R     DR+ D  +ER    D D+  
Sbjct: 390 RHRSPGREKGRHDRECTSQSHDRRHERREDTRGKR-----DREKDTREER----DYDQDQ 440

Query: 246 NGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG-DRRHRVDDRD--GDNEKERDHR 76
           N  R HRDD       R GR + ++ +  DR+  R   D R   D RD   DN+  RD R
Sbjct: 441 NSSRDHRDD----RESRDGRDRREARDNRDRREPRESRDTRDSRDTRDYSRDNKDSRDQR 496

Query: 75  RRYKDDSEEDDRKRNRDRRYRDT 7
               D     D    RDR  RDT
Sbjct: 497 ----DSRSTRDTHDYRDRESRDT 515

[30][TOP]
>UniRef100_A5JZU1 Eukaryotic translation initiation factor 3 subunit 10, putative n=1
            Tax=Plasmodium vivax RepID=A5JZU1_PLAVI
          Length = 1285

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 61/155 (39%), Positives = 89/155 (57%), Gaps = 12/155 (7%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
            +D  YRDR D  EK RD  GR   D E + DR+RDR  DR     DR+ D +K+RDR+  
Sbjct: 1037 QDSSYRDRSDRREK-RDWPGR---DKERDRDRERDRERDRDR---DRERDRDKDRDRKYR 1089

Query: 261  NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDGDNEKER 85
             D+    +R  +D + E+ RDR   Y+ D +   DR+++R+ DR +R D DRD   +++R
Sbjct: 1090 KDKEYRRDRS-KDRERERSRDRDREYRKDKDYRRDREKERDRDRDYRRDRDRDYRRDRDR 1148

Query: 84   DHRR----RYKDD-------SEEDDRKRNRDRRYR 13
            D+RR    R +DD         +DD +R+RDR Y+
Sbjct: 1149 DYRRDDDYRREDDYRRDDDYRRDDDYRRDRDRDYK 1183

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 62/156 (39%), Positives = 84/156 (53%), Gaps = 14/156 (8%)
 Frame = -1

Query: 450  KRNRDR---RYRDRDDDNEKER--DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 286
            +R+RDR   R RDRD D E++R  DR  +Y+ D E   DR +DR    R R  DRD +  
Sbjct: 1059 ERDRDRERDRERDRDRDRERDRDKDRDRKYRKDKEYRRDRSKDR---ERERSRDRDREYR 1115

Query: 285  KERDRRGDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
            K++D R D ++   R    RR RD D  ++RDR  R  DD   E D +RD   D   R D
Sbjct: 1116 KDKDYRRDREKERDRDRDYRRDRDRDYRRDRDRDYRRDDDYRREDDYRRD---DDYRRDD 1172

Query: 114  D--RDGDNEKERDHRRRYKDDSE----EDDRKRNRD 25
            D  RD D + ++  RRR +D+ E    E D ++N D
Sbjct: 1173 DYRRDRDRDYKKGERRRDRDEEEYERNESDVRKNHD 1208

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 54/150 (36%), Positives = 86/150 (57%), Gaps = 8/150 (5%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD---RDGDNEKE 280
            KR+   R ++RD D E++R+R      D + + +R RD++ DR++R D    RD   ++E
Sbjct: 1050 KRDWPGRDKERDRDRERDRER------DRDRDRERDRDKDRDRKYRKDKEYRRDRSKDRE 1103

Query: 279  RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN---GDRRHRVDD- 112
            R+R  D DR    ++ +R  D EKERDR   Y+ D + ++ R RDR+    D   R DD 
Sbjct: 1104 RERSRDRDREYRKDKDYR-RDREKERDRDRDYRRDRDRDYRRDRDRDYRRDDDYRREDDY 1162

Query: 111  -RDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
             RD D  ++ D+RR    D ++ +R+R+RD
Sbjct: 1163 RRDDDYRRDDDYRRDRDRDYKKGERRRDRD 1192

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 55/159 (34%), Positives = 81/159 (50%), Gaps = 17/159 (10%)
 Frame = -1

Query: 447  RNRDR---RYRDRDDDNEKERDRRGR----YKDDSEEEFDRKRDRNGDRRHRVD-----D 304
            R RDR   R RDR+ D +K+RDR+ R    Y+ D  ++ +R+R R+ DR +R D     D
Sbjct: 1064 RERDRERDRDRDRERDRDKDRDRKYRKDKEYRRDRSKDRERERSRDRDREYRKDKDYRRD 1123

Query: 303  RDGDNEKERDRRGDNDR---RGNGERRHRDDDNEKERD--RRGRYKDDSEEEFDRKRDRN 139
            R+ + +++RD R D DR   R       RDDD  +E D  R   Y+ D +   DR RD  
Sbjct: 1124 REKERDRDRDYRRDRDRDYRRDRDRDYRRDDDYRREDDYRRDDDYRRDDDYRRDRDRDYK 1183

Query: 138  GDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
               R R  D +     E D R+ +    E+D+ K  +D+
Sbjct: 1184 KGERRRDRDEEEYERNESDVRKNHDVGDEDDNGKMEKDK 1222

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 52/160 (32%), Positives = 85/160 (53%), Gaps = 18/160 (11%)
 Frame = -1

Query: 447  RNRDRRYR-------DRDDDNEKER--DRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DRD 298
            ++RDR+YR       DR  D E+ER  DR   Y+ D +   DR+++R+ DR +R D DRD
Sbjct: 1082 KDRDRKYRKDKEYRRDRSKDRERERSRDRDREYRKDKDYRRDREKERDRDRDYRRDRDRD 1141

Query: 297  GDNEKERDRRGDNDRRGNGERRH-----RDDDNEKERDR---RGRYKDDSEEEFDRKRDR 142
               +++RD R D+D R   + R      RDDD  ++RDR   +G  + D +EE   + + 
Sbjct: 1142 YRRDRDRDYRRDDDYRREDDYRRDDDYRRDDDYRRDRDRDYKKGERRRDRDEEEYERNES 1201

Query: 141  NGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            +  + H V D D + + E+D      +DS+  +    ++R
Sbjct: 1202 DVRKNHDVGDEDDNGKMEKDKGSNSDNDSDGGNHHHAKER 1241

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 63/186 (33%), Positives = 90/186 (48%), Gaps = 35/186 (18%)
 Frame = -1

Query: 465  RKMIWKRNRDRRYRDRDDDNE----KERDRRG-RYKDDSEEEFDRKRDRNGDR------- 322
            RK + + +R +R RD + + +    KE  R G +Y   S  E D    R GD+       
Sbjct: 967  RKRLDEISRIQRERDLEIEQQLLRRKEESRNGDKYYRKSSYEDDFSWKRGGDKAGSQYDE 1026

Query: 321  ---------------RHRVDDRDGDNEKERDRRGDNDRRGNGER---RHRDDDNEKERDR 196
                           R R D R+  +   RD+  D DR  + ER   R R+ D +K+RDR
Sbjct: 1027 DNNYKRLDEAQDSSYRDRSDRREKRDWPGRDKERDRDRERDRERDRDRDRERDRDKDRDR 1086

Query: 195  RGR----YKDDSEEEFDRKRDRNGDRRHRVD-DRDGDNEKERDHRRRYKDDSEEDDRKRN 31
            + R    Y+ D  ++ +R+R R+ DR +R D D   D EKERD  R Y+ D + D R R+
Sbjct: 1087 KYRKDKEYRRDRSKDRERERSRDRDREYRKDKDYRRDREKERDRDRDYRRDRDRDYR-RD 1145

Query: 30   RDRRYR 13
            RDR YR
Sbjct: 1146 RDRDYR 1151

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 52/150 (34%), Positives = 71/150 (47%), Gaps = 13/150 (8%)
 Frame = -1

Query: 447  RNRDRRYRDRDD---DNEKERDRRGRYKDDSEEEFDRKRDRN---GDRRHRVDD--RDGD 292
            R+RDR YR   D   D EKERDR   Y+ D + ++ R RDR+    D   R DD  RD D
Sbjct: 1108 RDRDREYRKDKDYRRDREKERDRDRDYRRDRDRDYRRDRDRDYRRDDDYRREDDYRRDDD 1167

Query: 291  NEKERDRRGDNDR--RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
              ++ D R D DR  +    RR RD++  +  +   R   D  +E D  +       +  
Sbjct: 1168 YRRDDDYRRDRDRDYKKGERRRDRDEEEYERNESDVRKNHDVGDEDDNGKMEKDKGSNSD 1227

Query: 117  DDRDGDNE---KERDHRRRYKDDSEEDDRK 37
            +D DG N    KER+     KD +E D  K
Sbjct: 1228 NDSDGGNHHHAKEREKMTNGKDITENDQAK 1257

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 60/238 (25%), Positives = 102/238 (42%), Gaps = 83/238 (34%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRD-RDDDNEKERDRRGRY------------KDDSE-----EEF 352
            R+++ +   K  +DR ++  +D+  ++ +DRR ++            +++ E     EE 
Sbjct: 898  RIVEFEKNLKDQKDRLHQLLKDEKVQRAKDRREQHLRKLKAEEERKRREEEEERLMKEEM 957

Query: 351  DRKR---------------------------------DRNGDRRHR----VDD----RDG 295
            +RK+                                  RNGD+ +R     DD    R G
Sbjct: 958  ERKKKEEAHRKRLDEISRIQRERDLEIEQQLLRRKEESRNGDKYYRKSSYEDDFSWKRGG 1017

Query: 294  D----------NEKERDRRGDNDRRGNGERRHRDD----DNEKERDRRGRYKDDSEEEFD 157
            D          N K  D   D+  R   +RR + D    D E++RDR    + D + + +
Sbjct: 1018 DKAGSQYDEDNNYKRLDEAQDSSYRDRSDRREKRDWPGRDKERDRDRERDRERDRDRDRE 1077

Query: 156  RKRDRNGDRRHRVD-----DRDGDNEKE--RDHRRRYKDDSE---EDDRKRNRDRRYR 13
            R RD++ DR++R D     DR  D E+E  RD  R Y+ D +   + +++R+RDR YR
Sbjct: 1078 RDRDKDRDRKYRKDKEYRRDRSKDRERERSRDRDREYRKDKDYRRDREKERDRDRDYR 1135

[31][TOP]
>UniRef100_A8N9G3 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea
            okayama7#130 RepID=A8N9G3_COPC7
          Length = 791

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 64/159 (40%), Positives = 83/159 (52%), Gaps = 9/159 (5%)
 Frame = -1

Query: 468  QRKMIWKRNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
            +RK   +  RD R R++D D ++ERDR R R KD    + DR RDR   R HR DD D +
Sbjct: 629  KRKEPHRDYRDDRDREKDRDRDRERDRDRDREKDRDHRDRDRDRDRR-SRHHRYDDYDAE 687

Query: 291  NEKERDRRG---DNDRRGNGERRHRDDD--NEKERDRRGRYKDDSEEEFDRKRDRNGDRR 127
                RD R    D DR     R HRDDD   ++ERDRRG Y+D     +D  RD   DR 
Sbjct: 688  PRSSRDHRDKSYDKDRDYRSSRHHRDDDRKRDRERDRRGSYRD-----YDDVRD---DRD 739

Query: 126  HRVDDRDGD---NEKERDHRRRYKDDSEEDDRKRNRDRR 19
            +R D RD D   ++   + R RY D    +  + + DRR
Sbjct: 740  YRDDRRDYDDNMSDSRAEKRPRYDDRDRTEPEEMDVDRR 778

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 60/146 (41%), Positives = 71/146 (48%), Gaps = 4/146 (2%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
            R R   +RD  DD ++E+DR      D + E DR RDR  DR HR  DRD D      R 
Sbjct: 628  RKRKEPHRDYRDDRDREKDR------DRDRERDRDRDREKDRDHRDRDRDRDRRSRHHRY 681

Query: 267  GDNDRRGNGERRHRDDDNEKERDRRG--RYKDDSEEEFDRKRDRNGDRRHRVDDRDG--D 100
             D D      R HRD   +K+RD R    ++DD     DRKRDR  DRR    D D   D
Sbjct: 682  DDYDAEPRSSRDHRDKSYDKDRDYRSSRHHRDD-----DRKRDRERDRRGSYRDYDDVRD 736

Query: 99   NEKERDHRRRYKDDSEEDDRKRNRDR 22
            +   RD RR Y DD+  D R   R R
Sbjct: 737  DRDYRDDRRDY-DDNMSDSRAEKRPR 761

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 55/145 (37%), Positives = 70/145 (48%), Gaps = 1/145 (0%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
            R+    D    + K ++    Y+DD + E DR RDR  DR       D D EK+RD R  
Sbjct: 616  RETASEDGSTTSRKRKEPHRDYRDDRDREKDRDRDRERDR-------DRDREKDRDHRDR 668

Query: 261  NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 82
            +  R    R HR DD + E  R  R  D  ++ +D+ RD    R HR DDR  D  +ERD
Sbjct: 669  DRDRDRRSRHHRYDDYDAE-PRSSR--DHRDKSYDKDRDYRSSRHHRDDDRKRD--RERD 723

Query: 81   HRRRYKD-DSEEDDRKRNRDRRYRD 10
             R  Y+D D   DDR    DRR  D
Sbjct: 724  RRGSYRDYDDVRDDRDYRDDRRDYD 748

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 42/120 (35%), Positives = 53/120 (44%)
 Frame = -1

Query: 366 SEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGR 187
           SE+     R R    R   DDRD + +++RDR  D DR           D EK+RD R R
Sbjct: 620 SEDGSTTSRKRKEPHRDYRDDRDREKDRDRDRERDRDR-----------DREKDRDHRDR 668

Query: 186 YKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
                    DR RDR   R HR DD D +    RDHR          D+  ++DR YR +
Sbjct: 669 ---------DRDRDRRS-RHHRYDDYDAEPRSSRDHR----------DKSYDKDRDYRSS 708

[32][TOP]
>UniRef100_UPI00016E5BAB UPI00016E5BAB related cluster n=1 Tax=Takifugu rubripes
            RepID=UPI00016E5BAB
          Length = 2174

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 60/148 (40%), Positives = 81/148 (54%), Gaps = 4/148 (2%)
 Frame = -1

Query: 453  WKRNRDRRY-RDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 283
            W RN+ +R+ RDRD   EKER+R R R + D + +  R RDR  +R R R   R+    K
Sbjct: 2025 WDRNQVKRWSRDRDRSKEKERERERSRERRDHDRDRGRNRDREREREREREKRRERSRSK 2084

Query: 282  ERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
            ERDR  D DR R  G+ R RD D +++RDR      D E + DR RDR+ DR     DR+
Sbjct: 2085 ERDRDRDRDRDRDRGKDRGRDRDRDRDRDRERDRDRDRERDRDRDRDRDRDR-----DRE 2139

Query: 105  GDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             D E++R    R K+  EE   K +  +
Sbjct: 2140 KDKERDRRDGSRSKEKREEKKDKHSTSK 2167

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 56/148 (37%), Positives = 77/148 (52%), Gaps = 9/148 (6%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDN 259
            + R R+  +D  +ERDR           +DR + +   R     DRD   EKER+R    
Sbjct: 2000 EERTREASEDRRRERDREAH---SGRPPWDRNQVKRWSR-----DRDRSKEKERERERSR 2051

Query: 258  DRRGNGERRHRDDDNEKERDR-------RGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRD 106
            +RR +   R R+ D E+ER+R       R R K+ D + + DR RDR  DR R R  DRD
Sbjct: 2052 ERRDHDRDRGRNRDREREREREREKRRERSRSKERDRDRDRDRDRDRGKDRGRDRDRDRD 2111

Query: 105  GDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             D E++RD R R +D   + DR R+RDR
Sbjct: 2112 RDRERDRD-RDRERDRDRDRDRDRDRDR 2138

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 51/139 (36%), Positives = 73/139 (52%), Gaps = 1/139 (0%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            +R+ DR R R+RD + E+ER+R  R +    +E DR RDR+ DR     DR  D  ++RD
Sbjct: 2053 RRDHDRDRGRNRDREREREREREKRRERSRSKERDRDRDRDRDR-----DRGKDRGRDRD 2107

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
            R  D D       R RD D ++ERDR      D + + DR RDR  D+    D RDG   
Sbjct: 2108 RDRDRD-------RERDRDRDRERDR------DRDRDRDRDRDREKDKER--DRRDGSRS 2152

Query: 93   KERDHRRRYKDDSEEDDRK 37
            KE+   ++ K  + ++  K
Sbjct: 2153 KEKREEKKDKHSTSKEGEK 2171

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 44/141 (31%), Positives = 66/141 (46%), Gaps = 2/141 (1%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRGRYKDDSEEEFDR-KRDRNGDRRHRVDDRDGDNEKERDRRGD 262
            DR   +R+ + E+ + R GR +  S E F R +  R           +   E   DRR +
Sbjct: 1956 DRLSEERNTEEEQHQSR-GR-RSHSGERFSRFESHREPASAPLQPSEERTREASEDRRRE 2013

Query: 261  NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 82
             DR  +  R   D +  K   R      + E E +R R+R    R R  +RD + E+ER+
Sbjct: 2014 RDREAHSGRPPWDRNQVKRWSRDRDRSKEKERERERSRERRDHDRDRGRNRDRERERERE 2073

Query: 81   -HRRRYKDDSEEDDRKRNRDR 22
              +RR +  S+E DR R+RDR
Sbjct: 2074 REKRRERSRSKERDRDRDRDR 2094

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 37/98 (37%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-RYRDRDDDNEKERDR---RGRYKD---DSEEEFDRKRDRNGDR-RHR 313
            +R+   +R R R + RDRD D +++RDR   RGR +D   D + E DR RDR  DR R R
Sbjct: 2071 EREREKRRERSRSKERDRDRDRDRDRDRGKDRGRDRDRDRDRDRERDRDRDRERDRDRDR 2130

Query: 312  VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERD 199
              DRD D EK+++R   +  R   +R  + D +   ++
Sbjct: 2131 DRDRDRDREKDKERDRRDGSRSKEKREEKKDKHSTSKE 2168

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 51/165 (30%), Positives = 71/165 (43%), Gaps = 37/165 (22%)
 Frame = -1

Query: 393  DRRGRYKDDSEEEFDRK--RDRNGDRRHRVDDRDG------DNEKERDRRGDNDRRGNGE 238
            DR    ++  EE+   +  R  +G+R  R +             +ER R    DRR   +
Sbjct: 1956 DRLSEERNTEEEQHQSRGRRSHSGERFSRFESHREPASAPLQPSEERTREASEDRRRERD 2015

Query: 237  R------------------RHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR----- 130
            R                  R RD   EKER+R R R + D + +  R RDR  +R     
Sbjct: 2016 REAHSGRPPWDRNQVKRWSRDRDRSKEKERERERSRERRDHDRDRGRNRDRERERERERE 2075

Query: 129  ----RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
                R R  +RD D +++RD R R KD   + DR R+RDR R RD
Sbjct: 2076 KRRERSRSKERDRDRDRDRD-RDRGKDRGRDRDRDRDRDRERDRD 2119

[33][TOP]
>UniRef100_A7RX62 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7RX62_NEMVE
          Length = 686

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 54/153 (35%), Positives = 87/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDGDNEKERDR 271
           R+ +RR ++     +K++DR    KD  + +  R +DR+ D+    D DRD + ++E+DR
Sbjct: 437 RSSERREKEEKKSRDKDKDRERERKDKKDRDRGRNKDRDRDKERDKDRDRDKERDREKDR 496

Query: 270 RGDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDG 103
             D DR   R   + R R+ D +KERDR        +++ D++RDR+ DR + R  DRD 
Sbjct: 497 ERDKDRDKERDRDKDREREKDRDKERDR--------DKDRDKERDRDKDRDKERDRDRDR 548

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           D +KERD + R++D    D +++ RDR  R  S
Sbjct: 549 DRDKERD-KDRHRDRDRRDRKEKTRDRTSRSPS 580

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 63/160 (39%), Positives = 90/160 (56%), Gaps = 13/160 (8%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKER----DR-RGRYKD-DSEEEFDRKRDRNGDRRHRVD-DRDGD 292
           +   +++ RD+D D E+ER    DR RGR KD D ++E D+ RDR+ +R    D +RD D
Sbjct: 442 REKEEKKSRDKDKDRERERKDKKDRDRGRNKDRDRDKERDKDRDRDKERDREKDRERDKD 501

Query: 291 NEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR----- 130
            +KERDR  D +R  + ++ R RD D +KERDR      D ++E DR RDR+ D+     
Sbjct: 502 RDKERDRDKDREREKDRDKERDRDKDRDKERDR----DKDRDKERDRDRDRDRDKERDKD 557

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           RHR  DRD  + KE+   R  +  SE   R     +R +D
Sbjct: 558 RHR--DRDRRDRKEKTRDRTSRSPSESPKRSSRHHKRKKD 595

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 58/158 (36%), Positives = 87/158 (55%), Gaps = 3/158 (1%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDR 301
           R I+   + K + D     R  +  ++ +++ R KD D E E   K+DR+   R R  DR
Sbjct: 421 RKIKEDSVTKSDEDE---GRSSERREKEEKKSRDKDKDRERERKDKKDRD---RGRNKDR 474

Query: 300 DGDNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
           D D E+++DR  D +R R     R +D D E++RD+    + D ++E DR +DR+ +R  
Sbjct: 475 DRDKERDKDRDRDKERDREKDRERDKDRDKERDRDKDREREKDRDKERDRDKDRDKER-- 532

Query: 123 RVDDRDGDNEKERDH-RRRYKDDSEEDDRKRNRDRRYR 13
              DRD D +KERD  R R +D   + DR R+RDRR R
Sbjct: 533 ---DRDKDRDKERDRDRDRDRDKERDKDRHRDRDRRDR 567

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 57/158 (36%), Positives = 85/158 (53%), Gaps = 10/158 (6%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEK 283
           K++RDR R +DRD D E+++DR      D ++E DR++DR  D+   + R  D+D + EK
Sbjct: 463 KKDRDRGRNKDRDRDKERDKDR------DRDKERDREKDRERDKDRDKERDRDKDREREK 516

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN-GDRRHRVDDRD 106
           +RD+  D D+  + E R RD D +KERDR      D E + DR RDR+  DR+ +  DR 
Sbjct: 517 DRDKERDRDKDRDKE-RDRDKDRDKERDRDRDRDRDKERDKDRHRDRDRRDRKEKTRDRT 575

Query: 105 GDNEKERD-----HRRRYKDDSEEDDRKRNRDRRYRDT 7
             +  E       H +R KD   ++     R   Y D+
Sbjct: 576 SRSPSESPKRSSRHHKRKKDKKSKEKESTRRASDYEDS 613

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 52/134 (38%), Positives = 80/134 (59%), Gaps = 9/134 (6%)
 Frame = -1

Query: 396 RDRRGRYKDDSEEEFDRKRDRNGDRRHRVD--DRDGDNEKERDRRGDNDR-RGNGERRHR 226
           R    + K+DS  + D    R+ +RR + +   RD D ++ER+R+   DR RG  + R R
Sbjct: 417 RSPERKIKEDSVTKSDEDEGRSSERREKEEKKSRDKDKDRERERKDKKDRDRGRNKDRDR 476

Query: 225 DDDNEKERDR---RGRYKD-DSEEEFDRKRDRNGDRRHRVD-DRDGDNEKERDHRR-RYK 64
           D + +K+RDR   R R KD + +++ D++RDR+ DR    D D++ D +K+RD  R R K
Sbjct: 477 DKERDKDRDRDKERDREKDRERDKDRDKERDRDKDREREKDRDKERDRDKDRDKERDRDK 536

Query: 63  DDSEEDDRKRNRDR 22
           D  +E DR R+RDR
Sbjct: 537 DRDKERDRDRDRDR 550

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 57/156 (36%), Positives = 88/156 (56%), Gaps = 8/156 (5%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR---RGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
           R+RD+  RDR+ D E+++DR   R R KD + E++ D++RDR+ D R +  DRD D +KE
Sbjct: 484 RDRDKE-RDREKDRERDKDRDKERDRDKDREREKDRDKERDRDKD-RDKERDRDKDRDKE 541

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           RDR  D DR      + RD D  ++RDRR R K+ + +   R    +  R  R   R  D
Sbjct: 542 RDRDRDRDR-----DKERDKDRHRDRDRRDR-KEKTRDRTSRSPSESPKRSSRHHKRKKD 595

Query: 99  NE-KERDHRRRYKDDSEEDDRKRN---RDRRYRDTS 4
            + KE++  RR  D  + D  K +   ++++ RD+S
Sbjct: 596 KKSKEKESTRRASDYEDSDIGKMSDTEQEKKARDSS 631

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 51/169 (30%), Positives = 82/169 (48%), Gaps = 23/169 (13%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDR-------RGRYKD-DSEEEFDRKRDRNGDR---RHRVDD 304
            +R+RD+  R+R+ D +KERDR       R R KD D E + DR RDR+ +R   RHR  D
Sbjct: 505  ERDRDKD-REREKDRDKERDRDKDRDKERDRDKDRDKERDRDRDRDRDKERDKDRHRDRD 563

Query: 303  RDGDNEKERDRR----GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
            R    EK RDR      ++ +R +   + + D   KE++   R  D  + +  +  D   
Sbjct: 564  RRDRKEKTRDRTSRSPSESPKRSSRHHKRKKDKKSKEKESTRRASDYEDSDIGKMSDTEQ 623

Query: 135  DRRHRVDDRDGDNEKERDHRRRYK--------DDSEEDDRKRNRDRRYR 13
            +++ R    D  +E ER  +++            SEE+  K+ + R Y+
Sbjct: 624  EKKARDSSHDSGSEYERKKKKKKNRSESQERASASEEETPKKKKKRSYK 672

[34][TOP]
>UniRef100_UPI00004EC28D RIKEN cDNA 3110050K21 n=1 Tax=Mus musculus RepID=UPI00004EC28D
          Length = 1729

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 57/147 (38%), Positives = 90/147 (61%), Gaps = 8/147 (5%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERDR 271
            RD R RDRD D E+ER+R    + + E+E +R+ +R   R   R R  +R+ + E+ERD+
Sbjct: 733  RDDRVRDRDRDREREREREREREREREKERERELERERAREREREREKERERERERERDQ 792

Query: 270  RG-DNDRRGNGER-RHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDG 103
            R  D+DR    ER R R+ + E+ER+ R R ++ + E E +R+R+R  +R R R  +R  
Sbjct: 793  RDRDHDREREREREREREKEREREREERERERERERERERERERERERERERERERERAR 852

Query: 102  DNEKERDHRRRYKD-DSEEDDRKRNRD 25
            + EKER+ +R ++D D   DDR+  R+
Sbjct: 853  EREKERERQREWEDKDKGRDDRREKRE 879

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 11/150 (7%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRG----RYKDDSEE-EFDRKR-----DRNGDRRH-RVDDRDGD 292
            +RR+ +RD  + +ERD+R     R++  SEE E D +R     DR  +RR  RV DRD D
Sbjct: 684  ERRHGERDRRDNRERDQRPSSPIRHQGRSEELERDERREERRIDRVDERRDDRVRDRDRD 743

Query: 291  NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
             E+ER+R  + +R      R ++ + E ER+R    + + E+E +R+R+R  D+R R  D
Sbjct: 744  RERERERERERER-----EREKERERELERERAREREREREKERERERERERDQRDRDHD 798

Query: 111  RDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            R+ + E+ER+  +  + + EE +R+R R+R
Sbjct: 799  REREREREREREKEREREREERERERERER 828

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 49/157 (31%), Positives = 90/157 (57%), Gaps = 4/157 (2%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDRRHRVD 307
            R ++R+   +R R+R  ++R+ + E+ERD+R R  D   + E E +R+++R  +R  R  
Sbjct: 764  RELERERARERERERE-KERERERERERDQRDRDHDREREREREREREKEREREREERER 822

Query: 306  DRDGDNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
            +R+ + E+ER+R  + +R    ER R R  + EKER+R+  ++D  +   DR R++  D 
Sbjct: 823  ERERERERERERERERERERERERERERAREREKERERQREWEDKDKGRDDR-REKREDI 881

Query: 129  RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
              R D    D+ +ER  ++RY+++     R+  + RR
Sbjct: 882  HVREDRIPRDSHEERKSKKRYRNEGSPSPRQSPKRRR 918

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 50/151 (33%), Positives = 88/151 (58%), Gaps = 4/151 (2%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKE 280
            +  R  R  +R DD  ++RDR    + + E E +R+R++  +R   R R  +R+ + EKE
Sbjct: 722  EERRIDRVDERRDDRVRDRDRDREREREREREREREREKERERELERERAREREREREKE 781

Query: 279  RDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
            R+R  + +R    ++R RD D E+ER+R R R K+   E  +R+R+R  + R R  +R+ 
Sbjct: 782  RERERERER----DQRDRDHDREREREREREREKEREREREERERERERE-RERERERER 836

Query: 102  DNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            + E+ER+ R R ++ + E +++R R R + D
Sbjct: 837  ERERERE-RERERERAREREKERERQREWED 866

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 50/143 (34%), Positives = 85/143 (59%), Gaps = 6/143 (4%)
 Frame = -1

Query: 432  RYRDRDDDNEKERDRRGRYKDDSEEEFD-RKRDRNGDR---RHRVDDRDGDNEKERDRRG 265
            R++ R ++ E++  R  R  D  +E  D R RDR+ DR   R R  +R+ + EKER+R  
Sbjct: 707  RHQGRSEELERDERREERRIDRVDERRDDRVRDRDRDREREREREREREREREKEREREL 766

Query: 264  DNDRRGNGER-RHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
            + +R    ER R ++ + E+ER+R  R +D D E E +R+R+R  +R    ++R+ + E+
Sbjct: 767  ERERAREREREREKERERERERERDQRDRDHDREREREREREREKEREREREERERERER 826

Query: 90   ERDHRRRYKDDSEEDDRKRNRDR 22
            ER+ R R ++   E +R+R R+R
Sbjct: 827  ERE-RERERERERERERERERER 848

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 47/145 (32%), Positives = 71/145 (48%), Gaps = 15/145 (10%)
 Frame = -1

Query: 411  DNEKERDRRGRYKDDSEEEFDRKRDRNGDR----------RH--RVDDRDGDNEKERDRR 268
            D   ERD R   +D S E    +RDR  +R          RH  R ++ + D  +E  R 
Sbjct: 667  DRYPERDTRDPARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRSEELERDERREERRI 726

Query: 267  GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDN 97
               D R +   R RD D E+ER+R    + + E+E +R+ +R   R   R R  +R+ + 
Sbjct: 727  DRVDERRDDRVRDRDRDREREREREREREREREKERERELERERAREREREREKERERER 786

Query: 96   EKERDHRRRYKDDSEEDDRKRNRDR 22
            E+ERD R R  D   E +R+R R++
Sbjct: 787  ERERDQRDRDHDREREREREREREK 811

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 47/138 (34%), Positives = 70/138 (50%), Gaps = 12/138 (8%)
 Frame = -1

Query: 387  RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRR--GNGERRHRDDDN 214
            R RY +   +  D  RD + +RRH   +RD  + +ERD+R  +  R  G  E   RD+  
Sbjct: 666  RDRYPE--RDTRDPARDSSFERRH--GERDRRDNRERDQRPSSPIRHQGRSEELERDERR 721

Query: 213  EKER-DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD---------HRRRYK 64
            E+ R DR    +DD   + DR R+R    R R  +R+ + EKER+          R R +
Sbjct: 722  EERRIDRVDERRDDRVRDRDRDRERE---REREREREREREKERERELERERARERERER 778

Query: 63   DDSEEDDRKRNRDRRYRD 10
            +   E +R+R RD+R RD
Sbjct: 779  EKERERERERERDQRDRD 796

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 51/185 (27%), Positives = 89/185 (48%), Gaps = 32/185 (17%)
 Frame = -1

Query: 468  QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
            +R+   +R R+R  R+R+ + E+ER+R    + + E E +R+R+R    R R  +R+   
Sbjct: 806  EREREKEREREREERERERERERERERERERERERERERERERER---AREREKERERQR 862

Query: 288  EKERDRRGDNDRRGNGERRH-RDD----DNEKERDRRGRYKDDS----EEEFDRKRDR-- 142
            E E   +G +DRR   E  H R+D    D+ +ER  + RY+++      +   R+R+   
Sbjct: 863  EWEDKDKGRDDRREKREDIHVREDRIPRDSHEERKSKKRYRNEGSPSPRQSPKRRREHSP 922

Query: 141  NGDRRHRVDDRDGDNEKER---------------------DHRRRYKDDSEEDDRKRNRD 25
            + D  H  DD+   NEK R                     D + R+K++  + +RK +  
Sbjct: 923  DSDTYHSGDDK---NEKHRLLSQVVRPQESRSLSPSHLTEDRQGRWKEEDRKSERKES-S 978

Query: 24   RRYRD 10
            RRY +
Sbjct: 979  RRYEE 983

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 42/114 (36%), Positives = 58/114 (50%), Gaps = 6/114 (5%)
 Frame = -1

Query: 345 KRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEE 166
           +RDR  +R  R   RD   E+   R G+ DRR N ER  R     + + R    + D   
Sbjct: 665 ERDRYPERDTRDPARDSSFER---RHGERDRRDNRERDQRPSSPIRHQGRSEELERDERR 721

Query: 165 EFDRKRDRNGDRRH-RVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           E +R+ DR  +RR  RV DRD D E+ER+      R R K+   E +R+R R+R
Sbjct: 722 E-ERRIDRVDERRDDRVRDRDRDREREREREREREREREKERERELERERARER 774

[35][TOP]
>UniRef100_B9EHN9 Zinc finger CCCH type containing 13 n=1 Tax=Mus musculus
            RepID=B9EHN9_MOUSE
          Length = 1730

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 57/147 (38%), Positives = 90/147 (61%), Gaps = 8/147 (5%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERDR 271
            RD R RDRD D E+ER+R    + + E+E +R+ +R   R   R R  +R+ + E+ERD+
Sbjct: 733  RDDRVRDRDRDREREREREREREREREKERERELERERAREREREREKERERERERERDQ 792

Query: 270  RG-DNDRRGNGER-RHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDG 103
            R  D+DR    ER R R+ + E+ER+ R R ++ + E E +R+R+R  +R R R  +R  
Sbjct: 793  RDRDHDREREREREREREKEREREREERERERERERERERERERERERERERERERERAR 852

Query: 102  DNEKERDHRRRYKD-DSEEDDRKRNRD 25
            + EKER+ +R ++D D   DDR+  R+
Sbjct: 853  EREKERERQREWEDKDKGRDDRREKRE 879

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 11/150 (7%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRG----RYKDDSEE-EFDRKR-----DRNGDRRH-RVDDRDGD 292
            +RR+ +RD  + +ERD+R     R++  SEE E D +R     DR  +RR  RV DRD D
Sbjct: 684  ERRHGERDRRDNRERDQRPSSPIRHQGRSEELERDERREERRIDRVDERRDDRVRDRDRD 743

Query: 291  NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
             E+ER+R  + +R      R ++ + E ER+R    + + E+E +R+R+R  D+R R  D
Sbjct: 744  RERERERERERER-----EREKERERELERERAREREREREKERERERERERDQRDRDHD 798

Query: 111  RDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            R+ + E+ER+  +  + + EE +R+R R+R
Sbjct: 799  REREREREREREKEREREREERERERERER 828

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 49/157 (31%), Positives = 90/157 (57%), Gaps = 4/157 (2%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDRRHRVD 307
            R ++R+   +R R+R  ++R+ + E+ERD+R R  D   + E E +R+++R  +R  R  
Sbjct: 764  RELERERARERERERE-KERERERERERDQRDRDHDREREREREREREKEREREREERER 822

Query: 306  DRDGDNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
            +R+ + E+ER+R  + +R    ER R R  + EKER+R+  ++D  +   DR R++  D 
Sbjct: 823  ERERERERERERERERERERERERERERAREREKERERQREWEDKDKGRDDR-REKREDI 881

Query: 129  RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
              R D    D+ +ER  ++RY+++     R+  + RR
Sbjct: 882  HVREDRIPRDSHEERKSKKRYRNEGSPSPRQSPKRRR 918

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 50/151 (33%), Positives = 88/151 (58%), Gaps = 4/151 (2%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKE 280
            +  R  R  +R DD  ++RDR    + + E E +R+R++  +R   R R  +R+ + EKE
Sbjct: 722  EERRIDRVDERRDDRVRDRDRDREREREREREREREREKERERELERERAREREREREKE 781

Query: 279  RDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
            R+R  + +R    ++R RD D E+ER+R R R K+   E  +R+R+R  + R R  +R+ 
Sbjct: 782  RERERERER----DQRDRDHDREREREREREREKEREREREERERERERE-RERERERER 836

Query: 102  DNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            + E+ER+ R R ++ + E +++R R R + D
Sbjct: 837  ERERERE-RERERERAREREKERERQREWED 866

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 50/143 (34%), Positives = 85/143 (59%), Gaps = 6/143 (4%)
 Frame = -1

Query: 432  RYRDRDDDNEKERDRRGRYKDDSEEEFD-RKRDRNGDR---RHRVDDRDGDNEKERDRRG 265
            R++ R ++ E++  R  R  D  +E  D R RDR+ DR   R R  +R+ + EKER+R  
Sbjct: 707  RHQGRSEELERDERREERRIDRVDERRDDRVRDRDRDREREREREREREREREKEREREL 766

Query: 264  DNDRRGNGER-RHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
            + +R    ER R ++ + E+ER+R  R +D D E E +R+R+R  +R    ++R+ + E+
Sbjct: 767  ERERAREREREREKERERERERERDQRDRDHDREREREREREREKEREREREERERERER 826

Query: 90   ERDHRRRYKDDSEEDDRKRNRDR 22
            ER+ R R ++   E +R+R R+R
Sbjct: 827  ERE-RERERERERERERERERER 848

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 47/145 (32%), Positives = 71/145 (48%), Gaps = 15/145 (10%)
 Frame = -1

Query: 411  DNEKERDRRGRYKDDSEEEFDRKRDRNGDR----------RH--RVDDRDGDNEKERDRR 268
            D   ERD R   +D S E    +RDR  +R          RH  R ++ + D  +E  R 
Sbjct: 667  DRYPERDTRDPARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRSEELERDERREERRI 726

Query: 267  GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDN 97
               D R +   R RD D E+ER+R    + + E+E +R+ +R   R   R R  +R+ + 
Sbjct: 727  DRVDERRDDRVRDRDRDREREREREREREREREKERERELERERAREREREREKERERER 786

Query: 96   EKERDHRRRYKDDSEEDDRKRNRDR 22
            E+ERD R R  D   E +R+R R++
Sbjct: 787  ERERDQRDRDHDREREREREREREK 811

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 47/138 (34%), Positives = 70/138 (50%), Gaps = 12/138 (8%)
 Frame = -1

Query: 387  RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRR--GNGERRHRDDDN 214
            R RY +   +  D  RD + +RRH   +RD  + +ERD+R  +  R  G  E   RD+  
Sbjct: 666  RDRYPE--RDTRDPARDSSFERRH--GERDRRDNRERDQRPSSPIRHQGRSEELERDERR 721

Query: 213  EKER-DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD---------HRRRYK 64
            E+ R DR    +DD   + DR R+R    R R  +R+ + EKER+          R R +
Sbjct: 722  EERRIDRVDERRDDRVRDRDRDRERE---REREREREREREKERERELERERARERERER 778

Query: 63   DDSEEDDRKRNRDRRYRD 10
            +   E +R+R RD+R RD
Sbjct: 779  EKERERERERERDQRDRD 796

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 51/185 (27%), Positives = 89/185 (48%), Gaps = 32/185 (17%)
 Frame = -1

Query: 468  QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
            +R+   +R R+R  R+R+ + E+ER+R    + + E E +R+R+R    R R  +R+   
Sbjct: 806  EREREKEREREREERERERERERERERERERERERERERERERER---AREREKERERQR 862

Query: 288  EKERDRRGDNDRRGNGERRH-RDD----DNEKERDRRGRYKDDS----EEEFDRKRDR-- 142
            E E   +G +DRR   E  H R+D    D+ +ER  + RY+++      +   R+R+   
Sbjct: 863  EWEDKDKGRDDRREKREDIHVREDRIPRDSHEERKSKKRYRNEGSPSPRQSPKRRREHSP 922

Query: 141  NGDRRHRVDDRDGDNEKER---------------------DHRRRYKDDSEEDDRKRNRD 25
            + D  H  DD+   NEK R                     D + R+K++  + +RK +  
Sbjct: 923  DSDTYHSGDDK---NEKHRLLSQVVRPQESRSLSPSHLTEDRQGRWKEEDRKSERKES-S 978

Query: 24   RRYRD 10
            RRY +
Sbjct: 979  RRYEE 983

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 42/114 (36%), Positives = 58/114 (50%), Gaps = 6/114 (5%)
 Frame = -1

Query: 345 KRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEE 166
           +RDR  +R  R   RD   E+   R G+ DRR N ER  R     + + R    + D   
Sbjct: 665 ERDRYPERDTRDPARDSSFER---RHGERDRRDNRERDQRPSSPIRHQGRSEELERDERR 721

Query: 165 EFDRKRDRNGDRRH-RVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           E +R+ DR  +RR  RV DRD D E+ER+      R R K+   E +R+R R+R
Sbjct: 722 E-ERRIDRVDERRDDRVRDRDRDREREREREREREREREKERERELERERARER 774

[36][TOP]
>UniRef100_C1EIV9 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EIV9_9CHLO
          Length = 554

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 61/153 (39%), Positives = 83/153 (54%), Gaps = 10/153 (6%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERDR 271
           R+RR RDRD D E++RDRR     D ++E DR R R+ DR   R R  DRD    + R R
Sbjct: 15  RERRERDRDRDRERDRDRRRDRSRDGDKERDRSRSRDRDRGRDRDRGRDRDRRESRSRSR 74

Query: 270 RGDNDR-----RGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDD 112
                R     RG G+R R RD D +++RDR      D + + DR RDR+ DR R R  D
Sbjct: 75  SRSRSRSRRRDRGRGDRDRDRDRDRDRDRDR------DRDRDRDRDRDRDRDRDRDRDRD 128

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
           RD D +++RD   R +   +  +R+  R+R  R
Sbjct: 129 RDRDRDRDRDREPRARKPPDFSNRRPLRNRGAR 161

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 56/149 (37%), Positives = 77/149 (51%), Gaps = 3/149 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD---RRHRVDDRDGDNEKE 280
           + + +R  R+RD D ++ERDR            DR+RDR+ D    R R   RD D  ++
Sbjct: 10  REDAERERRERDRDRDRERDR------------DRRRDRSRDGDKERDRSRSRDRDRGRD 57

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           RDR  D DRR +  R      +   R  RGR   D + + DR RDR+ DR     DRD D
Sbjct: 58  RDRGRDRDRRESRSRSRSRSRSRSRRRDRGRGDRDRDRDRDRDRDRDRDRDR---DRDRD 114

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
            +++RD R R +D   + DR R+RDR  R
Sbjct: 115 RDRDRD-RDRDRDRDRDRDRDRDRDREPR 142

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 59/159 (37%), Positives = 82/159 (51%), Gaps = 6/159 (3%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVD 307
           R+ + +   +R R  R RDRD +  ++RDRR     D ++E DR R R+ DR   R R  
Sbjct: 5   RLAKEREDAERERRERDRDRDRE--RDRDRRRDRSRDGDKERDRSRSRDRDRGRDRDRGR 62

Query: 306 DRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGD 133
           DRD    + R R     R    +R   D D +++RDR R R +D D + + DR RDR+ D
Sbjct: 63  DRDRRESRSRSRSRSRSRSRRRDRGRGDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRD 122

Query: 132 R-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           R R R  DRD D +++R+ R R   D       RNR  R
Sbjct: 123 RDRDRDRDRDRDRDRDREPRARKPPDFSNRRPLRNRGAR 161

[37][TOP]
>UniRef100_A2ELT7 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3
           RepID=A2ELT7_TRIVA
          Length = 545

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 54/159 (33%), Positives = 95/159 (59%), Gaps = 13/159 (8%)
 Frame = -1

Query: 447 RNRDRRYRDRD--DDNEKERDRRGRYKDDSEEEFDRK----RDRNGDRRHRVDD-RDGDN 289
           R+ DR+ RD D  D ++K+RD   + +D+ +++ DRK    + R+ DR+ R +D ++ DN
Sbjct: 289 RDEDRKERDNDRKDRDDKKRDNDHKERDNEKKDDDRKDRDDKKRDNDRKERDNDHKERDN 348

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK----RDRNGDRRHR 121
           EK+ D R D D +     R + D++ KERD   + +DD + + DRK    + R+ D + R
Sbjct: 349 EKKDDDRKDRDDKKRDNDRKKRDNDHKERDNDRKDRDDKKRDNDRKERDDKKRDNDHKER 408

Query: 120 VDDRDGDNEKERDHRRR-YKDDSEEDDRKRNRDRR-YRD 10
            D++  D+ K+RD +++  K   +  DRK N+D++ +RD
Sbjct: 409 DDEKKDDDHKDRDDKKKDEKPQGDRKDRKGNKDKKQHRD 447

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 56/153 (36%), Positives = 92/153 (60%), Gaps = 8/153 (5%)
 Frame = -1

Query: 444 NRDRR-YRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD-R 271
           N DR+ + DRD+ N  E DR+ R  D  + + D+KRD   D + R +++  D+ K+RD +
Sbjct: 275 NHDRKDHHDRDNKNRDE-DRKERDNDRKDRD-DKKRDN--DHKERDNEKKDDDRKDRDDK 330

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK------RDRNGDRRHRVDDR 109
           + DNDR+   +  H++ DNEK+ D R + +DD + + DRK      ++R+ DR+ R D +
Sbjct: 331 KRDNDRKER-DNDHKERDNEKKDDDR-KDRDDKKRDNDRKKRDNDHKERDNDRKDRDDKK 388

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             ++ KERD ++R  D  E DD K++ D + RD
Sbjct: 389 RDNDRKERDDKKRDNDHKERDDEKKDDDHKDRD 421

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 46/142 (32%), Positives = 86/142 (60%), Gaps = 6/142 (4%)
 Frame = -1

Query: 417 DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGE 238
           D  +++  DR+  +  D++   + +++R+ DR+ R D +  ++ KERD    +D R + +
Sbjct: 269 DHHHDENHDRKDHHDRDNKNRDEDRKERDNDRKDRDDKKRDNDHKERDNEKKDDDRKDRD 328

Query: 237 RRHRDDDNEKERDRRGRYKDDSEEEFDRK----RDRNGDRRHRVDD-RDGDNE-KERDHR 76
            + RD+D  KERD   + +D+ +++ DRK    + R+ DR+ R +D ++ DN+ K+RD +
Sbjct: 329 DKKRDND-RKERDNDHKERDNEKKDDDRKDRDDKKRDNDRKKRDNDHKERDNDRKDRDDK 387

Query: 75  RRYKDDSEEDDRKRNRDRRYRD 10
           +R  D  E DD+KR+ D + RD
Sbjct: 388 KRDNDRKERDDKKRDNDHKERD 409

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 56/164 (34%), Positives = 92/164 (56%), Gaps = 16/164 (9%)
 Frame = -1

Query: 450 KRNRDRRYRDRDD---DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
           +++RD + RD D    DNEK+ D R + +DD + + DRK +R+ D + R +++  D+ K+
Sbjct: 300 RKDRDDKKRDNDHKERDNEKKDDDR-KDRDDKKRDNDRK-ERDNDHKERDNEKKDDDRKD 357

Query: 279 RD-RRGDNDRRG--------NGERRHRDD---DNE-KERDRRGRYKDDSEEEFDRKRDRN 139
           RD ++ DNDR+         + +R+ RDD   DN+ KERD + R  D  E + D K+D  
Sbjct: 358 RDDKKRDNDRKKRDNDHKERDNDRKDRDDKKRDNDRKERDDKKRDNDHKERD-DEKKD-- 414

Query: 138 GDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
            D + R DD+  D + + D     KD     D+K++RD +  +T
Sbjct: 415 DDHKDR-DDKKKDEKPQGDR----KDRKGNKDKKQHRDEKKTET 453

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 45/147 (30%), Positives = 85/147 (57%), Gaps = 11/147 (7%)
 Frame = -1

Query: 450 KRNRDRRYRD--RDDDNEKERDRRGRYKDDSEEEFDRK----RDRNGDRRHRVDD---RD 298
           K++ DR+ RD  + D++ KERD   + +D+ +++ DRK    + R+ DR+ R +D   RD
Sbjct: 319 KKDDDRKDRDDKKRDNDRKERDNDHKERDNEKKDDDRKDRDDKKRDNDRKKRDNDHKERD 378

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR--NGDRRH 124
            D +   D++ DNDR+   +++  +D  E++ +++    DD ++  D+K+D    GDR+ 
Sbjct: 379 NDRKDRDDKKRDNDRKERDDKKRDNDHKERDDEKK---DDDHKDRDDKKKDEKPQGDRK- 434

Query: 123 RVDDRDGDNEKERDHRRRYKDDSEEDD 43
              DR G+ +K + HR   K +++  D
Sbjct: 435 ---DRKGNKDK-KQHRDEKKTETKPSD 457

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 38/140 (27%), Positives = 68/140 (48%), Gaps = 7/140 (5%)
 Frame = -1

Query: 408 NEKERDRRGRYKDDSEE---EFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR----R 250
           NE E+    R + D      +FD K++R  DR H      G          DN      +
Sbjct: 205 NETEKPNFPRNETDKPALIGKFDGKKERK-DRPH---PHPGHMNLRFHVADDNSSVKFSQ 260

Query: 249 GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRR 70
              E+   D  +++  DR+  +  D++   + +++R+ DR+ R D +  ++ KERD+ ++
Sbjct: 261 VAAEKEIPDHHHDENHDRKDHHDRDNKNRDEDRKERDNDRKDRDDKKRDNDHKERDNEKK 320

Query: 69  YKDDSEEDDRKRNRDRRYRD 10
             D  + DD+KR+ DR+ RD
Sbjct: 321 DDDRKDRDDKKRDNDRKERD 340

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 34/116 (29%), Positives = 59/116 (50%), Gaps = 12/116 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRK----RDRNGDRRHRVDDRDGDNEKE 280
           + RD   + RD+D+ KERD   + +DD + + DRK    + R+ D + R D++  D+ K+
Sbjct: 361 KKRDNDRKKRDNDH-KERDNDRKDRDDKKRDNDRKERDDKKRDNDHKERDDEKKDDDHKD 419

Query: 279 RDRR-------GD-NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
           RD +       GD  DR+GN +++   D+ + E          SEE+      ++G
Sbjct: 420 RDDKKKDEKPQGDRKDRKGNKDKKQHRDEKKTETKPSDSSNTGSEEKGSTANSKSG 475

[38][TOP]
>UniRef100_Q2KG93 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea 70-15
            RepID=Q2KG93_MAGGR
          Length = 1066

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 57/148 (38%), Positives = 80/148 (54%), Gaps = 7/148 (4%)
 Frame = -1

Query: 435  RRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDND 256
            R  R R+ +  ++RDRR   + D E + DR RDR         DR+GD+E+ R RR + D
Sbjct: 936  REMRLREYEKARDRDRRRDDEKDRERDRDRDRDR---------DREGDDERRRTRRREKD 986

Query: 255  RRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH- 79
                      +D +++E DR+ R +D  +   DR+RDR+ DRR R  DRD D  ++RD  
Sbjct: 987  ----------EDSDDREPDRKDRTRDRDD---DRERDRDRDRRERDRDRDRDRNRDRDRD 1033

Query: 78   ------RRRYKDDSEEDDRKRNRDRRYR 13
                   RR+ DD EEDDR  +R RR R
Sbjct: 1034 DERRRPSRRHSDDDEEDDRSGHRSRRER 1061

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 46/114 (40%), Positives = 60/114 (52%), Gaps = 1/114 (0%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            +R+RDR R RDR+ D+E+ R RR    +DS+       DR  DR+ R  DRD D E++RD
Sbjct: 960  ERDRDRDRDRDREGDDERRRTRRREKDEDSD-------DREPDRKDRTRDRDDDRERDRD 1012

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            R      R     R+RD D + ER R  R   D +EE DR   R+   R   DD
Sbjct: 1013 RDRRERDRDRDRDRNRDRDRDDERRRPSRRHSDDDEEDDRSGHRSRRERPANDD 1066

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 9/85 (10%)
 Frame = -1

Query: 237  RRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---------RHRVDDRDGDNEKER 85
            R  R  + EK RDR  R  D+ + E DR RDR+ DR         R R  D D D ++E 
Sbjct: 936  REMRLREYEKARDRDRRRDDEKDRERDRDRDRDRDREGDDERRRTRRREKDEDSD-DREP 994

Query: 84   DHRRRYKDDSEEDDRKRNRDRRYRD 10
            D + R +D  ++ +R R+RDRR RD
Sbjct: 995  DRKDRTRDRDDDRERDRDRDRRERD 1019

[39][TOP]
>UniRef100_B0DMQ1 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82
           RepID=B0DMQ1_LACBS
          Length = 680

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 68/165 (41%), Positives = 89/165 (53%), Gaps = 18/165 (10%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD---NEKE 280
           ++ R+ RYRD + D EKER+ R R   +S  E DR+R+R  D R R  DRD D   +E++
Sbjct: 412 RKEREARYRD-EYDREKEREYRSRRGYESGRERDRERERGYDGRERDKDRDMDRGYDERD 470

Query: 279 RDRRGDN-DRRGN---------GERRHRDDDNEKER--DRRGRYKDDSEEEFDRKRDRNG 136
           R+RR D  D RG+         G R  RD D ++ER  DR      D E E DR RDR  
Sbjct: 471 RERRYDERDMRGHDGRERDKYRGYRSDRDRDRDRERDKDRERERPRDPERERDRDRDREK 530

Query: 135 DR---RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            R   + R  DRD D E+ER+   + +D   E DR R R+ R RD
Sbjct: 531 GRDRDKDRGRDRDRDREREREWPEKERD--RERDRDRGREDRDRD 573

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 58/159 (36%), Positives = 87/159 (54%), Gaps = 10/159 (6%)
 Frame = -1

Query: 450 KRNRDRRYRDRD--DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD---DRDGDNE 286
           +R+R+RRY +RD    + +ERD+   Y+ D + + DR+RD++ +R    D   +RD D +
Sbjct: 468 ERDRERRYDERDMRGHDGRERDKYRGYRSDRDRDRDRERDKDRERERPRDPERERDRDRD 527

Query: 285 KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
           +E+ R  D DR      R RD D E+ER+       + E + +R RDR  + R R   RD
Sbjct: 528 REKGRDRDKDR-----GRDRDRDRERERE-----WPEKERDRERDRDRGREDRDRDKGRD 577

Query: 105 GDNEKERDHRRRYKDD--SEEDDRKRNRDR---RYRDTS 4
            + ++ERD  R    D   EE DR++ RDR   RY D S
Sbjct: 578 RNRDRERDKAREGGGDRKREEGDREKERDRERARYDDRS 616

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 41/113 (36%), Positives = 66/113 (58%), Gaps = 4/113 (3%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           +R++DR R R RD + E++RDR      D +++  R RDR+ +R     +++ D E++RD
Sbjct: 505 ERDKDRERERPRDPERERDRDRDREKGRDRDKDRGRDRDRDREREREWPEKERDRERDRD 564

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRG---RYKDDSEEEFDRKRDRNGDRRH 124
           R  ++  R  G  R+RD + +K R+  G   R + D E+E DR+R R  DR H
Sbjct: 565 RGREDRDRDKGRDRNRDRERDKAREGGGDRKREEGDREKERDRERARYDDRSH 617

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 43/108 (39%), Positives = 58/108 (53%), Gaps = 3/108 (2%)
 Frame = -1

Query: 336 RNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFD 157
           R  +R  R  D + D EKER+ R    RRG    R RD + E+  D R R   D + + D
Sbjct: 411 RRKEREARYRD-EYDREKEREYRS---RRGYESGRERDRERERGYDGRER---DKDRDMD 463

Query: 156 RKRDRNGDRRHRVDDRD--GDNEKERDHRRRYKDDSEED-DRKRNRDR 22
           R  D   DR  R D+RD  G + +ERD  R Y+ D + D DR+R++DR
Sbjct: 464 RGYDER-DRERRYDERDMRGHDGRERDKYRGYRSDRDRDRDRERDKDR 510

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 46/145 (31%), Positives = 70/145 (48%), Gaps = 14/145 (9%)
 Frame = -1

Query: 402 KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG-DNDRRGNGERRHR 226
           + ++R  RY+D    E+DR+++R                + R RRG ++ R  + ER   
Sbjct: 411 RRKEREARYRD----EYDREKER----------------EYRSRRGYESGRERDRERERG 450

Query: 225 DDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHR------VDDRDGDNEKERD--- 82
            D  E+++DR   RG  + D E  +D +  R  D R R        DRD D ++ERD   
Sbjct: 451 YDGRERDKDRDMDRGYDERDRERRYDERDMRGHDGRERDKYRGYRSDRDRDRDRERDKDR 510

Query: 81  HRRRYKDDSEEDDRKRNRDR-RYRD 10
            R R +D   E DR R+R++ R RD
Sbjct: 511 ERERPRDPERERDRDRDREKGRDRD 535

[40][TOP]
>UniRef100_A4RC33 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea
            RepID=A4RC33_MAGGR
          Length = 1112

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 57/148 (38%), Positives = 80/148 (54%), Gaps = 7/148 (4%)
 Frame = -1

Query: 435  RRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDND 256
            R  R R+ +  ++RDRR   + D E + DR RDR         DR+GD+E+ R RR + D
Sbjct: 982  REMRLREYEKARDRDRRRDDEKDRERDRDRDRDR---------DREGDDERRRTRRREKD 1032

Query: 255  RRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH- 79
                      +D +++E DR+ R +D  +   DR+RDR+ DRR R  DRD D  ++RD  
Sbjct: 1033 ----------EDSDDREPDRKDRTRDRDD---DRERDRDRDRRERDRDRDRDRNRDRDRD 1079

Query: 78   ------RRRYKDDSEEDDRKRNRDRRYR 13
                   RR+ DD EEDDR  +R RR R
Sbjct: 1080 DERRRPSRRHSDDDEEDDRSGHRSRRER 1107

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 46/114 (40%), Positives = 60/114 (52%), Gaps = 1/114 (0%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            +R+RDR R RDR+ D+E+ R RR    +DS+       DR  DR+ R  DRD D E++RD
Sbjct: 1006 ERDRDRDRDRDREGDDERRRTRRREKDEDSD-------DREPDRKDRTRDRDDDRERDRD 1058

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            R      R     R+RD D + ER R  R   D +EE DR   R+   R   DD
Sbjct: 1059 RDRRERDRDRDRDRNRDRDRDDERRRPSRRHSDDDEEDDRSGHRSRRERPANDD 1112

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 9/85 (10%)
 Frame = -1

Query: 237  RRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---------RHRVDDRDGDNEKER 85
            R  R  + EK RDR  R  D+ + E DR RDR+ DR         R R  D D D ++E 
Sbjct: 982  REMRLREYEKARDRDRRRDDEKDRERDRDRDRDRDREGDDERRRTRRREKDEDSD-DREP 1040

Query: 84   DHRRRYKDDSEEDDRKRNRDRRYRD 10
            D + R +D  ++ +R R+RDRR RD
Sbjct: 1041 DRKDRTRDRDDDRERDRDRDRRERD 1065

[41][TOP]
>UniRef100_UPI0001982F92 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982F92
          Length = 1019

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 59/161 (36%), Positives = 93/161 (57%), Gaps = 17/161 (10%)
 Frame = -1

Query: 441 RDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           RDR R R +D + E++RD  GR   D+E E +R+RD+    R R  +R+ D E+ER+R  
Sbjct: 78  RDRARERTKDREKERDRDHEGR---DAEREKERERDKESRERAREKERE-DREREREREK 133

Query: 264 DNDRRGNGER---------RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV-- 118
           + +R    ER         + R+ + E+ER++R R ++D E E +R R+R  +R  R   
Sbjct: 134 EREREKAREREREKEREREKEREREREREREKRDREREDREREKERDRERLREREKRREP 193

Query: 117 ---DDRDGDNEKERDHRRRYKDDSEED-DRKRN-RDRRYRD 10
              D  DGD+ ++RD +RR +DD  +D +R R+ R  R+RD
Sbjct: 194 DRNDSSDGDDVRDRDRKRRRRDDDYKDRERDRSGRSNRHRD 234

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 54/164 (32%), Positives = 88/164 (53%), Gaps = 22/164 (13%)
 Frame = -1

Query: 447 RNRDR---RYRDRDDDNEKE------RDRRGRYKDDSEEEFDR-----KRDRNGDRRHRV 310
           R+RDR   R+R+R+ D EK+      R  R +  DD   E +R     KRD+   R  R 
Sbjct: 16  RDRDRNGERHRERERDKEKKEHRESRRSEREKSSDDKHREKERDKHRDKRDKERTRSSRD 75

Query: 309 DDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
           D+RD   E+ +DR  + DR   G    R+ + E++++ R R ++   E+ +R+R+R  +R
Sbjct: 76  DERDRARERTKDREKERDRDHEGRDAEREKERERDKESRERAREKEREDREREREREKER 135

Query: 129 -------RHRVDDRDGDNEKERD-HRRRYKDDSEEDDRKRNRDR 22
                  R R  +R+ + E+ER+  R R K D E +DR+R ++R
Sbjct: 136 EREKAREREREKEREREKEREREREREREKRDREREDREREKER 179

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 53/160 (33%), Positives = 95/160 (59%), Gaps = 15/160 (9%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR-----RGRYKD-DSEEEFDRKRDRNGDRRHRV-DDRDGDN 289
           R ++R  R+R+ + EKER+R     R R K+ + E+E +R+R+R  ++R R  +DR+ + 
Sbjct: 118 REKEREDREREREREKEREREKAREREREKEREREKEREREREREREKRDREREDREREK 177

Query: 288 EKERDRRGDNDRRGNGERRHRDD-DNEKERDRRGRYKDDSEEEFDRKRDRNG-DRRHRVD 115
           E++R+R  + ++R   +R    D D+ ++RDR+ R +DD  +  DR+RDR+G   RHR +
Sbjct: 178 ERDRERLREREKRREPDRNDSSDGDDVRDRDRKRRRRDDDYK--DRERDRSGRSNRHRDE 235

Query: 114 DRDG------DNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
             D       D++ ++  RR  ++D EE+ RK + +   R
Sbjct: 236 GEDSPRKKSDDDDLDKKERRTREEDLEEEQRKLDEEMEKR 275

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/143 (32%), Positives = 82/143 (57%), Gaps = 5/143 (3%)
 Frame = -1

Query: 435 RRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRD---GDNEKERDRR 268
           + +RDRD + E+ R+R R + K +  E    +R+++ D +HR  +RD      +KER R 
Sbjct: 13  KSHRDRDRNGERHRERERDKEKKEHRESRRSEREKSSDDKHREKERDKHRDKRDKERTRS 72

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
             +D R     R +D + E++RD  GR   D+E E +R+RD+    R R  +R+ D E+E
Sbjct: 73  SRDDERDRARERTKDREKERDRDHEGR---DAEREKERERDKESRERAREKERE-DRERE 128

Query: 87  RD-HRRRYKDDSEEDDRKRNRDR 22
           R+  + R ++ + E +R++ R+R
Sbjct: 129 REREKEREREKAREREREKERER 151

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 51/167 (30%), Positives = 88/167 (52%), Gaps = 21/167 (12%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD----DRDGDNEK 283
           +++ D ++R+++ D  +++  + R +   ++E DR R+R  DR    D     RD + EK
Sbjct: 46  EKSSDDKHREKERDKHRDKRDKERTRSSRDDERDRARERTKDREKERDRDHEGRDAEREK 105

Query: 282 ERDRRGDNDRRG---NGERRHRDDDNEKERDRRGRYKDDSEEEFDR-------------K 151
           ER+R  ++  R      E R R+ + EKER+R    + + E+E +R             K
Sbjct: 106 ERERDKESRERAREKEREDREREREREKEREREKAREREREKEREREKEREREREREREK 165

Query: 150 RDRNGDRRHRVDDRDGDNEKERDHRRR-YKDDSEEDDRKRNRDRRYR 13
           RDR  + R R  +RD +  +ER+ RR   ++DS + D  R+RDR+ R
Sbjct: 166 RDREREDREREKERDRERLREREKRREPDRNDSSDGDDVRDRDRKRR 212

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 55/169 (32%), Positives = 91/169 (53%), Gaps = 19/169 (11%)
 Frame = -1

Query: 468 QRKMIWKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV---- 310
           +R+   +R R++   R ++R+ + E+ER++R R ++D E E +R R+R  +R  R     
Sbjct: 136 EREKAREREREKEREREKEREREREREREKRDREREDREREKERDRERLREREKRREPDR 195

Query: 309 -DDRDGDNEKERDRRGDNDRRGNGERRHRDDD-NEKERDRRG---RYKDDSEEEFDRKRD 145
            D  DGD+ ++RDR+          RR RDDD  ++ERDR G   R++D+ E+   +K D
Sbjct: 196 NDSSDGDDVRDRDRK----------RRRRDDDYKDRERDRSGRSNRHRDEGEDSPRKKSD 245

Query: 144 RNG----DRRHRVDDRDGDNEK---ERDHRRRYKDDSEEDDRKRNRDRR 19
            +     +RR R +D + +  K   E + RRR   + +E  RKR    R
Sbjct: 246 DDDLDKKERRTREEDLEEEQRKLDEEMEKRRRRVQEWQELKRKREESER 294

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 43/131 (32%), Positives = 75/131 (57%), Gaps = 9/131 (6%)
 Frame = -1

Query: 387 RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEK 208
           + R +D   ++  R RDRNG+ RHR  +RD + ++ R+ R  ++R  + + +HR+ + +K
Sbjct: 3   KSRREDSDLKKSHRDRDRNGE-RHRERERDKEKKEHRESR-RSEREKSSDDKHREKERDK 60

Query: 207 ERDRRG--RYKDDSEEEFDRKRDRNGDRRHRVD----DRDGDNEKERDHRRRYKD---DS 55
            RD+R   R +   ++E DR R+R  DR    D     RD + EKER+  +  ++   + 
Sbjct: 61  HRDKRDKERTRSSRDDERDRARERTKDREKERDRDHEGRDAEREKERERDKESRERAREK 120

Query: 54  EEDDRKRNRDR 22
           E +DR+R R+R
Sbjct: 121 EREDRERERER 131

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 54/162 (33%), Positives = 87/162 (53%), Gaps = 15/162 (9%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDD-DNEKERDRRGRYKDDSEEEFDRK--------RDRNGDRRH 316
           +R+   +R R++R R+R+D + EKERDR    + +   E DR         RDR+  RR 
Sbjct: 154 EREREREREREKRDREREDREREKERDRERLREREKRREPDRNDSSDGDDVRDRDRKRRR 213

Query: 315 RVDDRDGDNEKERDRRGDNDR-RGNGE---RRHRDDDNEKERDRRGRYKDDSEEEFDRKR 148
           R DD     ++ERDR G ++R R  GE   R+  DDD+  +++RR R +D  EE+  RK 
Sbjct: 214 RDDDY---KDRERDRSGRSNRHRDEGEDSPRKKSDDDDLDKKERRTREEDLEEEQ--RKL 268

Query: 147 DRNGD-RRHRVDD-RDGDNEKERDHRRRYKDDSEEDDRKRNR 28
           D   + RR RV + ++   ++E   R +  + +  D+ K  +
Sbjct: 269 DEEMEKRRRRVQEWQELKRKREESEREKLGEAANADEPKSGK 310

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 35/117 (29%), Positives = 62/117 (52%), Gaps = 2/117 (1%)
 Frame = -1

Query: 357 EFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKD 178
           E  R+ D +  + HR  DRD + E+ R+R  D +++ + E R  + +   +   R + +D
Sbjct: 2   EKSRREDSDLKKSHR--DRDRNGERHRERERDKEKKEHRESRRSEREKSSDDKHREKERD 59

Query: 177 DSEEEFDRKRDRNG--DRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
              ++ D++R R+   D R R  +R  D EKERD     +D   E +R+R+++ R R
Sbjct: 60  KHRDKRDKERTRSSRDDERDRARERTKDREKERDRDHEGRDAEREKERERDKESRER 116

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 39/141 (27%), Positives = 69/141 (48%), Gaps = 5/141 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG-DRRHRVDDRDGDNEKERD 274
           KR    R    D D+ ++RDR+ R +DD  +  DR+RDR+G   RHR +  D   +K   
Sbjct: 189 KRREPDRNDSSDGDDVRDRDRKRRRRDDDYK--DRERDRSGRSNRHRDEGEDSPRKK--- 243

Query: 273 RRGDNDRRGNGERRHRDDDNEKER----DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
              D+D     ERR R++D E+E+    +   + +   +E  + KR R    R ++ +  
Sbjct: 244 --SDDDDLDKKERRTREEDLEEEQRKLDEEMEKRRRRVQEWQELKRKREESEREKLGEAA 301

Query: 105 GDNEKERDHRRRYKDDSEEDD 43
             +E +       + +S+++D
Sbjct: 302 NADEPKSGKTWTLEGESDDED 322

[42][TOP]
>UniRef100_A7P8T9 Chromosome chr3 scaffold_8, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7P8T9_VITVI
          Length = 971

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 59/161 (36%), Positives = 93/161 (57%), Gaps = 17/161 (10%)
 Frame = -1

Query: 441 RDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           RDR R R +D + E++RD  GR   D+E E +R+RD+    R R  +R+ D E+ER+R  
Sbjct: 78  RDRARERTKDREKERDRDHEGR---DAEREKERERDKESRERAREKERE-DREREREREK 133

Query: 264 DNDRRGNGER---------RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV-- 118
           + +R    ER         + R+ + E+ER++R R ++D E E +R R+R  +R  R   
Sbjct: 134 EREREKAREREREKEREREKEREREREREREKRDREREDREREKERDRERLREREKRREP 193

Query: 117 ---DDRDGDNEKERDHRRRYKDDSEED-DRKRN-RDRRYRD 10
              D  DGD+ ++RD +RR +DD  +D +R R+ R  R+RD
Sbjct: 194 DRNDSSDGDDVRDRDRKRRRRDDDYKDRERDRSGRSNRHRD 234

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 54/164 (32%), Positives = 88/164 (53%), Gaps = 22/164 (13%)
 Frame = -1

Query: 447 RNRDR---RYRDRDDDNEKE------RDRRGRYKDDSEEEFDR-----KRDRNGDRRHRV 310
           R+RDR   R+R+R+ D EK+      R  R +  DD   E +R     KRD+   R  R 
Sbjct: 16  RDRDRNGERHRERERDKEKKEHRESRRSEREKSSDDKHREKERDKHRDKRDKERTRSSRD 75

Query: 309 DDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
           D+RD   E+ +DR  + DR   G    R+ + E++++ R R ++   E+ +R+R+R  +R
Sbjct: 76  DERDRARERTKDREKERDRDHEGRDAEREKERERDKESRERAREKEREDREREREREKER 135

Query: 129 -------RHRVDDRDGDNEKERD-HRRRYKDDSEEDDRKRNRDR 22
                  R R  +R+ + E+ER+  R R K D E +DR+R ++R
Sbjct: 136 EREKAREREREKEREREKEREREREREREKRDREREDREREKER 179

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 53/160 (33%), Positives = 95/160 (59%), Gaps = 15/160 (9%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR-----RGRYKD-DSEEEFDRKRDRNGDRRHRV-DDRDGDN 289
           R ++R  R+R+ + EKER+R     R R K+ + E+E +R+R+R  ++R R  +DR+ + 
Sbjct: 118 REKEREDREREREREKEREREKAREREREKEREREKEREREREREREKRDREREDREREK 177

Query: 288 EKERDRRGDNDRRGNGERRHRDD-DNEKERDRRGRYKDDSEEEFDRKRDRNG-DRRHRVD 115
           E++R+R  + ++R   +R    D D+ ++RDR+ R +DD  +  DR+RDR+G   RHR +
Sbjct: 178 ERDRERLREREKRREPDRNDSSDGDDVRDRDRKRRRRDDDYK--DRERDRSGRSNRHRDE 235

Query: 114 DRDG------DNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
             D       D++ ++  RR  ++D EE+ RK + +   R
Sbjct: 236 GEDSPRKKSDDDDLDKKERRTREEDLEEEQRKLDEEMEKR 275

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/143 (32%), Positives = 82/143 (57%), Gaps = 5/143 (3%)
 Frame = -1

Query: 435 RRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRD---GDNEKERDRR 268
           + +RDRD + E+ R+R R + K +  E    +R+++ D +HR  +RD      +KER R 
Sbjct: 13  KSHRDRDRNGERHRERERDKEKKEHRESRRSEREKSSDDKHREKERDKHRDKRDKERTRS 72

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
             +D R     R +D + E++RD  GR   D+E E +R+RD+    R R  +R+ D E+E
Sbjct: 73  SRDDERDRARERTKDREKERDRDHEGR---DAEREKERERDKESRERAREKERE-DRERE 128

Query: 87  RD-HRRRYKDDSEEDDRKRNRDR 22
           R+  + R ++ + E +R++ R+R
Sbjct: 129 REREKEREREKAREREREKERER 151

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 51/167 (30%), Positives = 88/167 (52%), Gaps = 21/167 (12%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD----DRDGDNEK 283
           +++ D ++R+++ D  +++  + R +   ++E DR R+R  DR    D     RD + EK
Sbjct: 46  EKSSDDKHREKERDKHRDKRDKERTRSSRDDERDRARERTKDREKERDRDHEGRDAEREK 105

Query: 282 ERDRRGDNDRRG---NGERRHRDDDNEKERDRRGRYKDDSEEEFDR-------------K 151
           ER+R  ++  R      E R R+ + EKER+R    + + E+E +R             K
Sbjct: 106 ERERDKESRERAREKEREDREREREREKEREREKAREREREKEREREKEREREREREREK 165

Query: 150 RDRNGDRRHRVDDRDGDNEKERDHRRR-YKDDSEEDDRKRNRDRRYR 13
           RDR  + R R  +RD +  +ER+ RR   ++DS + D  R+RDR+ R
Sbjct: 166 RDREREDREREKERDRERLREREKRREPDRNDSSDGDDVRDRDRKRR 212

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 55/169 (32%), Positives = 91/169 (53%), Gaps = 19/169 (11%)
 Frame = -1

Query: 468 QRKMIWKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV---- 310
           +R+   +R R++   R ++R+ + E+ER++R R ++D E E +R R+R  +R  R     
Sbjct: 136 EREKAREREREKEREREKEREREREREREKRDREREDREREKERDRERLREREKRREPDR 195

Query: 309 -DDRDGDNEKERDRRGDNDRRGNGERRHRDDD-NEKERDRRG---RYKDDSEEEFDRKRD 145
            D  DGD+ ++RDR+          RR RDDD  ++ERDR G   R++D+ E+   +K D
Sbjct: 196 NDSSDGDDVRDRDRK----------RRRRDDDYKDRERDRSGRSNRHRDEGEDSPRKKSD 245

Query: 144 RNG----DRRHRVDDRDGDNEK---ERDHRRRYKDDSEEDDRKRNRDRR 19
            +     +RR R +D + +  K   E + RRR   + +E  RKR    R
Sbjct: 246 DDDLDKKERRTREEDLEEEQRKLDEEMEKRRRRVQEWQELKRKREESER 294

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 43/131 (32%), Positives = 75/131 (57%), Gaps = 9/131 (6%)
 Frame = -1

Query: 387 RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEK 208
           + R +D   ++  R RDRNG+ RHR  +RD + ++ R+ R  ++R  + + +HR+ + +K
Sbjct: 3   KSRREDSDLKKSHRDRDRNGE-RHRERERDKEKKEHRESR-RSEREKSSDDKHREKERDK 60

Query: 207 ERDRRG--RYKDDSEEEFDRKRDRNGDRRHRVD----DRDGDNEKERDHRRRYKD---DS 55
            RD+R   R +   ++E DR R+R  DR    D     RD + EKER+  +  ++   + 
Sbjct: 61  HRDKRDKERTRSSRDDERDRARERTKDREKERDRDHEGRDAEREKERERDKESRERAREK 120

Query: 54  EEDDRKRNRDR 22
           E +DR+R R+R
Sbjct: 121 EREDRERERER 131

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 54/162 (33%), Positives = 87/162 (53%), Gaps = 15/162 (9%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDD-DNEKERDRRGRYKDDSEEEFDRK--------RDRNGDRRH 316
           +R+   +R R++R R+R+D + EKERDR    + +   E DR         RDR+  RR 
Sbjct: 154 EREREREREREKRDREREDREREKERDRERLREREKRREPDRNDSSDGDDVRDRDRKRRR 213

Query: 315 RVDDRDGDNEKERDRRGDNDR-RGNGE---RRHRDDDNEKERDRRGRYKDDSEEEFDRKR 148
           R DD     ++ERDR G ++R R  GE   R+  DDD+  +++RR R +D  EE+  RK 
Sbjct: 214 RDDDY---KDRERDRSGRSNRHRDEGEDSPRKKSDDDDLDKKERRTREEDLEEEQ--RKL 268

Query: 147 DRNGD-RRHRVDD-RDGDNEKERDHRRRYKDDSEEDDRKRNR 28
           D   + RR RV + ++   ++E   R +  + +  D+ K  +
Sbjct: 269 DEEMEKRRRRVQEWQELKRKREESEREKLGEAANADEPKSGK 310

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 35/117 (29%), Positives = 62/117 (52%), Gaps = 2/117 (1%)
 Frame = -1

Query: 357 EFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKD 178
           E  R+ D +  + HR  DRD + E+ R+R  D +++ + E R  + +   +   R + +D
Sbjct: 2   EKSRREDSDLKKSHR--DRDRNGERHRERERDKEKKEHRESRRSEREKSSDDKHREKERD 59

Query: 177 DSEEEFDRKRDRNG--DRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
              ++ D++R R+   D R R  +R  D EKERD     +D   E +R+R+++ R R
Sbjct: 60  KHRDKRDKERTRSSRDDERDRARERTKDREKERDRDHEGRDAEREKERERDKESRER 116

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 39/141 (27%), Positives = 69/141 (48%), Gaps = 5/141 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG-DRRHRVDDRDGDNEKERD 274
           KR    R    D D+ ++RDR+ R +DD  +  DR+RDR+G   RHR +  D   +K   
Sbjct: 189 KRREPDRNDSSDGDDVRDRDRKRRRRDDDYK--DRERDRSGRSNRHRDEGEDSPRKK--- 243

Query: 273 RRGDNDRRGNGERRHRDDDNEKER----DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
              D+D     ERR R++D E+E+    +   + +   +E  + KR R    R ++ +  
Sbjct: 244 --SDDDDLDKKERRTREEDLEEEQRKLDEEMEKRRRRVQEWQELKRKREESEREKLGEAA 301

Query: 105 GDNEKERDHRRRYKDDSEEDD 43
             +E +       + +S+++D
Sbjct: 302 NADEPKSGKTWTLEGESDDED 322

[43][TOP]
>UniRef100_Q7RBW9 Putative uncharacterized protein PY06017 (Fragment) n=1
           Tax=Plasmodium yoelii yoelii RepID=Q7RBW9_PLAYO
          Length = 229

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 60/158 (37%), Positives = 82/158 (51%), Gaps = 18/158 (11%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKE 280
           K  R  R +DR+ D ++ERDR    + D E + DR+RDR  DR   R R  +R+ D ++E
Sbjct: 11  KEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRERDRDRERDRDRERERDRDRE 70

Query: 279 RDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD- 106
           RDR  D DR RG   R+ +D   ++ERDR   Y+ D E E     +R GD R   +DR+ 
Sbjct: 71  RDRERDRDRERGRDYRKDKDHRRDRERDRERDYRKDGERE-----NRRGDTRRSENDREK 125

Query: 105 -----------GDNEKERDHRRRYKDDS--EEDDRKRN 31
                       DNEKER+      DD   E D+ K+N
Sbjct: 126 KRDKDDYTPNNSDNEKERNAWNIRNDDGGIESDENKKN 163

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 52/135 (38%), Positives = 76/135 (56%), Gaps = 1/135 (0%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRG 247
           RDR  D E++RDR      + + E DR+RDR  DR     DR+ D E++RDR  D DR  
Sbjct: 15  RDRSKDRERDRDR------ERDRERDRERDRERDR-----DRERDRERDRDRERDRDRER 63

Query: 246 NGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRR 70
             +R R RD + +++R+R   Y+ D +   DR+RDR  D R     +DG+ E  R   RR
Sbjct: 64  ERDRDRERDRERDRDRERGRDYRKDKDHRRDRERDRERDYR-----KDGERENRRGDTRR 118

Query: 69  YKDDSEEDDRKRNRD 25
            ++D E   +KR++D
Sbjct: 119 SENDRE---KKRDKD 130

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 49/125 (39%), Positives = 72/125 (57%), Gaps = 4/125 (3%)
 Frame = -1

Query: 372 DDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGDNDRRGNGER---RHRDDDNEKE 205
           +++E E + +RDR+ DR R R  +RD + ++ERDR  D DR  + ER   R RD D E+E
Sbjct: 5   ENTEGEKEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRERDRDRERDRDRERE 64

Query: 204 RDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
           RDR      D E + +R RDR   R +R  D+D   ++ERD  R Y+ D E ++R+ +  
Sbjct: 65  RDR------DRERDRERDRDRERGRDYR-KDKDHRRDRERDRERDYRKDGERENRRGDTR 117

Query: 24  RRYRD 10
           R   D
Sbjct: 118 RSEND 122

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 57/160 (35%), Positives = 84/160 (52%), Gaps = 18/160 (11%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDR---RGR-YKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 286
           +R+RDR R RDRD + ++ERDR   RGR Y+ D +   DR+RDR  D R     +DG+ E
Sbjct: 56  ERDRDRERERDRDRERDRERDRDRERGRDYRKDKDHRRDRERDRERDYR-----KDGERE 110

Query: 285 KER--DRRGDNDRRGNGERRHRDD------DNEKERDRRGRYKDDSEEEFDRKRDRN--G 136
             R   RR +NDR    ++R +DD      DNEKER+      DD   E D  +  N  G
Sbjct: 111 NRRGDTRRSENDRE---KKRDKDDYTPNNSDNEKERNAWNIRNDDGGIESDENKKNNIEG 167

Query: 135 D---RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
           D      + + RDG+  K+ ++    K + + D++ +  D
Sbjct: 168 DDNGNNLKGNKRDGEKNKDNENANNDKREEKGDEKGQGSD 207

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 46/152 (30%), Positives = 77/152 (50%), Gaps = 6/152 (3%)
 Frame = -1

Query: 447 RNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           R RDR   R R+RD D E+ERDR      + + + +R RD   D+ HR   RD + ++ER
Sbjct: 45  RERDRERDRDRERDRDRERERDRDRERDRERDRDRERGRDYRKDKDHR---RDRERDRER 101

Query: 276 DRRGDNDRRG-NGERRHRDDDNEKERDRRGRYKDDSEEEFDRK--RDRNGDRRHRVDDRD 106
           D R D +R    G+ R  ++D EK+RD+     ++S+ E +R     RN D     D+  
Sbjct: 102 DYRKDGERENRRGDTRRSENDREKKRDKDDYTPNNSDNEKERNAWNIRNDDGGIESDENK 161

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            +N +  D+    K +  + ++ ++ +    D
Sbjct: 162 KNNIEGDDNGNNLKGNKRDGEKNKDNENANND 193

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 36/87 (41%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = -1

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGD 100
           +R  +N       RR R  D E++RDR    + D E + +R RDR  DR R R  +RD D
Sbjct: 1   NREIENTEGEKEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRERDRDRERDRD 60

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDRR 19
            E+ERD R R +D   + DR+R RD R
Sbjct: 61  RERERD-RDRERDRERDRDRERGRDYR 86

[44][TOP]
>UniRef100_A5K5X2 Protein kinase domain containing protein n=1 Tax=Plasmodium vivax
            RepID=A5K5X2_PLAVI
          Length = 1544

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 59/160 (36%), Positives = 90/160 (56%), Gaps = 11/160 (6%)
 Frame = -1

Query: 468  QRKMIWKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-------R 319
            +R+  W+R++ R   R  +R  + E+ER R    +   E+E +R+RDR  DR       R
Sbjct: 1349 EREREWERDKRRDTGRELERGREQERERGREQERERGREQERERERDRERDREKERERAR 1408

Query: 318  HRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN 139
             R  +R+ + EKER+R  D DR      R R+ + E+ERDR    + + E+E +R RDR+
Sbjct: 1409 DREREREKEKEKERERARDRDRE-----RDREKERERERDRERDREKEKEKERERARDRD 1463

Query: 138  GDRRHRVDDRDGDNEKERDHRR-RYKDDSEEDDRKRNRDR 22
             +R     DR+ + E+ERD  R R K+   E DR+R+RDR
Sbjct: 1464 RER-----DREKERERERDRERDREKERERERDRERDRDR 1498

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/153 (34%), Positives = 88/153 (57%), Gaps = 12/153 (7%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---------RHRVDDRD 298
            +R RDR  RDR+ + E+ RDR    + + E+E +R RDR+ +R         R R  DR+
Sbjct: 1391 ERERDRE-RDREKERERARDREREREKEKEKERERARDRDRERDREKERERERDRERDRE 1449

Query: 297  GDNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD--RR 127
             + EKER+R  D DR  + E+ R R+ D E++R++    + D E + DR RDRN +  +R
Sbjct: 1450 KEKEKERERARDRDRERDREKERERERDRERDREKERERERDRERDRDRNRDRNREPHKR 1509

Query: 126  HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNR 28
               D+ + + E +   ++++K D+E+  R+R R
Sbjct: 1510 RSRDNPNRNEENQLKEQKKHKLDAEDAKRERKR 1542

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 54/148 (36%), Positives = 87/148 (58%), Gaps = 7/148 (4%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            R ++R R RDR+ D EKER+R    + + E+E +++R+R  D R R  DR+ + E+ERDR
Sbjct: 1386 REQERERERDRERDREKERERARDREREREKEKEKERERARD-RDRERDREKERERERDR 1444

Query: 270  RGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDR 109
              D ++    ER     R R+ D EKER+R    + D E+E +R+RDR  DR R+R  +R
Sbjct: 1445 ERDREKEKEKERERARDRDRERDREKERERERDRERDREKERERERDRERDRDRNRDRNR 1504

Query: 108  DGDNEKERDHRRRYKDDSEEDDRKRNRD 25
            +    + RD+  R +++  ++ +K   D
Sbjct: 1505 EPHKRRSRDNPNRNEENQLKEQKKHKLD 1532

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 55/167 (32%), Positives = 89/167 (53%), Gaps = 11/167 (6%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRV 310
            R ++R    +R R R   R R R+ + E+ERDR    + + E   DR+R+R  ++ + R 
Sbjct: 1364 RELERGREQERERGREQERERGREQERERERDRERDREKERERARDREREREKEKEKERE 1423

Query: 309  DDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKD---DSEEEFDRKRDR 142
              RD D E++R++  + +R      R RD + EKE++R R R +D   D E+E +R+RDR
Sbjct: 1424 RARDRDRERDREKERERER-----DRERDREKEKEKERERARDRDRERDREKERERERDR 1478

Query: 141  NGDR---RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
              DR   R R  DR+ D ++ RD  R        D+  RN + + ++
Sbjct: 1479 ERDREKERERERDRERDRDRNRDRNREPHKRRSRDNPNRNEENQLKE 1525

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 57/157 (36%), Positives = 78/157 (49%), Gaps = 15/157 (9%)
 Frame = -1

Query: 447  RNRDRRYRDRD---DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR-DGDNEKE 280
            R+R+R +  RD      E  RD       D   E DRKRDR  +R    D R D   E E
Sbjct: 1308 RSREREWYKRDYAERGRESGRDMGRENGRDIGRERDRKRDREREREWERDKRRDTGRELE 1367

Query: 279  RDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRV 118
            R R  + +R    ER R R+ + E+ERDR    + + E   DR+R+R  ++     R R 
Sbjct: 1368 RGREQERERGREQERERGREQERERERDRERDREKERERARDREREREKEKEKERERARD 1427

Query: 117  DDRDGDNEKERDHRR-----RYKDDSEEDDRKRNRDR 22
             DR+ D EKER+  R     R K+  +E +R R+RDR
Sbjct: 1428 RDRERDREKERERERDRERDREKEKEKERERARDRDR 1464

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 57/158 (36%), Positives = 79/158 (50%), Gaps = 16/158 (10%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGR----YKDDSEE-------EFDRKRDRN-GDRRHRVDD 304
            R R  R RD     E+ R  R R    YK D  E       +  R+  R+ G  R R  D
Sbjct: 1288 RGRVSRIRDSTSRVERSRHDRSREREWYKRDYAERGRESGRDMGRENGRDIGRERDRKRD 1347

Query: 303  RDGDNEKERDRRGDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD 133
            R+ + E ERD+R D  R   RG  + R R  + E+ER R    + + E E DR+RDR  +
Sbjct: 1348 REREREWERDKRRDTGRELERGREQERERGREQERERGR----EQERERERDRERDREKE 1403

Query: 132  RRHRVDDRDGDNEKERD-HRRRYKDDSEEDDRKRNRDR 22
             R R  DR+ + EKE++  R R +D   E DR++ R+R
Sbjct: 1404 -RERARDREREREKEKEKERERARDRDRERDREKERER 1440

[45][TOP]
>UniRef100_Q2UGJ3 Predicted protein n=1 Tax=Aspergillus oryzae RepID=Q2UGJ3_ASPOR
          Length = 527

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/141 (37%), Positives = 76/141 (53%), Gaps = 10/141 (7%)
 Frame = -1

Query: 453 WKRNRDRRYRDRDDDNEKERDRRGR-YKDDSEEEFDRK------RDRNGDRRHRVDDRDG 295
           WK  RDR       D +++RD R R Y+ D ++ +DR+      RDR+  RR R DD DG
Sbjct: 387 WKERRDRNLERSGRDKDRDRDYRRRDYERDDDDRYDRRKTGSSRRDRSHSRRRRYDDDDG 446

Query: 294 DNEKE---RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
           D++ +   RDR  D +RR + E R R  + EK+R+R  RY+DD      R       R  
Sbjct: 447 DSKDDRSYRDRDRDRERRRDRE-RDRSREREKDRERSRRYRDDDRYSSSRHSSNTSSRHG 505

Query: 123 RVDDRDGDNEKERDHRRRYKD 61
           R  DRD D++++   RRR+ D
Sbjct: 506 RDRDRDRDSDRDSYRRRRHDD 526

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 53/147 (36%), Positives = 72/147 (48%), Gaps = 14/147 (9%)
 Frame = -1

Query: 420 RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDN--DRRG 247
           +DDD  KER      +D + E   R +DR+ D R R  +RD D+  +R + G +  DR  
Sbjct: 382 KDDDEWKER------RDRNLERSGRDKDRDRDYRRRDYERDDDDRYDRRKTGSSRRDRSH 435

Query: 246 NGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRY 67
           +  RR+ DDD + + DR  R         DR RDR   RR R  DR  + EK+R+  RRY
Sbjct: 436 SRRRRYDDDDGDSKDDRSYR---------DRDRDRER-RRDRERDRSREREKDRERSRRY 485

Query: 66  KDD------------SEEDDRKRNRDR 22
           +DD            S    R R+RDR
Sbjct: 486 RDDDRYSSSRHSSNTSSRHGRDRDRDR 512

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 47/127 (37%), Positives = 65/127 (51%)
 Frame = -1

Query: 390 RRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNE 211
           + G+ K D ++E+  +RDRN +R  R  DRD D  +    R D+DR     R+      +
Sbjct: 376 KEGKSKKD-DDEWKERRDRNLERSGRDKDRDRDYRRRDYERDDDDRYDR--RKTGSSRRD 432

Query: 210 KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRN 31
           +   RR RY DD  +  D       DR +R  DRD D E+ RD   R +D S E ++ R 
Sbjct: 433 RSHSRRRRYDDDDGDSKD-------DRSYR--DRDRDRERRRD---RERDRSREREKDRE 480

Query: 30  RDRRYRD 10
           R RRYRD
Sbjct: 481 RSRRYRD 487

[46][TOP]
>UniRef100_B8N9T4 G-patch domain protein (Spp2), putative n=1 Tax=Aspergillus flavus
           NRRL3357 RepID=B8N9T4_ASPFN
          Length = 526

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/141 (37%), Positives = 76/141 (53%), Gaps = 10/141 (7%)
 Frame = -1

Query: 453 WKRNRDRRYRDRDDDNEKERDRRGR-YKDDSEEEFDRK------RDRNGDRRHRVDDRDG 295
           WK  RDR       D +++RD R R Y+ D ++ +DR+      RDR+  RR R DD DG
Sbjct: 386 WKERRDRNLERSGRDKDRDRDYRRRDYERDDDDRYDRRKTGSPRRDRSHSRRRRYDDDDG 445

Query: 294 DNEKE---RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
           D++ +   RDR  D +RR + E R R  + EK+R+R  RY+DD      R       R  
Sbjct: 446 DSKDDRSYRDRDRDRERRRDRE-RDRSREREKDRERSRRYRDDDRYSSSRHSSNTSSRHG 504

Query: 123 RVDDRDGDNEKERDHRRRYKD 61
           R  DRD D++++   RRR+ D
Sbjct: 505 RDRDRDRDSDRDSYRRRRHDD 525

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 52/149 (34%), Positives = 71/149 (47%), Gaps = 14/149 (9%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD--NDR 253
           + + DD  KER      +D + E   R +DR+ D R R  +RD D+  +R + G    DR
Sbjct: 379 KSKKDDEWKER------RDRNLERSGRDKDRDRDYRRRDYERDDDDRYDRRKTGSPRRDR 432

Query: 252 RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR 73
             +  RR+ DDD + + DR  R         DR RDR   RR R  DR  + EK+R+  R
Sbjct: 433 SHSRRRRYDDDDGDSKDDRSYR---------DRDRDRER-RRDRERDRSREREKDRERSR 482

Query: 72  RYKDD------------SEEDDRKRNRDR 22
           RY+DD            S    R R+RDR
Sbjct: 483 RYRDDDRYSSSRHSSNTSSRHGRDRDRDR 511

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 40/114 (35%), Positives = 63/114 (55%), Gaps = 16/114 (14%)
 Frame = -1

Query: 303 RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK------RDR 142
           ++G ++K+ + +   DR  N ER  RD D +++  RR  Y+ D ++ +DR+      RDR
Sbjct: 376 KEGKSKKDDEWKERRDR--NLERSGRDKDRDRDYRRRD-YERDDDDRYDRRKTGSPRRDR 432

Query: 141 NGDRRHRVDDRDGDNEKERDH----------RRRYKDDSEEDDRKRNRDRRYRD 10
           +  RR R DD DGD++ +R +          R R +D S E ++ R R RRYRD
Sbjct: 433 SHSRRRRYDDDDGDSKDDRSYRDRDRDRERRRDRERDRSREREKDRERSRRYRD 486

[47][TOP]
>UniRef100_Q5XGT0 LOC495149 protein (Fragment) n=1 Tax=Xenopus laevis
            RepID=Q5XGT0_XENLA
          Length = 1029

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 58/147 (39%), Positives = 86/147 (58%), Gaps = 6/147 (4%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDR- 271
            RD R R+R+ + E+ER+R  R ++ + E E +R+R R  DR R R  DR+ + EKER+R 
Sbjct: 715  RDERAREREREKEREREREQREREREKERESERERARERDREREREKDREREREKERERE 774

Query: 270  RGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
            R + +R    ER   R RD + E+ER+R    + D E+E +R+R R  DR    D    +
Sbjct: 775  REERERERERERERERERDRERERERERERERERDREKEKERERGRERDRDRPRDWE--E 832

Query: 99   NEKERDHRRRYKDDSEEDDRKRNRDRR 19
             EK R+ RR  +DD  ED R+ + DR+
Sbjct: 833  KEKAREDRRDKRDDVREDKRELHEDRK 859

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 54/160 (33%), Positives = 90/160 (56%), Gaps = 17/160 (10%)
 Frame = -1

Query: 450  KRNRDR--------RYRDRDDDNEKER-------DRRGRYKDDSEEEFDRKRDRNGDRRH 316
            +R+RDR        R++ R+DD E+E        DR    +D+   E +R+++R  +R  
Sbjct: 675  RRDRDRDQRPTSPVRHQGRNDDTEREERREERRVDRTDERRDERAREREREKEREREREQ 734

Query: 315  RVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRN 139
            R  +R+ + E ER+R  + DR      R R+ D E+ER++ R R +++ E E +R+R+R 
Sbjct: 735  REREREKERESERERARERDR-----EREREKDREREREKEREREREERERERERERERE 789

Query: 138  GDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             +R R R  +R+ + E+ERD   R K+   E  R+R+RDR
Sbjct: 790  RERDRERERERERERERERD---REKEKERERGRERDRDR 826

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 46/143 (32%), Positives = 77/143 (53%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            +R+ DR  RDRD D       R + ++D  E  +R+ +R  DR    D+R  +  +ER+R
Sbjct: 668  RRHGDRDRRDRDRDQRPTSPVRHQGRNDDTEREERREERRVDR---TDERRDERARERER 724

Query: 270  RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
              + +R      R R+ + E ER+R      + E E DR+R+R  +R    ++R+ + E+
Sbjct: 725  EKEREREREQREREREKERESERERARERDREREREKDREREREKEREREREERERERER 784

Query: 90   ERDHRRRYKDDSEEDDRKRNRDR 22
            ER+ R R +D   E +R+R R+R
Sbjct: 785  ERE-RERERDRERERERERERER 806

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 57/152 (37%), Positives = 86/152 (56%), Gaps = 11/152 (7%)
 Frame = -1

Query: 444  NRDRRYRDRDDDNEKERDRRGRYKDDSEEEF--DRKRDRNGDRR-HRVDDRDGDNEKE-- 280
            +RDRR RDRD         +GR  D   EE   +R+ DR  +RR  R  +R+ + E+E  
Sbjct: 672  DRDRRDRDRDQRPTSPVRHQGRNDDTEREERREERRVDRTDERRDERAREREREKERERE 731

Query: 279  ---RDRRGDNDRRGNGER-RHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHRV 118
               R+R  + +R    ER R RD + E+E+DR R R K+   E  +R+R+R  +R R R 
Sbjct: 732  REQREREREKERESERERARERDREREREKDREREREKEREREREERERERERERERERE 791

Query: 117  DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             DR+ + E+ER+ R R +D  +E +R+R R+R
Sbjct: 792  RDRERERERERE-RERERDREKEKERERGRER 822

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 49/150 (32%), Positives = 77/150 (51%), Gaps = 6/150 (4%)
 Frame = -1

Query: 453  WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER- 277
            W+       RDR D+ ++ RD     +    +  DR RD+      R   R+ D E+E  
Sbjct: 643  WESRSSYTERDRYDNRDQGRDSSFDRRHGDRDRRDRDRDQRPTSPVRHQGRNDDTEREER 702

Query: 276  --DRRGDN-DRRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR-RHRVDD 112
              +RR D  D R +   R R+ + E+ER+R  R ++ + E E +R+R R  DR R R  D
Sbjct: 703  REERRVDRTDERRDERAREREREKEREREREQREREREKERESERERARERDREREREKD 762

Query: 111  RDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            R+ + EKER+  R  ++   E +R+R R+R
Sbjct: 763  REREREKEREREREERERERERERERERER 792

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 46/162 (28%), Positives = 89/162 (54%), Gaps = 9/162 (5%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR-----RYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR 322
            R  +R+   +R+R+R     R R+R+ + E+ER+ R R ++   + E E DR+R+R  +R
Sbjct: 743  RESERERARERDREREREKDREREREKEREREREERERERERERERERERDRERERERER 802

Query: 321  -RHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRD 145
             R R  DR+ + E+ER R  D DR  + E + +    E  RD+R   ++D  E  + ++ 
Sbjct: 803  ERERERDREKEKERERGRERDRDRPRDWEEKEK--AREDRRDKRDDVREDKRELHEDRKP 860

Query: 144  RNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            ++   + +++ +   N   +D R+R++++S    R+  + RR
Sbjct: 861  KS--EKGKIEGQINQN-LHKDQRKRHRNESSPSPRQSPKRRR 899

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 56/188 (29%), Positives = 77/188 (40%), Gaps = 42/188 (22%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR------------------ 322
            RN  R     D  N++    RGR  D SE+     R    D                   
Sbjct: 592  RNDSRNENRSDTRNDRSGRARGRAPDPSEKTGRAARSSQADNHSSSNYHDNWESRSSYTE 651

Query: 321  RHRVDDRDGDNEKERDRR-GDNDRRGNGER-------RH--RDDDNEKERDRRGRYKDDS 172
            R R D+RD   +   DRR GD DRR            RH  R+DD E+E  R  R  D +
Sbjct: 652  RDRYDNRDQGRDSSFDRRHGDRDRRDRDRDQRPTSPVRHQGRNDDTEREERREERRVDRT 711

Query: 171  EEEFD---RKRDRNGDRRHRVDDRDGDNEKERD-----------HRRRYKDDSEEDDRKR 34
            +E  D   R+R+R  +R    + R+ + EKER+            R R KD   E +++R
Sbjct: 712  DERRDERAREREREKEREREREQREREREKERESERERARERDREREREKDREREREKER 771

Query: 33   NRDRRYRD 10
             R+R  R+
Sbjct: 772  EREREERE 779

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 49/173 (28%), Positives = 71/173 (41%), Gaps = 31/173 (17%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR-HRVDDRDGDNEKERDR 271
            R+RD R   R D+   ER  R   +DD+     R   RN  R  +R D R+  + + R R
Sbjct: 555  RDRDNRESHRKDEQYDERSYRNHGRDDTSRAESRNETRNDSRNENRSDTRNDRSGRARGR 614

Query: 270  RGD-NDRRGNGERRHRDDDNEK--------------ERDRRGRYKDDSEEEFDRKRDRNG 136
              D +++ G   R  + D++                ERDR        +  FDR   R+G
Sbjct: 615  APDPSEKTGRAARSSQADNHSSSNYHDNWESRSSYTERDRYDNRDQGRDSSFDR---RHG 671

Query: 135  DRRHRVDDR---------------DGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            DR  R  DR               D + E+ R+ RR  + D   D+R R R+R
Sbjct: 672  DRDRRDRDRDQRPTSPVRHQGRNDDTEREERREERRVDRTDERRDERARERER 724

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 40/156 (25%), Positives = 78/156 (50%), Gaps = 4/156 (2%)
 Frame = -1

Query: 468  QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRD 298
            +R+   +R R+ R R+R+ + E+ER+R    + + E E +R+RDR  ++   R R  DRD
Sbjct: 766  EREKEREREREERERERERERERERERDRERERERERERERERDREKEKERERGRERDRD 825

Query: 297  GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGR-YKDDSEEEFDRKRDRNGDRRHR 121
               + E   +   DRR   +   R+D  E   DR+ +  K   E + ++   ++  +RHR
Sbjct: 826  RPRDWEEKEKAREDRRDKRD-DVREDKRELHEDRKPKSEKGKIEGQINQNLHKDQRKRHR 884

Query: 120  VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
             +      +  +  RR +  DS+  +   +++ ++R
Sbjct: 885  NESSPSPRQSPK-RRREHSPDSDAYNSGDDKNEKHR 919

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 42/151 (27%), Positives = 67/151 (44%), Gaps = 10/151 (6%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           + DR +  RD+   ++RD R   ++ S    DR+     DRR   D+R  D+ + RD R 
Sbjct: 467 SHDRSHERRDESRGRKRD-RDHNREPSGSRDDRESREGRDRREVRDNR--DHREPRDSRD 523

Query: 264 DNDRRGNGERRHRDDDNEKERDRRGR----YKDDSEEEFDRKRDRNGDRRHRVDDRD--- 106
           + + R + E R   +  +++  R  R    Y+D    E  RK ++  +R +R   RD   
Sbjct: 524 NRETRDSREYRDAKESRDQKDSRSTRDTHEYRDRDNRESHRKDEQYDERSYRNHGRDDTS 583

Query: 105 ---GDNEKERDHRRRYKDDSEEDDRKRNRDR 22
                NE   D R   + D+  D   R R R
Sbjct: 584 RAESRNETRNDSRNENRSDTRNDRSGRARGR 614

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 44/163 (26%), Positives = 68/163 (41%), Gaps = 9/163 (5%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           QRK    ++R         D E+      R  +  +E   RKRDR+ +R       D ++
Sbjct: 441 QRKRSPSKHRSPTREKGRHDRERASASHDRSHERRDESRGRKRDRDHNREPSGSRDDRES 500

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN----GDRRHR 121
            + RDRR   D R + E R   D+ E    R  R   +S ++ D +  R+     DR +R
Sbjct: 501 REGRDRREVRDNRDHREPRDSRDNRETRDSREYRDAKESRDQKDSRSTRDTHEYRDRDNR 560

Query: 120 VDDRDGDNEKERDHRRRYKDD-----SEEDDRKRNRDRRYRDT 7
              R  +   ER +R   +DD     S  + R  +R+    DT
Sbjct: 561 ESHRKDEQYDERSYRNHGRDDTSRAESRNETRNDSRNENRSDT 603

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 46/190 (24%), Positives = 86/190 (45%), Gaps = 36/190 (18%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
            +R+   +R R+R R RDR+ + E+ER+R      + E+E +R R+R+ DR    ++++  
Sbjct: 777  ERERERERERERERERDRERERERERERERERDREKEKERERGRERDRDRPRDWEEKEKA 836

Query: 291  NEKERDRRGD--NDRRGNGERRHRDDDNEK---------ERDRRGRYKDDSE---EEFDR 154
             E  RD+R D   D+R   E R    +  K          +D+R R++++S     +  +
Sbjct: 837  REDRRDKRDDVREDKRELHEDRKPKSEKGKIEGQINQNLHKDQRKRHRNESSPSPRQSPK 896

Query: 153  KRDRNGDRRHRVDDRDGDNEKER---------------------DHRRRYKDDSEEDDRK 37
            +R  +       +  D  NEK R                     +   R+K++  + +RK
Sbjct: 897  RRREHSPDSDAYNSGDDKNEKHRLLSQVVKPLDSRSLSPAHVTEERPSRWKEEERKSERK 956

Query: 36   RNRDRRYRDT 7
             +  RRY ++
Sbjct: 957  ES-SRRYEES 965

[48][TOP]
>UniRef100_C7Z4Y9 Putative uncharacterized protein (Fragment) n=1 Tax=Nectria
           haematococca mpVI 77-13-4 RepID=C7Z4Y9_NECH7
          Length = 307

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 60/146 (41%), Positives = 78/146 (53%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K    R +R R DD+ ++R R+ R +D++  E D +R     RRHR  DRD D    RDR
Sbjct: 182 KHRHHRSHRSRRDDSREDRHRKSR-RDETPVEGDERRHEKESRRHR--DRDDD----RDR 234

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
           R D DRR    R   D+D E++RDRR            R RDR+ DR HR  DRD D+E 
Sbjct: 235 RRDRDRR----RDREDEDGERDRDRR------------RDRDRDRDREHRRRDRDEDDE- 277

Query: 90  ERDHRRRYKDDSEEDDRKRNRDRRYR 13
            R  R R +DD +   R+R+R R  R
Sbjct: 278 SRHRRHRDEDDKDRKPRRRSRSRSPR 303

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 42/107 (39%), Positives = 58/107 (54%)
 Frame = -1

Query: 435 RRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDND 256
           RR+RDRDDD ++ RDR            DR+RDR        +D DG+ +++R R  D D
Sbjct: 223 RRHRDRDDDRDRRRDR------------DRRRDR--------EDEDGERDRDRRRDRDRD 262

Query: 255 RRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
           R     RR RD+D+E  R RR R +DD + +  R+R R+   R R D
Sbjct: 263 RDREHRRRDRDEDDE-SRHRRHRDEDDKDRK-PRRRSRSRSPRRRDD 307

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 49/145 (33%), Positives = 68/145 (46%), Gaps = 10/145 (6%)
 Frame = -1

Query: 414 DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER 235
           ++ +KE +   R  D      DRK      R HR    D   ++ R  R D       ER
Sbjct: 161 EEKKKEVEEARRNADKK----DRKHKHRHHRSHRSRRDDSREDRHRKSRRDETPVEGDER 216

Query: 234 RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG----------DNEKER 85
           RH     EKE  RR R +DD     DR+RDR  DRR   +D DG          D +++R
Sbjct: 217 RH-----EKE-SRRHRDRDDDR---DRRRDR--DRRRDREDEDGERDRDRRRDRDRDRDR 265

Query: 84  DHRRRYKDDSEEDDRKRNRDRRYRD 10
           +HRRR +D+ +E   +R+RD   +D
Sbjct: 266 EHRRRDRDEDDESRHRRHRDEDDKD 290

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 46/150 (30%), Positives = 73/150 (48%), Gaps = 11/150 (7%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRG 247
           ++ DDD+      +G   ++ ++E +  R RN D++ R   +   +   R RR D+  R 
Sbjct: 147 QEHDDDDPM----KGFLIEEKKKEVEEAR-RNADKKDR-KHKHRHHRSHRSRRDDS--RE 198

Query: 246 NGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR----HRVDDRDGDNEKERDH 79
           +  R+ R D+   E D R   + + E    R RD + DRR     R D  D D E++RD 
Sbjct: 199 DRHRKSRRDETPVEGDER---RHEKESRRHRDRDDDRDRRRDRDRRRDREDEDGERDRDR 255

Query: 78  RRRYKDDSEEDDRKRNRD-------RRYRD 10
           RR    D + + R+R+RD       RR+RD
Sbjct: 256 RRDRDRDRDREHRRRDRDEDDESRHRRHRD 285

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 40/155 (25%), Positives = 73/155 (47%), Gaps = 17/155 (10%)
 Frame = -1

Query: 432 RYRDRDDDNEKE----------RDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           RY+ RDD++ +E          R+ +   +D+S EE  R+     +R   +  ++ D++ 
Sbjct: 94  RYKARDDEDPEEFKVGWEDIMKREGQALSEDESSEEEQRRPMLPEERELALLMQEHDDDD 153

Query: 282 -------ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
                  E  ++   + R N +++ R   +   R  R R +DDS E+  RK  R+     
Sbjct: 154 PMKGFLIEEKKKEVEEARRNADKKDRKHKHRHHRSHRSR-RDDSREDRHRKSRRDET--- 209

Query: 123 RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
                +GD  +     RR++D  ++ DR+R+RDRR
Sbjct: 210 ---PVEGDERRHEKESRRHRDRDDDRDRRRDRDRR 241

[49][TOP]
>UniRef100_UPI0001A5EDA6 PREDICTED: hypothetical protein n=1 Tax=Homo sapiens
           RepID=UPI0001A5EDA6
          Length = 290

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 57/159 (35%), Positives = 91/159 (57%), Gaps = 15/159 (9%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           KR+R+RR ++++ +  ++R+++   + D E E  + R+R  DR  R  +RD D EKER+R
Sbjct: 97  KRDRERRRKEKETNRNRDREKQTEIERDREREKQKGRERERDRG-RERERDRDREKERER 155

Query: 270 RGDNDRRGNGE---RRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR----- 130
           + + DR G  E    R RD + EK+++R     R R + D+E+E +R+ DR  DR     
Sbjct: 156 QTEKDRDGQRETETERERDREREKQKERETERDRDRQR-DTEKERERQTDRERDRQRKTQ 214

Query: 129 --RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
             R R  DR+G+ E +R  R R +D     +R R RDR+
Sbjct: 215 TERQRETDREGERETDR-RRERQRDRDRGKERDRERDRK 252

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 54/154 (35%), Positives = 85/154 (55%), Gaps = 13/154 (8%)
 Frame = -1

Query: 429 YRDRD-DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK----ERDR-- 271
           ++D D DD ++ERDR  R K + E + DRKRDR   R+ +  +R+ D EK    ERDR  
Sbjct: 69  HKDADGDDRQRERDRV-REKTEKERDRDRKRDRERRRKEKETNRNRDREKQTEIERDRER 127

Query: 270 ---RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDR 109
              +G    R  G  R RD D EKER+R+     D + E + +R+R+ +R   + R  +R
Sbjct: 128 EKQKGRERERDRGRERERDRDREKERERQTEKDRDGQRETETERERDREREKQKERETER 187

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
           D D +++ +  R  + D E D +++ +  R R+T
Sbjct: 188 DRDRQRDTEKERERQTDRERDRQRKTQTERQRET 221

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 56/152 (36%), Positives = 83/152 (54%), Gaps = 8/152 (5%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKER------DRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDG 295
           +R RDR R R+RD D EKER      DR G+ + ++E E DR+R++  +R    D DR  
Sbjct: 134 ERERDRGRERERDRDREKERERQTEKDRDGQRETETERERDREREKQKERETERDRDRQR 193

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
           D EKER+R+ D +R     +R    + ++E DR G  + D   E  R RDR G  R R  
Sbjct: 194 DTEKERERQTDRER---DRQRKTQTERQRETDREGERETDRRRERQRDRDR-GKERDRER 249

Query: 114 DRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           DR  + +KER   R+ +   ++ + KR  D++
Sbjct: 250 DRKEERKKERKKERKKERKEKKKEEKRREDKK 281

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 54/159 (33%), Positives = 86/159 (54%), Gaps = 16/159 (10%)
 Frame = -1

Query: 447 RNRDR---------RYRDRDDDNEKERDRRGRYKDDSEEEFDRKR----DRNGDRR---H 316
           RNRDR         R R++    E+ERDR    + D + E +R+R    DR+G R     
Sbjct: 111 RNRDREKQTEIERDREREKQKGRERERDRGRERERDRDREKERERQTEKDRDGQRETETE 170

Query: 315 RVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
           R  DR+ + +KER+   D DR+ + E + R+   ++ERDR+ + + + + E DR+ +R  
Sbjct: 171 RERDREREKQKERETERDRDRQRDTE-KERERQTDRERDRQRKTQTERQRETDREGERET 229

Query: 135 DRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           DRR R   RD D  KERD  R  K++ +++ +K  +  R
Sbjct: 230 DRR-RERQRDRDRGKERDRERDRKEERKKERKKERKKER 267

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 39/146 (26%), Positives = 83/146 (56%), Gaps = 1/146 (0%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDGD 292
           +R+   +++RD + R+ + + E++R+R  + + ++E + DR+RD   +R  + D +RD  
Sbjct: 152 ERERQTEKDRDGQ-RETETERERDREREKQKERETERDRDRQRDTEKERERQTDRERDRQ 210

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            + + +R+ + DR G    R  D   E++RDR      D  +E DR+RDR  +R+     
Sbjct: 211 RKTQTERQRETDREG---ERETDRRRERQRDR------DRGKERDRERDRKEERK----- 256

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRKR 34
           ++   E++++ + + K++   +D+KR
Sbjct: 257 KERKKERKKERKEKKKEEKRREDKKR 282

[50][TOP]
>UniRef100_UPI00017F0566 PREDICTED: similar to mCG119432 n=1 Tax=Sus scrofa
            RepID=UPI00017F0566
          Length = 1588

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 59/157 (37%), Positives = 90/157 (57%), Gaps = 13/157 (8%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
            RD R R+RD + ++ER+R    + D E E +R+ +R    R R  +R+ + EKERDR  +
Sbjct: 673  RDERARERDRERDRERERERERERDREREKERELERE---RAREREREREREKERDRDRE 729

Query: 261  NDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRD-----G 103
             DR  + ER R R+ D EKER+R  R +++ E E +R+R+R  +R R R  +RD      
Sbjct: 730  RDRDHDRERERERERDREKERERE-REREERERERERERERERERAREREKERDRQRDWE 788

Query: 102  DNEKERDHRRRYKDDSEED------DRKRNRDRRYRD 10
            D +K R+ RR  +DD+ ED        +R   +RYR+
Sbjct: 789  DKDKGREERREKRDDAREDRNPRDGHEERKSKKRYRN 825

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 57/157 (36%), Positives = 86/157 (54%), Gaps = 18/157 (11%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRR--------GRY----KDDSEEE--FDRKRDRNGDRRHRVDDR 301
            +RR+ +R+  + +ERD+R        GR     +D+  EE   DR  DR  D R R  DR
Sbjct: 624  ERRHGERERRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRAEDRR-DERARERDR 682

Query: 300  DGDNEKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
            + D E+ER+R  + DR    ER   R R  + E+ER+R      + E + DR+RDR+ DR
Sbjct: 683  ERDRERERERERERDREREKERELERERARERERERER------EKERDRDRERDRDHDR 736

Query: 129  -RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             R R  +RD + E+ER+  R  ++   E +R+R R+R
Sbjct: 737  ERERERERDREKEREREREREERERERERERERERER 773

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 48/145 (33%), Positives = 84/145 (57%), Gaps = 4/145 (2%)
 Frame = -1

Query: 432  RYRDRDDDNEKERDRRGRYKDDSEEEFD---RKRDRNGDR-RHRVDDRDGDNEKERDRRG 265
            R++ R+D+ E++  R  R  D +E+  D   R+RDR  DR R R  +R+ D E+E++R  
Sbjct: 647  RHQGRNDELERDERREERRVDRAEDRRDERARERDRERDRERERERERERDREREKEREL 706

Query: 264  DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
            + +R    ER  R+ + E++RDR      D E E +R+RDR  +R    +  + + E+ER
Sbjct: 707  ERERARERERE-REREKERDRDRERDRDHDRERERERERDREKEREREREREERERERER 765

Query: 84   DHRRRYKDDSEEDDRKRNRDRRYRD 10
            + R R ++ + E +++R+R R + D
Sbjct: 766  E-RERERERAREREKERDRQRDWED 789

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 53/156 (33%), Positives = 91/156 (58%), Gaps = 6/156 (3%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDG 295
            +R+   +R RDR R ++R+ + E+ R+R    + + E + DR+RDR+ DR R R  +RD 
Sbjct: 687  ERERERERERDREREKERELERERAREREREREREKERDRDRERDRDHDRERERERERDR 746

Query: 294  DNEKERDR-RGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR 127
            + E+ER+R R + +R    ER   R R  + EKERDR+ R  +D ++  + +R++  D R
Sbjct: 747  EKEREREREREERERERERERERERERAREREKERDRQ-RDWEDKDKGREERREKRDDAR 805

Query: 126  HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
               + RDG   +ER  ++RY+++     R+  + RR
Sbjct: 806  EDRNPRDG--HEERKSKKRYRNEGSPSPRQSPKRRR 839

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 62/192 (32%), Positives = 90/192 (46%), Gaps = 41/192 (21%)
 Frame = -1

Query: 468  QRKMIWKRNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDG 295
            +R+   +R+RDR  RDRD D E+ER+R R R K+   E    +R+R  +R R R  +R  
Sbjct: 717  EREREKERDRDRE-RDRDHDRERERERERDREKEREREREREERERERERERERERERAR 775

Query: 294  DNEKERDRRGD--NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN------ 139
            + EKERDR+ D  +  +G  ERR + DD  ++R+ R    D  EE   +KR RN      
Sbjct: 776  EREKERDRQRDWEDKDKGREERREKRDDAREDRNPR----DGHEERKSKKRYRNEGSPSP 831

Query: 138  --GDRRHRVDDRDGD--------NEKER---------------------DHRRRYKDDSE 52
                +R R    D D        NEK R                     D + R+K++  
Sbjct: 832  RQSPKRRREHSPDSDTYNSGDDKNEKHRLLSQVVRPQESRSLSPSHLTEDRQSRWKEEDR 891

Query: 51   EDDRKRNRDRRY 16
            + +RK +  RRY
Sbjct: 892  KPERKES-SRRY 902

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 53/161 (32%), Positives = 78/161 (48%), Gaps = 35/161 (21%)
 Frame = -1

Query: 387  RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR--------GDNDRRGNGERR 232
            R RY +   E  ++ RD + +RRH   +R+  + +ERD+R        G ND     ERR
Sbjct: 606  RDRYPE--RENREQARDSSFERRH--GERERRDNRERDQRPSSPIRHQGRNDELERDERR 661

Query: 231  H--RDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-----------------RHRV 118
               R D  E  RD R R +D   D E E +R+R+R+ +R                 R R 
Sbjct: 662  EERRVDRAEDRRDERARERDRERDRERERERERERDREREKERELERERARERERERERE 721

Query: 117  DDRDGDNEKERDH-----RRRYKDDSEEDDRKRNRDRRYRD 10
             +RD D E++RDH     R R +D  +E +R+R R+ R R+
Sbjct: 722  KERDRDRERDRDHDRERERERERDREKEREREREREERERE 762

[51][TOP]
>UniRef100_UPI0000E469DC PREDICTED: similar to CG7564-PA n=1 Tax=Strongylocentrotus
           purpuratus RepID=UPI0000E469DC
          Length = 472

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 61/179 (34%), Positives = 90/179 (50%), Gaps = 18/179 (10%)
 Frame = -1

Query: 486 VGIRMIQRKMIW-------KRNRDRRYRDRDDDNEKE-----RDRRGRYKDDSEEEFDRK 343
           +G   I+ K+ W       +R + R  R+RDD+ E +     RDRR R   D E E DR 
Sbjct: 197 LGFIEIREKLQWLLNYSEQQREQRRMERERDDEEEPKSSSSYRDRRDRGDRDKEREKDRD 256

Query: 342 RDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEE 163
           ++R+ DR     DRD D +++RDR  D DR  + +R    + + + RDR      D +++
Sbjct: 257 KERDRDR-----DRDRDRDRDRDRDRDRDRDRDRDRDRERESSSRNRDRDRNRDRDRDQD 311

Query: 162 FDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRN------RDRRYRDTS 4
            DR RDR+ +R  R       + + R  R R K  S++ DRK N      RDRR+R  S
Sbjct: 312 RDRDRDRDRERDRRRSRSKSRSNRHRRSRSRDKKRSKDRDRKSNRSRDPDRDRRHRSRS 370

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 61/153 (39%), Positives = 82/153 (53%), Gaps = 6/153 (3%)
 Frame = -1

Query: 441 RDRRYR-DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           RDRR R DRD + EK+RD+        E + DR RDR+ DR     DRD D +++RDR  
Sbjct: 239 RDRRDRGDRDKEREKDRDK--------ERDRDRDRDRDRDR-----DRDRDRDRDRDRDR 285

Query: 264 DNDRRGNGERRHRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRN---GDRRHRVDDRDGD 100
           D DR      R+RD D  ++RDR + R +D D + E DR+R R+    +R  R   RD  
Sbjct: 286 DRDRERESSSRNRDRDRNRDRDRDQDRDRDRDRDRERDRRRSRSKSRSNRHRRSRSRDKK 345

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDRRYRDTSC 1
             K+RD +     D + D R R+R R  RD  C
Sbjct: 346 RSKDRDRKSNRSRDPDRDRRHRSRSRD-RDRHC 377

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 56/144 (38%), Positives = 80/144 (55%), Gaps = 3/144 (2%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           R+RDR R RDRD D +++RDR R R ++ S    DR R+R+ D R +  DRD D ++ERD
Sbjct: 265 RDRDRDRDRDRDRDRDRDRDRDRDRERESSSRNRDRDRNRDRD-RDQDRDRDRDRDRERD 323

Query: 273 RRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           RR    + R N  RR R  D ++ +DR        + + +R RD + DRRHR   RD D 
Sbjct: 324 RRRSRSKSRSNRHRRSRSRDKKRSKDR--------DRKSNRSRDPDRDRRHRSRSRDRDR 375

Query: 96  EKERDHRRRYKDDSEEDDRKRNRD 25
             +R HR R ++ S    R  + +
Sbjct: 376 HCDRRHRSRSRERSSRHSRSHSHE 399

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 57/157 (36%), Positives = 80/157 (50%), Gaps = 11/157 (7%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDGDNEKER 277
           R+RDR R RDRD D +++RDR R R ++      +R RDRN DR    D DRD D ++ER
Sbjct: 263 RDRDRDRDRDRDRDRDRDRDRDRDRDRERESSSRNRDRDRNRDRDRDQDRDRDRDRDRER 322

Query: 276 DRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK-------RDRNGDRRHR 121
           DRR    + R N  RR R  D ++ +DR  +     + + DR+       RDR+ DRRHR
Sbjct: 323 DRRRSRSKSRSNRHRRSRSRDKKRSKDRDRKSNRSRDPDRDRRHRSRSRDRDRHCDRRHR 382

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
              R+  +   R H     +  EE   K  +   Y +
Sbjct: 383 SRSRERSSRHSRSHSHESGETKEEPRVKETKVSDYEE 419

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 50/168 (29%), Positives = 73/168 (43%), Gaps = 33/168 (19%)
 Frame = -1

Query: 447 RNRDR---RYRDRDDDNEKERDRR-------------GRYKD-----DSEEEFDRKRDRN 331
           RNRDR   + RDRD D ++ERDRR              R +D     D + + +R RD +
Sbjct: 302 RNRDRDRDQDRDRDRDRDRERDRRRSRSKSRSNRHRRSRSRDKKRSKDRDRKSNRSRDPD 361

Query: 330 GDRRHRVD--DRDGDNEKERDRRGDNDRRGNGERRHRDDDNE-KERDRRGRYKDDSEEEF 160
            DRRHR    DRD   ++ R R    +R     R H  +  E KE  R    K    EE 
Sbjct: 362 RDRRHRSRSRDRDRHCDR-RHRSRSRERSSRHSRSHSHESGETKEEPRVKETKVSDYEEG 420

Query: 159 DRKRD---------RNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDD 43
           + ++D         +   +R R+   + D E   D +    D++ E+D
Sbjct: 421 EMRQDDYEAPPTEMKTETKRERMSSPE-DGEDREDEKGNEMDENPEED 467

[52][TOP]
>UniRef100_A9TSN9 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9TSN9_PHYPA
          Length = 1072

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 57/163 (34%), Positives = 96/163 (58%), Gaps = 14/163 (8%)
 Frame = -1

Query: 453 WKRNRD--RRYRDR----DDDNEKERDRRGRYKDDSE----EEFDRKRDRNGDRRHRVDD 304
           W+R RD  R++R+R    D D EKERD R R + D +    ++ +++RDR G  R R   
Sbjct: 19  WERERDKERKHREREKRGDRDLEKERDERKRSRRDDDGVEVKDKEKERDRKGGERDREGK 78

Query: 303 RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-R 127
           ++ D E+ER+R  + +R  + +RR +D+D  +ER+   R K++ E E +++R R  ++ R
Sbjct: 79  KERDREREREREAEEER--DRKRRKKDEDESREREEI-REKEEREREREKERLREREKER 135

Query: 126 HRVDDRDGDNEKERDH---RRRYKDDSEEDDRKRNRDRRYRDT 7
            R ++R+   E+ER+    R R KD  +E DR++ RD+    T
Sbjct: 136 DREEEREKSREREREREKSRDRDKDKEKEKDREKGRDKHRERT 178

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 57/157 (36%), Positives = 86/157 (54%), Gaps = 10/157 (6%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV-------DDRDGD 292
           ++ RDR+  +RD + +KERDR    + ++EEE DRKR +  +   R        ++R+ +
Sbjct: 63  EKERDRKGGERDREGKKERDREREREREAEEERDRKRRKKDEDESREREEIREKEERERE 122

Query: 291 NEKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 121
            EKER R  + +R    ER   R R+ + EK RDR      D E+E DR++ R+   +HR
Sbjct: 123 REKERLREREKERDREEEREKSREREREREKSRDR----DKDKEKEKDREKGRD---KHR 175

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
              RD D ++ERD R      S E DR R+R RR ++
Sbjct: 176 ERTRDKDRDRERDLR------SGEGDRDRDRKRRRKE 206

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 55/161 (34%), Positives = 82/161 (50%), Gaps = 17/161 (10%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDN-------EKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHR 313
           ++ RD R R R DD+       EKERDR+G       + + D E E +R+ +   DR+ R
Sbjct: 41  EKERDERKRSRRDDDGVEVKDKEKERDRKGGERDREGKKERDREREREREAEEERDRKRR 100

Query: 312 VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD 133
             D D   E+E  R          E+  R+ + EKER R    + D EEE ++ R+R  +
Sbjct: 101 KKDEDESREREEIR----------EKEEREREREKERLREREKERDREEEREKSRERERE 150

Query: 132 RRHRVDDRDGDNEKERDH---RRRYKDDSEEDDRKRNRDRR 19
            R +  DRD D EKE+D    R ++++ + + DR R RD R
Sbjct: 151 -REKSRDRDKDKEKEKDREKGRDKHRERTRDKDRDRERDLR 190

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 52/151 (34%), Positives = 85/151 (56%), Gaps = 3/151 (1%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGD 292
           +R+   +  RDR+ R +D+D  +ER       ++  E+ +R+R+R  +R R R  +RD +
Sbjct: 86  EREREAEEERDRKRRKKDEDESRER-------EEIREKEEREREREKERLREREKERDRE 138

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVD 115
            E+E+ R  + +R    + R RD D EKE+DR +GR K        R+R R+ DR    D
Sbjct: 139 EEREKSRERERERE---KSRDRDKDKEKEKDREKGRDK-------HRERTRDKDRDRERD 188

Query: 114 DRDGDNEKERDHRRRYK-DDSEEDDRKRNRD 25
            R G+ +++RD +RR K +D+  DD K  +D
Sbjct: 189 LRSGEGDRDRDRKRRRKEEDAARDDLKVKKD 219

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 49/148 (33%), Positives = 75/148 (50%), Gaps = 1/148 (0%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R   R   +R+ + EKER R    + D EEE ++ R+R  +R  +  DRD D EKE+DR
Sbjct: 109 EREEIREKEEREREREKERLREREKERDREEEREKSRERERERE-KSRDRDKDKEKEKDR 167

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR-DGDNE 94
               D+      R RD D ++ERD R     + + + DRKR R  +   R D +   D E
Sbjct: 168 EKGRDKH---RERTRDKDRDRERDLR---SGEGDRDRDRKRRRKEEDAARDDLKVKKDPE 221

Query: 93  KERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            + D     K   EE D++R R + +++
Sbjct: 222 NDEDPEEEQKRLDEEIDKRRRRVQEWQE 249

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 51/144 (35%), Positives = 75/144 (52%), Gaps = 12/144 (8%)
 Frame = -1

Query: 405 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHR 226
           +K RDR   Y D  +E ++R+RD+  +R+HR          ER++RGD D          
Sbjct: 4   DKYRDREKDYGD--KEHWERERDK--ERKHR----------EREKRGDRDL--------- 40

Query: 225 DDDNEKERDRRGRYK--------DDSEEEFDRK---RDRNGDR-RHRVDDRDGDNEKERD 82
               EKERD R R +         D E+E DRK   RDR G + R R  +R+ + E+ERD
Sbjct: 41  ----EKERDERKRSRRDDDGVEVKDKEKERDRKGGERDREGKKERDREREREREAEEERD 96

Query: 81  HRRRYKDDSEEDDRKRNRDRRYRD 10
            +RR KD+ E  +R+  R++  R+
Sbjct: 97  RKRRKKDEDESREREEIREKEERE 120

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 46/152 (30%), Positives = 84/152 (55%), Gaps = 10/152 (6%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDR-----RGRYKD-DSEEEFDRKRDRNGDRRHRV 310
           +R+   +R R+R + RDR+++ EK R+R     + R +D D E+E DR++ R+   +HR 
Sbjct: 120 EREREKERLREREKERDREEEREKSREREREREKSRDRDKDKEKEKDREKGRD---KHRE 176

Query: 309 DDRDGDNEKERD-RRGDNDRRGNGERRHRDDDNEKE--RDRRGRYKDDSEEEFDRKRDRN 139
             RD D ++ERD R G+ DR  + +RR +++D  ++  + ++    D+  EE  ++ D  
Sbjct: 177 RTRDKDRDRERDLRSGEGDRDRDRKRRRKEEDAARDDLKVKKDPENDEDPEEEQKRLDEE 236

Query: 138 GDRRHRVDDRDGDNEKERDHRRRYKDDSEEDD 43
            D+R R      +  + +D   R K +S + D
Sbjct: 237 IDKRRRRVQEWQELRRRKDEEDRQKRESVQAD 268

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 44/154 (28%), Positives = 78/154 (50%), Gaps = 6/154 (3%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDN 289
           K  R+R R ++R  + EKERDR    +   E E +R++ R+ D+     + R   RD   
Sbjct: 116 KEEREREREKERLREREKERDREEEREKSREREREREKSRDRDKDKEKEKDREKGRDKHR 175

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
           E+ RD+  D +R    + R  + D +++R RR + +D + ++   K+D   D     + +
Sbjct: 176 ERTRDKDRDRER----DLRSGEGDRDRDRKRRRKEEDAARDDLKVKKDPENDEDPEEEQK 231

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
             D E ++  RRR ++  E   RK   DR+ R++
Sbjct: 232 RLDEEIDK-RRRRVQEWQELRRRKDEEDRQKRES 264

[53][TOP]
>UniRef100_B3MZ35 GF21909 n=1 Tax=Drosophila ananassae RepID=B3MZ35_DROAN
          Length = 608

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 57/147 (38%), Positives = 79/147 (53%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           +R R+ RDRD + +++RDR    + D + E DR RDR+ D R R  DRD D E+ER+R  
Sbjct: 129 SRPRQERDRDRERDRDRDR----ERDRDRERDRDRDRDRD-RDRDRDRDRDRERERERDR 183

Query: 264 DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
           D +R      R RD ++ K   R  R K+ S     R+R+R    R R  +RD D E++R
Sbjct: 184 DREREKRDLERSRDREHNKSDHRHYRTKESSSNSGHRERERERGDRDRERERDRDRERDR 243

Query: 84  DHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           +  R         DR R+RDRR  D S
Sbjct: 244 ERDR---------DRDRDRDRRRSDKS 261

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 52/153 (33%), Positives = 73/153 (47%), Gaps = 5/153 (3%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           R RDR R RDRD D +++RDR      D E E +R RDR  ++R     RD ++ K   R
Sbjct: 147 RERDRDRERDRDRDRDRDRDRDRDRDRDRERERERDRDREREKRDLERSRDREHNKSDHR 206

Query: 270 ----RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
               +  +   G+ ER     D ++ER+R      D + E DR+RDR+ DR    D R  
Sbjct: 207 HYRTKESSSNSGHRERERERGDRDRERER------DRDRERDRERDRDRDRDR--DRRRS 258

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           D      H  + K+  +E     +R RR R  S
Sbjct: 259 DKSSRHHHSGKDKEQRKEHHHNHDRSRRRRGDS 291

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 53/157 (33%), Positives = 78/157 (49%), Gaps = 10/157 (6%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDR---NGDRRH----RVDDRDG 295
           R+RDR R RDRD D ++ER+R R R ++  + + +R RDR     D RH          G
Sbjct: 159 RDRDRDRDRDRDRDRDRERERERDRDREREKRDLERSRDREHNKSDHRHYRTKESSSNSG 218

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKR-DRNGDRRHRV 118
             E+ER+ RGD DR      R RD + ++ERDR      D + + DR+R D++    H  
Sbjct: 219 HRERERE-RGDRDRE---RERDRDRERDRERDR------DRDRDRDRRRSDKSSRHHHSG 268

Query: 117 DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
            D++   E   +H R  +   +   R  +R R   DT
Sbjct: 269 KDKEQRKEHHHNHDRSRRRRGDSRSRSGSRSRSANDT 305

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 52/164 (31%), Positives = 79/164 (48%), Gaps = 18/164 (10%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRD-------- 298
           R+RDR R RDRD + E+ERDR R R K D E   DR+ +++  R +R  +          
Sbjct: 163 RDRDRDRDRDRDRERERERDRDREREKRDLERSRDREHNKSDHRHYRTKESSSNSGHRER 222

Query: 297 ----GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
               GD ++ER+R  D +R      R RD D +++RDRR   K        + +++  + 
Sbjct: 223 ERERGDRDRERERDRDRER-----DRERDRDRDRDRDRRRSDKSSRHHHSGKDKEQRKEH 277

Query: 129 RHRVD---DRDGDNEKERDHRRRYKDDSEEDDRKRN-RDRRYRD 10
            H  D    R GD+      R R  +D+    R+R+ R R  R+
Sbjct: 278 HHNHDRSRRRRGDSRSRSGSRSRSANDTPPASRRRHYRSRSPRE 321

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 35/86 (40%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = -1

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNE 94
           R D D   +  R+ RD D E++RDR      D E + DR+RDR+ DR R R  DRD D +
Sbjct: 121 RIDEDSHPSRPRQERDRDRERDRDR------DRERDRDRERDRDRDRDRDRDRDRDRDRD 174

Query: 93  KERDHRRRYKDDSEEDDRKRNRDRRY 16
           +ER+  R    + E+ D +R+RDR +
Sbjct: 175 RERERERDRDREREKRDLERSRDREH 200

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 34/93 (36%), Positives = 47/93 (50%), Gaps = 3/93 (3%)
 Frame = -1

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRD 106
           + D      R+     R RD D ++ERDR      D E + DR RDR+ DR R R  DR+
Sbjct: 123 DEDSHPSRPRQERDRDRERDRDRDRERDR------DRERDRDRDRDRDRDRDRDRDRDRE 176

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRD--RRYR 13
            + E++RD  R  +D     DR+ N+   R YR
Sbjct: 177 RERERDRDREREKRDLERSRDREHNKSDHRHYR 209

[54][TOP]
>UniRef100_UPI0000F2DFC4 PREDICTED: similar to RIKEN cDNA 3110050K21 n=1 Tax=Monodelphis
            domestica RepID=UPI0000F2DFC4
          Length = 1589

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 55/144 (38%), Positives = 84/144 (58%), Gaps = 3/144 (2%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRG 265
            R+ R  DR DD   ER R    + + E E +R+R+R+ +R + R  +RD   E+ER+R  
Sbjct: 659  REERRIDRTDDRRDERARERERERERERERERERERDREREKERELERDRARERERERER 718

Query: 264  DNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 91
            + DR  + ER  RD D E+ER+R R R K+   E  +R+R+R  +R R R  +R  + EK
Sbjct: 719  EKDRERDRER-DRDHDREREREREREREKEREREREERERERERERERERERERGREREK 777

Query: 90   ERDHRRRYKDDSEEDDRKRNRDRR 19
            ERD +R ++D   +D R++  D R
Sbjct: 778  ERDRQRDWEDKGRDDRREKREDIR 801

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 57/161 (35%), Positives = 90/161 (55%), Gaps = 11/161 (6%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
            +R+   +R R+R R R+R+ + E ERDR    + + E E DR+RDR  DR H   DR+ +
Sbjct: 681  ERERERERERERERDREREKERELERDRAREREREREREKDRERDRERDRDH---DRERE 737

Query: 291  NEKERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRD-----RNGDR 130
             E+ER+R  + +R      R R+ + E+ER+R RGR   + E+E DR+RD     R+  R
Sbjct: 738  REREREREKEREREREERERERERERERERERERGR---EREKERDRQRDWEDKGRDDRR 794

Query: 129  RHRVDDRDGDNEK----ERDHRRRYKDDSEEDDRKRNRDRR 19
              R D R+  N +    ER  ++R++ +S    R+  + RR
Sbjct: 795  EKREDIREDRNPRDVHDERKSKKRHRTESSLSPRQSPKRRR 835

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 50/145 (34%), Positives = 78/145 (53%), Gaps = 6/145 (4%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRGRYKDDSE---EEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
            +RR+ +RD  + +ERD R       +   +E +R   R   R  R DDR  +  +ER+R 
Sbjct: 622  ERRHGERDRRDNRERDPRPNSPVRHQGRGDELERDERREERRIDRTDDRRDERARERERE 681

Query: 267  GDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
             + +R    ER   R R+ + E ERDR    + + E E DR+RDR  DR H   DR+ + 
Sbjct: 682  RERERERERERERDREREKERELERDRAREREREREREKDRERDRERDRDH---DRERER 738

Query: 96   EKERDHRRRYKDDSEEDDRKRNRDR 22
            E+ER+  +  + + EE +R+R R+R
Sbjct: 739  EREREREKEREREREERERERERER 763

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 56/194 (28%), Positives = 92/194 (47%), Gaps = 38/194 (19%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR---RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHR 313
            R  +R+   +R +DR   R RDRD D E+ER+R R R K+   E  +R+R+R  +R R R
Sbjct: 708  RAREREREREREKDRERDRERDRDHDREREREREREREKEREREREERERERERERERER 767

Query: 312  VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKER-------DRRGRYKDDSEEEFDR 154
              +R  + EKERDR+ D + +G  +RR + +D  ++R       +R+ + +  +E     
Sbjct: 768  ERERGREREKERDRQRDWEDKGRDDRREKREDIREDRNPRDVHDERKSKKRHRTESSLSP 827

Query: 153  KRDRNGDRRHRVD-----DRDGDNEKER---------------------DHRRRYKDDSE 52
            ++     R H  D       D  NEK R                     D + R+K++  
Sbjct: 828  RQSPKRRREHSPDSDTYNSGDDKNEKHRLLSQVVRPQESRSLSPSHMAEDRQNRWKEEDR 887

Query: 51   EDDRKRNRDRRYRD 10
            + +RK +  RRY +
Sbjct: 888  KTERKES-SRRYEE 900

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 53/156 (33%), Positives = 79/156 (50%), Gaps = 13/156 (8%)
 Frame = -1

Query: 438  DRRYRDRDDDNEK---ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
            D R + RD   E+   ERDRR   + D       +    GD   R + R+   E+  DR 
Sbjct: 611  DARDQARDSSFERRHGERDRRDNRERDPRPNSPVRHQGRGDELERDERRE---ERRIDRT 667

Query: 267  GDNDRRGNGERRHRDDDNEKERDR---RGRYKD---DSEEEFDRKRDRNGDR-RHRVDDR 109
              +DRR   + R R+ + E+ER+R   R R +D   + E E +R R R  +R R R  DR
Sbjct: 668  --DDRR---DERARERERERERERERERERERDREREKERELERDRAREREREREREKDR 722

Query: 108  DGDNEKERDH---RRRYKDDSEEDDRKRNRDRRYRD 10
            + D E++RDH   R R ++   E +R+R R+ R R+
Sbjct: 723  ERDRERDRDHDREREREREREREKEREREREERERE 758

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 45/149 (30%), Positives = 72/149 (48%), Gaps = 5/149 (3%)
 Frame = -1

Query: 453  WKRNRDRRYRDRDDDNEKERD---RRGRYKDDSEEEFDRKRDRNGDRRH--RVDDRDGDN 289
            W        RDR D  ++ RD    R   + D  +  +R    N   RH  R D+ + D 
Sbjct: 598  WDSRSGYPERDRYDARDQARDSSFERRHGERDRRDNRERDPRPNSPVRHQGRGDELERDE 657

Query: 288  EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
             +E  R    D R +   R R+ + E+ER+R    + D E E +R+ +R+   R R  +R
Sbjct: 658  RREERRIDRTDDRRDERARERERERERERERERERERDREREKERELERDR-ARERERER 716

Query: 108  DGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            + + ++ERD R R +D   E +R+R R+R
Sbjct: 717  EREKDRERD-RERDRDHDRERERERERER 744

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 53/187 (28%), Positives = 77/187 (41%), Gaps = 45/187 (24%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRK-----------RDRNGDRRHRVDDR 301
            R   R     +  NE   DR GR +    E  ++             +  G+     D R
Sbjct: 542  RTETRNDSRNESRNESRSDRTGRSRGRGPELPEKGGRGTRGSQVDGHNSGGNYHESWDSR 601

Query: 300  DGDNEKER-------------DRRGDNDRRGNGER--------RHRDDDNEKERDRRGRY 184
             G  E++R              R G+ DRR N ER        RH+   +E ERD R   
Sbjct: 602  SGYPERDRYDARDQARDSSFERRHGERDRRDNRERDPRPNSPVRHQGRGDELERDERREE 661

Query: 183  K-----DDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERD-----HRRRYKDDSEEDD 43
            +     DD  +E  R+R+R  +R   R R  +RD + EKER+      R R ++   E D
Sbjct: 662  RRIDRTDDRRDERARERERERERERERERERERDREREKERELERDRAREREREREREKD 721

Query: 42   RKRNRDR 22
            R+R+R+R
Sbjct: 722  RERDRER 728

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 41/150 (27%), Positives = 66/150 (44%), Gaps = 8/150 (5%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRK--RDRNGDRRHRVDDRDGDNEKE-- 280
           ++ DRR+  R+D   K  +R    +++ E + D+   RD   DR    + RDG + +E  
Sbjct: 409 QSHDRRHERREDTRGKRENREKETREEREYDQDQSSSRDHRDDR----ESRDGRDRRETR 464

Query: 279 --RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
             RDRR   + R   + R   D N   +D R +    S  +    RDR     HR +D  
Sbjct: 465 DTRDRRELKESRDVRDSRDTRDYNRDNKDSRDQRDSRSTRDTHDYRDRESRDTHRKEDTY 524

Query: 105 GDNEKE--RDHRRRYKDDSEEDDRKRNRDR 22
            ++ +   R+H R     +E  +  RN  R
Sbjct: 525 QEDSRSYGRNHGREESSRTETRNDSRNESR 554

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 44/154 (28%), Positives = 71/154 (46%), Gaps = 6/154 (3%)
 Frame = -1

Query: 468  QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
            +++++   +RDR  + +  +   ER  R       E       DR   R H       ++
Sbjct: 1152 RKRVLHSSSRDRE-KTKSLEIPGERKSRIDQLKRGEPSRSTSSDRQDSRSHSSRRSSPES 1210

Query: 288  EKE-RDRRGDNDRRGNGERRHRDD-DNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRV 118
            +++   R G  D R   + R R D D E+ER+RR    +  + E+DR  D++  R R R+
Sbjct: 1211 DRQVHSRSGSFDSRERLQERDRHDHDRERERERR----ETRQREWDRDTDKDWPRNRDRL 1266

Query: 117  DDRDGDNEKERD---HRRRYKDDSEEDDRKRNRD 25
             +R+ + +K RD    R R   DS E DR R  D
Sbjct: 1267 RERERERDKRRDLDRERERQNPDSSERDRDRTLD 1300

[55][TOP]
>UniRef100_B9Q1B2 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1
           RepID=B9Q1B2_TOXGO
          Length = 473

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 55/151 (36%), Positives = 82/151 (54%), Gaps = 8/151 (5%)
 Frame = -1

Query: 453 WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDD-----RD 298
           W+  R+   RDR+ D ++ERDR      D E E DR+RDR+ +R   R R  D     RD
Sbjct: 275 WREKREPGDRDRERDRDRERDRDRERDRDRERERDRERDRDRERERERERERDYEKERRD 334

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
            D ++ R RR + + R     R R +D+E+ER RR R +++ EEE DRKR ++ D   ++
Sbjct: 335 EDEDERRRRRREEEERERRRERRRWEDDERERRRRDR-REEREEEGDRKRRKHEDEERKL 393

Query: 117 DDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
            DR  D    R  + + + D   +DR+  RD
Sbjct: 394 RDRPDDRYSSRSKQVKERGD---EDRRHRRD 421

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 58/173 (33%), Positives = 88/173 (50%), Gaps = 21/173 (12%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRD-----RRYRDRDDDNEKERDRRGRYKDDSEEEF--------DRKRD 337
           R++Q++M  K+        ++ R+ + +N       G  K+DS E +        DR R+
Sbjct: 228 RVLQQRMKQKQQEQEQLLLQQVRELEAENGVAEQSEGTRKEDSGEGWWREKREPGDRDRE 287

Query: 336 RNGDR-RHRVDDRDGDNEKERDRRGDNDRRGNGER-------RHRDDDNEKERDRRGRYK 181
           R+ DR R R  +RD D E+ERDR  D DR    ER       + R D++E ER RR R +
Sbjct: 288 RDRDRERDRDRERDRDRERERDRERDRDRERERERERERDYEKERRDEDEDERRRRRREE 347

Query: 180 DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           ++ E   +R+R  + +R  R  DR  + E+E D +RR  +D E   R R  DR
Sbjct: 348 EERERRRERRRWEDDERERRRRDRREEREEEGDRKRRKHEDEERKLRDRPDDR 400

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 47/151 (31%), Positives = 73/151 (48%), Gaps = 9/151 (5%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYK-----DDSEEEFDRKRDRNGDRRHRVDDRDGDNE 286
           +R RDR  RDRD + E+ER+R   Y+     +D +E   R+R+     R R   R  D+E
Sbjct: 305 ERERDRE-RDRDRERERERERERDYEKERRDEDEDERRRRRREEEERERRRERRRWEDDE 363

Query: 285 KER---DRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRV 118
           +ER   DRR + +  G+ +RR  +D+  K RDR   RY   S++  +R  +   DRRHR 
Sbjct: 364 RERRRRDRREEREEEGDRKRRKHEDEERKLRDRPDDRYSSRSKQVKERGDE---DRRHRR 420

Query: 117 DDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
           D      ++       +  +      K+  D
Sbjct: 421 DAEQPSGDRAEKKAPAFSLEKNASREKKGDD 451

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 50/159 (31%), Positives = 84/159 (52%), Gaps = 8/159 (5%)
 Frame = -1

Query: 462 KMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           + +W   +++  +++     +   +R + K   +E+   ++ R  +  + V ++     K
Sbjct: 208 QQLWLLQKEQLRKEQKQLQRRVLQQRMKQKQQEQEQLLLQQVRELEAENGVAEQSEGTRK 267

Query: 282 ERDRRGD-NDRRGNGER-RHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
           E    G   ++R  G+R R RD D E++RDR R R   D E E DR+RDR+ + R R  +
Sbjct: 268 EDSGEGWWREKREPGDRDRERDRDRERDRDRERDR---DRERERDRERDRDRE-RERERE 323

Query: 111 RDGDNEKER-----DHRRRYKDDSEEDDRKRNRDRRYRD 10
           R+ D EKER     D RRR + + EE +R+R R RR+ D
Sbjct: 324 RERDYEKERRDEDEDERRRRRREEEERERRRER-RRWED 361

[56][TOP]
>UniRef100_B3LCC3 Eukaryotic translation initiation factor 3 subunit 10, putative n=1
            Tax=Plasmodium knowlesi strain H RepID=B3LCC3_PLAKH
          Length = 1283

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 64/158 (40%), Positives = 83/158 (52%), Gaps = 9/158 (5%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            +R RDR  RDRD + E+ERDR   ++ D +   DR +DR    R R  DRD +  KERD 
Sbjct: 1066 ERERDRE-RDRDRERERERDRDRIFRKDRDYRRDRSKDR---ERERSRDRDREYRKERDY 1121

Query: 270  RGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG--DRRHRVDDRD 106
            RGD DR     R   R RD D  ++RDR  R  DD   + D K DR+   DR +R  +R 
Sbjct: 1122 RGDRDREYRSYRDKERDRDRDYRRDRDRDYRRDDDYRRDRDYKNDRDDKLDRDYRKVERS 1181

Query: 105  GDNEKERDHRRRYKDDSEED----DRKRNRDRRYRDTS 4
            G  E E   RRR +D+ E +    D K+N +    D S
Sbjct: 1182 GKGEHE---RRRDRDEEEYERNDLDVKKNHNIHDEDDS 1216

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 56/160 (35%), Positives = 76/160 (47%), Gaps = 18/160 (11%)
 Frame = -1

Query: 438  DRRYRD---RDDDNEKERDRRGRYKDDSE--EEFDRKRDRN----GDRRHRVDDRDGDNE 286
            D+ YR     DD + K  D+ G   D+    +  D  +D +     DRR R D    D E
Sbjct: 1007 DKYYRKPSYEDDFSWKRGDKAGSQHDEDSNYKRLDDAQDSSYIDRSDRRERRDWPGRDRE 1066

Query: 285  KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
            +ERDR  D DR           + E+ERDR   ++ D +   DR +DR    R R  DRD
Sbjct: 1067 RERDRERDRDR-----------ERERERDRDRIFRKDRDYRRDRSKDR---ERERSRDRD 1112

Query: 105  GDNEKERDHR-------RRYKDDSEEDDR--KRNRDRRYR 13
             +  KERD+R       R Y+D   + DR  +R+RDR YR
Sbjct: 1113 REYRKERDYRGDRDREYRSYRDKERDRDRDYRRDRDRDYR 1152

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 54/142 (38%), Positives = 74/142 (52%), Gaps = 3/142 (2%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
            +D  Y DR D  E+ RD  GR   D E E DR+RDR             D E+ER+R  D
Sbjct: 1044 QDSSYIDRSDRRER-RDWPGR---DRERERDRERDR-------------DRERERERDRD 1086

Query: 261  N-DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKE 88
               R+    RR R  D E+ER R      D + E+ ++RD  GDR R     RD + +++
Sbjct: 1087 RIFRKDRDYRRDRSKDRERERSR------DRDREYRKERDYRGDRDREYRSYRDKERDRD 1140

Query: 87   RDHRR-RYKDDSEEDDRKRNRD 25
            RD+RR R +D   +DD +R+RD
Sbjct: 1141 RDYRRDRDRDYRRDDDYRRDRD 1162

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 56/160 (35%), Positives = 79/160 (49%), Gaps = 23/160 (14%)
 Frame = -1

Query: 447  RNRDR---RYRDRDDDNEKERDRRG----RYKDDSEEEFDRKRD--RNGDRRHRVDD--- 304
            R++DR   R RDRD +  KERD RG     Y+   ++E DR RD  R+ DR +R DD   
Sbjct: 1099 RSKDRERERSRDRDREYRKERDYRGDRDREYRSYRDKERDRDRDYRRDRDRDYRRDDDYR 1158

Query: 303  RDGDNEKERDRRGDND-----RRGNGERRHRDDDNEKERDRRG---RYKDDSEEEFDRKR 148
            RD D + +RD + D D     R G GE   R D +E+E +R     +   +  +E D  R
Sbjct: 1159 RDRDYKNDRDDKLDRDYRKVERSGKGEHERRRDRDEEEYERNDLDVKKNHNIHDEDDSVR 1218

Query: 147  DRNGDRRHRVDDRDGDNE---KERDHRRRYKDDSEEDDRK 37
               G   H  +D DG N    KE++     KD ++ +  K
Sbjct: 1219 VEKGKEGHSGNDSDGANHHHLKEKEKMTNGKDITKNEQAK 1258

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 52/156 (33%), Positives = 78/156 (50%), Gaps = 18/156 (11%)
 Frame = -1

Query: 465  RKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-------RHRVD 307
            R  I++++RD R RDR  D E+ER R      D + E+ ++RD  GDR       R +  
Sbjct: 1085 RDRIFRKDRDYR-RDRSKDRERERSR------DRDREYRKERDYRGDRDREYRSYRDKER 1137

Query: 306  DRDGDNEKERDR--RGDND-RRGNGERRHRDDDNEK-----ERDRRG---RYKDDSEEEF 160
            DRD D  ++RDR  R D+D RR    +  RDD  ++     ER  +G   R +D  EEE+
Sbjct: 1138 DRDRDYRRDRDRDYRRDDDYRRDRDYKNDRDDKLDRDYRKVERSGKGEHERRRDRDEEEY 1197

Query: 159  DRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSE 52
            +R  D +  + H + D D     E+       +DS+
Sbjct: 1198 ER-NDLDVKKNHNIHDEDDSVRVEKGKEGHSGNDSD 1232

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 56/163 (34%), Positives = 79/163 (48%), Gaps = 12/163 (7%)
 Frame = -1

Query: 465  RKMIWKRNRDRRYRDRDDDNE----KERDRRG-RY--KDDSEEEFDRKRDRNGDRRHRVD 307
            RK + + +R +R RD + + +    KE  R G +Y  K   E++F  KR   GD+     
Sbjct: 975  RKKLDEISRIQRERDLEIEQQLLKRKEESRIGDKYYRKPSYEDDFSWKR---GDKAGSQH 1031

Query: 306  DRDGDNEKERDRRGDNDRRGNGERRHRDD----DNEKERDRRGRYKDDSEEEFDRKRDRN 139
            D D  N K  D   D+      +RR R D    D E+ERDR      + E E DR R   
Sbjct: 1032 DEDS-NYKRLDDAQDSSYIDRSDRRERRDWPGRDRERERDRERDRDRERERERDRDRIFR 1090

Query: 138  GDRRHRVD-DRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
             DR +R D  +D + E+ RD  R Y+   +E D + +RDR YR
Sbjct: 1091 KDRDYRRDRSKDRERERSRDRDREYR---KERDYRGDRDREYR 1130

[57][TOP]
>UniRef100_B6QII3 Arginine rich protein n=1 Tax=Penicillium marneffei ATCC 18224
            RepID=B6QII3_PENMQ
          Length = 821

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 62/160 (38%), Positives = 83/160 (51%), Gaps = 14/160 (8%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRG-RY-----------KDDSEEEFDRKRDRNGDRRHRVD 307
            +R RDR  RDR  D E  R+ RG RY           + D     DR R+++GD  H   
Sbjct: 663  ERERDRE-RDRPRDQEWNREPRGDRYIPGVTTGDRDTEGDKSGNRDRDRNKDGDNSH--- 718

Query: 306  DRDGDNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
            D+DG  + +RDR  D DR R   + R RD+D E++R R     D  +   DR RDR+ DR
Sbjct: 719  DKDGARDHDRDRDHDRDRNRDTDKDRTRDEDRERDRPRARDVDDRDDRARDRDRDRDRDR 778

Query: 129  -RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
             R R  DRD D E++R+  R    D +    +R+RDRR R
Sbjct: 779  DRDRDRDRDRDRERDRERERERGRDRDRSRDRRDRDRRDR 818

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 64/160 (40%), Positives = 84/160 (52%), Gaps = 14/160 (8%)
 Frame = -1

Query: 447 RNRDR----RYRDRDDDNEKERDRRGRYKDD--------SEEEFDRKRDRNGDRRHRVDD 304
           RN+ R    R RDR+DD    R  R   +D         S+   DR+RDR+ DR HR   
Sbjct: 395 RNKSRDGSIRLRDREDDRHSVRSHRDERRDRAARQSRSRSKARNDRERDRD-DRSHRASR 453

Query: 303 RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-R 127
           R     K RDR  + DR  + +RR RD D E++RDR        + + DR+RDR+ DR R
Sbjct: 454 RSRTRSKTRDR--ERDRVDSRDRRERDRDRERDRDR--------DRDRDRERDRDRDRER 503

Query: 126 HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
            R  DRD + +++RD  R   D   E DR R+RDR R RD
Sbjct: 504 DRDRDRDRERDRDRDRDRDRVDRDRERDRDRDRDRDRDRD 543

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 59/156 (37%), Positives = 84/156 (53%), Gaps = 12/156 (7%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRRGRYKD-----DSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +R+R R + RDR+ D    RDRR R +D     D + + DR+RDR+ D R R  DRD D 
Sbjct: 453 RRSRTRSKTRDRERDRVDSRDRRERDRDRERDRDRDRDRDRERDRDRD-RERDRDRDRDR 511

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEF-----DRKRDRNGDRR 127
           E++RDR  D DR      R RD D +++RDR R  + D   + +     DR R+R    R
Sbjct: 512 ERDRDRDRDRDRVDRDRERDRDRDRDRDRDRDRDNFLDRGYDRYTGRDMDRSRERE-QAR 570

Query: 126 HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            R  +RD D  +++D  R    D ++  R R+R RR
Sbjct: 571 KRSAERDRDRSRDKDKNRDRPRDRDDRPRSRSRHRR 606

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 61/160 (38%), Positives = 86/160 (53%), Gaps = 13/160 (8%)
 Frame = -1

Query: 444 NRDRRYRDRDD----DNEKERDR-RGRYKD---DSEEEFDRKRDRNGDR-RHRVD-DRDG 295
           +RDRR RDRD     D +++RDR R R +D   D + + DR+RDR+ DR R RVD DR+ 
Sbjct: 471 SRDRRERDRDRERDRDRDRDRDRERDRDRDRERDRDRDRDRERDRDRDRDRDRVDRDRER 530

Query: 294 DNEKERDRRGDNDRRG---NGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
           D +++RDR  D DR      G  R+   D ++ R+R    K  +E + DR RD++ +R  
Sbjct: 531 DRDRDRDRDRDRDRDNFLDRGYDRYTGRDMDRSREREQARKRSAERDRDRSRDKDKNR-- 588

Query: 123 RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
              DR  D +     R R++      DR R R RR R  S
Sbjct: 589 ---DRPRDRDDRPRSRSRHRRSPSRTDRSRTRHRRDRSGS 625

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 64/168 (38%), Positives = 86/168 (51%), Gaps = 24/168 (14%)
 Frame = -1

Query: 441 RDRRYRDRDDDNE----------KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           R+ R RDRDD +           K RDR  R + DS +  +R RDR  DR     DRD D
Sbjct: 437 RNDRERDRDDRSHRASRRSRTRSKTRDRE-RDRVDSRDRRERDRDRERDR-----DRDRD 490

Query: 291 NEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH--- 124
            ++ERDR  D +R  + +R R RD D +++RDR  R   D E + DR RDR+ DR     
Sbjct: 491 RDRERDRDRDRERDRDRDRDRERDRDRDRDRDRVDR---DRERDRDRDRDRDRDRDRDNF 547

Query: 123 ------RVDDRDGDNEKERDHRRRYKDDSEED---DRKRNRDR-RYRD 10
                 R   RD D  +ER+  R+   + + D   D+ +NRDR R RD
Sbjct: 548 LDRGYDRYTGRDMDRSREREQARKRSAERDRDRSRDKDKNRDRPRDRD 595

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 62/170 (36%), Positives = 83/170 (48%), Gaps = 25/170 (14%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDRRHRVDDRD------ 298
           +RDRR + R     +   R     R + +D S    DR+ DR+  R HR + RD      
Sbjct: 371 SRDRRRKSRTRSRTRRSSRYETEGRNKSRDGSIRLRDREDDRHSVRSHRDERRDRAARQS 430

Query: 297 -----GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR---RGRYKDDSEEEFDRKRDR 142
                  N++ERDR  D   R +   R R    ++ERDR   R R + D + E DR RDR
Sbjct: 431 RSRSKARNDRERDR-DDRSHRASRRSRTRSKTRDRERDRVDSRDRRERDRDRERDRDRDR 489

Query: 141 NGDR-----RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
           + DR     R R  DRD D ++ERD  R    D  + DR+R+RDR R RD
Sbjct: 490 DRDRERDRDRDRERDRDRDRDRERDRDRDRDRDRVDRDRERDRDRDRDRD 539

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 56/141 (39%), Positives = 75/141 (53%), Gaps = 3/141 (2%)
 Frame = -1

Query: 423  DRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRR 250
            DRD + +K  +R R R KD D+  + D  RD + DR H   DRD + + ++DR  D DR 
Sbjct: 695  DRDTEGDKSGNRDRDRNKDGDNSHDKDGARDHDRDRDH---DRDRNRDTDKDRTRDEDRE 751

Query: 249  GNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR 73
             +  R    DD    RD R R +D D + + DR RDR+ DR     DR+ D E+ER+  R
Sbjct: 752  RDRPRARDVDD----RDDRARDRDRDRDRDRDRDRDRDRDR-----DRERDRERERERGR 802

Query: 72   RYKDDSEEDDRKRNRDRRYRD 10
                     DR R+RDRR RD
Sbjct: 803  ---------DRDRSRDRRDRD 814

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 60/164 (36%), Positives = 80/164 (48%), Gaps = 17/164 (10%)
 Frame = -1

Query: 444  NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDR------NGDRRHRVDDRDGDN-- 289
            NR R  R R    E+ERDR      D E   + + DR       GDR     D +GD   
Sbjct: 650  NRSRSPRRRMRSPERERDRERDRPRDQEWNREPRGDRYIPGVTTGDR-----DTEGDKSG 704

Query: 288  --EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN-----GDR 130
              +++R++ GDN    +G R H D D + +RDR      D   + DR+RDR       DR
Sbjct: 705  NRDRDRNKDGDNSHDKDGARDH-DRDRDHDRDRNRDTDKDRTRDEDRERDRPRARDVDDR 763

Query: 129  RHRVDDRDGDNEKERDH-RRRYKDDSEEDDRKRNRDR-RYRDTS 4
              R  DRD D +++RD  R R +D   E DR+R R+R R RD S
Sbjct: 764  DDRARDRDRDRDRDRDRDRDRDRDRDRERDRERERERGRDRDRS 807

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 71/200 (35%), Positives = 95/200 (47%), Gaps = 57/200 (28%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVD-----DRDGD 292
            +R+RDR R RDRD D ++ERDR    + D + + DR+RDR+ DR R RVD     DRD D
Sbjct: 476  ERDRDRERDRDRDRDRDRERDRDRDRERDRDRDRDRERDRDRDRDRDRVDRDRERDRDRD 535

Query: 291  NEKERDRRGDN----------------------DRRGNGER-RHRDDDNEKERDRRGRYK 181
             +++RDR  DN                       R+ + ER R R  D +K RD R R +
Sbjct: 536  RDRDRDRDRDNFLDRGYDRYTGRDMDRSREREQARKRSAERDRDRSRDKDKNRD-RPRDR 594

Query: 180  DD----------SEEEFDR-----KRDRNGD-----RRHRVDDR-DGD------NEKERD 82
            DD          S    DR     +RDR+G      RR R  D+ D D      + + R 
Sbjct: 595  DDRPRSRSRHRRSPSRTDRSRTRHRRDRSGSRTSTRRRSRTPDQLDIDRYVPVTSNRSRS 654

Query: 81   HRRRYKDDSEEDDRKRNRDR 22
             RRR +    E DR+R+R R
Sbjct: 655  PRRRMRSPERERDRERDRPR 674

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 49/127 (38%), Positives = 67/127 (52%), Gaps = 2/127 (1%)
 Frame = -1

Query: 444  NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRR 268
            NRDR   DR+ D +   D+ G    D + + DR R+R+ D+ R R +DR+ D  + RD  
Sbjct: 705  NRDR---DRNKDGDNSHDKDGARDHDRDRDHDRDRNRDTDKDRTRDEDRERDRPRARDV- 760

Query: 267  GDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
             D D R     R RD D +++RDR R R   D E + +R+R+R  DR    D RD D   
Sbjct: 761  DDRDDRARDRDRDRDRDRDRDRDRDRDR---DRERDRERERERGRDRDRSRDRRDRD--- 814

Query: 90   ERDHRRR 70
             RD  RR
Sbjct: 815  RRDRSRR 821

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 43/140 (30%), Positives = 64/140 (45%), Gaps = 7/140 (5%)
 Frame = -1

Query: 420 RDDDNEKERDRRGRYKDDSEEEFDRK-RDRNGDRRHRVDDRDGDNEK---ERDRRGDNDR 253
           RD   ++ R  R R +      ++ + R+++ D   R+ DR+ D       RD R D   
Sbjct: 368 RDSSRDRRRKSRTRSRTRRSSRYETEGRNKSRDGSIRLRDREDDRHSVRSHRDERRDRAA 427

Query: 252 RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR 73
           R +  R    +D E++RD R            + RDR  DR    D R+ D ++ERD  R
Sbjct: 428 RQSRSRSKARNDRERDRDDRSHRASRRSRTRSKTRDRERDRVDSRDRRERDRDRERDRDR 487

Query: 72  RYKDDSEED---DRKRNRDR 22
               D E D   DR+R+RDR
Sbjct: 488 DRDRDRERDRDRDRERDRDR 507

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 57/201 (28%), Positives = 79/201 (39%), Gaps = 54/201 (26%)
 Frame = -1

Query: 447  RNRDR---------RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR--------- 322
            R+RDR         RY  RD D  +ER++  +   + + +  R +D+N DR         
Sbjct: 540  RDRDRDNFLDRGYDRYTGRDMDRSREREQARKRSAERDRDRSRDKDKNRDRPRDRDDRPR 599

Query: 321  ---RHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDD-----------NEKERDRRGRY 184
               RHR      D  + R RR  +  R +  RR R  D           + + R  R R 
Sbjct: 600  SRSRHRRSPSRTDRSRTRHRRDRSGSRTSTRRRSRTPDQLDIDRYVPVTSNRSRSPRRRM 659

Query: 183  KDDSEE---EFDRKRDRNGDRRHRVD-----------DRDGDNEKERDHRRRY------- 67
            +    E   E DR RD+  +R  R D           D +GD    RD  R         
Sbjct: 660  RSPERERDRERDRPRDQEWNREPRGDRYIPGVTTGDRDTEGDKSGNRDRDRNKDGDNSHD 719

Query: 66   KDDSEEDDRKRNRDR-RYRDT 7
            KD + + DR R+ DR R RDT
Sbjct: 720  KDGARDHDRDRDHDRDRNRDT 740

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 52/155 (33%), Positives = 67/155 (43%), Gaps = 23/155 (14%)
 Frame = -1

Query: 405 EKERDRRGRYKDDSEEEFDRK--RDRNGDRRHRVDDRDGDNEKER-DRRGDNDRRGNGER 235
           E  R    R K  +E  F     RD + DRR +   R       R +  G N  R    R
Sbjct: 345 ESGRKPSARPKSVTESRFPATGTRDSSRDRRRKSRTRSRTRRSSRYETEGRNKSRDGSIR 404

Query: 234 -RHRDDD-------NEKERDRRGRY-KDDSEEEFDRKRDRNGDRRHRVD----------D 112
            R R+DD        ++ RDR  R  +  S+   DR+RDR+ DR HR            D
Sbjct: 405 LRDREDDRHSVRSHRDERRDRAARQSRSRSKARNDRERDRD-DRSHRASRRSRTRSKTRD 463

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
           R+ D    RD R R +D   + DR R+RDR R RD
Sbjct: 464 RERDRVDSRDRRERDRDRERDRDRDRDRDRERDRD 498

[58][TOP]
>UniRef100_UPI000175FB1B PREDICTED: similar to WD repeat domain 60 n=1 Tax=Danio rerio
           RepID=UPI000175FB1B
          Length = 1095

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 59/170 (34%), Positives = 92/170 (54%), Gaps = 16/170 (9%)
 Frame = -1

Query: 465 RKMIWKRNRDRRYRDRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVD 307
           R   +KR   R  R ++   E+E+ R G       RY  D +E  +R+RDR  DR   + 
Sbjct: 126 RNQDFKREDVREDRHKERRREREKARHGDGDEDEKRYYRDDKENGERRRDREKDRNVDMY 185

Query: 306 DRDGDNEKERDRRGDN-----DRRGNGERRHRDDDNEKERDRRGRYK----DDSEEEFDR 154
           +++ D E+ERDRR        + RG GE+  R+ D E+ER+RR R++    D    E+D 
Sbjct: 186 NQE-DKERERDRRRAERARRKEERGEGEKEERERDKERERERRERHRARESDRYRLEYDE 244

Query: 153 KRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           K+ R G+RR R  D++    KER+HRR   D  +++ R+R+++     TS
Sbjct: 245 KQ-REGERRERHSDKEHSGHKEREHRR---DREDKERRRRDKESHMAKTS 290

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 53/152 (34%), Positives = 81/152 (53%), Gaps = 8/152 (5%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           + DRR+RD D D  +E+++R R ++ S+   D +RDRN D + R D R+ D  KER R  
Sbjct: 92  SEDRRHRDPDRDPRREKEKR-REREGSKHR-DPERDRNQDFK-REDVRE-DRHKERRRER 147

Query: 264 DNDRRGNG---ERRHRDDDNEKERDRRGRYKDDS-----EEEFDRKRDRNGDRRHRVDDR 109
           +  R G+G   E+R+  DD E    RR R KD +     +E+ +R+RDR    R R  + 
Sbjct: 148 EKARHGDGDEDEKRYYRDDKENGERRRDREKDRNVDMYNQEDKERERDRRRAERARRKEE 207

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
            G+ EKE   R + ++    +  +     RYR
Sbjct: 208 RGEGEKEERERDKERERERRERHRARESDRYR 239

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 50/153 (32%), Positives = 78/153 (50%), Gaps = 12/153 (7%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDR 271
           R R  R R +++  E E++ R R K+   E  +R R R  DR R   D++  + E+ R+R
Sbjct: 196 RRRAERARRKEERGEGEKEERERDKERERERRERHRARESDRYRLEYDEKQREGER-RER 254

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGR----YKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
             D +  G+ ER HR D  +KER RR +     K     E +  R    D +     +DG
Sbjct: 255 HSDKEHSGHKEREHRRDREDKERRRRDKESHMAKTSHSREAEHHRQELKDSKDFHGIKDG 314

Query: 102 DNEK-----ERDHRRRYKD--DSEEDDRKRNRD 25
           ++EK     ER H R++K+  DS+  DR++ +D
Sbjct: 315 ESEKAREERERRHERKHKEASDSKRSDREQKQD 347

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 57/164 (34%), Positives = 78/164 (47%), Gaps = 31/164 (18%)
 Frame = -1

Query: 408 NEKERDRRGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEK--------------ERD 274
           NE+ R R  R     EEE  + RD  + DRRHR  DRD   EK              ERD
Sbjct: 71  NEESRRRSKR-----EEEHRKHRDGESEDRRHRDPDRDPRREKEKRREREGSKHRDPERD 125

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVD 115
           R  D  R    E RH++   E+E+ R G       RY  D +E  +R+RDR  DR   + 
Sbjct: 126 RNQDFKREDVREDRHKERRREREKARHGDGDEDEKRYYRDDKENGERRRDREKDRNVDMY 185

Query: 114 DRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRD 10
           +++ D E+ERD RR         R + + EE +R + R+R  R+
Sbjct: 186 NQE-DKERERDRRRAERARRKEERGEGEKEERERDKERERERRE 228

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 45/175 (25%), Positives = 82/175 (46%), Gaps = 31/175 (17%)
 Frame = -1

Query: 435 RRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV-----------DDRDGDN 289
           R YRD  ++ E+ RDR      D   + D++R+R+  R  R            ++R+ D 
Sbjct: 161 RYYRDDKENGERRRDREKDRNVDMYNQEDKERERDRRRAERARRKEERGEGEKEERERDK 220

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDRRHRV 118
           E+ER+RR  +  R +   R   D+ ++E +RR R+ D      +E + +RDR    R R 
Sbjct: 221 ERERERRERHRARESDRYRLEYDEKQREGERRERHSDKEHSGHKEREHRRDREDKERRRR 280

Query: 117 DDRD----GDNEKERDHRRRYKDDSEE-------------DDRKRNRDRRYRDTS 4
           D         + +E +H R+   DS++             ++R+R  +R++++ S
Sbjct: 281 DKESHMAKTSHSREAEHHRQELKDSKDFHGIKDGESEKAREERERRHERKHKEAS 335

[59][TOP]
>UniRef100_UPI0000E818EB PREDICTED: hypothetical protein n=1 Tax=Gallus gallus
           RepID=UPI0000E818EB
          Length = 642

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/159 (33%), Positives = 94/159 (59%), Gaps = 14/159 (8%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDR 271
           R+RD++ RD++   EKE+ +      D E+E DR RD+  +R R +  +RD D EK++DR
Sbjct: 343 RSRDKK-RDKEKVKEKEKTKEKERDRDKEKERDRDRDKEREREREKERNRDKDREKDKDR 401

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDN- 97
             D +R  + +R  RD + EKE+D + + ++D ++  ++  DR+G+R R ++ DR+GD  
Sbjct: 402 NKDRERVKDRDR-DRDKEREKEKDEKEKDREDVDQNKEKDDDRDGERDREKMKDREGDKD 460

Query: 96  -----------EKERDHRRRYKDDSEEDDRKRNRDRRYR 13
                      EKE+D  +  + + E DD+K+ +D+R R
Sbjct: 461 KGGDKEKDREKEKEKDGDKEREREKERDDKKK-KDKRSR 498

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 58/149 (38%), Positives = 83/149 (55%), Gaps = 4/149 (2%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           +R+RD+ + RDRD D E+ER+R      D + E D+  DRN DR  RV DRD D +KER+
Sbjct: 364 ERDRDKEKERDRDRDKEREREREKERNRDKDREKDK--DRNKDRE-RVKDRDRDRDKERE 420

Query: 273 RRGDN---DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
           +  D    DR    + + +DDD + ERDR      D E + D+  D+  DR  +  ++DG
Sbjct: 421 KEKDEKEKDREDVDQNKEKDDDRDGERDREKM--KDREGDKDKGGDKEKDRE-KEKEKDG 477

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRY 16
           D E+ER+  R   D  ++D R R   R Y
Sbjct: 478 DKEREREKER--DDKKKKDKRSRTPPRSY 504

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 54/176 (30%), Positives = 94/176 (53%), Gaps = 20/176 (11%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDR-----RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 313
           R   R  + KR+R R     R R R  D ++++++    +   E+E DR +++  DR   
Sbjct: 319 RRRSRSPLKKRSRSRERRKSRSRSRSRDKKRDKEKVKEKEKTKEKERDRDKEKERDR--- 375

Query: 312 VDDRDGDNEKER--------DRRGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDS 172
             DRD + E+ER        DR  D DR  + ER     R RD + EKE+D + + ++D 
Sbjct: 376 --DRDKEREREREKERNRDKDREKDKDRNKDRERVKDRDRDRDKEREKEKDEKEKDREDV 433

Query: 171 EEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRR-RYKDDSEEDDRKRNRDRRYRD 10
           ++  ++  DR+G+R R ++ DR+GD +K  D  + R K+  ++ D++R R++   D
Sbjct: 434 DQNKEKDDDRDGERDREKMKDREGDKDKGGDKEKDREKEKEKDGDKEREREKERDD 489

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 49/158 (31%), Positives = 85/158 (53%), Gaps = 11/158 (6%)
 Frame = -1

Query: 447 RNRDR-----RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDN- 289
           RN+DR     R RDRD + EKE+D + + ++D ++  ++  DR+G+R R ++ DR+GD  
Sbjct: 401 RNKDRERVKDRDRDRDKEREKEKDEKEKDREDVDQNKEKDDDRDGERDREKMKDREGDKD 460

Query: 288 ---EKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 121
              +KE+DR  + ++ G+ ER R ++ D++K++D+R R    S     R R  + +RR R
Sbjct: 461 KGGDKEKDREKEKEKDGDKEREREKERDDKKKKDKRSRTPPRSYSSSRRSRSSSRERRKR 520

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
                  + K     +R    +    R +   +R RDT
Sbjct: 521 KSRSLSKSPKTSKGTKRKSSRTPSPRRNKKEKKRERDT 558

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 50/146 (34%), Positives = 76/146 (52%), Gaps = 4/146 (2%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKER 277
           R++DRR R R    ++ R R  R         D+KRD+   +   + +  +RD D EKER
Sbjct: 315 RHKDRR-RSRSPLKKRSRSRERRKSRSRSRSRDKKRDKEKVKEKEKTKEKERDRDKEKER 373

Query: 276 DRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           DR  D +R    E+ R+RD D EK++DR      D E   DR RDR+ +R    D+++ D
Sbjct: 374 DRDRDKEREREREKERNRDKDREKDKDR----NKDRERVKDRDRDRDKEREKEKDEKEKD 429

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDR 22
            E    ++ +  D   E DR++ +DR
Sbjct: 430 REDVDQNKEKDDDRDGERDREKMKDR 455

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 48/147 (32%), Positives = 69/147 (46%), Gaps = 4/147 (2%)
 Frame = -1

Query: 450 KRNRDRRY-RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH-RVDDRDGDNEKER 277
           K  R R + R     + K R RR R          R +DR   R   +   R  +  K R
Sbjct: 281 KGGRSRSHSRSESRSSSKSRSRRKR-SHSKHRSLSRHKDRRRSRSPLKKRSRSRERRKSR 339

Query: 276 DRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDG 103
            R    D++ + E+ + ++   EKERDR      D E+E DR RD+  +R R +  +RD 
Sbjct: 340 SRSRSRDKKRDKEKVKEKEKTKEKERDR------DKEKERDRDRDKEREREREKERNRDK 393

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDR 22
           D EK++D   R KD     DR R+RD+
Sbjct: 394 DREKDKD---RNKDRERVKDRDRDRDK 417

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 33/134 (24%), Positives = 62/134 (46%), Gaps = 4/134 (2%)
 Frame = -1

Query: 411 DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDND---RRGNG 241
           ++ K  +R+G           R   ++  RR R   +     + +DRR       +R   
Sbjct: 273 ESGKSSERKGGRSRSHSRSESRSSSKSRSRRKRSHSKHRSLSRHKDRRRSRSPLKKRSRS 332

Query: 240 ERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDGDNEKERDHRRRYK 64
             R +     + RD++   +   E+E  ++++R+ D+    D DRD + E+ER+ + R +
Sbjct: 333 RERRKSRSRSRSRDKKRDKEKVKEKEKTKEKERDRDKEKERDRDRDKERERERE-KERNR 391

Query: 63  DDSEEDDRKRNRDR 22
           D   E D+ RN+DR
Sbjct: 392 DKDREKDKDRNKDR 405

[60][TOP]
>UniRef100_UPI0000E7FBBC PREDICTED: similar to KIAA0853 protein n=1 Tax=Gallus gallus
            RepID=UPI0000E7FBBC
          Length = 1689

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 59/151 (39%), Positives = 84/151 (55%), Gaps = 5/151 (3%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRG 265
            RD R  DR DD   ER R    + + + E +R+RDR  +R + R  +RD   E+ER+R  
Sbjct: 762  RDERRVDRSDDRRDERARERERERERDRERERERDREREREKERELERDRARERERERER 821

Query: 264  DNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 91
            D DR    +R  RD D E+ER+R R + ++   EE +R+R+R  DR R R  +R  D +K
Sbjct: 822  DKDRDRERDR-DRDHDREREREREREKEREREREERERERERERDRERERERERGRDRDK 880

Query: 90   ERDHRRRY--KDDSEEDDRKRNRDRRYRDTS 4
            ER+ +R +  KD   ED R R  D R   +S
Sbjct: 881  ERERQRDWDDKDKGREDRRDRREDIREERSS 911

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/152 (34%), Positives = 84/152 (55%), Gaps = 3/152 (1%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
            +R RDR  R+R+ D E+ER++    + D   E +R+R+R+ DR R R  DRD D E+ER+
Sbjct: 784  ERERDRE-RERERDREREREKERELERDRARERERERERDKDRDRERDRDRDHDRERERE 842

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
            R  + +R    E R R+ + E++R+R      + E E  R RD+  +R+   DD+D   E
Sbjct: 843  REREKEREREREERERERERERDRER------ERERERGRDRDKERERQRDWDDKDKGRE 896

Query: 93   KERDHRRRYKDDSEEDD--RKRNRDRRYRDTS 4
              RD R   +++    D   +R   +R+R+ S
Sbjct: 897  DRRDRREDIREERSSRDVHEERKSKKRHRNES 928

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/147 (36%), Positives = 83/147 (56%), Gaps = 8/147 (5%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRG----RYKDDSEE-EFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            +RR+ +RD  + +ERD+R     R++  S++ E D +RD    R  R DDR  +  +ER+
Sbjct: 725  ERRHGERDRRDNRERDQRASSPVRHQGRSDDLERDERRDER--RVDRSDDRRDERARERE 782

Query: 273  RRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
            R  + DR    ER   R R+ + E ERDR    + + E + DR R+R+ DR H   DR+ 
Sbjct: 783  RERERDRERERERDREREREKERELERDRARERERERERDKDRDRERDRDRDH---DRER 839

Query: 102  DNEKERDHRRRYKDDSEEDDRKRNRDR 22
            + E+ER+  R  + +  E +R+R RDR
Sbjct: 840  EREREREKEREREREERERERERERDR 866

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 50/158 (31%), Positives = 84/158 (53%), Gaps = 3/158 (1%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
            R ++R    +R R+R  RD+D D E++RDR    + + E E +++R+R  + R R  +R+
Sbjct: 805  RELERDRARERERERE-RDKDRDRERDRDRDHDREREREREREKEREREREERERERERE 863

Query: 297  GDNEKERDRRGDNDRRGNGERRHRDDDNEKER-DRRGRYKDDSEEEFDR--KRDRNGDRR 127
             D E+ER+R    DR    ER+   DD +K R DRR R +D  EE   R    +R   +R
Sbjct: 864  RDRERERERERGRDRDKERERQRDWDDKDKGREDRRDRREDIREERSSRDVHEERKSKKR 923

Query: 126  HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
            HR +      +  +  RR +  DS+  +   +++ ++R
Sbjct: 924  HRNESSPSPRQSPK-RRREHSPDSDAYNSGDDKNEKHR 960

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 49/147 (33%), Positives = 85/147 (57%), Gaps = 6/147 (4%)
 Frame = -1

Query: 432  RYRDRDDDNEKER---DRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRG 265
            R++ R DD E++    +RR    DD  +E  R+R+R  +R R R  +RD + E+E++R  
Sbjct: 748  RHQGRSDDLERDERRDERRVDRSDDRRDERARERERERERDRERERERDREREREKEREL 807

Query: 264  DNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
            + DR    ER  R+ D +++R+R R R   D + E +R+R+R  +R    ++R+ + E+E
Sbjct: 808  ERDRARERERE-RERDKDRDRERDRDR---DHDREREREREREKEREREREERERERERE 863

Query: 87   RD-HRRRYKDDSEEDDRKRNRDRRYRD 10
            RD  R R ++   + D++R R R + D
Sbjct: 864  RDRERERERERGRDRDKERERQRDWDD 890

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 65/200 (32%), Positives = 93/200 (46%), Gaps = 44/200 (22%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR---RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR---R 319
            R  +R+   +R++DR   R RDRD D E+ER+R R + ++   EE +R+R+R  DR   R
Sbjct: 811  RARERERERERDKDRDRERDRDRDHDREREREREREKEREREREERERERERERDRERER 870

Query: 318  HRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN 139
             R   RD D E+ER R  D+  +G  +RR R +D  +ER  R    D  EE   +KR RN
Sbjct: 871  ERERGRDRDKERERQRDWDDKDKGREDRRDRREDIREERSSR----DVHEERKSKKRHRN 926

Query: 138  --------GDRRHRVDDRDGD--------NEKER---------------------DHRRR 70
                      +R R    D D        NEK R                     D + R
Sbjct: 927  ESSPSPRQSPKRRREHSPDSDAYNSGDDKNEKHRLLSQVVRPQESRSLSPSHVTEDRQSR 986

Query: 69   YKDDSEEDDRKRNRDRRYRD 10
            +K++  + DRK +  RRY +
Sbjct: 987  WKEEERKSDRKES-SRRYEE 1005

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 46/159 (28%), Positives = 77/159 (48%), Gaps = 11/159 (6%)
 Frame = -1

Query: 453  WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFD-RKRDRNGDR--RHRVDDRDGDNEK 283
            W+       RDR D  ++ RD     +    +  D R+RD+      RH+    D + ++
Sbjct: 701  WESRSSYPDRDRYDSRDQARDSSFERRHGERDRRDNRERDQRASSPVRHQGRSDDLERDE 760

Query: 282  ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-------RH 124
             RD R  +      + R R+ + E+ERDR    + D E E +++R+   DR       R 
Sbjct: 761  RRDERRVDRSDDRRDERARERERERERDRERERERDREREREKERELERDRARERERERE 820

Query: 123  RVDDRDGDNEKERDH-RRRYKDDSEEDDRKRNRDRRYRD 10
            R  DRD + +++RDH R R ++   E +R+R R+ R R+
Sbjct: 821  RDKDRDRERDRDRDHDREREREREREKEREREREERERE 859

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 46/150 (30%), Positives = 66/150 (44%), Gaps = 9/150 (6%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEK--ERDRRGD 262
           R R    EK R  R R     +   DR+ +  G R   R   DDRD D E+   RD R D
Sbjct: 495 RHRSPGREKGRHDRDRTSQSHDRRHDRRDETRGKREKERETRDDRDYDQEQSTSRDHRDD 554

Query: 261 NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR--NGDRRHRVDDRDGDNEKE 88
            + R   +RR   D+ ++   R  R   DS +  D  RD   + D+R     RD  + ++
Sbjct: 555 RESRDGRDRRDTRDNRDRRETRESRDTRDSRDTRDYSRDNKDSRDQRDSRSTRDSHDYRD 614

Query: 87  RDHRRRYKDDS--EEDDRKRNRDRRYRDTS 4
           R+ R  +K D   +ED R   R     ++S
Sbjct: 615 RESRDAHKKDDQYQEDSRSYGRSHGREESS 644

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 45/156 (28%), Positives = 68/156 (43%), Gaps = 13/156 (8%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEK-ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD----GDNEK 283
           ++ DRR+  RD+   K E++R  R   D ++E    RD   DR  R D RD     DN  
Sbjct: 513 QSHDRRHDRRDETRGKREKERETRDDRDYDQEQSTSRDHRDDRESR-DGRDRRDTRDNRD 571

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
            R+ R   D R + + R    DN+  RD+R         ++   RDR     H+ DD+  
Sbjct: 572 RRETRESRDTRDSRDTRDYSRDNKDSRDQRDSRSTRDSHDY---RDRESRDAHKKDDQYQ 628

Query: 102 DNE--------KERDHRRRYKDDSEEDDRKRNRDRR 19
           ++         +E   R   ++DS  D R  +R  R
Sbjct: 629 EDSRSYGRSHGREESSRAETRNDSRSDSRNESRSDR 664

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 41/148 (27%), Positives = 68/148 (45%), Gaps = 2/148 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRD--RNGDRRHRVDDRDGDNEKER 277
           + +RDR  +  D  +++  + RG+ + + E   DR  D  ++  R HR D    D    R
Sbjct: 505 RHDRDRTSQSHDRRHDRRDETRGKREKERETRDDRDYDQEQSTSRDHRDDRESRDGRDRR 564

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           D R + DRR   E R    D    RD R  Y  D+++  D++  R+    H   DR+  +
Sbjct: 565 DTRDNRDRRETRESR----DTRDSRDTRD-YSRDNKDSRDQRDSRSTRDSHDYRDRESRD 619

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYR 13
             ++D   +Y++DS    R   R+   R
Sbjct: 620 AHKKDD--QYQEDSRSYGRSHGREESSR 645

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 45/151 (29%), Positives = 66/151 (43%), Gaps = 5/151 (3%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG---DRRH-RVDDRDGDNEKE 280
           R     Y  R   + + +    R++    E+    RDR     DRRH R D+  G  EKE
Sbjct: 473 RRSSSPYPPRSSSSPQRKRSPSRHRSPGREKGRHDRDRTSQSHDRRHDRRDETRGKREKE 532

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           R+    +DR  + E+    D  +    R GR + D+ +  DR+  R  + R   D RD  
Sbjct: 533 RE--TRDDRDYDQEQSTSRDHRDDRESRDGRDRRDTRDNRDRRETR--ESRDTRDSRD-- 586

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDRR-YRD 10
               RD+ R  KD  ++ D +  RD   YRD
Sbjct: 587 ---TRDYSRDNKDSRDQRDSRSTRDSHDYRD 614

[61][TOP]
>UniRef100_UPI0000D9E69D PREDICTED: zinc finger CCCH-type containing 13 n=1 Tax=Macaca mulatta
            RepID=UPI0000D9E69D
          Length = 1696

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 57/149 (38%), Positives = 88/149 (59%), Gaps = 5/149 (3%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD-RRHRVDDRDGDNEKERDRRG 265
            RD R R+RD + E++R+R    + + E E DR+R++  +  R R  +R+ + EKERDR  
Sbjct: 700  RDERARERDRERERDRER----ERERERERDREREKERELERERAREREREREKERDRER 755

Query: 264  DNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 91
            D DR  + ER R R+ D EKER+R  R + + E E +R+R+R  +R R R  +RD + E+
Sbjct: 756  DRDRDHDRERERERERDREKERERE-REERERERERERERERERERERERARERDKERER 814

Query: 90   ERD--HRRRYKDDSEEDDRKRNRDRRYRD 10
            +RD   + + +DD  E   +   DR  RD
Sbjct: 815  QRDWEDKDKGRDDRREKREEIREDRNPRD 843

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 51/152 (33%), Positives = 84/152 (55%), Gaps = 6/152 (3%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKE 280
            R RDR R RDR+ + E+ER+R    + + E E +R R+R  +R   R R  DRD D+++E
Sbjct: 705  RERDRERERDRERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDRE 764

Query: 279  RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
            R+R  + DR    ER   + + E+ER+R    + + E E  R+RD+  +R+   +D+D  
Sbjct: 765  RERERERDREKEREREREERERERERERERERERERERERARERDKERERQRDWEDKDKG 824

Query: 99   NEKERDHRRRYKDDSEEDD--RKRNRDRRYRD 10
             +  R+ R   ++D    D   +R   +RYR+
Sbjct: 825  RDDRREKREEIREDRNPRDGHDERKSKKRYRN 856

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 55/150 (36%), Positives = 88/150 (58%), Gaps = 9/150 (6%)
 Frame = -1

Query: 432  RYRDRDDD---NEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
            R++ R+D+   +E+  +RR    DD  +E  R+RDR    R R  +R+ + E+ERDR  +
Sbjct: 674  RHQGRNDELERDERREERRVDRVDDRRDERARERDR---ERERDRERERERERERDRERE 730

Query: 261  NDRRGNGER-RHRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
             +R    ER R R+ + EKERDR R R +D D E E +R+RDR  +R    ++R+ + E+
Sbjct: 731  KERELERERAREREREREKERDRERDRDRDHDRERERERERDREKEREREREERERERER 790

Query: 90   ERD---HRRRYKDDSEEDDRKRNRDRRYRD 10
            ER+    R R ++ + E D++R R R + D
Sbjct: 791  ERERERERERERERARERDKERERQRDWED 820

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 50/135 (37%), Positives = 75/135 (55%), Gaps = 7/135 (5%)
 Frame = -1

Query: 405  EKERDRRG------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGN 244
            EK RD+R       + ++D  E  +R+ +R  DR   VDDR  +  +ERDR  + DR   
Sbjct: 662  EKIRDQRPSSPIRHQGRNDELERDERREERRVDR---VDDRRDERARERDRERERDRERE 718

Query: 243  GER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRY 67
             ER R RD + EKER+       + E E +++RDR  DR  R  DR+ + E+ERD  +  
Sbjct: 719  RERERERDREREKERELERERAREREREREKERDRERDR-DRDHDRERERERERDREKER 777

Query: 66   KDDSEEDDRKRNRDR 22
            + + EE +R+R R+R
Sbjct: 778  EREREERERERERER 792

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 53/163 (32%), Positives = 88/163 (53%), Gaps = 13/163 (7%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-----------RYRDRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNG 328
            +R+   +R RDR           R R+R+ + EKERDR R R +D D E E +R+RDR  
Sbjct: 716  ERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDRERERERERDREK 775

Query: 327  DRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKR 148
            +R    ++R+ + E+ER+R  + +R      R R  + +KER+R+  ++D  +   DR+ 
Sbjct: 776  EREREREERERERERERERERERERE-----RERARERDKERERQRDWEDKDKGRDDRRE 830

Query: 147  DRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
             R   R  R + RDG +  ER  ++RY+++     R+  + RR
Sbjct: 831  KREEIREDR-NPRDGHD--ERKSKKRYRNEGSPSPRQSPKRRR 870

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 53/168 (31%), Positives = 71/168 (42%), Gaps = 38/168 (22%)
 Frame = -1

Query: 411  DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR---------------VDDRDGDNEKER 277
            D   ERD R + +D S E    +RDR  +R                       G  EK R
Sbjct: 606  DRYPERDNRDQARDSSFERRHGERDRRDNRERAPMFYTSCCPYPLPPVFSGPAGGTEKIR 665

Query: 276  DRR--------GDNDRRGNGERRH---------RDDDNEKERDRRGRYKDDSEEEFDRKR 148
            D+R        G ND     ERR          R D+  +ERDR      + E E +R+R
Sbjct: 666  DQRPSSPIRHQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRERERERERER 725

Query: 147  DRNGDR-----RHRVDDRDGDNEKERDHRR-RYKDDSEEDDRKRNRDR 22
            DR  ++     R R  +R+ + EKERD  R R +D   E +R+R RDR
Sbjct: 726  DREREKERELERERAREREREREKERDRERDRDRDHDRERERERERDR 773

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 45/153 (29%), Positives = 66/153 (43%), Gaps = 11/153 (7%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           ++ DRR+  R+D   K RDR    + DS EE + ++D++  R HR D    D    RD R
Sbjct: 408 QSHDRRHERREDTRGK-RDR----EKDSREEREYEQDQSSSRDHRDDREPRDGRDRRDAR 462

Query: 267 GDNDRR---------GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
              DRR          + E R    D ++ RD R         ++   RDR G   HR +
Sbjct: 463 DTRDRRELRDSRDIRDSREMRDYSRDTKESRDPRDSRSTRDAHDY---RDREGRDTHRKE 519

Query: 114 DRDGDNEKE--RDHRRRYKDDSEEDDRKRNRDR 22
           D   +  +   R+H R     +E  +  RN  R
Sbjct: 520 DAYPEESRSYGRNHLREESSRTEIRNESRNESR 552

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 44/150 (29%), Positives = 69/150 (46%), Gaps = 10/150 (6%)
 Frame = -1

Query: 426  RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR-----GD 262
            RDR+     E     + + D  +  +  R  + DR+         +  E DR+     G 
Sbjct: 1261 RDREKTKSLEITGERKSRIDQLKRGEPSRSTSSDRQDSRSHSSRRSSPESDRQVHSRSGS 1320

Query: 261  NDRRGNGERRHR-DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKE 88
             D R   + R R + D E+ER+RR   + + + + D+   RN DR R R  +R+ + +K 
Sbjct: 1321 FDSRDRLQERDRYEHDRERERERRDTRQREWDRDADKDWPRNRDRDRLRERERERERDKR 1380

Query: 87   RD---HRRRYKDDSEEDDRKRNRDRRYRDT 7
            RD    R R   DS E DR R+RDR +  +
Sbjct: 1381 RDLDRERERLISDSVERDRDRDRDRTFESS 1410

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 44/162 (27%), Positives = 70/162 (43%), Gaps = 7/162 (4%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEK---ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
           QRK    R+R         D+E+     DRR   ++D+  + DR++D   +R +     +
Sbjct: 383 QRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREDTRGKRDREKDSREEREY-----E 437

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRD--RNGDRRH 124
            D    RD R D + R   +RR   D  ++   R  R   DS E  D  RD   + D R 
Sbjct: 438 QDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDIRDSREMRDYSRDTKESRDPRD 497

Query: 123 RVDDRDGDNEKERDHR--RRYKDDSEEDDRKRNRDRRYRDTS 4
               RD  + ++R+ R   R +D   E+ R   R+    ++S
Sbjct: 498 SRSTRDAHDYRDREGRDTHRKEDAYPEESRSYGRNHLREESS 539

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 44/145 (30%), Positives = 63/145 (43%), Gaps = 7/145 (4%)
 Frame = -1

Query: 438  DRRYRDRDD--DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
            DR+   R    D+      R RY+ D E E +R+     D R R  DRD D +  R+R  
Sbjct: 1311 DRQVHSRSGSFDSRDRLQERDRYEHDRERERERR-----DTRQREWDRDADKDWPRNR-- 1363

Query: 264  DNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH----RVDDRDGD 100
            D DR    ER R RD   + +R+R     D  E + DR RDR  +       +  +   +
Sbjct: 1364 DRDRLRERERERERDKRRDLDRERERLISDSVERDRDRDRDRTFESSQIESVKRCEAKLE 1423

Query: 99   NEKERDHRRRYKDDSEEDDRKRNRD 25
             E ERD     +D    D  + ++D
Sbjct: 1424 GEHERDLESTSRDSVAVDKERMDKD 1448

[62][TOP]
>UniRef100_UPI00006CB316 hypothetical protein TTHERM_00456860 n=1 Tax=Tetrahymena thermophila
            RepID=UPI00006CB316
          Length = 1627

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 61/164 (37%), Positives = 92/164 (56%), Gaps = 19/164 (11%)
 Frame = -1

Query: 444  NRDRRYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
            ++D + +DR+ D +  RD+  R KD DS+   DRK+  + D R   D +   +  +RD+R
Sbjct: 1385 HKDNKDKDRERDRDYYRDKEDRAKDRDSDRYRDRKKTSDRDDRDHRDKKYEHDRDDRDKR 1444

Query: 267  GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEE---EFDRKRDRNGDRRHRVD------ 115
                 R N +R H+D +  KE+DR   YKD  +E   + DR+RDR+ ++R R D      
Sbjct: 1445 DKKSDRDNSDRDHKDREY-KEKDREREYKDKDKEKDKDRDRERDRDREKRDRRDYYDRDH 1503

Query: 114  -DRDG-DNEKERDHRRRYKD-DSEE------DDRKRNRDRRYRD 10
             DRD  D  KERD++ R KD D +E      DDR+R+RD + +D
Sbjct: 1504 YDRDSRDYRKERDYKDRDKDRDPKEKERDYRDDRERDRDYKEKD 1547

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 52/163 (31%), Positives = 84/163 (51%), Gaps = 14/163 (8%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDRRHRVD-------DR 301
            K +RD   RD  D   KE+DR   YKD   + +++ DR+RDR+ ++R R D       DR
Sbjct: 1447 KSDRDNSDRDHKDREYKEKDREREYKDKDKEKDKDRDRERDRDREKRDRRDYYDRDHYDR 1506

Query: 300  DG-DNEKERDRRG-DNDRRGNGERRHRDDDNEKERD--RRGRYKDDSEEEFDRKRDRNGD 133
            D  D  KERD +  D DR    + R   DD E++RD   + RY+D  +  +D K     D
Sbjct: 1507 DSRDYRKERDYKDRDKDRDPKEKERDYRDDRERDRDYKEKDRYRDKDKYYYDHKDSERKD 1566

Query: 132  RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            R      +D D+ K+   +R+  + S+  +++ N+ +  + +S
Sbjct: 1567 RY-----KDKDHSKDESSKRKESETSQTKEKEENKKKEQQSSS 1604

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 52/158 (32%), Positives = 83/158 (52%), Gaps = 14/158 (8%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
            RD+  R +D D+++ RDR+     D  +  D+K + + D R + D +   +  +RD +  
Sbjct: 1401 RDKEDRAKDRDSDRYRDRKKTSDRDDRDHRDKKYEHDRDDRDKRDKKSDRDNSDRDHKDR 1460

Query: 261  NDRRGNGERRHRDDDNE--KERDR---RGRYKDDSEEEFDR------KRDRNGDRRHRVD 115
              +  + ER ++D D E  K+RDR   R R K D  + +DR       RD   +R ++  
Sbjct: 1461 EYKEKDREREYKDKDKEKDKDRDRERDRDREKRDRRDYYDRDHYDRDSRDYRKERDYKDR 1520

Query: 114  DRDGD-NEKERDHR--RRYKDDSEEDDRKRNRDRRYRD 10
            D+D D  EKERD+R  R    D +E DR R++D+ Y D
Sbjct: 1521 DKDRDPKEKERDYRDDRERDRDYKEKDRYRDKDKYYYD 1558

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 60/179 (33%), Positives = 87/179 (48%), Gaps = 31/179 (17%)
 Frame = -1

Query: 447  RNRDR---RYRDR----DDDNEKERDRRGRYKDDSEEEFDRKRDR-NGDRRHR------- 313
            R +DR   RYRDR    D D+   RD++  +  D  ++ D+K DR N DR H+       
Sbjct: 1406 RAKDRDSDRYRDRKKTSDRDDRDHRDKKYEHDRDDRDKRDKKSDRDNSDRDHKDREYKEK 1465

Query: 312  -----VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDN--------EKERDRRGRYK--D 178
                   D+D + +K+RDR  D DR     R + D D+         KERD + R K  D
Sbjct: 1466 DREREYKDKDKEKDKDRDRERDRDREKRDRRDYYDRDHYDRDSRDYRKERDYKDRDKDRD 1525

Query: 177  DSEEEFDRKRDRNGDRRHRVDDRDGDNEK-ERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
              E+E D + DR  DR ++  DR  D +K   DH+     DSE  DR +++D    ++S
Sbjct: 1526 PKEKERDYRDDRERDRDYKEKDRYRDKDKYYYDHK-----DSERKDRYKDKDHSKDESS 1579

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 36/142 (25%), Positives = 77/142 (54%), Gaps = 5/142 (3%)
 Frame = -1

Query: 420  RDDDNEKERDRRGR-----YKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDND 256
            +++ N +++DR  +     +KD+ +++ +R RD   D+  R  DRD D  ++R +  D D
Sbjct: 1366 KNNGNSQKKDRSSKETSHDHKDNKDKDRERDRDYYRDKEDRAKDRDSDRYRDRKKTSDRD 1425

Query: 255  RRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHR 76
             R + ++++  D +++++  +   +D+S+ +   +  +  DR     D+D + +K+RD  
Sbjct: 1426 DRDHRDKKYEHDRDDRDKRDKKSDRDNSDRDHKDREYKEKDREREYKDKDKEKDKDRDRE 1485

Query: 75   RRYKDDSEEDDRKRNRDRRYRD 10
            R    D E+ DR+   DR + D
Sbjct: 1486 R--DRDREKRDRRDYYDRDHYD 1505

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 49/160 (30%), Positives = 82/160 (51%), Gaps = 16/160 (10%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDR---RGRYKDDSEEEFDR------KRDRNGDRRHRVDDRD 298
            +++R+R Y+D+D + +K+RDR   R R K D  + +DR       RD   +R ++  D+D
Sbjct: 1464 EKDREREYKDKDKEKDKDRDRERDRDREKRDRRDYYDRDHYDRDSRDYRKERDYKDRDKD 1523

Query: 297  GD-NEKERDRRGDNDR-RGNGER-RHRDDD----NEKERDRRGRYKDDSEEEFDRKRDRN 139
             D  EKERD R D +R R   E+ R+RD D    + K+ +R+ RYKD         +D +
Sbjct: 1524 RDPKEKERDYRDDRERDRDYKEKDRYRDKDKYYYDHKDSERKDRYKD---------KDHS 1574

Query: 138  GDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
             D   +  + +    KE++  ++ +  S  +  K    RR
Sbjct: 1575 KDESSKRKESETSQTKEKEENKKKEQQSSSEGTKEELKRR 1614

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 49/141 (34%), Positives = 75/141 (53%), Gaps = 6/141 (4%)
 Frame = -1

Query: 414  DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE-RDRRGDNDRRGNGE 238
            DD +   + + + +   E   D K +++ DR     DRD   +KE R +  D+DR     
Sbjct: 1363 DDTKNNGNSQKKDRSSKETSHDHKDNKDKDRER---DRDYYRDKEDRAKDRDSDRY-RDR 1418

Query: 237  RRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR-NGDRRHRVDDRDGDNEKERDHRRRYKD 61
            ++  D D+   RD++  +  D  ++ D+K DR N DR H+  DR+    KE+D  R YKD
Sbjct: 1419 KKTSDRDDRDHRDKKYEHDRDDRDKRDKKSDRDNSDRDHK--DRE---YKEKDREREYKD 1473

Query: 60   -DSEED---DRKRNRDRRYRD 10
             D E+D   DR+R+RDR  RD
Sbjct: 1474 KDKEKDKDRDRERDRDREKRD 1494

[63][TOP]
>UniRef100_UPI0001A2DEB7 UPI0001A2DEB7 related cluster n=1 Tax=Danio rerio
           RepID=UPI0001A2DEB7
          Length = 1048

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 57/154 (37%), Positives = 85/154 (55%), Gaps = 14/154 (9%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRG-----RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           R+ R+++R  + EK R   G     RY  D +E  +R+RDR  DR   + +++ D E+ER
Sbjct: 89  REDRHKERRREREKARHGDGDEDEKRYNRDDKENGERRRDREKDRNVDMYNQE-DKERER 147

Query: 276 DRRGDN-----DRRGNGERRHRDDDNEKERDRRGRYK----DDSEEEFDRKRDRNGDRRH 124
           DRR        + RG GE+  R+ D E+ER+RR R++    D    E+D K+ R G+RR 
Sbjct: 148 DRRRAERARRKEERGEGEKEERERDKERERERRERHRARESDRYRLEYDEKQ-REGERRE 206

Query: 123 RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           R  D++    KER+HRR       ED  +R RD+
Sbjct: 207 RHSDKEHSGHKEREHRR-----DREDKERRRRDK 235

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 53/152 (34%), Positives = 81/152 (53%), Gaps = 8/152 (5%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           + DRR+RD D D  +E+++R R ++ S+   D +RDRN D + R D R+ D  KER R  
Sbjct: 45  SEDRRHRDPDRDPRREKEKR-REREGSKHR-DPERDRNQDIK-REDVRE-DRHKERRRER 100

Query: 264 DNDRRGNG---ERRHRDDDNEKERDRRGRYKDDS-----EEEFDRKRDRNGDRRHRVDDR 109
           +  R G+G   E+R+  DD E    RR R KD +     +E+ +R+RDR    R R  + 
Sbjct: 101 EKARHGDGDEDEKRYNRDDKENGERRRDREKDRNVDMYNQEDKERERDRRRAERARRKEE 160

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
            G+ EKE   R + ++    +  +     RYR
Sbjct: 161 RGEGEKEERERDKERERERRERHRARESDRYR 192

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 57/164 (34%), Positives = 78/164 (47%), Gaps = 31/164 (18%)
 Frame = -1

Query: 408 NEKERDRRGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEK--------------ERD 274
           NE+ R R  R     EEE  + RD  + DRRHR  DRD   EK              ERD
Sbjct: 24  NEESRRRSKR-----EEEHRKHRDGESEDRRHRDPDRDPRREKEKRREREGSKHRDPERD 78

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVD 115
           R  D  R    E RH++   E+E+ R G       RY  D +E  +R+RDR  DR   + 
Sbjct: 79  RNQDIKREDVREDRHKERRREREKARHGDGDEDEKRYNRDDKENGERRRDREKDRNVDMY 138

Query: 114 DRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRD 10
           +++ D E+ERD RR         R + + EE +R + R+R  R+
Sbjct: 139 NQE-DKERERDRRRAERARRKEERGEGEKEERERDKERERERRE 181

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 50/161 (31%), Positives = 78/161 (48%), Gaps = 20/161 (12%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDR 271
           R R  R R +++  E E++ R R K+   E  +R R R  DR R   D++  + E+ R+R
Sbjct: 149 RRRAERARRKEERGEGEKEERERDKERERERRERHRARESDRYRLEYDEKQREGER-RER 207

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGR------------YKDDSEEEFDRKRDRNGDRR 127
             D +  G+ ER HR D  +KER RR +             K     E +  R    D +
Sbjct: 208 HSDKEHSGHKEREHRRDREDKERRRRDKESHVSQIKGIAMAKTSHSREAEHHRQELKDSK 267

Query: 126 HRVDDRDGDNEK-----ERDHRRRYKD--DSEEDDRKRNRD 25
                +DG++EK     ER H R++K+  DS+  DR++ +D
Sbjct: 268 DFHGIKDGESEKAREERERRHERKHKEASDSKRSDREQKQD 308

[64][TOP]
>UniRef100_UPI0000ECD64D Zinc finger CCCH domain-containing protein 13. n=1 Tax=Gallus gallus
            RepID=UPI0000ECD64D
          Length = 1588

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 59/151 (39%), Positives = 84/151 (55%), Gaps = 5/151 (3%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRG 265
            RD R  DR DD   ER R    + + + E +R+RDR  +R + R  +RD   E+ER+R  
Sbjct: 660  RDERRVDRSDDRRDERARERERERERDRERERERDREREREKERELERDRARERERERER 719

Query: 264  DNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 91
            D DR    +R  RD D E+ER+R R + ++   EE +R+R+R  DR R R  +R  D +K
Sbjct: 720  DKDRDRERDR-DRDHDREREREREREKEREREREERERERERERDRERERERERGRDRDK 778

Query: 90   ERDHRRRY--KDDSEEDDRKRNRDRRYRDTS 4
            ER+ +R +  KD   ED R R  D R   +S
Sbjct: 779  ERERQRDWDDKDKGREDRRDRREDIREERSS 809

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/152 (34%), Positives = 84/152 (55%), Gaps = 3/152 (1%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
            +R RDR  R+R+ D E+ER++    + D   E +R+R+R+ DR R R  DRD D E+ER+
Sbjct: 682  ERERDRE-RERERDREREREKERELERDRARERERERERDKDRDRERDRDRDHDRERERE 740

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
            R  + +R    E R R+ + E++R+R      + E E  R RD+  +R+   DD+D   E
Sbjct: 741  REREKEREREREERERERERERDRER------ERERERGRDRDKERERQRDWDDKDKGRE 794

Query: 93   KERDHRRRYKDDSEEDD--RKRNRDRRYRDTS 4
              RD R   +++    D   +R   +R+R+ S
Sbjct: 795  DRRDRREDIREERSSRDVHEERKSKKRHRNES 826

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/147 (36%), Positives = 83/147 (56%), Gaps = 8/147 (5%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRG----RYKDDSEE-EFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            +RR+ +RD  + +ERD+R     R++  S++ E D +RD    R  R DDR  +  +ER+
Sbjct: 623  ERRHGERDRRDNRERDQRASSPVRHQGRSDDLERDERRDER--RVDRSDDRRDERARERE 680

Query: 273  RRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
            R  + DR    ER   R R+ + E ERDR    + + E + DR R+R+ DR H   DR+ 
Sbjct: 681  RERERDRERERERDREREREKERELERDRARERERERERDKDRDRERDRDRDH---DRER 737

Query: 102  DNEKERDHRRRYKDDSEEDDRKRNRDR 22
            + E+ER+  R  + +  E +R+R RDR
Sbjct: 738  EREREREKEREREREERERERERERDR 764

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 50/158 (31%), Positives = 84/158 (53%), Gaps = 3/158 (1%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
            R ++R    +R R+R  RD+D D E++RDR    + + E E +++R+R  + R R  +R+
Sbjct: 703  RELERDRARERERERE-RDKDRDRERDRDRDHDREREREREREKEREREREERERERERE 761

Query: 297  GDNEKERDRRGDNDRRGNGERRHRDDDNEKER-DRRGRYKDDSEEEFDR--KRDRNGDRR 127
             D E+ER+R    DR    ER+   DD +K R DRR R +D  EE   R    +R   +R
Sbjct: 762  RDRERERERERGRDRDKERERQRDWDDKDKGREDRRDRREDIREERSSRDVHEERKSKKR 821

Query: 126  HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
            HR +      +  +  RR +  DS+  +   +++ ++R
Sbjct: 822  HRNESSPSPRQSPK-RRREHSPDSDAYNSGDDKNEKHR 858

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 49/147 (33%), Positives = 85/147 (57%), Gaps = 6/147 (4%)
 Frame = -1

Query: 432  RYRDRDDDNEKER---DRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRG 265
            R++ R DD E++    +RR    DD  +E  R+R+R  +R R R  +RD + E+E++R  
Sbjct: 646  RHQGRSDDLERDERRDERRVDRSDDRRDERARERERERERDRERERERDREREREKEREL 705

Query: 264  DNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
            + DR    ER  R+ D +++R+R R R   D + E +R+R+R  +R    ++R+ + E+E
Sbjct: 706  ERDRARERERE-RERDKDRDRERDRDR---DHDREREREREREKEREREREERERERERE 761

Query: 87   RD-HRRRYKDDSEEDDRKRNRDRRYRD 10
            RD  R R ++   + D++R R R + D
Sbjct: 762  RDRERERERERGRDRDKERERQRDWDD 788

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 65/200 (32%), Positives = 93/200 (46%), Gaps = 44/200 (22%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR---RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR---R 319
            R  +R+   +R++DR   R RDRD D E+ER+R R + ++   EE +R+R+R  DR   R
Sbjct: 709  RARERERERERDKDRDRERDRDRDHDREREREREREKEREREREERERERERERDRERER 768

Query: 318  HRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN 139
             R   RD D E+ER R  D+  +G  +RR R +D  +ER  R    D  EE   +KR RN
Sbjct: 769  ERERGRDRDKERERQRDWDDKDKGREDRRDRREDIREERSSR----DVHEERKSKKRHRN 824

Query: 138  --------GDRRHRVDDRDGD--------NEKER---------------------DHRRR 70
                      +R R    D D        NEK R                     D + R
Sbjct: 825  ESSPSPRQSPKRRREHSPDSDAYNSGDDKNEKHRLLSQVVRPQESRSLSPSHVTEDRQSR 884

Query: 69   YKDDSEEDDRKRNRDRRYRD 10
            +K++  + DRK +  RRY +
Sbjct: 885  WKEEERKSDRKES-SRRYEE 903

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 46/159 (28%), Positives = 77/159 (48%), Gaps = 11/159 (6%)
 Frame = -1

Query: 453  WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFD-RKRDRNGDR--RHRVDDRDGDNEK 283
            W+       RDR D  ++ RD     +    +  D R+RD+      RH+    D + ++
Sbjct: 599  WESRSSYPDRDRYDSRDQARDSSFERRHGERDRRDNRERDQRASSPVRHQGRSDDLERDE 658

Query: 282  ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-------RH 124
             RD R  +      + R R+ + E+ERDR    + D E E +++R+   DR       R 
Sbjct: 659  RRDERRVDRSDDRRDERARERERERERDRERERERDREREREKERELERDRARERERERE 718

Query: 123  RVDDRDGDNEKERDH-RRRYKDDSEEDDRKRNRDRRYRD 10
            R  DRD + +++RDH R R ++   E +R+R R+ R R+
Sbjct: 719  RDKDRDRERDRDRDHDREREREREREKEREREREERERE 757

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 46/150 (30%), Positives = 66/150 (44%), Gaps = 9/150 (6%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEK--ERDRRGD 262
           R R    EK R  R R     +   DR+ +  G R   R   DDRD D E+   RD R D
Sbjct: 393 RHRSPGREKGRHDRDRTSQSHDRRHDRRDETRGKREKERETRDDRDYDQEQSTSRDHRDD 452

Query: 261 NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR--NGDRRHRVDDRDGDNEKE 88
            + R   +RR   D+ ++   R  R   DS +  D  RD   + D+R     RD  + ++
Sbjct: 453 RESRDGRDRRDTRDNRDRRETRESRDTRDSRDTRDYSRDNKDSRDQRDSRSTRDSHDYRD 512

Query: 87  RDHRRRYKDDS--EEDDRKRNRDRRYRDTS 4
           R+ R  +K D   +ED R   R     ++S
Sbjct: 513 RESRDAHKKDDQYQEDSRSYGRSHGREESS 542

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 45/156 (28%), Positives = 68/156 (43%), Gaps = 13/156 (8%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEK-ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD----GDNEK 283
           ++ DRR+  RD+   K E++R  R   D ++E    RD   DR  R D RD     DN  
Sbjct: 411 QSHDRRHDRRDETRGKREKERETRDDRDYDQEQSTSRDHRDDRESR-DGRDRRDTRDNRD 469

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
            R+ R   D R + + R    DN+  RD+R         ++   RDR     H+ DD+  
Sbjct: 470 RRETRESRDTRDSRDTRDYSRDNKDSRDQRDSRSTRDSHDY---RDRESRDAHKKDDQYQ 526

Query: 102 DNE--------KERDHRRRYKDDSEEDDRKRNRDRR 19
           ++         +E   R   ++DS  D R  +R  R
Sbjct: 527 EDSRSYGRSHGREESSRAETRNDSRSDSRNESRSDR 562

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 41/148 (27%), Positives = 68/148 (45%), Gaps = 2/148 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRD--RNGDRRHRVDDRDGDNEKER 277
           + +RDR  +  D  +++  + RG+ + + E   DR  D  ++  R HR D    D    R
Sbjct: 403 RHDRDRTSQSHDRRHDRRDETRGKREKERETRDDRDYDQEQSTSRDHRDDRESRDGRDRR 462

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           D R + DRR   E R    D    RD R  Y  D+++  D++  R+    H   DR+  +
Sbjct: 463 DTRDNRDRRETRESR----DTRDSRDTRD-YSRDNKDSRDQRDSRSTRDSHDYRDRESRD 517

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYR 13
             ++D   +Y++DS    R   R+   R
Sbjct: 518 AHKKDD--QYQEDSRSYGRSHGREESSR 543

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 45/151 (29%), Positives = 66/151 (43%), Gaps = 5/151 (3%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG---DRRH-RVDDRDGDNEKE 280
           R     Y  R   + + +    R++    E+    RDR     DRRH R D+  G  EKE
Sbjct: 371 RRSSSPYPPRSSSSPQRKRSPSRHRSPGREKGRHDRDRTSQSHDRRHDRRDETRGKREKE 430

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           R+    +DR  + E+    D  +    R GR + D+ +  DR+  R  + R   D RD  
Sbjct: 431 RE--TRDDRDYDQEQSTSRDHRDDRESRDGRDRRDTRDNRDRRETR--ESRDTRDSRD-- 484

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDRR-YRD 10
               RD+ R  KD  ++ D +  RD   YRD
Sbjct: 485 ---TRDYSRDNKDSRDQRDSRSTRDSHDYRD 512

[65][TOP]
>UniRef100_Q54WY7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum
           RepID=Q54WY7_DICDI
          Length = 727

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 57/144 (39%), Positives = 75/144 (52%), Gaps = 2/144 (1%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD--DRDGDNEKERDRRG 265
           D + RDRD + E++RDR      D + E DR RDR  DR    D  DRD D  +ERDR  
Sbjct: 3   DDKDRDRDRNRERDRDRERDRGKDRDRERDRDRDRERDRDGERDRMDRDRDRSEERDRYR 62

Query: 264 DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
             D+  N   R RD D  KER+++ R   D  EE DR RD + DR++R   R  D +K  
Sbjct: 63  GRDKE-NQRDRERDRDRSKERNKKDR---DRSEERDRSRDIDRDRKYRDRSRSRDKKKSS 118

Query: 84  DHRRRYKDDSEEDDRKRNRDRRYR 13
             + R K  S   D+K +  +R R
Sbjct: 119 SEKDRSKSRSRSRDKKSSSYKRNR 142

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/146 (37%), Positives = 75/146 (51%), Gaps = 5/146 (3%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRG 247
           +DRD D  +ERDR            DR+RDR  DR         D E++RDR  + DR G
Sbjct: 5   KDRDRDRNRERDR------------DRERDRGKDR---------DRERDRDRDRERDRDG 43

Query: 246 NGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER----D 82
             +R  RD D  +ERDR RGR   D E + DR+RDR+  +     DRD   E++R    D
Sbjct: 44  ERDRMDRDRDRSEERDRYRGR---DKENQRDRERDRDRSKERNKKDRDRSEERDRSRDID 100

Query: 81  HRRRYKDDSEEDDRKRNRDRRYRDTS 4
             R+Y+D S   D+K++   + R  S
Sbjct: 101 RDRKYRDRSRSRDKKKSSSEKDRSKS 126

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 49/158 (31%), Positives = 75/158 (47%), Gaps = 15/158 (9%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           R+ +R   DRD D  +ERDR RGR   D E + DR+RDR+  +     DRD   E++R R
Sbjct: 41  RDGERDRMDRDRDRSEERDRYRGR---DKENQRDRERDRDRSKERNKKDRDRSEERDRSR 97

Query: 270 RGDNDRRGNGERRHRD---DDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
             D DR+     R RD     +EK+R + R R +D     + R R    D     D   G
Sbjct: 98  DIDRDRKYRDRSRSRDKKKSSSEKDRSKSRSRSRDKKSSSYKRNRKDYSDSDSDSDSSSG 157

Query: 102 DNEKERDHRRRYKD----------DSEEDDRKRNRDRR 19
            ++ + + +R+             +S+E+ RKR +  +
Sbjct: 158 SDDSDYERKRKSSSSTSTSSTSNKESKEERRKRKKQEK 195

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 44/160 (27%), Positives = 79/160 (49%), Gaps = 19/160 (11%)
 Frame = -1

Query: 447 RNRDR-----RYRDRDDDNEKERDR-RGRYKD------DSEEEFDRKRDRNGDRRHRVDD 304
           R+RDR     RYR RD +N+++R+R R R K+      D  EE DR RD + DR++R   
Sbjct: 50  RDRDRSEERDRYRGRDKENQRDRERDRDRSKERNKKDRDRSEERDRSRDIDRDRKYRDRS 109

Query: 303 RDGDNEK-------ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRD 145
           R  D +K        + R    D++ +  +R+R D ++ + D       D + +++RKR 
Sbjct: 110 RSRDKKKSSSEKDRSKSRSRSRDKKSSSYKRNRKDYSDSDSDSDSSSGSD-DSDYERKRK 168

Query: 144 RNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
            +            + E + + R+R K + +E + ++ R+
Sbjct: 169 SSSSTS---TSSTSNKESKEERRKRKKQEKKEKEERKARE 205

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 43/124 (34%), Positives = 63/124 (50%), Gaps = 22/124 (17%)
 Frame = -1

Query: 309 DDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
           DD+D D ++ R+R  D +R      R +D D E++RDR            DR+RDR+G+R
Sbjct: 3   DDKDRDRDRNRERDRDRERD-----RGKDRDRERDRDR------------DRERDRDGER 45

Query: 129 --------------RHRVDDRDGDNEKERDHRR------RYKDDSEEDDRKR--NRDRRY 16
                         R+R  D++   ++ERD  R      + +D SEE DR R  +RDR+Y
Sbjct: 46  DRMDRDRDRSEERDRYRGRDKENQRDRERDRDRSKERNKKDRDRSEERDRSRDIDRDRKY 105

Query: 15  RDTS 4
           RD S
Sbjct: 106 RDRS 109

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 36/154 (23%), Positives = 74/154 (48%), Gaps = 13/154 (8%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKER----DRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDN 289
           R+++R  +DRD   E++R    DR  +Y+D S     +K     DR   R R  D+   +
Sbjct: 78  RSKERNKKDRDRSEERDRSRDIDRDRKYRDRSRSRDKKKSSSEKDRSKSRSRSRDKKSSS 137

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYK------DDSEEEFDRKRDRNGDRR 127
            K R+R+  +D   + +     DD++ ER R+           + E + +R++ +  +++
Sbjct: 138 YK-RNRKDYSDSDSDSDSSSGSDDSDYERKRKSSSSTSTSSTSNKESKEERRKRKKQEKK 196

Query: 126 HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
            + + +  +  +E+  RR  K   +E+++K   D
Sbjct: 197 EKEERKARETPEEKRKRRLEKKQRKEENKKSGLD 230

[66][TOP]
>UniRef100_Q7S1G9 Predicted protein n=1 Tax=Neurospora crassa RepID=Q7S1G9_NEUCR
          Length = 856

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 64/180 (35%), Positives = 89/180 (49%), Gaps = 31/180 (17%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNG---------------DRR 319
            +  R+ R R   D +  +RDR R R++DD E + DR R R+                DR 
Sbjct: 655  EEERENRRRSNRDPSRDDRDRDRSRHRDDKERDRDRDRSRSRVRPRDLVGADLGRDRDRD 714

Query: 318  HRVD------DRDGDNEKERDRRGDNDRRGNGER---RHRDDDNEKER-----DRRGRYK 181
            H  D      DRD + ++ERDR  D D R   +R   R RD D ++ER     DR  RY+
Sbjct: 715  HHRDPSRSRRDRDRERDRERDRERDRDLRDPRDRERERERDRDRDRERGDRDRDRDSRYR 774

Query: 180  DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEED-DRKRNRDRRYRDTS 4
            D    E DR RDR+ DR     DRD + +++R  R R     + D DR+R+R+R  R+ S
Sbjct: 775  DGGGGERDRDRDRDRDR-----DRDRERDRDRGDRHRSSRHHDRDRDRERDRERERRERS 829

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 56/139 (40%), Positives = 73/139 (52%), Gaps = 16/139 (11%)
 Frame = -1

Query: 426  RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR-----RGD 262
            RDRD D+ ++  R  R   D + E DR+RDR  DR  R D RD + E+ERDR     RGD
Sbjct: 709  RDRDRDHHRDPSRSRR---DRDRERDRERDRERDRDLR-DPRDRERERERDRDRDRERGD 764

Query: 261  NDRR--------GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD--- 115
             DR         G GER  RD D +++RDR            DR+RDR+   RHR     
Sbjct: 765  RDRDRDSRYRDGGGGER-DRDRDRDRDRDR------------DRERDRDRGDRHRSSRHH 811

Query: 114  DRDGDNEKERDHRRRYKDD 58
            DRD D E++R+  RR + +
Sbjct: 812  DRDRDRERDRERERRERSE 830

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 46/131 (35%), Positives = 67/131 (51%)
 Frame = -1

Query: 444  NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
            +R RR RDR+ D E++R+R    +D  + E +R+RDR+ DR     DRD D+   R R G
Sbjct: 720  SRSRRDRDRERDRERDRERDRDLRDPRDRERERERDRDRDRERGDRDRDRDS---RYRDG 776

Query: 264  DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
                R     R RD D ++ERDR              + DR+   RH   DRD + ++ER
Sbjct: 777  GGGERDRDRDRDRDRDRDRERDR-------------DRGDRHRSSRHHDRDRDRERDRER 823

Query: 84   DHRRRYKDDSE 52
            + R R +  S+
Sbjct: 824  ERRERSEKSSK 834

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 54/138 (39%), Positives = 68/138 (49%), Gaps = 13/138 (9%)
 Frame = -1

Query: 384  GRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD-----NEKERDRRGDNDRR--------GN 244
            G Y +    E +R+  R  +R    DDRD D     ++KERDR  D  R         G 
Sbjct: 646  GEYAERKRREEERENRRRSNRDPSRDDRDRDRSRHRDDKERDRDRDRSRSRVRPRDLVGA 705

Query: 243  GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYK 64
               R RD D+ ++  R  R   D + E DR+RDR  DR  R D RD + E+ERD  R   
Sbjct: 706  DLGRDRDRDHHRDPSRSRR---DRDRERDRERDRERDRDLR-DPRDRERERERDRDR--- 758

Query: 63   DDSEEDDRKRNRDRRYRD 10
             D E  DR R+RD RYRD
Sbjct: 759  -DRERGDRDRDRDSRYRD 775

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 56/154 (36%), Positives = 73/154 (47%), Gaps = 14/154 (9%)
 Frame = -1

Query: 429  YRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRR 250
            Y +R    E+  +RR   +D S ++ DR R R+ D + R  DRD D  + R R  D    
Sbjct: 648  YAERKRREEERENRRRSNRDPSRDDRDRDRSRHRDDKER--DRDRDRSRSRVRPRDLVGA 705

Query: 249  GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-------RHRVDDRDGDNEK 91
              G  R RD   +  R RR     D + E DR+RDR  DR       R R  +RD D ++
Sbjct: 706  DLGRDRDRDHHRDPSRSRR-----DRDRERDRERDRERDRDLRDPRDRERERERDRDRDR 760

Query: 90   ERDHRRRYKDDSEED------DRKRNRDR-RYRD 10
            ER  R R +D    D      DR R+RDR R RD
Sbjct: 761  ERGDRDRDRDSRYRDGGGGERDRDRDRDRDRDRD 794

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 45/99 (45%), Positives = 59/99 (59%), Gaps = 5/99 (5%)
 Frame = -1

Query: 447  RNRDRRYRD-RDDDNEKERDR-RGRYKDDSEEEFD-RKRDRNGDRRHRVDDRDGDNEKER 277
            R RDR  RD RD + E+ERDR R R + D + + D R RD  G  R R  DRD D +++R
Sbjct: 736  RERDRDLRDPRDRERERERDRDRDRERGDRDRDRDSRYRDGGGGERDR--DRDRDRDRDR 793

Query: 276  DRRGDNDRRGNGER--RHRDDDNEKERDRRGRYKDDSEE 166
            DR  D D RG+  R  RH D D ++ERDR    ++ SE+
Sbjct: 794  DRERDRD-RGDRHRSSRHHDRDRDRERDRERERRERSEK 831

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 43/98 (43%), Positives = 56/98 (57%), Gaps = 5/98 (5%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEK---ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
            R+R+R R RDRD D E+   +RDR  RY+D    E DR RDR         DRD D ++E
Sbjct: 746  RDRERERERDRDRDRERGDRDRDRDSRYRDGGGGERDRDRDR---------DRDRDRDRE 796

Query: 279  RDR-RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSE 169
            RDR RGD  R      R RD + ++ER+RR R +  S+
Sbjct: 797  RDRDRGDRHRSSRHHDRDRDRERDRERERRERSEKSSK 834

[67][TOP]
>UniRef100_Q551H4 Serine/threonine-protein kinase fray2 n=1 Tax=Dictyostelium
            discoideum RepID=FRAY2_DICDI
          Length = 1028

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 58/164 (35%), Positives = 82/164 (50%), Gaps = 15/164 (9%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDR 301
            R + R    +R+R  R RDRD + E+ERDR      D E + DR RDR+ DR R R  DR
Sbjct: 751  RNVSRDRERERDRHNRSRDRDRERERERDR------DRERDRDRSRDRSRDRSRDRERDR 804

Query: 300  DGDNEKERDRRGDNDRRGNGER-------RHRDDDNEKERDRRGRYKDDSEEEFDRKRDR 142
              D  ++RDR  D  R  + ER       R RD    ++ D R R +D S    +R+R R
Sbjct: 805  SRDRSRDRDRSRDRSRDRSRERDRDRSRDRSRDRSRSRDSDSRDRSRDRSRSHSNRRRSR 864

Query: 141  NGDRRHRVDDRDGDNEKERDHRR-------RYKDDSEEDDRKRN 31
            + D R++  DR  D+++ RD  R       +YK  S     ++N
Sbjct: 865  SRDSRNKSRDRSSDSDRSRDRSRDRDYKSSKYKKSSRGTSGRKN 908

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 60/154 (38%), Positives = 80/154 (51%), Gaps = 6/154 (3%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKER 277
            K  ++ R R+   D E+ERDR  R +D D E E +R RDR  DR R R   RD   ++ER
Sbjct: 743  KTYKNSRSRNVSRDRERERDRHNRSRDRDRERERERDRDRERDRDRSRDRSRDRSRDRER 802

Query: 276  DRRGDNDR-RGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
            DR  D  R R     R RD   E++RDR R R +D S       RDR+ DR     +R  
Sbjct: 803  DRSRDRSRDRDRSRDRSRDRSRERDRDRSRDRSRDRSRSRDSDSRDRSRDRSRSHSNR-- 860

Query: 102  DNEKERDHRRRYKDDSEEDDRK--RNRDRRYRDT 7
               + RD R + +D S + DR   R+RDR Y+ +
Sbjct: 861  RRSRSRDSRNKSRDRSSDSDRSRDRSRDRDYKSS 894

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 50/136 (36%), Positives = 70/136 (51%), Gaps = 1/136 (0%)
 Frame = -1

Query: 420  RDDDNEKERDRRGR-YKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGN 244
            RD + E++RDR  + YK+       R R+R  DR +R  DRD + E+ERDR  + DR   
Sbjct: 730  RDRERERDRDRSNKTYKNSRSRNVSRDRERERDRHNRSRDRDRERERERDRDRERDRD-- 787

Query: 243  GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYK 64
               R RD   ++ RDR      D   + DR RDR+ DR     +RD D  ++R   R   
Sbjct: 788  ---RSRDRSRDRSRDRERDRSRDRSRDRDRSRDRSRDRSR---ERDRDRSRDRSRDRSRS 841

Query: 63   DDSEEDDRKRNRDRRY 16
             DS+  DR R+R R +
Sbjct: 842  RDSDSRDRSRDRSRSH 857

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 52/144 (36%), Positives = 73/144 (50%), Gaps = 2/144 (1%)
 Frame = -1

Query: 429  YRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRR 250
            +  R + + K   ++      S  + DR+R+R+ DR ++           RDR  + DR 
Sbjct: 705  HSSRYESDRKSYKKKKSSSSSSNSKRDRERERDRDRSNKTYKNSRSRNVSRDRERERDR- 763

Query: 249  GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRR 73
             +   R RD + E+ERDR      D E + DR RDR+ DR R R  DR  D  ++RD  R
Sbjct: 764  -HNRSRDRDRERERERDR------DRERDRDRSRDRSRDRSRDRERDRSRDRSRDRDRSR 816

Query: 72   -RYKDDSEEDDRKRNRDRRYRDTS 4
             R +D S E DR R+RDR  RD S
Sbjct: 817  DRSRDRSRERDRDRSRDRS-RDRS 839

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 40/144 (27%), Positives = 60/144 (41%), Gaps = 7/144 (4%)
 Frame = -1

Query: 414  DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER 235
            D       +  + K           + +    H     +  +  E DR+    ++ +   
Sbjct: 666  DKENNSTSKSNKSKSRQSSRASSLSESSDSTSHTSSSDEHSSRYESDRKSYKKKKSSSSS 725

Query: 234  RHRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH-RRRY 67
             +   D E+ERDR      YK+       R R+R  DR +R  DRD + E+ERD  R R 
Sbjct: 726  SNSKRDRERERDRDRSNKTYKNSRSRNVSRDRERERDRHNRSRDRDRERERERDRDRERD 785

Query: 66   KDDSEEDDRKRNRDR---RYRDTS 4
            +D S +  R R+RDR   R RD S
Sbjct: 786  RDRSRDRSRDRSRDRERDRSRDRS 809

[68][TOP]
>UniRef100_UPI000194B92B PREDICTED: zinc finger CCCH-type containing 13 n=1 Tax=Taeniopygia
            guttata RepID=UPI000194B92B
          Length = 1584

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 57/144 (39%), Positives = 83/144 (57%), Gaps = 3/144 (2%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRG 265
            R+ R  DR DD   ER R    + + + E +R+RDR  +R + R  +RD   E+ERDR  
Sbjct: 656  REERRVDRSDDRRDERARERERERERDRERERERDREREREKERELERDRARERERDRER 715

Query: 264  DNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 91
            D DR    + R RD D E+ER+R R + ++   EE +R+R+R  DR R R  +R  D +K
Sbjct: 716  DKDRDRERD-RDRDHDREREREREREKEREREREERERERERERDRERERERERGRDRDK 774

Query: 90   ERDHRRRYKDDSEEDDRKRNRDRR 19
            ERD +R +  D +E  R+  RD+R
Sbjct: 775  ERDRQRDW--DDKEKGREDRRDKR 796

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 61/160 (38%), Positives = 92/160 (57%), Gaps = 11/160 (6%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            +R R+R R R+RD + E+ERDR    + + E E DR R+R  DR     +RD D ++ERD
Sbjct: 670  ERARERERERERDRERERERDREREREKERELERDRARERERDR-----ERDKDRDRERD 724

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-RHRVDDRD 106
            R  D+DR    ER  R+ + E+ER+ R R ++   D E E +R+R R+ D+ R R  D D
Sbjct: 725  RDRDHDRERERERE-REKEREREREERERERERERDRERERERERGRDRDKERDRQRDWD 783

Query: 105  GDNEKERDHRRRYKDDSEED------DRKRNRDRRYRDTS 4
             D EK R+ RR  ++D+ E+        +R   +R+R+ S
Sbjct: 784  -DKEKGREDRRDKREDTREERGSRDVHEERKSKKRHRNES 822

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/148 (35%), Positives = 81/148 (54%), Gaps = 9/148 (6%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRG------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
            +RR+ +RD  + +ERD+R       + + D  E  +R+ +R  DR    DDR  +  +ER
Sbjct: 619  ERRHSERDRRDNRERDQRASSPVRHQGRSDDLERDERREERRVDRS---DDRRDERARER 675

Query: 276  DRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
            +R  + DR    ER   R R+ + E ERDR    + D E + DR R+R+ DR H   DR+
Sbjct: 676  ERERERDRERERERDREREREKERELERDRARERERDRERDKDRDRERDRDRDH---DRE 732

Query: 105  GDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             + E+ER+  R  + +  E +R+R RDR
Sbjct: 733  REREREREKEREREREERERERERERDR 760

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 51/143 (35%), Positives = 84/143 (58%), Gaps = 7/143 (4%)
 Frame = -1

Query: 432  RYRDRDDD---NEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRG 265
            R++ R DD   +E+  +RR    DD  +E  R+R+R  +R R R  +RD + E+E++R  
Sbjct: 642  RHQGRSDDLERDERREERRVDRSDDRRDERARERERERERDRERERERDREREREKEREL 701

Query: 264  DNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
            + DR    ER   R +D D E++RDR    + + E E +++R+R  + R R  +R+ D E
Sbjct: 702  ERDRARERERDRERDKDRDRERDRDRDHDREREREREREKEREREREERERERERERDRE 761

Query: 93   KERDHRRRYKDDSEEDDRKRNRD 25
            +ER+ R R +D  +E DR+R+ D
Sbjct: 762  RERE-RERGRDRDKERDRQRDWD 783

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 56/162 (34%), Positives = 87/162 (53%), Gaps = 18/162 (11%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
            +R RDR  R+R+ D E+ER++    + D   E +R R+R+ DR R R  DRD D E+ER+
Sbjct: 678  ERERDRE-RERERDREREREKERELERDRARERERDRERDKDRDRERDRDRDHDRERERE 736

Query: 273  RRGDNDRRGNGERRHR------DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            R  + +R    E R R      D + E+ER+ RGR   D ++E DR+RD +   + R D 
Sbjct: 737  REREKEREREREERERERERERDRERERERE-RGR---DRDKERDRQRDWDDKEKGREDR 792

Query: 111  RD-----------GDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            RD            D  +ER  ++R++++S    R+  + RR
Sbjct: 793  RDKREDTREERGSRDVHEERKSKKRHRNESSPSPRQSPKRRR 834

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 48/151 (31%), Positives = 81/151 (53%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
            R ++R    +R RDR  RD+D D E++RDR    + + E E +++R+R  + R R  +R+
Sbjct: 699  RELERDRARERERDRE-RDKDRDRERDRDRDHDREREREREREKEREREREERERERERE 757

Query: 297  GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
             D E+ER+R    DR    +R+   DD EK R+ R   ++D+ EE    RD + +R+ + 
Sbjct: 758  RDRERERERERGRDRDKERDRQRDWDDKEKGREDRRDKREDTREE-RGSRDVHEERKSKK 816

Query: 117  DDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
              R+  +   R   +R +D S + D   + D
Sbjct: 817  RHRNESSPSPRQSPKRRRDHSPDSDAYNSGD 847

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 65/198 (32%), Positives = 94/198 (47%), Gaps = 42/198 (21%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR---RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHR 313
            R  +R+   +R++DR   R RDRD D E+ER+R R + ++   EE +R+R+R  DR R R
Sbjct: 705  RARERERDRERDKDRDRERDRDRDHDREREREREREKEREREREERERERERERDRERER 764

Query: 312  VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN-- 139
              +R  D +KERDR+ D D +  G R  R D  E  R+ RG  +D  EE   +KR RN  
Sbjct: 765  ERERGRDRDKERDRQRDWDDKEKG-REDRRDKREDTREERGS-RDVHEERKSKKRHRNES 822

Query: 138  ------GDRRHRVDDRDGD--------NEKER---------------------DHRRRYK 64
                    +R R    D D        NEK R                     + + R+K
Sbjct: 823  SPSPRQSPKRRRDHSPDSDAYNSGDDKNEKHRLLSQVVRPQESRSLSPSHVTEERQSRWK 882

Query: 63   DDSEEDDRKRNRDRRYRD 10
            ++  + DRK +  RRY +
Sbjct: 883  EEDRKSDRKES-SRRYEE 899

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 53/163 (32%), Positives = 82/163 (50%), Gaps = 15/163 (9%)
 Frame = -1

Query: 453  WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFD-RKRDRNGDR--RH--RVDDRDGDN 289
            W        RDR D  ++ RD     +    +  D R+RD+      RH  R DD + D 
Sbjct: 595  WDSRSSYADRDRYDSRDQARDSSFERRHSERDRRDNRERDQRASSPVRHQGRSDDLERDE 654

Query: 288  EKERDRRGD--NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR----- 130
             +E +RR D  +DRR   + R R+ + E+ERDR    + D E E +++R+   DR     
Sbjct: 655  RRE-ERRVDRSDDRR---DERARERERERERDRERERERDREREREKERELERDRARERE 710

Query: 129  --RHRVDDRDGDNEKERDH-RRRYKDDSEEDDRKRNRDRRYRD 10
              R R  DRD + +++RDH R R ++   E +R+R R+ R R+
Sbjct: 711  RDRERDKDRDRERDRDRDHDREREREREREKEREREREERERE 753

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 44/149 (29%), Positives = 64/149 (42%), Gaps = 4/149 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK--ER 277
           KR+  R      D    +RDR  +  D   E  D  R +    R   DDRD D E+   R
Sbjct: 384 KRSPSRHRSPGRDKGRHDRDRTSQSHDRRHERRDETRGKREKERETRDDRDYDQEQSTSR 443

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR--NGDRRHRVDDRDG 103
           D R D + R   +RR   D  ++   R  R   DS +  D  RD   + D+R     RD 
Sbjct: 444 DHRDDRESRDGRDRRDTRDTRDRREPRESRDTRDSRDTRDYSRDAKDSRDQRDSRSTRDS 503

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRY 16
            + ++R+ R  +K D +  D  R+  R +
Sbjct: 504 HDYRDRESRDAHKKDDQYQDDLRSYGRSH 532

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 45/153 (29%), Positives = 66/153 (43%), Gaps = 10/153 (6%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEK-ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD-GDNEKERD 274
           ++ DRR+  RD+   K E++R  R   D ++E    RD   DR  R D RD  D    RD
Sbjct: 407 QSHDRRHERRDETRGKREKERETRDDRDYDQEQSTSRDHRDDRESR-DGRDRRDTRDTRD 465

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD-- 100
           RR   + R   + R   D +   +D R +    S  +    RDR     H+ DD+  D  
Sbjct: 466 RREPRESRDTRDSRDTRDYSRDAKDSRDQRDSRSTRDSHDYRDRESRDAHKKDDQYQDDL 525

Query: 99  ------NEKERDHRRRYKDDSEEDDRKRNRDRR 19
                 + +E   R   ++DS  D R  +R  R
Sbjct: 526 RSYGRSHGREESSRAETRNDSRSDSRNESRSDR 558

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 45/131 (34%), Positives = 62/131 (47%), Gaps = 7/131 (5%)
 Frame = -1

Query: 381 RYKDDSEEEFDRKRDRNG---DRRH-RVDDRDGDNEKERDRRGDND--RRGNGERRHRDD 220
           R++    ++    RDR     DRRH R D+  G  EKER+ R D D  +  +  R HRDD
Sbjct: 389 RHRSPGRDKGRHDRDRTSQSHDRRHERRDETRGKREKERETRDDRDYDQEQSTSRDHRDD 448

Query: 219 DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDR 40
                  R GR + D+ +  DR+  R  + R   D RD      RD+ R  KD  ++ D 
Sbjct: 449 ----RESRDGRDRRDTRDTRDRREPR--ESRDTRDSRD-----TRDYSRDAKDSRDQRDS 497

Query: 39  KRNRDRR-YRD 10
           +  RD   YRD
Sbjct: 498 RSTRDSHDYRD 508

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 53/168 (31%), Positives = 73/168 (43%), Gaps = 32/168 (19%)
 Frame = -1

Query: 417  DDDNEKERDRRGRYKDDSEEEFDRK-----------RDRNGDRRHRVDDRDGDNEKERDR 271
            D  NE   DR GR +    E  D+               +G+     D R    +++R  
Sbjct: 549  DSRNESRSDRIGRSRGRGPELSDKGSRGTRGSQADGHSSSGNYHDSWDSRSSYADRDRYD 608

Query: 270  RGDNDRRGNGERRHRDDD--NEKERDRR--------GRYKD--DSEEEFDRKRDRNGDR- 130
              D  R  + ERRH + D  + +ERD+R        GR  D    E   +R+ DR+ DR 
Sbjct: 609  SRDQARDSSFERRHSERDRRDNRERDQRASSPVRHQGRSDDLERDERREERRVDRSDDRR 668

Query: 129  ------RHRVDDRDGDNEKERD-HRRRYKDDSEEDDRKRNRDR-RYRD 10
                  R R  +RD + E+ERD  R R K+   E DR R R+R R RD
Sbjct: 669  DERARERERERERDRERERERDREREREKERELERDRARERERDRERD 716

[69][TOP]
>UniRef100_UPI00017F0784 PREDICTED: hypothetical protein n=1 Tax=Sus scrofa
           RepID=UPI00017F0784
          Length = 193

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 56/144 (38%), Positives = 85/144 (59%), Gaps = 7/144 (4%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
           RD R R+RD + ++ER+R    + D E E +R+ +R    R R  +R+ + EKERDR  +
Sbjct: 46  RDERARERDRERDRERERERERERDREREKERELERE---RAREREREREREKERDRDRE 102

Query: 261 NDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRD-----G 103
            DR  + ER R R+ D EKER+R  R +++ E E +R+R+R  +R R R  +RD      
Sbjct: 103 RDRDHDRERERERERDREKERERE-REREERERERERERERERERAREREKERDRQRDWE 161

Query: 102 DNEKERDHRRRYKDDSEEDDRKRN 31
           D +K R+ RR  +DD+ ED   R+
Sbjct: 162 DKDKGREERREKRDDAREDRNPRD 185

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 48/145 (33%), Positives = 84/145 (57%), Gaps = 4/145 (2%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRGRYKDDSEEEFD---RKRDRNGDR-RHRVDDRDGDNEKERDRRG 265
           R++ R+D+ E++  R  R  D +E+  D   R+RDR  DR R R  +R+ D E+E++R  
Sbjct: 20  RHQGRNDELERDERREERRVDRAEDRRDERARERDRERDRERERERERERDREREKEREL 79

Query: 264 DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
           + +R    ER  R+ + E++RDR      D E E +R+RDR  +R    +  + + E+ER
Sbjct: 80  ERERARERERE-REREKERDRDRERDRDHDRERERERERDREKEREREREREERERERER 138

Query: 84  DHRRRYKDDSEEDDRKRNRDRRYRD 10
           + R R ++ + E +++R+R R + D
Sbjct: 139 E-RERERERAREREKERDRQRDWED 162

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 37/124 (29%), Positives = 68/124 (54%), Gaps = 5/124 (4%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDR-----RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 313
           R ++R+   +R R+R     R RDR+ D + +R+R    + D E+E +R+R+R    R R
Sbjct: 77  RELERERAREREREREREKERDRDRERDRDHDRERERERERDREKEREREREREERERER 136

Query: 312 VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD 133
             +R+ + E+ R+R  + DR+ + E      D +K R+ R   +DD+ E+    RD + +
Sbjct: 137 ERERERERERAREREKERDRQRDWE------DKDKGREERREKRDDARED-RNPRDGHEE 189

Query: 132 RRHR 121
           R+ +
Sbjct: 190 RKSK 193

[70][TOP]
>UniRef100_UPI0000E4A6CC PREDICTED: similar to WD repeat domain 60 n=2
           Tax=Strongylocentrotus purpuratus RepID=UPI0000E4A6CC
          Length = 1077

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 47/151 (31%), Positives = 85/151 (56%), Gaps = 4/151 (2%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRRGRY--KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
           KR++DR R +++D D E+ +DR G    + D E   DR++D + D+  R  DRDG  E+E
Sbjct: 68  KRDKDRDRQKEKDKDRERRKDREGESSKEKDRERRKDREKDSSKDKDRREKDRDGRKERE 127

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           ++   + DR      +HR+ + +++R+++ R   D++E  +R      +R    D++  +
Sbjct: 128 KESSKEKDRGEKDRSKHREKEKDRDREKKERSHRDNKESAERTDSGKKERHRDRDEKKRE 187

Query: 99  NEKERDHRRRYKDDSEEDDR-KRNRDRRYRD 10
            EKE   R   K  +++ DR KR  ++R+RD
Sbjct: 188 REKESGSRDGDKSSTKDGDRDKRREEKRHRD 218

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 50/152 (32%), Positives = 87/152 (57%), Gaps = 6/152 (3%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           R++DR R+RD+D D +  RD+    K D + +  +++D++ +RR    DR+G++ KE+DR
Sbjct: 43  RDKDRERHRDKDRDKDSHRDKEHERKRDKDRDRQKEKDKDRERRK---DREGESSKEKDR 99

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE- 94
               +RR + E+    D + +E+DR GR + + E   ++ R      +HR  ++D D E 
Sbjct: 100 ----ERRKDREKDSSKDKDRREKDRDGRKEREKESSKEKDRGEKDRSKHREKEKDRDREK 155

Query: 93  KERDHR----RRYKDDSEEDDRKRNRDRRYRD 10
           KER HR       + DS + +R R+RD + R+
Sbjct: 156 KERSHRDNKESAERTDSGKKERHRDRDEKKRE 187

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 48/143 (33%), Positives = 82/143 (57%), Gaps = 9/143 (6%)
 Frame = -1

Query: 405 EKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDN--EKERDRRGDNDRRGNGER 235
           E     + R+KD D ++E ++ RD++ +R HR  DRD D+  +KE +R+ D DR     +
Sbjct: 21  EARSSGKSRHKDKDRDKEREKPRDKDRER-HRDKDRDKDSHRDKEHERKRDKDR---DRQ 76

Query: 234 RHRDDDNEKERDRRGR--YKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHR----R 73
           + +D D E+ +DR G    + D E   DR++D + D+  R  DRDG  E+E++      R
Sbjct: 77  KEKDKDRERRKDREGESSKEKDRERRKDREKDSSKDKDRREKDRDGRKEREKESSKEKDR 136

Query: 72  RYKDDSEEDDRKRNRDRRYRDTS 4
             KD S+  +++++RDR  ++ S
Sbjct: 137 GEKDRSKHREKEKDRDREKKERS 159

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 49/169 (28%), Positives = 95/169 (56%), Gaps = 23/169 (13%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
           +++R+RR +DR+ D+ K++DRR + +D   + E+E  +++DR    R +  +++ D ++E
Sbjct: 96  EKDRERR-KDREKDSSKDKDRREKDRDGRKEREKESSKEKDRGEKDRSKHREKEKDRDRE 154

Query: 279 RDRRGDNDRRGNGER-------RHRD-DDNEKERDRRGRYKD---------DSEEEFDRK 151
           +  R   D + + ER       RHRD D+ ++ER++    +D         D ++  + K
Sbjct: 155 KKERSHRDNKESAERTDSGKKERHRDRDEKKREREKESGSRDGDKSSTKDGDRDKRREEK 214

Query: 150 RDRNGDRRHRVDDRDGDNEKERDHRRRYKD-DSEEDDRKRNR--DRRYR 13
           R R+ DR  R +    D+++E   RR+++D D   D RKR +  +R++R
Sbjct: 215 RHRDKDRERRKEKESNDSDRE---RRKHRDKDGSADRRKREKSGERKHR 260

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 50/168 (29%), Positives = 84/168 (50%), Gaps = 17/168 (10%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEF------------DRKRDRNGD 325
           +R+    + +DR  +DR    EKE+DR    K+ S  +             +R RDR+  
Sbjct: 125 EREKESSKEKDRGEKDRSKHREKEKDRDREKKERSHRDNKESAERTDSGKKERHRDRDEK 184

Query: 324 RRHRVDD---RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDR 154
           +R R  +   RDGD    +D  GD D+R   E+RHRD D E+ +++     +DS+ E  +
Sbjct: 185 KREREKESGSRDGDKSSTKD--GDRDKRRE-EKRHRDKDRERRKEKE---SNDSDRERRK 238

Query: 153 KRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDS--EEDDRKRNRDRRY 16
            RD++G    R  ++ G    ER HR+ +K++    + + K  +D R+
Sbjct: 239 HRDKDGSADRRKREKSG----ERKHRKEHKEEKGRSKSEHKNGQDERH 282

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 35/142 (24%), Positives = 78/142 (54%), Gaps = 6/142 (4%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEK-ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           +  ++R +RD  +  E+ +  ++ R++D  E++ +R+++       +   +DGD +K R+
Sbjct: 153 REKKERSHRDNKESAERTDSGKKERHRDRDEKKREREKESGSRDGDKSSTKDGDRDKRRE 212

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
            +   D+  + ERR   + N+ +R+RR +++D       RKR+++G+R+HR + ++    
Sbjct: 213 EKRHRDK--DRERRKEKESNDSDRERR-KHRDKDGSADRRKREKSGERKHRKEHKEEKGR 269

Query: 93  KERDHR-----RRYKDDSEEDD 43
            + +H+     R  K   +EDD
Sbjct: 270 SKSEHKNGQDERHEKKREDEDD 291

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 41/151 (27%), Positives = 77/151 (50%), Gaps = 8/151 (5%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDN-EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD----DRDGDNEK 283
           R+RD + R+R+ ++  ++ D+      D ++  + KR R+ DR  R +    D D +  K
Sbjct: 179 RDRDEKKREREKESGSRDGDKSSTKDGDRDKRREEKRHRDKDRERRKEKESNDSDRERRK 238

Query: 282 ERDRRGDNDRR---GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            RD+ G  DRR    +GER+HR +  E++   +  +K+  +E  ++KR+   D    +  
Sbjct: 239 HRDKDGSADRRKREKSGERKHRKEHKEEKGRSKSEHKNGQDERHEKKREDEDDVGEEI-- 296

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
               ++KE+      +DD  EDD +  R ++
Sbjct: 297 LKVSDQKEQQMEESNQDDGYEDDFESGRQKQ 327

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 42/128 (32%), Positives = 73/128 (57%), Gaps = 3/128 (2%)
 Frame = -1

Query: 384 GRYKDDS---EEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDN 214
           G+ K+D+   +E  +  ++     + R  D+D D E+E+ R  D DR      RHRD D 
Sbjct: 3   GKSKEDTWGAKELTESIKEARSSGKSRHKDKDRDKEREKPR--DKDR-----ERHRDKDR 55

Query: 213 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKR 34
           +K+  R   ++   +++ DR+++++ DR  R  DR+G++ KE+D  RR KD   E D  +
Sbjct: 56  DKDSHRDKEHERKRDKDRDRQKEKDKDRERR-KDREGESSKEKDRERR-KD--REKDSSK 111

Query: 33  NRDRRYRD 10
           ++DRR +D
Sbjct: 112 DKDRREKD 119

[71][TOP]
>UniRef100_UPI0000DA3D05 PREDICTED: similar to RIKEN cDNA 3110050K21 n=1 Tax=Rattus norvegicus
            RepID=UPI0000DA3D05
          Length = 1728

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/147 (35%), Positives = 86/147 (58%), Gaps = 8/147 (5%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDNEKER 277
            RD R RDRD + E+ER+R    + + E E +R+R+   +R     R R  +R+ + E+ER
Sbjct: 729  RDERVRDRDRERERERERERDREREREREKERERELERERAREREREREKERERERERER 788

Query: 276  DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDG 103
            D+R  +  R     R R+ + E+ER+ R R ++ + E E +R+R+R  +R R R  +R  
Sbjct: 789  DQRDRDHDREREREREREREKEREREERERERERERERERERERERERERERERERERAR 848

Query: 102  DNEKERDHRRRYKD-DSEEDDRKRNRD 25
            + EKER+ +R ++D D   DDR+  R+
Sbjct: 849  EREKERERQREWEDKDKGRDDRREKRE 875

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 52/150 (34%), Positives = 85/150 (56%), Gaps = 11/150 (7%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRR--------GRYKDDSEEEF--DRKRDRNGDRR-HRVDDRDGD 292
            +RR+ +RD  + +ERD+R        GR ++   EE   +R+ DR  +RR  RV DRD +
Sbjct: 680  ERRHGERDRRDNRERDQRPSSPIRHQGRSEELEREERREERRIDRVDERRDERVRDRDRE 739

Query: 291  NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
             E+ER+R  D +R      R R+ + E+E +R    + + E E +R+R+R  +R  R  D
Sbjct: 740  RERERERERDRERE-----REREKERERELERERAREREREREKERERERERERDQRDRD 794

Query: 111  RDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             D + E+ER+  R  + + EE +R+R R+R
Sbjct: 795  HDREREREREREREKEREREERERERERER 824

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 52/164 (31%), Positives = 90/164 (54%), Gaps = 11/164 (6%)
 Frame = -1

Query: 468  QRKMIWKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
            +R+   +R RDR   R R+++ + E ER+R    + + E+E +R+R+R  D+R R  DR+
Sbjct: 739  ERERERERERDREREREREKERERELERERAREREREREKERERERERERDQRDRDHDRE 798

Query: 297  GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
             + E+ER+R  + +R      R R+ + E+ER+R    + + E E +R R+R  +R  + 
Sbjct: 799  REREREREREKEREREERERERERERERERERERERERERERERERERAREREKERERQR 858

Query: 117  DDRDGDNEKERDHRRRYKDDSE-EDDR-------KRNRDRRYRD 10
            +  D D  K RD RR  ++D    +DR       +R   +RYR+
Sbjct: 859  EWEDKD--KGRDDRREKREDVHVREDRIPRDGHEERKSKKRYRN 900

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 49/155 (31%), Positives = 89/155 (57%), Gaps = 2/155 (1%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDR 301
            R ++R+   +R R+R  ++R+ + E+ERD+R R  D + E E +R+R++  +R  R  +R
Sbjct: 762  RELERERARERERERE-KERERERERERDQRDRDHDREREREREREREKEREREERERER 820

Query: 300  DGDNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
            + + E+ER+R  + +R    ER R R  + EKER+R+  ++D  +   DR R++  D   
Sbjct: 821  ERERERERERERERERERERERERERAREREKERERQREWEDKDKGRDDR-REKREDVHV 879

Query: 123  RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            R D    D  +ER  ++RY+++     R+  + RR
Sbjct: 880  REDRIPRDGHEERKSKKRYRNEGSPSPRQSPKRRR 914

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 47/156 (30%), Positives = 91/156 (58%), Gaps = 2/156 (1%)
 Frame = -1

Query: 471  IQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDG 295
            ++R+   +  R  R  +R D+  ++RDR    + + E + +R+R+R  +R   ++ +R  
Sbjct: 711  LEREERREERRIDRVDERRDERVRDRDRERERERERERDREREREREKERERELERERAR 770

Query: 294  DNEKERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRV 118
            + E+ER++  + +R    ++R RD D E+ER+R R R K+   EE +R+R+R    R R 
Sbjct: 771  EREREREKERERERERERDQRDRDHDREREREREREREKEREREERERERER---ERERE 827

Query: 117  DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             +R+ + E+ER+ R R ++ + E +++R R R + D
Sbjct: 828  RERERERERERE-RERERERAREREKERERQREWED 862

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 55/160 (34%), Positives = 83/160 (51%), Gaps = 20/160 (12%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEK---ERDRRGRYKDDS-----------EEEFDRKRDRNGDRRHRVDD 304
            RD R + RD   E+   ERDRR   + D             EE +R+  R   R  RVD+
Sbjct: 668  RDTRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRSEELEREERREERRIDRVDE 727

Query: 303  ------RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR 142
                  RD D E+ER+R  + DR    E R ++ + E ER+R    + + E+E +R+R+R
Sbjct: 728  RRDERVRDRDRERERERERERDRERERE-REKERERELERERAREREREREKERERERER 786

Query: 141  NGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
              D+R    DRD D E+ER+  R  + + E ++R+R R+R
Sbjct: 787  ERDQR----DRDHDREREREREREREKEREREERERERER 822

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 49/140 (35%), Positives = 81/140 (57%), Gaps = 3/140 (2%)
 Frame = -1

Query: 432  RYRDRDDDNEKERDRRGRYKDDSEEEFD-RKRDRNGDRRHRVDDRDGDNEKERDRRGDND 256
            R++ R ++ E+E  R  R  D  +E  D R RDR+ +R  R  +R+ D E+ER+R  + +
Sbjct: 703  RHQGRSEELEREERREERRIDRVDERRDERVRDRDRERE-RERERERDREREREREKERE 761

Query: 255  RRGNGER-RHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 82
            R    ER R R+ + EKER+R R R +D  + + DR+R+R         +R+ + E+ER+
Sbjct: 762  RELERERAREREREREKERERERERERDQRDRDHDRERERE-------REREREKERERE 814

Query: 81   HRRRYKDDSEEDDRKRNRDR 22
             R R ++   E +R+R R+R
Sbjct: 815  ERERERERERERERERERER 834

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 44/140 (31%), Positives = 72/140 (51%), Gaps = 14/140 (10%)
 Frame = -1

Query: 387  RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRR--GNGERRHRDDDN 214
            R RY +   +  D+ RD + +RRH   +RD  + +ERD+R  +  R  G  E   R++  
Sbjct: 662  RDRYPE--RDTRDQARDSSFERRH--GERDRRDNRERDQRPSSPIRHQGRSEELEREERR 717

Query: 213  EKER-DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD-----------HRRR 70
            E+ R DR    +D+   + DR+R+R    R R  DR+ + E+E++            R R
Sbjct: 718  EERRIDRVDERRDERVRDRDRERERE---RERERDREREREREKERERELERERARERER 774

Query: 69   YKDDSEEDDRKRNRDRRYRD 10
             ++   E +R+R RD+R RD
Sbjct: 775  EREKERERERERERDQRDRD 794

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 50/185 (27%), Positives = 88/185 (47%), Gaps = 32/185 (17%)
 Frame = -1

Query: 468  QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
            +R+   ++ R+R  R+R+ + E+ER+R    + + E E +R+R+R    R R  +R+   
Sbjct: 802  EREREREKEREREERERERERERERERERERERERERERERERER---AREREKERERQR 858

Query: 288  EKERDRRGDNDRRGNGERRH-RDD----DNEKERDRRGRYKDDS----EEEFDRKRDR-- 142
            E E   +G +DRR   E  H R+D    D  +ER  + RY+++      +   R+R+   
Sbjct: 859  EWEDKDKGRDDRREKREDVHVREDRIPRDGHEERKSKKRYRNEGSPSPRQSPKRRREHSP 918

Query: 141  NGDRRHRVDDRDGDNEKER---------------------DHRRRYKDDSEEDDRKRNRD 25
            + D  H  DD+   NEK R                     D + R+K++  + +RK +  
Sbjct: 919  DSDTYHSGDDK---NEKHRLLSQVVRPQESRSLSPSHLTEDRQGRWKEEERKSERKES-S 974

Query: 24   RRYRD 10
            RRY +
Sbjct: 975  RRYEE 979

[72][TOP]
>UniRef100_UPI00005A4144 PREDICTED: similar to Protein KIAA0853 n=1 Tax=Canis lupus familiaris
            RepID=UPI00005A4144
          Length = 1656

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 58/158 (36%), Positives = 86/158 (54%), Gaps = 12/158 (7%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDNE 286
            R RDR R RDR+ + E+ERDR    + + E E  R+R+R  +R     R R  DRD D E
Sbjct: 678  RERDRERERDRERERERERDREREKERELERERAREREREREREKERDRERERDRDHDRE 737

Query: 285  KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
            +ER+R  D ++    ER  R+ + E+ER+R      + E E +R R+R+ +R  + D  D
Sbjct: 738  RERERERDREKEREREREERERERERERER------ERERERERARERDKERERQRDWED 791

Query: 105  GDNEKERDHRRRYKDDSEEDDR------KRNRDRRYRD 10
             D  K RD RR  ++D+ ED        +R   +RYR+
Sbjct: 792  KD--KGRDDRREKREDTREDRNPRDGHDERKSKKRYRN 827

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 61/168 (36%), Positives = 93/168 (55%), Gaps = 25/168 (14%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRR--------GRY----KDDSEEE--FDRKRDRNGDR-----RH 316
            +RR+ +RD  + +ERD+R        GR     +D+  EE   DR  DR  +R     R 
Sbjct: 624  ERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRVEDRRDERARERDRE 683

Query: 315  RVDDRDGDNEKERDRRGDNDRRGNGER---RHRDDDNEKERDR-RGRYKD-DSEEEFDRK 151
            R  DR+ + E+ERDR  + +R    ER   R R+ + EKERDR R R +D D E E +R+
Sbjct: 684  RERDRERERERERDREREKERELERERAREREREREREKERDRERERDRDHDRERERERE 743

Query: 150  RDRNGDRRHRVDDRDGDNEKERD-HRRRYKDDSEEDDRKRNRDRRYRD 10
            RDR  +R    ++R+ + E+ER+  R R ++ + E D++R R R + D
Sbjct: 744  RDREKEREREREERERERERERERERERERERARERDKERERQRDWED 791

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 56/153 (36%), Positives = 85/153 (55%), Gaps = 9/153 (5%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-------RHRVDDRDGD 292
            +  R  R  DR D+  +ERDR    + D E E +R+RDR  ++       R R  +R+ +
Sbjct: 662  EERRVDRVEDRRDERARERDRER--ERDRERERERERDREREKERELERERARERERERE 719

Query: 291  NEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRV 118
             EKERDR  + DR  + ER R R+ D EKER+R    +++ E E +R+R+R  +R R R 
Sbjct: 720  REKERDRERERDRDHDRERERERERDREKERERE---REERERERERERERERERERERA 776

Query: 117  DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
             +RD + E++RD     KD   +D R++  D R
Sbjct: 777  RERDKERERQRDWED--KDKGRDDRREKREDTR 807

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 54/161 (33%), Positives = 87/161 (54%), Gaps = 17/161 (10%)
 Frame = -1

Query: 450  KRNRDR---RYRDRDDDNEKERD---RRGRYKD---DSEEEFDRKRDRNGDR-RHRVDDR 301
            +R RDR   R R+RD + EKER+    R R ++   + E+E DR+R+R+ D  R R  +R
Sbjct: 683  ERERDRERERERERDREREKERELERERAREREREREREKERDRERERDRDHDRERERER 742

Query: 300  DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDR 142
            + D EKER+R  +   R     R R+ + E+ER R       R R  +D ++  D +R++
Sbjct: 743  ERDREKEREREREERERERERERERERERERERARERDKERERQRDWEDKDKGRDDRREK 802

Query: 141  NGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
              D R   + RDG +  ER  ++RY+++     R+  + RR
Sbjct: 803  REDTREDRNPRDGHD--ERKSKKRYRNEGSPSPRQSPKRRR 841

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 52/162 (32%), Positives = 76/162 (46%), Gaps = 32/162 (19%)
 Frame = -1

Query: 411  DNEKERDRRGRYKDDSEEEFDRKRDRNGDR----------RH------------------ 316
            D   ERD R + +D S E    +RDR  +R          RH                  
Sbjct: 607  DRYPERDNRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRV 666

Query: 315  -RVDDRDGDNEKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKR 148
             RV+DR  +  +ERDR  + DR    ER   R R+ + E ER+R    + + E E +R R
Sbjct: 667  DRVEDRRDERARERDRERERDRERERERERDREREKERELERERAREREREREREKERDR 726

Query: 147  DRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            +R  DR H   DR+ + E+ERD  +  + + EE +R+R R+R
Sbjct: 727  ERERDRDH---DRERERERERDREKEREREREERERERERER 765

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 47/150 (31%), Positives = 81/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
            +R+   ++ RDR R RDRD D E+ER+R R R K+   E  +R+R+R  +R     +R+ 
Sbjct: 715  EREREREKERDRERERDRDHDRERERERERDREKEREREREERERERERER-----ERER 769

Query: 294  DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
            + E+ER R  D +R    ER+   +D +K RD R   ++D+ E+    RD + +R+ +  
Sbjct: 770  ERERERARERDKER----ERQRDWEDKDKGRDDRREKREDTRED-RNPRDGHDERKSKKR 824

Query: 114  DRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
             R+  +   R   +R ++ S + D   + D
Sbjct: 825  YRNEGSPSPRQSPKRRREHSPDSDAYNSGD 854

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 53/145 (36%), Positives = 73/145 (50%), Gaps = 23/145 (15%)
 Frame = -1

Query: 387  RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR--------GDNDRRGNGERR 232
            R RY +   +  D+ RD + +RRH   +RD  + +ERD+R        G ND     ERR
Sbjct: 606  RDRYPE--RDNRDQARDSSFERRH--GERDRRDNRERDQRPSSPIRHQGRNDELERDERR 661

Query: 231  H--RDDDNEKERDRRGRYKD-----DSEEEFDRKRDRNGDR-------RHRVDDRDGDNE 94
               R D  E  RD R R +D     D E E +R+RDR  ++       R R  +R+ + E
Sbjct: 662  EERRVDRVEDRRDERARERDRERERDRERERERERDREREKERELERERARERERERERE 721

Query: 93   KERD-HRRRYKDDSEEDDRKRNRDR 22
            KERD  R R +D   E +R+R RDR
Sbjct: 722  KERDRERERDRDHDRERERERERDR 746

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 54/186 (29%), Positives = 88/186 (47%), Gaps = 39/186 (20%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKER 277
            +R RDR + DR+ + E+ERDR + R ++  E E +R+R+R  +R R R   R+ D E+ER
Sbjct: 727  ERERDRDH-DRERERERERDREKEREREREERERERERERERERERERERARERDKERER 785

Query: 276  DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN--------GDRRHR 121
             R  ++  +G  +RR + +D  ++R+ R    D  +E   +KR RN          +R R
Sbjct: 786  QRDWEDKDKGRDDRREKREDTREDRNPR----DGHDERKSKKRYRNEGSPSPRQSPKRRR 841

Query: 120  VDDRDGD--------NEKER---------------------DHRRRYKDDSEEDDRKRNR 28
                D D        NEK R                     D + R+K++  + +RK + 
Sbjct: 842  EHSPDSDAYNSGDDKNEKHRLLSQVVRPQESRSLSPSHLTEDRQGRWKEEDRKLERKES- 900

Query: 27   DRRYRD 10
             RRY +
Sbjct: 901  SRRYEE 906

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 45/131 (34%), Positives = 67/131 (51%), Gaps = 23/131 (17%)
 Frame = -1

Query: 345 KRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER--------RHRDDDNEKERDRRG 190
           +RDR  +R +R   RD   E+   R G+ DRR N ER        RH+  ++E ERD R 
Sbjct: 605 ERDRYPERDNRDQARDSSFER---RHGERDRRDNRERDQRPSSPIRHQGRNDELERDERR 661

Query: 189 RYK-----DDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD---------HRRRYKDDS 55
             +     +D  +E  R+RDR  +R R R  +R+ D E+E++          R R ++  
Sbjct: 662 EERRVDRVEDRRDERARERDRERERDRERERERERDREREKERELERERARERERERERE 721

Query: 54  EEDDRKRNRDR 22
           +E DR+R RDR
Sbjct: 722 KERDRERERDR 732

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 45/153 (29%), Positives = 71/153 (46%), Gaps = 12/153 (7%)
 Frame = -1

Query: 426  RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR-----GD 262
            RDR+     E     + + D  +  +  R  + DR+         +  E DR+     G 
Sbjct: 1222 RDREKTKSLEITGERKSRIDQLKRGEPSRSTSSDRQDSRSHSSRRSSPESDRQVHSRSGS 1281

Query: 261  NDRRGNGERRHR-DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNE 94
             D R   + R R + D E++R+RR    D  + E+DR  D++  R   R R+ +R+ + +
Sbjct: 1282 FDSRDRLQERDRYEHDRERDRERR----DTRQREWDRDADKDWPRNRDRDRLRERERERD 1337

Query: 93   KERD---HRRRYKDDSEEDDRKRNRDRRYRDTS 4
            K RD    R R   DS E DR R+RDR +  +S
Sbjct: 1338 KRRDLDRERERLISDSVERDRDRDRDRTFESSS 1370

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 47/156 (30%), Positives = 68/156 (43%), Gaps = 15/156 (9%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKER---------DRRGRYKDDSEEEFDRKRDRNG-DRRHRVDDRD 298
            R   R +  R    E +R         D R R ++    E DR+RDR   D R R  DRD
Sbjct: 1256 RQDSRSHSSRRSSPESDRQVHSRSGSFDSRDRLQERDRYEHDRERDRERRDTRQREWDRD 1315

Query: 297  GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
             D +  R+R  D DR    ER  RD   + +R+R     D  E + DR RDR  +   ++
Sbjct: 1316 ADKDWPRNR--DRDRLRERERE-RDKRRDLDRERERLISDSVERDRDRDRDRTFESSSQI 1372

Query: 117  D-----DRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
            +     +   ++E ERD     +D    D  K ++D
Sbjct: 1373 ESVKRSEAKLESEHERDLEGTSRDSLALDKEKMDKD 1408

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 43/162 (26%), Positives = 71/162 (43%), Gaps = 7/162 (4%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEK---ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
           QRK    R+R         D+E+     DRR   ++++  + DR++D   +R +     +
Sbjct: 384 QRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREETRSKRDREKDAREEREY-----E 438

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRD--RNGDRRH 124
            D    RD R D + R   +RR   D  ++   R  R   DS E  D  RD   + D R 
Sbjct: 439 QDQSSSRDHRDDREPRDGRDRRDARDARDRRELRDSRDIRDSREMRDYSRDNKESRDPRD 498

Query: 123 RVDDRDGDNEKERDHR--RRYKDDSEEDDRKRNRDRRYRDTS 4
               RD  + ++R+ R   R +D  +E+ R   R+    ++S
Sbjct: 499 SRSARDTHDYRDRESRDTHRKEDTYQEESRSYGRNHLREESS 540

[73][TOP]
>UniRef100_UPI0000DA3DB4 PREDICTED: similar to RIKEN cDNA 3110050K21 n=1 Tax=Rattus norvegicus
            RepID=UPI0000DA3DB4
          Length = 1727

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/147 (35%), Positives = 86/147 (58%), Gaps = 8/147 (5%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDNEKER 277
            RD R RDRD + E+ER+R    + + E E +R+R+   +R     R R  +R+ + E+ER
Sbjct: 729  RDERVRDRDRERERERERERDREREREREKERERELERERAREREREREKERERERERER 788

Query: 276  DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDG 103
            D+R  +  R     R R+ + E+ER+ R R ++ + E E +R+R+R  +R R R  +R  
Sbjct: 789  DQRDRDHDREREREREREREKEREREERERERERERERERERERERERERERERERERAR 848

Query: 102  DNEKERDHRRRYKD-DSEEDDRKRNRD 25
            + EKER+ +R ++D D   DDR+  R+
Sbjct: 849  EREKERERQREWEDKDKGRDDRREKRE 875

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 52/150 (34%), Positives = 85/150 (56%), Gaps = 11/150 (7%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRR--------GRYKDDSEEEF--DRKRDRNGDRR-HRVDDRDGD 292
            +RR+ +RD  + +ERD+R        GR ++   EE   +R+ DR  +RR  RV DRD +
Sbjct: 680  ERRHGERDRRDNRERDQRPSSPIRHQGRSEELEREERREERRIDRVDERRDERVRDRDRE 739

Query: 291  NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
             E+ER+R  D +R      R R+ + E+E +R    + + E E +R+R+R  +R  R  D
Sbjct: 740  RERERERERDRERE-----REREKERERELERERAREREREREKERERERERERDQRDRD 794

Query: 111  RDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             D + E+ER+  R  + + EE +R+R R+R
Sbjct: 795  HDREREREREREREKEREREERERERERER 824

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 52/164 (31%), Positives = 90/164 (54%), Gaps = 11/164 (6%)
 Frame = -1

Query: 468  QRKMIWKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
            +R+   +R RDR   R R+++ + E ER+R    + + E+E +R+R+R  D+R R  DR+
Sbjct: 739  ERERERERERDREREREREKERERELERERAREREREREKERERERERERDQRDRDHDRE 798

Query: 297  GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
             + E+ER+R  + +R      R R+ + E+ER+R    + + E E +R R+R  +R  + 
Sbjct: 799  REREREREREKEREREERERERERERERERERERERERERERERERERAREREKERERQR 858

Query: 117  DDRDGDNEKERDHRRRYKDDSE-EDDR-------KRNRDRRYRD 10
            +  D D  K RD RR  ++D    +DR       +R   +RYR+
Sbjct: 859  EWEDKD--KGRDDRREKREDVHVREDRIPRDGHEERKSKKRYRN 900

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 49/155 (31%), Positives = 89/155 (57%), Gaps = 2/155 (1%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDR 301
            R ++R+   +R R+R  ++R+ + E+ERD+R R  D + E E +R+R++  +R  R  +R
Sbjct: 762  RELERERARERERERE-KERERERERERDQRDRDHDREREREREREREKEREREERERER 820

Query: 300  DGDNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
            + + E+ER+R  + +R    ER R R  + EKER+R+  ++D  +   DR R++  D   
Sbjct: 821  ERERERERERERERERERERERERERAREREKERERQREWEDKDKGRDDR-REKREDVHV 879

Query: 123  RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            R D    D  +ER  ++RY+++     R+  + RR
Sbjct: 880  REDRIPRDGHEERKSKKRYRNEGSPSPRQSPKRRR 914

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 47/156 (30%), Positives = 91/156 (58%), Gaps = 2/156 (1%)
 Frame = -1

Query: 471  IQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDG 295
            ++R+   +  R  R  +R D+  ++RDR    + + E + +R+R+R  +R   ++ +R  
Sbjct: 711  LEREERREERRIDRVDERRDERVRDRDRERERERERERDREREREREKERERELERERAR 770

Query: 294  DNEKERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRV 118
            + E+ER++  + +R    ++R RD D E+ER+R R R K+   EE +R+R+R    R R 
Sbjct: 771  EREREREKERERERERERDQRDRDHDREREREREREREKEREREERERERER---ERERE 827

Query: 117  DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             +R+ + E+ER+ R R ++ + E +++R R R + D
Sbjct: 828  RERERERERERE-RERERERAREREKERERQREWED 862

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 55/160 (34%), Positives = 83/160 (51%), Gaps = 20/160 (12%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEK---ERDRRGRYKDDS-----------EEEFDRKRDRNGDRRHRVDD 304
            RD R + RD   E+   ERDRR   + D             EE +R+  R   R  RVD+
Sbjct: 668  RDTRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRSEELEREERREERRIDRVDE 727

Query: 303  ------RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR 142
                  RD D E+ER+R  + DR    E R ++ + E ER+R    + + E+E +R+R+R
Sbjct: 728  RRDERVRDRDRERERERERERDRERERE-REKERERELERERAREREREREKERERERER 786

Query: 141  NGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
              D+R    DRD D E+ER+  R  + + E ++R+R R+R
Sbjct: 787  ERDQR----DRDHDREREREREREREKEREREERERERER 822

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 49/140 (35%), Positives = 81/140 (57%), Gaps = 3/140 (2%)
 Frame = -1

Query: 432  RYRDRDDDNEKERDRRGRYKDDSEEEFD-RKRDRNGDRRHRVDDRDGDNEKERDRRGDND 256
            R++ R ++ E+E  R  R  D  +E  D R RDR+ +R  R  +R+ D E+ER+R  + +
Sbjct: 703  RHQGRSEELEREERREERRIDRVDERRDERVRDRDRERE-RERERERDREREREREKERE 761

Query: 255  RRGNGER-RHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 82
            R    ER R R+ + EKER+R R R +D  + + DR+R+R         +R+ + E+ER+
Sbjct: 762  RELERERAREREREREKERERERERERDQRDRDHDRERERE-------REREREKERERE 814

Query: 81   HRRRYKDDSEEDDRKRNRDR 22
             R R ++   E +R+R R+R
Sbjct: 815  ERERERERERERERERERER 834

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 44/140 (31%), Positives = 72/140 (51%), Gaps = 14/140 (10%)
 Frame = -1

Query: 387  RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRR--GNGERRHRDDDN 214
            R RY +   +  D+ RD + +RRH   +RD  + +ERD+R  +  R  G  E   R++  
Sbjct: 662  RDRYPE--RDTRDQARDSSFERRH--GERDRRDNRERDQRPSSPIRHQGRSEELEREERR 717

Query: 213  EKER-DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD-----------HRRR 70
            E+ R DR    +D+   + DR+R+R    R R  DR+ + E+E++            R R
Sbjct: 718  EERRIDRVDERRDERVRDRDRERERE---RERERDREREREREKERERELERERARERER 774

Query: 69   YKDDSEEDDRKRNRDRRYRD 10
             ++   E +R+R RD+R RD
Sbjct: 775  EREKERERERERERDQRDRD 794

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 50/185 (27%), Positives = 88/185 (47%), Gaps = 32/185 (17%)
 Frame = -1

Query: 468  QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
            +R+   ++ R+R  R+R+ + E+ER+R    + + E E +R+R+R    R R  +R+   
Sbjct: 802  EREREREKEREREERERERERERERERERERERERERERERERER---AREREKERERQR 858

Query: 288  EKERDRRGDNDRRGNGERRH-RDD----DNEKERDRRGRYKDDS----EEEFDRKRDR-- 142
            E E   +G +DRR   E  H R+D    D  +ER  + RY+++      +   R+R+   
Sbjct: 859  EWEDKDKGRDDRREKREDVHVREDRIPRDGHEERKSKKRYRNEGSPSPRQSPKRRREHSP 918

Query: 141  NGDRRHRVDDRDGDNEKER---------------------DHRRRYKDDSEEDDRKRNRD 25
            + D  H  DD+   NEK R                     D + R+K++  + +RK +  
Sbjct: 919  DSDTYHSGDDK---NEKHRLLSQVVRPQESRSLSPSHLTEDRQGRWKEEERKSERKES-S 974

Query: 24   RRYRD 10
            RRY +
Sbjct: 975  RRYEE 979

[74][TOP]
>UniRef100_C1EGB6 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EGB6_9CHLO
          Length = 424

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 58/145 (40%), Positives = 84/145 (57%), Gaps = 2/145 (1%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           R+RDR R RDRD D +++RDR      D + + DR+RD + DRR R  DR  D +++RDR
Sbjct: 288 RDRDRDRDRDRDRDRDRDRDR------DRDRDRDRRRDGSRDRRDRSRDRRRDRDRDRDR 341

Query: 270 RGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
             D D+  +   R RD D +K+RDR R R   D +E++DR R R  DR          + 
Sbjct: 342 DRDRDKDRD---RDRDKDRDKDRDRNRDR---DRDEDYDRDRKRRRDRSRSRSRSRSRSP 395

Query: 93  KERDHRRRYKDDSEEDDRKRNRDRR 19
           +++D R R K+D +  DR+R+ D R
Sbjct: 396 RKKDRRERDKEDRDR-DRRRSPDPR 419

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 59/158 (37%), Positives = 80/158 (50%), Gaps = 13/158 (8%)
 Frame = -1

Query: 453 WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKER 277
           W R+    +  R+     +RDR            DR RDR+ DR R R  DRD D +++R
Sbjct: 269 WGRDSRPPFSARNQGRGMDRDR------------DRDRDRDRDRDRDRDRDRDRDRDRDR 316

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDG 103
            R G  DRR     R RD D +++RDR R + +D D +++ D+ RDRN D R R +D D 
Sbjct: 317 RRDGSRDRRDRSRDRRRDRDRDRDRDRDRDKDRDRDRDKDRDKDRDRNRD-RDRDEDYDR 375

Query: 102 DNEKERDHRR----------RYKDDSEEDDRKRNRDRR 19
           D ++ RD  R          R KD  E D   R+RDRR
Sbjct: 376 DRKRRRDRSRSRSRSRSRSPRKKDRRERDKEDRDRDRR 413

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 50/117 (42%), Positives = 66/117 (56%), Gaps = 3/117 (2%)
 Frame = -1

Query: 351 DRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDS 172
           DR RDR+ DR     DRD D +++RDR  D DRR +G R  RD   ++ RDR      D 
Sbjct: 289 DRDRDRDRDR-----DRDRDRDRDRDRDRDRDRRRDGSRDRRDRSRDRRRDRDRDRDRDR 343

Query: 171 EEEFDRKRDRNGDR---RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           + + DR RDR+ DR   R R  DRD D + +RD +RR +D S    R R+R  R +D
Sbjct: 344 DRDKDRDRDRDKDRDKDRDRNRDRDRDEDYDRDRKRR-RDRSRSRSRSRSRSPRKKD 399

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 46/120 (38%), Positives = 60/120 (50%)
 Frame = -1

Query: 465 RKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 286
           R+    R+R  R RDR  D +++RDR      D + + DR RDR+ DR     D+D D  
Sbjct: 316 RRRDGSRDRRDRSRDRRRDRDRDRDR------DRDRDKDRDRDRDKDR-----DKDRDRN 364

Query: 285 KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
           ++RDR  D D R    RR R     + R R  R KD  E +   K DR+ DRR   D RD
Sbjct: 365 RDRDRDEDYD-RDRKRRRDRSRSRSRSRSRSPRKKDRRERD---KEDRDRDRRRSPDPRD 420

[75][TOP]
>UniRef100_B9PW17 Protein phosphatase 2C, putative n=1 Tax=Toxoplasma gondii GT1
           RepID=B9PW17_TOXGO
          Length = 867

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/145 (36%), Positives = 85/145 (58%), Gaps = 2/145 (1%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           RNR+    DR+   E++RDR    + D E E DR R+R+ +R+    +R+ + E+ERDR 
Sbjct: 140 RNREGDTGDRERQRERDRDR----ERDRERERDRDRERDRERQR---EREKERERERDRE 192

Query: 267 GDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNE 94
            D +R    +R R RD D E++RDR    + + E + +R+RDR+ +R R R  DR+ + E
Sbjct: 193 RDRERERFRDRDRDRDRDRERDRDRERERERERERDRERERDRDRERDRERERDRERERE 252

Query: 93  KERDHRRRYKDDSEEDDRKRNRDRR 19
           +ER+     +++   +DRKR   RR
Sbjct: 253 REREKEGEEREEKGSEDRKRGWKRR 277

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 54/146 (36%), Positives = 83/146 (56%), Gaps = 1/146 (0%)
 Frame = -1

Query: 483 GIRMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVD 307
           G R  QR+    R RDR  R+RD D E++R+R+   + + E E DR+RDR  +R R R  
Sbjct: 147 GDRERQRERDRDRERDRE-RERDRDRERDRERQREREKERERERDRERDRERERFRDRDR 205

Query: 306 DRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR 127
           DRD D E++RDR  + +R      R RD + E++RDR    + D E E DR+R+R  +R 
Sbjct: 206 DRDRDRERDRDRERERER-----ERERDRERERDRDR----ERDRERERDRERERERERE 256

Query: 126 HRVDDRDGDNEKERDHRRRYKDDSEE 49
              ++R+    ++R    + ++D EE
Sbjct: 257 KEGEEREEKGSEDRKRGWKRREDREE 282

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 56/147 (38%), Positives = 81/147 (55%), Gaps = 5/147 (3%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKE-RDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           R R+RR   +D  ++++ R   G +++   +  DR+R R  DR     DR+ D E+ERDR
Sbjct: 115 RRRERREARKDAGSQRQWRRPEGSWRNREGDTGDRERQRERDR-----DRERDRERERDR 169

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEF-DRKRDRNGDRRHRVDDRDGDNE 94
             + DR     +R R+ + E+ERDR    +D   E F DR RDR+ DR     DRD + E
Sbjct: 170 DRERDRE---RQREREKERERERDRE---RDRERERFRDRDRDRDRDRER---DRDRERE 220

Query: 93  KERDH---RRRYKDDSEEDDRKRNRDR 22
           +ER+    R R +D   E DR+R RDR
Sbjct: 221 RERERERDRERERDRDRERDRERERDR 247

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 47/119 (39%), Positives = 71/119 (59%), Gaps = 10/119 (8%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR-----RGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGD 292
           R RDR R R+R+ + E+ERDR     R R++D D + + DR+RDR+ +R R R  +RD +
Sbjct: 171 RERDRERQREREKERERERDRERDRERERFRDRDRDRDRDRERDRDRERERERERERDRE 230

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKR--DRNGDRRHR 121
            E++RDR  D +R      R R+ + E+ER++ G  +++   E DRKR   R  DR  R
Sbjct: 231 RERDRDRERDRER-----ERDREREREREREKEGEEREEKGSE-DRKRGWKRREDREER 283

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 45/139 (32%), Positives = 69/139 (49%), Gaps = 6/139 (4%)
 Frame = -1

Query: 420 RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGN- 244
           R+  +E+   RR   ++ S    +    R+G RR R + R     + + RR +   R   
Sbjct: 84  REVTDERVHTRRRSERERSLSAEESSESRSGRRRERREARKDAGSQRQWRRPEGSWRNRE 143

Query: 243 ---GER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER-DH 79
              G+R R R+ D ++ERDR      D E + +R+R+R  +R  R  DR+ D E+ER   
Sbjct: 144 GDTGDRERQRERDRDRERDRERERDRDRERDRERQREREKERE-RERDRERDRERERFRD 202

Query: 78  RRRYKDDSEEDDRKRNRDR 22
           R R +D   E DR R R+R
Sbjct: 203 RDRDRDRDRERDRDRERER 221

[76][TOP]
>UniRef100_A7US43 AGAP011217-PA n=1 Tax=Anopheles gambiae RepID=A7US43_ANOGA
          Length = 1241

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 48/155 (30%), Positives = 90/155 (58%), Gaps = 10/155 (6%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDNEK 283
            RN+++   D  + ++++RDRR   + + E+E +R+R++  +R     + R  +R  D EK
Sbjct: 737  RNKEKERGDHAEHHDRDRDRRKEKEREKEKEKEREREKEREREKVREKEREKERLRDREK 796

Query: 282  ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDD 112
            ERD+  D +R      R +D D EK+RD     + + E E +R+++R  +R   R +  D
Sbjct: 797  ERDKEKDRERGEKDREREKDRDKEKDRDMEKDREREKEREKEREKEREKEREKEREKERD 856

Query: 111  RDGDNEKERDHRRRYKDDSEED--DRKRNRDRRYR 13
            R+ D + +   +++ +D S+ED  DRK++RD++ R
Sbjct: 857  REKDKDGKEVSKKKTRDSSDEDRRDRKKDRDKKKR 891

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 59/168 (35%), Positives = 93/168 (55%), Gaps = 25/168 (14%)
 Frame = -1

Query: 447  RNRDRRY-RDRDDDNEKERDR-----------RGRYKD---DSEEEFDRKRDRNGDRRHR 313
            R+RDRR  ++R+ + EKER+R           + R K+   D E+E D+++DR    + R
Sbjct: 752  RDRDRRKEKEREKEKEKEREREKEREREKVREKEREKERLRDREKERDKEKDRERGEKDR 811

Query: 312  VDDRDGDNEKERDRRGDNDRRGNGER---RHRDDDNEKERDR-RGRYKDDSEEEFDRKRD 145
              ++D D EK+RD   D +R    E+   + R+ + EKER++ R R KD   +E  +K+ 
Sbjct: 812  EREKDRDKEKDRDMEKDREREKEREKEREKEREKEREKEREKERDREKDKDGKEVSKKKT 871

Query: 144  RNG---DRRHRVDDRD---GDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            R+    DRR R  DRD      EKE + R+  K+  E+D  +R++DRR
Sbjct: 872  RDSSDEDRRDRKKDRDKKKRKKEKEVEKRKHKKERKEKDKERRSKDRR 919

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 58/166 (34%), Positives = 94/166 (56%), Gaps = 17/166 (10%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
            +R R+R R RDR  D E+E+DR + + + D  E  DR RDR  ++     +R+ + EKER
Sbjct: 716  QRERERERDRDRQRDREREKDRNKEKERGDHAEHHDRDRDRRKEK-----EREKEKEKER 770

Query: 276  DRRGDNDR---RGNGERRHRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR---RH 124
            +R  + +R   R     + R  D EKERD+   R R + D E E DR ++++ D    R 
Sbjct: 771  EREKEREREKVREKEREKERLRDREKERDKEKDRERGEKDREREKDRDKEKDRDMEKDRE 830

Query: 123  RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD------RRYRDTS 4
            R  +R+ + EKER+ + R K+  +E DR++++D      ++ RD+S
Sbjct: 831  REKEREKEREKERE-KEREKEREKERDREKDKDGKEVSKKKTRDSS 875

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 46/157 (29%), Positives = 83/157 (52%), Gaps = 17/157 (10%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKER-DRRGRYKDDSEEEFDRKR-------DRNGDRRHRVDDRDGDNE 286
            +DR+++  + D   E  D+ GR   D  +   R+R       +R GD + R  +R+ D +
Sbjct: 668  QDRKHQPSEKDKRSEPVDQHGRRGGDERDHHHRERGKERGENERGGDHQ-RERERERDRD 726

Query: 285  KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-------- 130
            ++RDR  + DR    ER    + ++++RDRR   + + E+E +R+R++  +R        
Sbjct: 727  RQRDREREKDRNKEKERGDHAEHHDRDRDRRKEKEREKEKEKEREREKEREREKVREKER 786

Query: 129  -RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             + R+ DR+ + +KE+D  R  KD   E DR + +DR
Sbjct: 787  EKERLRDREKERDKEKDRERGEKDREREKDRDKEKDR 823

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 48/153 (31%), Positives = 86/153 (56%), Gaps = 10/153 (6%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDR---RGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
            +R ++R   +R  D+++ER+R   R R +D + E++ +++++R     H   DRD   EK
Sbjct: 701  ERGKERGENERGGDHQRERERERDRDRQRDREREKDRNKEKERGDHAEHHDRDRDRRKEK 760

Query: 282  ERDRRGDNDRRGNGERRH---RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            ER++  + +R    ER     R+ + EKER R      D E+E D+++DR    + R  +
Sbjct: 761  EREKEKEKEREREKEREREKVREKEREKERLR------DREKERDKEKDRERGEKDRERE 814

Query: 111  RDGDNEKERD---HRRRYKDDSEEDDRKRNRDR 22
            +D D EK+RD    R R K+  +E +++R ++R
Sbjct: 815  KDRDKEKDRDMEKDREREKEREKEREKEREKER 847

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 43/146 (29%), Positives = 81/146 (55%), Gaps = 2/146 (1%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR-RHRVDD 304
            R+  R+    + +DR   ++D + EK+RD+    KD D E++ +R+++R  +R + R  +
Sbjct: 790  RLRDREKERDKEKDRERGEKDREREKDRDKE---KDRDMEKDREREKEREKEREKEREKE 846

Query: 303  RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
            R+ + EKERDR  D D +   +++ RD  +E  RDR    K D +++  +K      R+H
Sbjct: 847  REKEREKERDREKDKDGKEVSKKKTRDSSDEDRRDR----KKDRDKKKRKKEKEVEKRKH 902

Query: 123  RVDDRDGDNEKERDHRRRYKDDSEED 46
            + + ++ D E+    RR+ +   +ED
Sbjct: 903  KKERKEKDKERRSKDRRKERKTMDED 928

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 54/165 (32%), Positives = 77/165 (46%), Gaps = 16/165 (9%)
 Frame = -1

Query: 468  QRKMIWKRNR----DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 301
            Q++   +RNR    +R  R R  DN     R G  + +S +     R R+ DRR   DD+
Sbjct: 578  QQQQQMRRNRSPMGERGRRSRSFDNG---GRGGGPRGNSSDRRRTSRQRSPDRRRSPDDK 634

Query: 300  DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRY-----KDDSEEEFDRKRDRNG 136
               +  ERDR  +   R N   R      E ERD++ R      KD   E  D+   R G
Sbjct: 635  H--HPDERDRSAERHERSNRGSRSAGGGGEHERDKQDRKHQPSEKDKRSEPVDQHGRRGG 692

Query: 135  DRR---HRVDDRD-GDNEKERDHRR---RYKDDSEEDDRKRNRDR 22
            D R   HR   ++ G+NE+  DH+R   R +D   + DR+R +DR
Sbjct: 693  DERDHHHRERGKERGENERGGDHQRERERERDRDRQRDREREKDR 737

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 48/159 (30%), Positives = 78/159 (49%), Gaps = 10/159 (6%)
 Frame = -1

Query: 468  QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
            +R+   +R+ DRR   R  D++   D R R  +  E      R   G   H  D +D  +
Sbjct: 616  RRRTSRQRSPDRR---RSPDDKHHPDERDRSAERHERSNRGSRSAGGGGEHERDKQDRKH 672

Query: 288  E-KERDRRGD----NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-R 127
            +  E+D+R +    + RRG  ER H   +  KER    R  D   E   R+R+R+ DR R
Sbjct: 673  QPSEKDKRSEPVDQHGRRGGDERDHHHRERGKERGENERGGDHQRE---RERERDRDRQR 729

Query: 126  HRVDDRDGDNEKER----DHRRRYKDDSEEDDRKRNRDR 22
             R  ++D + EKER    +H  R +D  +E +R++ +++
Sbjct: 730  DREREKDRNKEKERGDHAEHHDRDRDRRKEKEREKEKEK 768

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 32/121 (26%), Positives = 64/121 (52%), Gaps = 6/121 (4%)
 Frame = -1

Query: 432  RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
            R R+++ + E+E++R    + + E+E DR++D++G    +   RD  +E  RDR+ D D+
Sbjct: 829  REREKEREKEREKEREKEREKEREKERDREKDKDGKEVSKKKTRDSSDEDRRDRKKDRDK 888

Query: 252  RGNGE------RRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
            +   +      R+H+ +   KE+D+  R KD       RK  +  D   +++   G++ +
Sbjct: 889  KKRKKEKEVEKRKHKKE--RKEKDKERRSKD------RRKERKTMDEDGQINSSTGEDGQ 940

Query: 90   E 88
            E
Sbjct: 941  E 941

[77][TOP]
>UniRef100_Q2H786 Putative uncharacterized protein n=1 Tax=Chaetomium globosum
            RepID=Q2H786_CHAGB
          Length = 829

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/135 (39%), Positives = 74/135 (54%), Gaps = 2/135 (1%)
 Frame = -1

Query: 432  RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDGDNEKERDRRGDN 259
            +Y DR  D E++RDR R R +D     +DR R+R+ DR H  D +RD + + ERDR  D 
Sbjct: 675  QYSDRHRDRERDRDRPRDRERDRERPRWDRSRERSTDRSHGADGERDKERDCERDRERDR 734

Query: 258  DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH 79
            D      RRH + D +++RDR          + DR RDRN DR  R  DRD D++++RD 
Sbjct: 735  DADHRSTRRHSERDRDRDRDR----------DRDRNRDRNRDR-DRERDRDRDHDRDRDR 783

Query: 78   RRRYKDDSEEDDRKR 34
             R  +   E+D   R
Sbjct: 784  DRDQRGRGEDDRPSR 798

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 57/151 (37%), Positives = 78/151 (51%), Gaps = 2/151 (1%)
 Frame = -1

Query: 483  GIRMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD- 307
            G R I       R+RDR  RDRD   ++ERDR           +DR R+R+ DR H  D 
Sbjct: 667  GPREISPAQYSDRHRDRE-RDRDRPRDRERDR-------ERPRWDRSRERSTDRSHGADG 718

Query: 306  DRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR- 130
            +RD + + ERDR  D D      RRH + D +++RDR          + DR RDRN DR 
Sbjct: 719  ERDKERDCERDRERDRDADHRSTRRHSERDRDRDRDR----------DRDRNRDRNRDRD 768

Query: 129  RHRVDDRDGDNEKERDHRRRYKDDSEEDDRK 37
            R R  DRD D +++RD  +R + + +   RK
Sbjct: 769  RERDRDRDHDRDRDRDRDQRGRGEDDRPSRK 799

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 52/137 (37%), Positives = 68/137 (49%), Gaps = 4/137 (2%)
 Frame = -1

Query: 408  NEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR-RGDNDRRGNGERR 232
            N    DR G  +    +  DR RDR  DR     DR  D E++R+R R D  R  + +R 
Sbjct: 659  NHVRFDRSGPREISPAQYSDRHRDRERDR-----DRPRDRERDRERPRWDRSRERSTDRS 713

Query: 231  H-RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR-RYKDD 58
            H  D + +KERD       + + E DR  D    RRH   DRD D +++RD  R R +D 
Sbjct: 714  HGADGERDKERDC------ERDRERDRDADHRSTRRHSERDRDRDRDRDRDRNRDRNRDR 767

Query: 57   SEEDDRKRNRDR-RYRD 10
              E DR R+ DR R RD
Sbjct: 768  DRERDRDRDHDRDRDRD 784

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 40/120 (33%), Positives = 61/120 (50%), Gaps = 14/120 (11%)
 Frame = -1

Query: 453  WKRNRDR-----------RYRDRDDDNEKERDRRGRYKDD---SEEEFDRKRDRNGDRRH 316
            W R+R+R           R ++RD + ++ERDR   ++     SE + DR RDR+ DR  
Sbjct: 702  WDRSRERSTDRSHGADGERDKERDCERDRERDRDADHRSTRRHSERDRDRDRDRDRDRNR 761

Query: 315  RVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
               DR+ D ++ERDR  D+DR           D +++RD+RGR +DD        +D  G
Sbjct: 762  ---DRNRDRDRERDRDRDHDR-----------DRDRDRDQRGRGEDDRPSRKTALKDAAG 807

[78][TOP]
>UniRef100_UPI000186D81D coiled-coil domain-containing protein, putative n=1 Tax=Pediculus
           humanus corporis RepID=UPI000186D81D
          Length = 560

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 58/164 (35%), Positives = 88/164 (53%), Gaps = 11/164 (6%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDRRYRDRDD----------DNEKERDRRG-RYKDDSEEEFDRKRDRN 331
           RM QR+   KR+  RR  DRD           DN+++R R G +Y+DD E +    RD  
Sbjct: 192 RMRQRENDRKRDDYRRKEDRDGGRRRDDERYRDNDRDRRRDGEKYRDDKERDRFPTRDHG 251

Query: 330 GDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK 151
             R H  D +D D +  RDR  + DR    E+  RD + ++ERDR      D + + +R+
Sbjct: 252 RKRSHSPDRKDRDRDYARDRERERDREREREKE-RDRNRDRERDR------DRDRDRERE 304

Query: 150 RDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           RDR+ D R R  D+D + EKE++  +  + + E+D  +R+ DRR
Sbjct: 305 RDRDRD-RDREKDKDKEKEKEKEKEKEKEKEKEKDRDRRSSDRR 347

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 56/163 (34%), Positives = 86/163 (52%), Gaps = 29/163 (17%)
 Frame = -1

Query: 411 DNEKERDRRGRYK--DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR----- 253
           D  K +D R R +  D   +++ RK DR+G RR R D+R  DN+++R R G+  R     
Sbjct: 184 DGHKSKDDRMRQRENDRKRDDYRRKEDRDGGRR-RDDERYRDNDRDRRRDGEKYRDDKER 242

Query: 252 -----RGNGERR-HRDD----------DNEKERDRRGRYKDDSEEEFDRKRDRNGDR--- 130
                R +G +R H  D          D E+ERDR    + + +   DR+RDR+ DR   
Sbjct: 243 DRFPTRDHGRKRSHSPDRKDRDRDYARDRERERDREREREKERDRNRDRERDRDRDRDRE 302

Query: 129 RHRVDDRDGDNEKERD---HRRRYKDDSEEDDRKRNRDRRYRD 10
           R R  DRD D EK++D    + + K+  +E +++++RDRR  D
Sbjct: 303 RERDRDRDRDREKDKDKEKEKEKEKEKEKEKEKEKDRDRRSSD 345

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 50/149 (33%), Positives = 81/149 (54%), Gaps = 7/149 (4%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           +++D R R R++D +++  RR   +D      D +R R+ DR  R D     ++KERDR 
Sbjct: 187 KSKDDRMRQRENDRKRDDYRRKEDRDGGRRR-DDERYRDNDRDRRRDGEKYRDDKERDRF 245

Query: 267 GDND----RRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
              D    R  + +R+ RD D  ++R+R    + + E+E DR RDR  DR     DRD D
Sbjct: 246 PTRDHGRKRSHSPDRKDRDRDYARDRERERDREREREKERDRNRDRERDR-----DRDRD 300

Query: 99  NEKERDH---RRRYKDDSEEDDRKRNRDR 22
            E+ERD    R R KD  +E ++++ +++
Sbjct: 301 RERERDRDRDRDREKDKDKEKEKEKEKEK 329

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 48/123 (39%), Positives = 66/123 (53%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDN 259
           DR+ RDRD   ++ER+R      D E E +++RDRN DR  R  DRD D E+ERDR  D 
Sbjct: 259 DRKDRDRDYARDRERER------DREREREKERDRNRDRE-RDRDRDRDRERERDRDRDR 311

Query: 258 DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH 79
           D       R +D D EKE+++    + + E+E DR R R+ DRR     R      +R  
Sbjct: 312 D-------REKDKDKEKEKEKEKEKEKEKEKEKDRDR-RSSDRRSPKHSRRSSRSPDRSW 363

Query: 78  RRR 70
           + R
Sbjct: 364 KAR 366

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 38/115 (33%), Positives = 61/115 (53%), Gaps = 8/115 (6%)
 Frame = -1

Query: 450 KRNRDRRY-------RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDG 295
           +++RDR Y       RDR+ + EKERDR    + D + + DR+R+R+ DR R R  D+D 
Sbjct: 260 RKDRDRDYARDRERERDREREREKERDRNRDRERDRDRDRDRERERDRDRDRDREKDKDK 319

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
           + EKE++             + ++ + EKE+DR  R  D    +  R+  R+ DR
Sbjct: 320 EKEKEKE-------------KEKEKEKEKEKDRDRRSSDRRSPKHSRRSSRSPDR 361

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 48/150 (32%), Positives = 65/150 (43%), Gaps = 15/150 (10%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR---RGDND 256
           +D D    K  +      +D +       + N D     DDR    E +R R   R   D
Sbjct: 151 KDLDGTELKNSNEEKCTMNDKDVYLSENDNFNFDGHKSKDDRMRQRENDRKRDDYRRKED 210

Query: 255 RRGNGERRHRDDDNEKERDRRGR-----YKDDSE------EEFDRKRDRNGDRRHRVDDR 109
           R G    R RDD+  ++ DR  R     Y+DD E       +  RKR  + DR+ R  D 
Sbjct: 211 RDGG---RRRDDERYRDNDRDRRRDGEKYRDDKERDRFPTRDHGRKRSHSPDRKDRDRDY 267

Query: 108 DGDNEKERD-HRRRYKDDSEEDDRKRNRDR 22
             D E+ERD  R R K+     DR+R+RDR
Sbjct: 268 ARDRERERDREREREKERDRNRDRERDRDR 297

[79][TOP]
>UniRef100_UPI00017978C7 PREDICTED: similar to RNA binding motif protein 25 n=1 Tax=Equus
           caballus RepID=UPI00017978C7
          Length = 843

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/149 (34%), Positives = 90/149 (60%), Gaps = 5/149 (3%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           ++RR R+R+ + E+ER  R R ++   + E+E +R+R+R  DR R R  +RD D ++ERD
Sbjct: 307 KERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERD 366

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           R  D DR  + +R + R    EK RDR    + + E E +R+R+R  + R R  +R+ + 
Sbjct: 367 R--DRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERE-RERERERERER 423

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           E+E+D +R  ++D E+   +R  +R+ R+
Sbjct: 424 EREKDKKRDREEDEEDAYERRKLERKLRE 452

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/155 (30%), Positives = 86/155 (55%), Gaps = 3/155 (1%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 276 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 335

Query: 294 DNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHR 121
           + EKER+R  + DR R   + R RD D E++RDR      D  ++  R R+++ DR R R
Sbjct: 336 EKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERER 395

Query: 120 VDDRDGDNEKERD-HRRRYKDDSEEDDRKRNRDRR 19
             +R+ + E+ER+  R R ++   E +R+R +D++
Sbjct: 396 EREREREREREREREREREREREREREREREKDKK 430

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 54/152 (35%), Positives = 80/152 (52%), Gaps = 4/152 (2%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           +R+   +R R+R R RDRD   E++RDR      D E + DR R+R+ DR     DR   
Sbjct: 334 EREKEKERERERERDRDRDRTKERDRDR------DRERDRDRDRERSSDRN---KDRSRS 384

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            EK RDR  + +R    E R R+ + E+ER+R    + + E E D+KRDR  D     + 
Sbjct: 385 REKSRDRERERERERERE-REREREREREREREREREREREREKDKKRDREEDEEDAYER 443

Query: 111 RDGD---NEKERDHRRRYKDDSEEDDRKRNRD 25
           R  +    EKE  ++ R K + E  +RK+ R+
Sbjct: 444 RKLERKLREKEAAYQERLK-NWEIRERKKTRE 474

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 53/175 (30%), Positives = 90/175 (51%), Gaps = 27/175 (15%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           R+RDR + RDRD D E++RDR      D E   DR +DR+  R + R  +R+ + E+ER+
Sbjct: 349 RDRDRTKERDRDRDRERDRDR------DRERSSDRNKDRSRSREKSRDRERERERERERE 402

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRK---------------RDR 142
           R  + +R    ER R R+ + E+E+D++   ++D E+ ++R+               R +
Sbjct: 403 REREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLK 462

Query: 141 NGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRDTS 4
           N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR ++
Sbjct: 463 NWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSA 517

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 9/127 (7%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD------RRGDNDRRGNGERRHRDDDN 214
           ++D  +   R+  +  D   ++++  G  EKER       R  + +R    ERR R+ + 
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 329

Query: 213 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEED---D 43
           E+ER+R    + + E E DR RDR  +R     DRD D E++RD  R    D  +D    
Sbjct: 330 EREREREKEKERERERERDRDRDRTKER-----DRDRDRERDRDRDRERSSDRNKDRSRS 384

Query: 42  RKRNRDR 22
           R+++RDR
Sbjct: 385 REKSRDR 391

[80][TOP]
>UniRef100_UPI000155C2B7 PREDICTED: similar to RBM25 protein n=1 Tax=Ornithorhynchus
           anatinus RepID=UPI000155C2B7
          Length = 1017

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/149 (34%), Positives = 90/149 (60%), Gaps = 5/149 (3%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           ++RR R+R+ + E+ER  R R ++   + E+E +R+R+R  DR R R  +RD D E++RD
Sbjct: 481 KERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRD 540

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           R  D DR  + +R + R    EK RDR    + + E E +R+R+R  + R R  +R+ + 
Sbjct: 541 R--DRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERE-RERERERERER 597

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           E+E+D +R  ++D E+   +R  +R+ R+
Sbjct: 598 EREKDKKRDREEDEEDAYERRKLERKLRE 626

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 46/155 (29%), Positives = 86/155 (55%), Gaps = 3/155 (1%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 450 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 509

Query: 294 DNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHR 121
           + EKER+R  + DR R   + R RD + +++RDR      D  ++  R R+++ DR R R
Sbjct: 510 EKEKERERERERDRDRDRTKERDRDRERDRDRDRDRERSSDRNKDRSRSREKSRDRERER 569

Query: 120 VDDRDGDNEKERD-HRRRYKDDSEEDDRKRNRDRR 19
             +R+ + E+ER+  R R ++   E +R+R +D++
Sbjct: 570 EREREREREREREREREREREREREREREREKDKK 604

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 56/154 (36%), Positives = 88/154 (57%), Gaps = 12/154 (7%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDR---RGRYKDDSEE-EFDRKRDRNGDR-RHRVDDRDGDN 289
           +R R+R R R+R+ + EKER+R   R R +D ++E + DR+RDR+ DR R R  DR+ D 
Sbjct: 496 RREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRDRERSSDRNKDR 555

Query: 288 EKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
            + R++  D +R    ER   R R+ + E+ER+R    + + E E D+KRDR  D     
Sbjct: 556 SRSREKSRDREREREREREREREREREREREREREREREREREREKDKKRDREEDEEDAY 615

Query: 117 DDRDGD---NEKERDHRRRYKDDSEEDDRKRNRD 25
           + R  +    EKE  ++ R K + E  +RK+ R+
Sbjct: 616 ERRKLERKLREKEAAYQERLK-NWEIRERKKTRE 648

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 56/185 (30%), Positives = 91/185 (49%), Gaps = 30/185 (16%)
 Frame = -1

Query: 468  QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGD 292
            +R+   +R R+R  RDRD D  KERDR      D + + +R  DRN DR R R   RD +
Sbjct: 508  EREKEKERERERE-RDRDRDRTKERDRDRERDRDRDRDRERSSDRNKDRSRSREKSRDRE 566

Query: 291  NEKERDRRGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRK-------- 151
             E+ER+R  + +R    ER     R R+ + E+E+D++   ++D E+ ++R+        
Sbjct: 567  REREREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLRE 626

Query: 150  -------RDRNGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRR 19
                   R +N + R R   R+ + E ER+  R         R K+  E+ D  R+  + 
Sbjct: 627  KEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKY 686

Query: 18   YRDTS 4
            YR ++
Sbjct: 687  YRGSA 691

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 39/127 (30%), Positives = 65/127 (51%), Gaps = 9/127 (7%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD------RRGDNDRRGNGERRHRDDDN 214
           ++D  +   R+  +  D   ++++  G  EKER       R  + +R    ERR R+ + 
Sbjct: 444 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 503

Query: 213 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR---RYKDDSEEDD 43
           E+ER+R    + + E E DR RDR  +R     DR+ D +++RD  R   R KD S   +
Sbjct: 504 EREREREKEKERERERERDRDRDRTKERDR---DRERDRDRDRDRERSSDRNKDRSRSRE 560

Query: 42  RKRNRDR 22
           + R+R+R
Sbjct: 561 KSRDRER 567

[81][TOP]
>UniRef100_UPI0000D9BCCE PREDICTED: similar to RNA binding motif protein 25 isoform 1 n=1
           Tax=Macaca mulatta RepID=UPI0000D9BCCE
          Length = 706

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/149 (34%), Positives = 90/149 (60%), Gaps = 5/149 (3%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           ++RR R+R+ + E+ER  R R ++   + E+E +R+R+R  DR R R  +RD D ++ERD
Sbjct: 307 KERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERD 366

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           R  D DR  + +R + R    EK RDR    + + E E +R+R+R  + R R  +R+ + 
Sbjct: 367 R--DRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERE-RERERERERER 423

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           E+E+D +R  ++D E+   +R  +R+ R+
Sbjct: 424 EREKDKKRDREEDEEDAYERRKLERKLRE 452

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/155 (30%), Positives = 86/155 (55%), Gaps = 3/155 (1%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 276 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 335

Query: 294 DNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHR 121
           + EKER+R  + DR R   + R RD D E++RDR      D  ++  R R+++ DR R R
Sbjct: 336 EKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERER 395

Query: 120 VDDRDGDNEKERD-HRRRYKDDSEEDDRKRNRDRR 19
             +R+ + E+ER+  R R ++   E +R+R +D++
Sbjct: 396 EREREREREREREREREREREREREREREREKDKK 430

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 54/152 (35%), Positives = 80/152 (52%), Gaps = 4/152 (2%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           +R+   +R R+R R RDRD   E++RDR      D E + DR R+R+ DR     DR   
Sbjct: 334 EREKEKERERERERDRDRDRTKERDRDR------DRERDRDRDRERSSDRN---KDRSRS 384

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            EK RDR  + +R    E R R+ + E+ER+R    + + E E D+KRDR  D     + 
Sbjct: 385 REKSRDRERERERERERE-REREREREREREREREREREREREKDKKRDREEDEEDAYER 443

Query: 111 RDGD---NEKERDHRRRYKDDSEEDDRKRNRD 25
           R  +    EKE  ++ R K + E  +RK+ R+
Sbjct: 444 RKLERKLREKEAAYQERLK-NWEIRERKKTRE 474

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 53/175 (30%), Positives = 90/175 (51%), Gaps = 27/175 (15%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           R+RDR + RDRD D E++RDR      D E   DR +DR+  R + R  +R+ + E+ER+
Sbjct: 349 RDRDRTKERDRDRDRERDRDR------DRERSSDRNKDRSRSREKSRDRERERERERERE 402

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRK---------------RDR 142
           R  + +R    ER R R+ + E+E+D++   ++D E+ ++R+               R +
Sbjct: 403 REREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLK 462

Query: 141 NGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRDTS 4
           N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR ++
Sbjct: 463 NWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSA 517

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 9/127 (7%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD------RRGDNDRRGNGERRHRDDDN 214
           ++D  +   R+  +  D   ++++  G  EKER       R  + +R    ERR R+ + 
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 329

Query: 213 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEED---D 43
           E+ER+R    + + E E DR RDR  +R     DRD D E++RD  R    D  +D    
Sbjct: 330 EREREREKEKERERERERDRDRDRTKER-----DRDRDRERDRDRDRERSSDRNKDRSRS 384

Query: 42  RKRNRDR 22
           R+++RDR
Sbjct: 385 REKSRDR 391

[82][TOP]
>UniRef100_UPI00005A1803 PREDICTED: similar to RNA binding motif protein 25 isoform 9 n=1
           Tax=Canis lupus familiaris RepID=UPI00005A1803
          Length = 708

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/149 (34%), Positives = 90/149 (60%), Gaps = 5/149 (3%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           ++RR R+R+ + E+ER  R R ++   + E+E +R+R+R  DR R R  +RD D ++ERD
Sbjct: 307 KERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERD 366

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           R  D DR  + +R + R    EK RDR    + + E E +R+R+R  + R R  +R+ + 
Sbjct: 367 R--DRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERE-RERERERERER 423

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           E+E+D +R  ++D E+   +R  +R+ R+
Sbjct: 424 EREKDKKRDREEDEEDAYERRKLERKLRE 452

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/155 (30%), Positives = 86/155 (55%), Gaps = 3/155 (1%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 276 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 335

Query: 294 DNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHR 121
           + EKER+R  + DR R   + R RD D E++RDR      D  ++  R R+++ DR R R
Sbjct: 336 EKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERER 395

Query: 120 VDDRDGDNEKERD-HRRRYKDDSEEDDRKRNRDRR 19
             +R+ + E+ER+  R R ++   E +R+R +D++
Sbjct: 396 EREREREREREREREREREREREREREREREKDKK 430

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 54/152 (35%), Positives = 80/152 (52%), Gaps = 4/152 (2%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           +R+   +R R+R R RDRD   E++RDR      D E + DR R+R+ DR     DR   
Sbjct: 334 EREKEKERERERERDRDRDRTKERDRDR------DRERDRDRDRERSSDRN---KDRSRS 384

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            EK RDR  + +R    E R R+ + E+ER+R    + + E E D+KRDR  D     + 
Sbjct: 385 REKSRDRERERERERERE-REREREREREREREREREREREREKDKKRDREEDEEDAYER 443

Query: 111 RDGD---NEKERDHRRRYKDDSEEDDRKRNRD 25
           R  +    EKE  ++ R K + E  +RK+ R+
Sbjct: 444 RKLERKLREKEAAYQERLK-NWEIRERKKTRE 474

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 53/175 (30%), Positives = 90/175 (51%), Gaps = 27/175 (15%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           R+RDR + RDRD D E++RDR      D E   DR +DR+  R + R  +R+ + E+ER+
Sbjct: 349 RDRDRTKERDRDRDRERDRDR------DRERSSDRNKDRSRSREKSRDRERERERERERE 402

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRK---------------RDR 142
           R  + +R    ER R R+ + E+E+D++   ++D E+ ++R+               R +
Sbjct: 403 REREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLK 462

Query: 141 NGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRDTS 4
           N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR ++
Sbjct: 463 NWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSA 517

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 9/127 (7%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD------RRGDNDRRGNGERRHRDDDN 214
           ++D  +   R+  +  D   ++++  G  EKER       R  + +R    ERR R+ + 
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 329

Query: 213 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEED---D 43
           E+ER+R    + + E E DR RDR  +R     DRD D E++RD  R    D  +D    
Sbjct: 330 EREREREKEKERERERERDRDRDRTKER-----DRDRDRERDRDRDRERSSDRNKDRSRS 384

Query: 42  RKRNRDR 22
           R+++RDR
Sbjct: 385 REKSRDR 391

[83][TOP]
>UniRef100_UPI00005A17FF PREDICTED: similar to RNA binding motif protein 25 isoform 3 n=1
           Tax=Canis lupus familiaris RepID=UPI00005A17FF
          Length = 708

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/149 (34%), Positives = 90/149 (60%), Gaps = 5/149 (3%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           ++RR R+R+ + E+ER  R R ++   + E+E +R+R+R  DR R R  +RD D ++ERD
Sbjct: 307 KERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERD 366

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           R  D DR  + +R + R    EK RDR    + + E E +R+R+R  + R R  +R+ + 
Sbjct: 367 R--DRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERE-RERERERERER 423

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           E+E+D +R  ++D E+   +R  +R+ R+
Sbjct: 424 EREKDKKRDREEDEEDAYERRKLERKLRE 452

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/155 (30%), Positives = 86/155 (55%), Gaps = 3/155 (1%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 276 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 335

Query: 294 DNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHR 121
           + EKER+R  + DR R   + R RD D E++RDR      D  ++  R R+++ DR R R
Sbjct: 336 EKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERER 395

Query: 120 VDDRDGDNEKERD-HRRRYKDDSEEDDRKRNRDRR 19
             +R+ + E+ER+  R R ++   E +R+R +D++
Sbjct: 396 EREREREREREREREREREREREREREREREKDKK 430

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 54/152 (35%), Positives = 80/152 (52%), Gaps = 4/152 (2%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           +R+   +R R+R R RDRD   E++RDR      D E + DR R+R+ DR     DR   
Sbjct: 334 EREKEKERERERERDRDRDRTKERDRDR------DRERDRDRDRERSSDRN---KDRSRS 384

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            EK RDR  + +R    E R R+ + E+ER+R    + + E E D+KRDR  D     + 
Sbjct: 385 REKSRDRERERERERERE-REREREREREREREREREREREREKDKKRDREEDEEDAYER 443

Query: 111 RDGD---NEKERDHRRRYKDDSEEDDRKRNRD 25
           R  +    EKE  ++ R K + E  +RK+ R+
Sbjct: 444 RKLERKLREKEAAYQERLK-NWEIRERKKTRE 474

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 53/175 (30%), Positives = 90/175 (51%), Gaps = 27/175 (15%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           R+RDR + RDRD D E++RDR      D E   DR +DR+  R + R  +R+ + E+ER+
Sbjct: 349 RDRDRTKERDRDRDRERDRDR------DRERSSDRNKDRSRSREKSRDRERERERERERE 402

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRK---------------RDR 142
           R  + +R    ER R R+ + E+E+D++   ++D E+ ++R+               R +
Sbjct: 403 REREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLK 462

Query: 141 NGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRDTS 4
           N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR ++
Sbjct: 463 NWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSA 517

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 9/127 (7%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD------RRGDNDRRGNGERRHRDDDN 214
           ++D  +   R+  +  D   ++++  G  EKER       R  + +R    ERR R+ + 
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 329

Query: 213 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEED---D 43
           E+ER+R    + + E E DR RDR  +R     DRD D E++RD  R    D  +D    
Sbjct: 330 EREREREKEKERERERERDRDRDRTKER-----DRDRDRERDRDRDRERSSDRNKDRSRS 384

Query: 42  RKRNRDR 22
           R+++RDR
Sbjct: 385 REKSRDR 391

[84][TOP]
>UniRef100_UPI00001D7B5D PREDICTED: hypothetical protein isoform 4 n=1 Tax=Pan troglodytes
           RepID=UPI00001D7B5D
          Length = 706

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/149 (34%), Positives = 90/149 (60%), Gaps = 5/149 (3%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           ++RR R+R+ + E+ER  R R ++   + E+E +R+R+R  DR R R  +RD D ++ERD
Sbjct: 307 KERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERD 366

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           R  D DR  + +R + R    EK RDR    + + E E +R+R+R  + R R  +R+ + 
Sbjct: 367 R--DRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERE-RERERERERER 423

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           E+E+D +R  ++D E+   +R  +R+ R+
Sbjct: 424 EREKDKKRDREEDEEDAYERRKLERKLRE 452

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/155 (30%), Positives = 86/155 (55%), Gaps = 3/155 (1%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 276 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 335

Query: 294 DNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHR 121
           + EKER+R  + DR R   + R RD D E++RDR      D  ++  R R+++ DR R R
Sbjct: 336 EKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERER 395

Query: 120 VDDRDGDNEKERD-HRRRYKDDSEEDDRKRNRDRR 19
             +R+ + E+ER+  R R ++   E +R+R +D++
Sbjct: 396 EREREREREREREREREREREREREREREREKDKK 430

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 54/152 (35%), Positives = 80/152 (52%), Gaps = 4/152 (2%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           +R+   +R R+R R RDRD   E++RDR      D E + DR R+R+ DR     DR   
Sbjct: 334 EREKEKERERERERDRDRDRTKERDRDR------DRERDRDRDRERSSDRN---KDRSRS 384

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            EK RDR  + +R    E R R+ + E+ER+R    + + E E D+KRDR  D     + 
Sbjct: 385 REKSRDRERERERERERE-REREREREREREREREREREREREKDKKRDREEDEEDAYER 443

Query: 111 RDGD---NEKERDHRRRYKDDSEEDDRKRNRD 25
           R  +    EKE  ++ R K + E  +RK+ R+
Sbjct: 444 RKLERKLREKEAAYQERLK-NWEIRERKKTRE 474

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 53/175 (30%), Positives = 90/175 (51%), Gaps = 27/175 (15%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           R+RDR + RDRD D E++RDR      D E   DR +DR+  R + R  +R+ + E+ER+
Sbjct: 349 RDRDRTKERDRDRDRERDRDR------DRERSSDRNKDRSRSREKSRDRERERERERERE 402

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRK---------------RDR 142
           R  + +R    ER R R+ + E+E+D++   ++D E+ ++R+               R +
Sbjct: 403 REREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLK 462

Query: 141 NGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRDTS 4
           N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR ++
Sbjct: 463 NWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSA 517

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 9/127 (7%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD------RRGDNDRRGNGERRHRDDDN 214
           ++D  +   R+  +  D   ++++  G  EKER       R  + +R    ERR R+ + 
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 329

Query: 213 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEED---D 43
           E+ER+R    + + E E DR RDR  +R     DRD D E++RD  R    D  +D    
Sbjct: 330 EREREREKEKERERERERDRDRDRTKER-----DRDRDRERDRDRDRERSSDRNKDRSRS 384

Query: 42  RKRNRDR 22
           R+++RDR
Sbjct: 385 REKSRDR 391

[85][TOP]
>UniRef100_UPI00016E5BAA UPI00016E5BAA related cluster n=1 Tax=Takifugu rubripes
            RepID=UPI00016E5BAA
          Length = 1827

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 56/150 (37%), Positives = 77/150 (51%), Gaps = 7/150 (4%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDN 289
            +     R+RD+D +  ++RDR R R +D    + DR R RN DR     R R   R+   
Sbjct: 1675 RETEGERHRDQDAEKRRDRDRDRDRTRDSDRRDHDRDRGRNRDREREREREREKRRERSR 1734

Query: 288  EKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
             KERDR  D DR R  G+ R RD D +++RDR      D E + DR RDR+ DR     D
Sbjct: 1735 SKERDRDRDRDRDRDRGKDRGRDRDRDRDRDRERDRDRDRERDRDRDRDRDRDR-----D 1789

Query: 111  RDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            R+ D E++R    R K+  EE   K +  +
Sbjct: 1790 REKDKERDRRDGSRSKEKREEKKDKHSTSK 1819

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 58/158 (36%), Positives = 84/158 (53%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
            R  QRK    R + R+ R R  + E+ R+  G    D + E  R RDR+ DR    D RD
Sbjct: 1648 RSEQRKRARARAQPRKGRSRGKEGERHRETEGERHRDQDAEKRRDRDRDRDRTRDSDRRD 1707

Query: 297  GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
             D ++ R+R  + +R    E+R R+    KERDR      D +   DR RDR+ DR  R 
Sbjct: 1708 HDRDRGRNRDREREREREREKR-RERSRSKERDRDRDRDRDRDRGKDRGRDRDRDR-DRD 1765

Query: 117  DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
             +RD D ++ERD R R +D   + DR+++++R  RD S
Sbjct: 1766 RERDRDRDRERD-RDRDRDRDRDRDREKDKERDRRDGS 1802

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 51/139 (36%), Positives = 73/139 (52%), Gaps = 1/139 (0%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            +R+ DR R R+RD + E+ER+R  R +    +E DR RDR+ DR     DR  D  ++RD
Sbjct: 1705 RRDHDRDRGRNRDREREREREREKRRERSRSKERDRDRDRDRDR-----DRGKDRGRDRD 1759

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
            R  D D       R RD D ++ERDR      D + + DR RDR  D+    D RDG   
Sbjct: 1760 RDRDRD-------RERDRDRDRERDR------DRDRDRDRDRDREKDKER--DRRDGSRS 1804

Query: 93   KERDHRRRYKDDSEEDDRK 37
            KE+   ++ K  + ++  K
Sbjct: 1805 KEKREEKKDKHSTSKEGEK 1823

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 52/146 (35%), Positives = 71/146 (48%), Gaps = 7/146 (4%)
 Frame = -1

Query: 426  RDRDDDNEKERDRRGRYKDDSE-EEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRR 250
            R R +  ++ R R    K  S  +E +R R+  G+R      RD D EK RDR  D DR 
Sbjct: 1646 RSRSEQRKRARARAQPRKGRSRGKEGERHRETEGERH-----RDQDAEKRRDRDRDRDRT 1700

Query: 249  GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDNEKER 85
             + +RR  D D  + RDR              +R+R  +R     R R  +RD D +++R
Sbjct: 1701 RDSDRRDHDRDRGRNRDR--------------EREREREREKRRERSRSKERDRDRDRDR 1746

Query: 84   DHRRRYKDDSEEDDRKRNRDR-RYRD 10
            D R R KD   + DR R+RDR R RD
Sbjct: 1747 D-RDRGKDRGRDRDRDRDRDRERDRD 1771

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 54/143 (37%), Positives = 68/143 (47%), Gaps = 13/143 (9%)
 Frame = -1

Query: 399  ERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERDRRGDNDRRGNGERRH 229
            E+ R  R  ++   +   +R R+  R   R R   R G   + R + G+  R   GER H
Sbjct: 1627 EQYRFDRLSEEEPGQALEQRSRSEQRKRARARAQPRKG---RSRGKEGERHRETEGER-H 1682

Query: 228  RDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDNEKERDHRR 73
            RD D EK RDR   R R +D    + DR R RN DR     R R   R+    KERD  R
Sbjct: 1683 RDQDAEKRRDRDRDRDRTRDSDRRDHDRDRGRNRDREREREREREKRRERSRSKERDRDR 1742

Query: 72   -RYKDDSEEDDRKRNRDR-RYRD 10
             R +D     DR R+RDR R RD
Sbjct: 1743 DRDRDRDRGKDRGRDRDRDRDRD 1765

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 37/98 (37%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-RYRDRDDDNEKERDR---RGRYKD---DSEEEFDRKRDRNGDR-RHR 313
            +R+   +R R R + RDRD D +++RDR   RGR +D   D + E DR RDR  DR R R
Sbjct: 1723 EREREKRRERSRSKERDRDRDRDRDRDRGKDRGRDRDRDRDRDRERDRDRDRERDRDRDR 1782

Query: 312  VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERD 199
              DRD D EK+++R   +  R   +R  + D +   ++
Sbjct: 1783 DRDRDRDREKDKERDRRDGSRSKEKREEKKDKHSTSKE 1820

[86][TOP]
>UniRef100_UPI00016E5B8F UPI00016E5B8F related cluster n=1 Tax=Takifugu rubripes
            RepID=UPI00016E5B8F
          Length = 2124

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 56/150 (37%), Positives = 77/150 (51%), Gaps = 7/150 (4%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDN 289
            +     R+RD+D +  ++RDR R R +D    + DR R RN DR     R R   R+   
Sbjct: 1972 RETEGERHRDQDAEKRRDRDRDRDRTRDSDRRDHDRDRGRNRDREREREREREKRRERSR 2031

Query: 288  EKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
             KERDR  D DR R  G+ R RD D +++RDR      D E + DR RDR+ DR     D
Sbjct: 2032 SKERDRDRDRDRDRDRGKDRGRDRDRDRDRDRERDRDRDRERDRDRDRDRDRDR-----D 2086

Query: 111  RDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            R+ D E++R    R K+  EE   K +  +
Sbjct: 2087 REKDKERDRRDGSRSKEKREEKKDKHSTSK 2116

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 58/158 (36%), Positives = 84/158 (53%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
            R  QRK    R + R+ R R  + E+ R+  G    D + E  R RDR+ DR    D RD
Sbjct: 1945 RSEQRKRARARAQPRKGRSRGKEGERHRETEGERHRDQDAEKRRDRDRDRDRTRDSDRRD 2004

Query: 297  GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
             D ++ R+R  + +R    E+R R+    KERDR      D +   DR RDR+ DR  R 
Sbjct: 2005 HDRDRGRNRDREREREREREKR-RERSRSKERDRDRDRDRDRDRGKDRGRDRDRDR-DRD 2062

Query: 117  DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
             +RD D ++ERD R R +D   + DR+++++R  RD S
Sbjct: 2063 RERDRDRDRERD-RDRDRDRDRDRDREKDKERDRRDGS 2099

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 51/139 (36%), Positives = 73/139 (52%), Gaps = 1/139 (0%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            +R+ DR R R+RD + E+ER+R  R +    +E DR RDR+ DR     DR  D  ++RD
Sbjct: 2002 RRDHDRDRGRNRDREREREREREKRRERSRSKERDRDRDRDRDR-----DRGKDRGRDRD 2056

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
            R  D D       R RD D ++ERDR      D + + DR RDR  D+    D RDG   
Sbjct: 2057 RDRDRD-------RERDRDRDRERDR------DRDRDRDRDRDREKDKER--DRRDGSRS 2101

Query: 93   KERDHRRRYKDDSEEDDRK 37
            KE+   ++ K  + ++  K
Sbjct: 2102 KEKREEKKDKHSTSKEGEK 2120

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 58/156 (37%), Positives = 72/156 (46%), Gaps = 10/156 (6%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
            R+RD  +R R  +    ++     +  S  E  RKR      R R   R G   + R + 
Sbjct: 1917 RHRDDHWRRRSPETAMGQEPGQALEQRSRSE-QRKR-----ARARAQPRKG---RSRGKE 1967

Query: 267  GDNDRRGNGERRHRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR-----RHRVDD 112
            G+  R   GER HRD D EK RDR   R R +D    + DR R RN DR     R R   
Sbjct: 1968 GERHRETEGER-HRDQDAEKRRDRDRDRDRTRDSDRRDHDRDRGRNRDREREREREREKR 2026

Query: 111  RDGDNEKERDHRR-RYKDDSEEDDRKRNRDR-RYRD 10
            R+    KERD  R R +D     DR R+RDR R RD
Sbjct: 2027 RERSRSKERDRDRDRDRDRDRGKDRGRDRDRDRDRD 2062

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 37/98 (37%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-RYRDRDDDNEKERDR---RGRYKD---DSEEEFDRKRDRNGDR-RHR 313
            +R+   +R R R + RDRD D +++RDR   RGR +D   D + E DR RDR  DR R R
Sbjct: 2020 EREREKRRERSRSKERDRDRDRDRDRDRGKDRGRDRDRDRDRDRERDRDRDRERDRDRDR 2079

Query: 312  VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERD 199
              DRD D EK+++R   +  R   +R  + D +   ++
Sbjct: 2080 DRDRDRDREKDKERDRRDGSRSKEKREEKKDKHSTSKE 2117

[87][TOP]
>UniRef100_UPI00016E5B8E UPI00016E5B8E related cluster n=1 Tax=Takifugu rubripes
            RepID=UPI00016E5B8E
          Length = 2146

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 56/150 (37%), Positives = 77/150 (51%), Gaps = 7/150 (4%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDN 289
            +     R+RD+D +  ++RDR R R +D    + DR R RN DR     R R   R+   
Sbjct: 1994 RETEGERHRDQDAEKRRDRDRDRDRTRDSDRRDHDRDRGRNRDREREREREREKRRERSR 2053

Query: 288  EKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
             KERDR  D DR R  G+ R RD D +++RDR      D E + DR RDR+ DR     D
Sbjct: 2054 SKERDRDRDRDRDRDRGKDRGRDRDRDRDRDRERDRDRDRERDRDRDRDRDRDR-----D 2108

Query: 111  RDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            R+ D E++R    R K+  EE   K +  +
Sbjct: 2109 REKDKERDRRDGSRSKEKREEKKDKHSTSK 2138

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 58/158 (36%), Positives = 84/158 (53%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
            R  QRK    R + R+ R R  + E+ R+  G    D + E  R RDR+ DR    D RD
Sbjct: 1967 RSEQRKRARARAQPRKGRSRGKEGERHRETEGERHRDQDAEKRRDRDRDRDRTRDSDRRD 2026

Query: 297  GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
             D ++ R+R  + +R    E+R R+    KERDR      D +   DR RDR+ DR  R 
Sbjct: 2027 HDRDRGRNRDREREREREREKR-RERSRSKERDRDRDRDRDRDRGKDRGRDRDRDR-DRD 2084

Query: 117  DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
             +RD D ++ERD R R +D   + DR+++++R  RD S
Sbjct: 2085 RERDRDRDRERD-RDRDRDRDRDRDREKDKERDRRDGS 2121

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 51/139 (36%), Positives = 73/139 (52%), Gaps = 1/139 (0%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            +R+ DR R R+RD + E+ER+R  R +    +E DR RDR+ DR     DR  D  ++RD
Sbjct: 2024 RRDHDRDRGRNRDREREREREREKRRERSRSKERDRDRDRDRDR-----DRGKDRGRDRD 2078

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
            R  D D       R RD D ++ERDR      D + + DR RDR  D+    D RDG   
Sbjct: 2079 RDRDRD-------RERDRDRDRERDR------DRDRDRDRDRDREKDKER--DRRDGSRS 2123

Query: 93   KERDHRRRYKDDSEEDDRK 37
            KE+   ++ K  + ++  K
Sbjct: 2124 KEKREEKKDKHSTSKEGEK 2142

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 59/165 (35%), Positives = 76/165 (46%), Gaps = 17/165 (10%)
 Frame = -1

Query: 453  WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            W+R R    R R   N ++ +  G+  +       RKR      R R   R G   + R 
Sbjct: 1937 WRR-RSPEIRRRSSTNREDAEEPGQALEQRSRSEQRKR-----ARARAQPRKG---RSRG 1987

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR--------- 130
            + G+  R   GER HRD D EK RDR   R R +D    + DR R RN DR         
Sbjct: 1988 KEGERHRETEGER-HRDQDAEKRRDRDRDRDRTRDSDRRDHDRDRGRNRDRERERERERE 2046

Query: 129  ----RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
                R R  +RD D +++RD R R KD   + DR R+RDR R RD
Sbjct: 2047 KRRERSRSKERDRDRDRDRD-RDRGKDRGRDRDRDRDRDRERDRD 2090

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 37/98 (37%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-RYRDRDDDNEKERDR---RGRYKD---DSEEEFDRKRDRNGDR-RHR 313
            +R+   +R R R + RDRD D +++RDR   RGR +D   D + E DR RDR  DR R R
Sbjct: 2042 EREREKRRERSRSKERDRDRDRDRDRDRGKDRGRDRDRDRDRDRERDRDRDRERDRDRDR 2101

Query: 312  VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERD 199
              DRD D EK+++R   +  R   +R  + D +   ++
Sbjct: 2102 DRDRDRDREKDKERDRRDGSRSKEKREEKKDKHSTSKE 2139

[88][TOP]
>UniRef100_UPI000057F387 PREDICTED: RNA binding motif protein 25 isoform 5 n=1 Tax=Bos
           taurus RepID=UPI000057F387
          Length = 843

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/149 (34%), Positives = 90/149 (60%), Gaps = 5/149 (3%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           ++RR R+R+ + E+ER  R R ++   + E+E +R+R+R  DR R R  +RD D ++ERD
Sbjct: 307 KERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERD 366

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           R  D DR  + +R + R    EK RDR    + + E E +R+R+R  + R R  +R+ + 
Sbjct: 367 R--DRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERE-RERERERERER 423

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           E+E+D +R  ++D E+   +R  +R+ R+
Sbjct: 424 EREKDKKRDREEDEEDAYERRKLERKLRE 452

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/155 (30%), Positives = 86/155 (55%), Gaps = 3/155 (1%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 276 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 335

Query: 294 DNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHR 121
           + EKER+R  + DR R   + R RD D E++RDR      D  ++  R R+++ DR R R
Sbjct: 336 EKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERER 395

Query: 120 VDDRDGDNEKERD-HRRRYKDDSEEDDRKRNRDRR 19
             +R+ + E+ER+  R R ++   E +R+R +D++
Sbjct: 396 EREREREREREREREREREREREREREREREKDKK 430

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 54/152 (35%), Positives = 80/152 (52%), Gaps = 4/152 (2%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           +R+   +R R+R R RDRD   E++RDR      D E + DR R+R+ DR     DR   
Sbjct: 334 EREKEKERERERERDRDRDRTKERDRDR------DRERDRDRDRERSSDRN---KDRSRS 384

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            EK RDR  + +R    E R R+ + E+ER+R    + + E E D+KRDR  D     + 
Sbjct: 385 REKSRDRERERERERERE-REREREREREREREREREREREREKDKKRDREEDEEDAYER 443

Query: 111 RDGD---NEKERDHRRRYKDDSEEDDRKRNRD 25
           R  +    EKE  ++ R K + E  +RK+ R+
Sbjct: 444 RKLERKLREKEAAYQERLK-NWEIRERKKTRE 474

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 53/175 (30%), Positives = 90/175 (51%), Gaps = 27/175 (15%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           R+RDR + RDRD D E++RDR      D E   DR +DR+  R + R  +R+ + E+ER+
Sbjct: 349 RDRDRTKERDRDRDRERDRDR------DRERSSDRNKDRSRSREKSRDRERERERERERE 402

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRK---------------RDR 142
           R  + +R    ER R R+ + E+E+D++   ++D E+ ++R+               R +
Sbjct: 403 REREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLK 462

Query: 141 NGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRDTS 4
           N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR ++
Sbjct: 463 NWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSA 517

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 9/127 (7%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD------RRGDNDRRGNGERRHRDDDN 214
           ++D  +   R+  +  D   ++++  G  EKER       R  + +R    ERR R+ + 
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 329

Query: 213 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEED---D 43
           E+ER+R    + + E E DR RDR  +R     DRD D E++RD  R    D  +D    
Sbjct: 330 EREREREKEKERERERERDRDRDRTKER-----DRDRDRERDRDRDRERSSDRNKDRSRS 384

Query: 42  RKRNRDR 22
           R+++RDR
Sbjct: 385 REKSRDR 391

[89][TOP]
>UniRef100_Q7SDE6 Predicted protein n=1 Tax=Neurospora crassa RepID=Q7SDE6_NEUCR
          Length = 1870

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 59/156 (37%), Positives = 83/156 (53%), Gaps = 9/156 (5%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR------RHRVDDRDGDN 289
            +RN++R  RDR+ D ++ERD   ++++    + DR+R R G        R R  DR+ D 
Sbjct: 1565 QRNKERD-RDRERDRDRERDSSSKFREKDRNDHDRERYRGGAEREKEKYRERERDRESDR 1623

Query: 288  EKERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDR-KRDRNGDRRHRVD 115
            E ER R  + DR    ER  RD D E++R R + R K     + DR  R  + DR     
Sbjct: 1624 EHERPREKERDREKYRERGDRDSDRERDRPREKYREKGTDRGDSDRGGRTTDSDRERNRI 1683

Query: 114  DRDGDNEKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
            DRD D ++ER+ R R   D E  DR+R R R +YRD
Sbjct: 1684 DRDRDRDRERE-RERSDRDRERTDRERERIRDKYRD 1718

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 67/198 (33%), Positives = 92/198 (46%), Gaps = 54/198 (27%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDR-----------------RGRYKDDSEEE----FDRKRDRNGD 325
            +++R ++RD D E++RDR                 R RY+  +E E     +R+RDR  D
Sbjct: 1563 KEQRNKERDRDRERDRDRERDSSSKFREKDRNDHDRERYRGGAEREKEKYRERERDRESD 1622

Query: 324  RRH--------------RVDDRDGDNEKERDR---------RGDNDRRG---------NG 241
            R H                 DRD D E++R R         RGD+DR G         N 
Sbjct: 1623 REHERPREKERDREKYRERGDRDSDRERDRPREKYREKGTDRGDSDRGGRTTDSDRERNR 1682

Query: 240  ERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR-RYK 64
              R RD D E+ER+R  R ++ ++ E +R RD+  DR  R  DRD D+ K+RD  R R +
Sbjct: 1683 IDRDRDRDRERERERSDRDRERTDRERERIRDKYRDRADRDSDRDRDSYKDRDRERDRDR 1742

Query: 63   DDSEEDDRKRNRDRRYRD 10
            D   E DR    DR  RD
Sbjct: 1743 DRDRERDRGDRGDRGDRD 1760

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 58/162 (35%), Positives = 85/162 (52%), Gaps = 15/162 (9%)
 Frame = -1

Query: 450  KRNRDRRY-RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            +R RDR   R+ +   EKERDR  +Y++  + + DR+RDR  ++        GD+++   
Sbjct: 1614 ERERDRESDREHERPREKERDRE-KYRERGDRDSDRERDRPREKYREKGTDRGDSDRG-G 1671

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRD-------RNGDR----- 130
            R  D+DR  N   R RD D E+ER+R  R ++ ++ E +R RD       R+ DR     
Sbjct: 1672 RTTDSDRERNRIDRDRDRDRERERERSDRDRERTDRERERIRDKYRDRADRDSDRDRDSY 1731

Query: 129  --RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
              R R  DRD D ++ERD   R      + DR R+RDR  RD
Sbjct: 1732 KDRDRERDRDRDRDRERDRGDRGDRGDRDRDRDRDRDRGDRD 1773

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 53/134 (39%), Positives = 69/134 (51%), Gaps = 13/134 (9%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
            R R+R  RDRD D E+ER+R  R ++ ++ E +R RD+  DR  R  DRD D+ K+RDR 
Sbjct: 1678 RERNRIDRDRDRDRERERERSDRDRERTDRERERIRDKYRDRADRDSDRDRDSYKDRDRE 1737

Query: 267  GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD--------- 115
             D D         RD D E++R  RG   D  + + DR RDR+   R RV          
Sbjct: 1738 RDRD---------RDRDRERDRGDRG---DRGDRDRDRDRDRDRGDRDRVSSSGSSLLIK 1785

Query: 114  -DR---DGDNEKER 85
             DR    G  EKER
Sbjct: 1786 KDRKPLPGSGEKER 1799

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 44/137 (32%), Positives = 68/137 (49%), Gaps = 12/137 (8%)
 Frame = -1

Query: 384  GRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKE 205
            G Y +  +   +R RDR  DR    D      EK+R+   D +R   G  R ++   E+E
Sbjct: 1558 GSYAEKEQRNKERDRDRERDRDRERDSSSKFREKDRNDH-DRERYRGGAEREKEKYRERE 1616

Query: 204  RDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKD------DSE--- 52
            RDR    + D E E  R+++R+ ++     DRD D E++R  R +Y++      DS+   
Sbjct: 1617 RDR----ESDREHERPREKERDREKYRERGDRDSDRERDRP-REKYREKGTDRGDSDRGG 1671

Query: 51   ---EDDRKRNRDRRYRD 10
               + DR+RNR  R RD
Sbjct: 1672 RTTDSDRERNRIDRDRD 1688

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 37/98 (37%), Positives = 49/98 (50%), Gaps = 9/98 (9%)
 Frame = -1

Query: 468  QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
            +R+ I  + RDR  RD D D +  +DR      D E + DR RDR  DR  R D  D D 
Sbjct: 1708 ERERIRDKYRDRADRDSDRDRDSYKDR------DRERDRDRDRDRERDRGDRGDRGDRDR 1761

Query: 288  EKERDR-RGDNDRRGNG--------ERRHRDDDNEKER 202
            +++RDR RGD DR  +         +R+      EKER
Sbjct: 1762 DRDRDRDRGDRDRVSSSGSSLLIKKDRKPLPGSGEKER 1799

[90][TOP]
>UniRef100_P49756 RNA-binding protein 25 n=2 Tax=Homo sapiens RepID=RBM25_HUMAN
          Length = 843

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/149 (34%), Positives = 90/149 (60%), Gaps = 5/149 (3%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           ++RR R+R+ + E+ER  R R ++   + E+E +R+R+R  DR R R  +RD D ++ERD
Sbjct: 307 KERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERD 366

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           R  D DR  + +R + R    EK RDR    + + E E +R+R+R  + R R  +R+ + 
Sbjct: 367 R--DRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERE-RERERERERER 423

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           E+E+D +R  ++D E+   +R  +R+ R+
Sbjct: 424 EREKDKKRDREEDEEDAYERRKLERKLRE 452

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/155 (30%), Positives = 86/155 (55%), Gaps = 3/155 (1%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 276 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 335

Query: 294 DNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHR 121
           + EKER+R  + DR R   + R RD D E++RDR      D  ++  R R+++ DR R R
Sbjct: 336 EKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERER 395

Query: 120 VDDRDGDNEKERD-HRRRYKDDSEEDDRKRNRDRR 19
             +R+ + E+ER+  R R ++   E +R+R +D++
Sbjct: 396 EREREREREREREREREREREREREREREREKDKK 430

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 54/152 (35%), Positives = 80/152 (52%), Gaps = 4/152 (2%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           +R+   +R R+R R RDRD   E++RDR      D E + DR R+R+ DR     DR   
Sbjct: 334 EREKEKERERERERDRDRDRTKERDRDR------DRERDRDRDRERSSDRN---KDRSRS 384

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            EK RDR  + +R    E R R+ + E+ER+R    + + E E D+KRDR  D     + 
Sbjct: 385 REKSRDRERERERERERE-REREREREREREREREREREREREKDKKRDREEDEEDAYER 443

Query: 111 RDGD---NEKERDHRRRYKDDSEEDDRKRNRD 25
           R  +    EKE  ++ R K + E  +RK+ R+
Sbjct: 444 RKLERKLREKEAAYQERLK-NWEIRERKKTRE 474

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 53/175 (30%), Positives = 90/175 (51%), Gaps = 27/175 (15%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           R+RDR + RDRD D E++RDR      D E   DR +DR+  R + R  +R+ + E+ER+
Sbjct: 349 RDRDRTKERDRDRDRERDRDR------DRERSSDRNKDRSRSREKSRDRERERERERERE 402

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRK---------------RDR 142
           R  + +R    ER R R+ + E+E+D++   ++D E+ ++R+               R +
Sbjct: 403 REREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLK 462

Query: 141 NGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRDTS 4
           N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR ++
Sbjct: 463 NWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSA 517

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 9/127 (7%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD------RRGDNDRRGNGERRHRDDDN 214
           ++D  +   R+  +  D   ++++  G  EKER       R  + +R    ERR R+ + 
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 329

Query: 213 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEED---D 43
           E+ER+R    + + E E DR RDR  +R     DRD D E++RD  R    D  +D    
Sbjct: 330 EREREREKEKERERERERDRDRDRTKER-----DRDRDRERDRDRDRERSSDRNKDRSRS 384

Query: 42  RKRNRDR 22
           R+++RDR
Sbjct: 385 REKSRDR 391

[91][TOP]
>UniRef100_Q7ZX66 RNPC7 protein (Fragment) n=1 Tax=Xenopus laevis RepID=Q7ZX66_XENLA
          Length = 447

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 52/152 (34%), Positives = 89/152 (58%), Gaps = 8/152 (5%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
           RD   +  ++  +KE++R+   KD  + E +R+R+R    R R  +R+ + E+ERDR  +
Sbjct: 272 RDTHKKLEEEKGKKEKERQEIEKDRKDRERERERERREREREREKEREKEKERERDRERN 331

Query: 261 NDRRGNGER---RHRDDDNEKERDR-RGRYKDDS---EEEFDRKRDRNGDR-RHRVDDRD 106
           ++R  + +R   R RD D +K+RDR +   KD S   E+  DR RDR  DR R R  +R+
Sbjct: 332 SERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSRSREKSRDRDRDRERDRERERERERE 391

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            D ++++D +R  ++D EE   +R  +R+ R+
Sbjct: 392 RDRDRDKDKKRDREEDEEEAYERRKLERKLRE 423

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 46/151 (30%), Positives = 75/151 (49%), Gaps = 8/151 (5%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K+ +D++         +E       ++D  +   R+  +  D   ++++  G  EKER  
Sbjct: 232 KKKKDKKEEMSSSVQLQEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQE 291

Query: 270 ----RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRD 106
               R D +R    ERR R+ + EKER++    + D E   +R +DR+ DR R R  DRD
Sbjct: 292 IEKDRKDRERERERERREREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRD 351

Query: 105 GDNEKERDH---RRRYKDDSEEDDRKRNRDR 22
            D ++ +DH   R R ++ S + DR R RDR
Sbjct: 352 KDRDRVQDHIKDRSRSREKSRDRDRDRERDR 382

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 49/156 (31%), Positives = 81/156 (51%), Gaps = 12/156 (7%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKE--------RDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRD 298
           +R R+RR R+R+ + E+E        R+R      D + + DR+RDR+ D+ R RV D  
Sbjct: 302 ERERERREREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRDRVQDHI 361

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
            D  + R++  D DR      R RD + E+ER+R    + D + + D+KRDR  D     
Sbjct: 362 KDRSRSREKSRDRDR-----DRERDRERERERER----ERDRDRDKDKKRDREEDEEEAY 412

Query: 117 DDRDGD---NEKERDHRRRYKDDSEEDDRKRNRDRR 19
           + R  +    EKE  ++ R K + E  +RK+ + ++
Sbjct: 413 ERRKLERKLREKEAAYQERLK-NWEIRERKKTKKKK 447

[92][TOP]
>UniRef100_Q3KPK7 RNPC7 protein (Fragment) n=1 Tax=Xenopus laevis RepID=Q3KPK7_XENLA
          Length = 465

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 52/152 (34%), Positives = 89/152 (58%), Gaps = 8/152 (5%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
           RD   +  ++  +KE++R+   KD  + E +R+R+R    R R  +R+ + E+ERDR  +
Sbjct: 272 RDTHKKLEEEKGKKEKERQEIEKDRKDRERERERERREREREREKEREKEKERERDRERN 331

Query: 261 NDRRGNGER---RHRDDDNEKERDR-RGRYKDDS---EEEFDRKRDRNGDR-RHRVDDRD 106
           ++R  + +R   R RD D +K+RDR +   KD S   E+  DR RDR  DR R R  +R+
Sbjct: 332 SERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSRSREKSRDRDRDRERDRERERERERE 391

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            D ++++D +R  ++D EE   +R  +R+ R+
Sbjct: 392 RDRDRDKDKKRDREEDEEEAYERRKLERKLRE 423

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 46/151 (30%), Positives = 75/151 (49%), Gaps = 8/151 (5%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K+ +D++         +E       ++D  +   R+  +  D   ++++  G  EKER  
Sbjct: 232 KKKKDKKEEMSSSVQLQEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQE 291

Query: 270 ----RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRD 106
               R D +R    ERR R+ + EKER++    + D E   +R +DR+ DR R R  DRD
Sbjct: 292 IEKDRKDRERERERERREREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRD 351

Query: 105 GDNEKERDH---RRRYKDDSEEDDRKRNRDR 22
            D ++ +DH   R R ++ S + DR R RDR
Sbjct: 352 KDRDRVQDHIKDRSRSREKSRDRDRDRERDR 382

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 51/160 (31%), Positives = 91/160 (56%), Gaps = 16/160 (10%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRR---GRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDG 295
           +R R+R R ++R+ + E+ERDR     R KD   D + E DR RD++ DR +  + DR  
Sbjct: 307 RREREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSR 366

Query: 294 DNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRK------RDRNG 136
             EK RDR  D +R    ER R R+ D ++++D++   ++D EE ++R+      R++  
Sbjct: 367 SREKSRDRDRDRERDRERERERERERDRDRDKDKKRDREEDEEEAYERRKLERKLREKEA 426

Query: 135 DRRHRVDDRDGDNEKERDHRRRYKDDSE-EDDRKRNRDRR 19
             + R+ + +    +ER   R Y+ D+E E++R+R+  ++
Sbjct: 427 AYQERLKNWE---IRERKKTREYEKDAEREEERRRDTTKK 463

[93][TOP]
>UniRef100_Q32NW5 LOC397946 protein n=1 Tax=Xenopus laevis RepID=Q32NW5_XENLA
          Length = 471

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 63/176 (35%), Positives = 87/176 (49%), Gaps = 29/176 (16%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R RDRR R R    E+E++ R R +  S E   R R R  + R R  ++  D EKE+D+
Sbjct: 228 ERERDRRERSR----EREKEPRERRRSRSRERRKRSRSREKEERKRSREKSKDKEKEKDK 283

Query: 270 RG-DNDR----RGNGERRHRDDDNEKERDR--------RGRYKDDSE------------- 169
              D DR    R    +R RD D EK+ +R            +DD++             
Sbjct: 284 DNKDRDRKRRSRSRERKRERDRDREKKEERVEAEVPEADDAPQDDAQIGDLGIDGIELKQ 343

Query: 168 --EEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
             EE  R+RDR+ DR     DRD D +++RD RR ++D   E DR R+RDR R RD
Sbjct: 344 EPEEKSRERDRDRDREKGEKDRDKDRDRDRDRRRSHRDRDREKDRDRDRDRDRRRD 399

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 58/161 (36%), Positives = 84/161 (52%), Gaps = 18/161 (11%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER-- 277
           KR+R R   +R    EK +D+  + KD   ++ DRKR      R R  DRD + ++ER  
Sbjct: 257 KRSRSREKEERKRSREKSKDKE-KEKDKDNKDRDRKRRSRSRERKRERDRDREKKEERVE 315

Query: 276 -------DRRGDNDRRGNG-----ERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNG 136
                  D   D+ + G+      E +   ++  +ERDR R R K + + + DR RDR+ 
Sbjct: 316 AEVPEADDAPQDDAQIGDLGIDGIELKQEPEEKSRERDRDRDREKGEKDRDKDRDRDRDR 375

Query: 135 DRRHRVDDRDGDNEKERDH-RRRYKD-DSEED-DRKRNRDR 22
            R HR  DR+ D +++RD  RRR +D D E D D KR RDR
Sbjct: 376 RRSHRDRDREKDRDRDRDRDRRRDRDRDRERDKDHKRERDR 416

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 56/179 (31%), Positives = 80/179 (44%), Gaps = 32/179 (17%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYK--------------DDSE---------------EE 355
           R+R RR R R+   E++RDR  + +              DD++               EE
Sbjct: 288 RDRKRRSRSRERKRERDRDREKKEERVEAEVPEADDAPQDDAQIGDLGIDGIELKQEPEE 347

Query: 354 FDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKD 178
             R+RDR+ DR     DRD    K+RDR  D DRR +   R R+ D +++RDR R R +D
Sbjct: 348 KSRERDRDRDREKGEKDRD----KDRDR--DRDRRRSHRDRDREKDRDRDRDRDRRRDRD 401

Query: 177 -DSEEEFDRKRDRN-GDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
            D E + D KR+R+ GDR  + ++R  DN    +       D   D         Y  T
Sbjct: 402 RDRERDKDHKRERDRGDRSEKREERVPDNGMVMEQAEETSQDMYLDQESMQSGDGYLST 460

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 39/111 (35%), Positives = 61/111 (54%)
 Frame = -1

Query: 342 RDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEE 163
           R    D   R D+RD   E+ERDRR   +R    E+  R+    + R+RR R +   +EE
Sbjct: 212 RHSGRDDTSRYDERD--RERERDRR---ERSREREKEPRERRRSRSRERRKRSRSREKEE 266

Query: 162 FDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             R R+++ D+     ++D DN K+RD +RR +  S E  R+R+RDR  ++
Sbjct: 267 RKRSREKSKDKEK---EKDKDN-KDRDRKRRSR--SRERKRERDRDREKKE 311

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/109 (33%), Positives = 57/109 (52%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR 196
           +DD+    +R R+R  DRR R  +R+   ++ R+RR    R    ERR R    EKE  +
Sbjct: 216 RDDTSRYDERDRERERDRRERSRERE---KEPRERRRSRSR----ERRKRSRSREKEERK 268

Query: 195 RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEE 49
           R R K   +E+   K +++ DR+ R   R  + ++ERD  R  K++  E
Sbjct: 269 RSREKSKDKEKEKDKDNKDRDRKRR--SRSRERKRERDRDREKKEERVE 315

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 47/149 (31%), Positives = 71/149 (47%), Gaps = 15/149 (10%)
 Frame = -1

Query: 405 EKERDRRGRYKDDSEEEFD---------RKRDRNGDRRHRVDDRDGDNEKERDRRG--DN 259
           E ERD    YK    ++ D         R R   G R  R+    G       RRG  D 
Sbjct: 155 EHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGT-----RRGGADV 209

Query: 258 DRRGNGE---RRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
           + R +G     R+ + D E+ERDRR R ++  +E  +R+R R+ +RR R   R  + E+ 
Sbjct: 210 NIRHSGRDDTSRYDERDRERERDRRERSREREKEPRERRRSRSRERRKR--SRSREKEER 267

Query: 87  RDHRRRYKDDSEEDDR-KRNRDRRYRDTS 4
           +  R + KD  +E D+  ++RDR+ R  S
Sbjct: 268 KRSREKSKDKEKEKDKDNKDRDRKRRSRS 296

[94][TOP]
>UniRef100_Q08B25 RNPC7 protein n=1 Tax=Xenopus laevis RepID=Q08B25_XENLA
          Length = 814

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 52/152 (34%), Positives = 89/152 (58%), Gaps = 8/152 (5%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
           RD   +  ++  +KE++R+   KD  + E +R+R+R    R R  +R+ + E+ERDR  +
Sbjct: 272 RDTHKKLEEEKGKKEKERQEIEKDRKDRERERERERREREREREKEREKEKERERDRERN 331

Query: 261 NDRRGNGER---RHRDDDNEKERDR-RGRYKDDS---EEEFDRKRDRNGDR-RHRVDDRD 106
           ++R  + +R   R RD D +K+RDR +   KD S   E+  DR RDR  DR R R  +R+
Sbjct: 332 SERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSRSREKSRDRDRDRERDRERERERERE 391

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            D ++++D +R  ++D EE   +R  +R+ R+
Sbjct: 392 RDRDRDKDKKRDREEDEEEAYERRKLERKLRE 423

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 46/151 (30%), Positives = 75/151 (49%), Gaps = 8/151 (5%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K+ +D++         +E       ++D  +   R+  +  D   ++++  G  EKER  
Sbjct: 232 KKKKDKKEEMSSSVQLQEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQE 291

Query: 270 ----RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRD 106
               R D +R    ERR R+ + EKER++    + D E   +R +DR+ DR R R  DRD
Sbjct: 292 IEKDRKDRERERERERREREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRD 351

Query: 105 GDNEKERDH---RRRYKDDSEEDDRKRNRDR 22
            D ++ +DH   R R ++ S + DR R RDR
Sbjct: 352 KDRDRVQDHIKDRSRSREKSRDRDRDRERDR 382

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 54/171 (31%), Positives = 89/171 (52%), Gaps = 24/171 (14%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRR---GRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDG 295
           +R R+R R ++R+ + E+ERDR     R KD   D + E DR RD++ DR +  + DR  
Sbjct: 307 RREREREREKEREKEKERERDRERNSERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSR 366

Query: 294 DNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRK----------- 151
             EK RDR  D +R    ER R R+ D ++++D++   ++D EE ++R+           
Sbjct: 367 SREKSRDRDRDRERDRERERERERERDRDRDKDKKRDREEDEEEAYERRKLERKLREKEA 426

Query: 150 ----RDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
               R +N + R R   R+ + + ER+  RR +D ++E  R +     Y D
Sbjct: 427 AYQERLKNWEIRERKKTREYEKDAEREEERR-RDTTKEGKRLKEFLEDYDD 476

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 60/179 (33%), Positives = 95/179 (53%), Gaps = 36/179 (20%)
 Frame = -1

Query: 450 KRNRDR---RYRDRDDDNEKERDR-------RGRYKDDSEE-EFDRKRDRNGDR-RHRVD 307
           +RN+DR   R R+RD D +K+RDR       R R ++ S + + DR+RDR  +R R R  
Sbjct: 333 ERNKDRDRDRDRERDRDRDKDRDRVQDHIKDRSRSREKSRDRDRDRERDRERERERERER 392

Query: 306 DRDGDNEKERDRRGDND---RRGNGERRHRDDD----------NEKERDRRGRYKDDSEE 166
           DRD D +K+RDR  D +    R   ER+ R+ +            +ER +   Y+ D+E 
Sbjct: 393 DRDRDKDKKRDREEDEEEAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKDAER 452

Query: 165 EFDRKRD--RNGDR-RHRVDDRDGDNEKERDHR-----RRYKD---DSEEDDRKRNRDR 22
           E +R+RD  + G R +  ++D D D +  + +R     +R +D   + E DDR R R++
Sbjct: 453 EEERRRDTTKEGKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKELEADDRDRKREK 511

[95][TOP]
>UniRef100_C1FJ05 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FJ05_9CHLO
          Length = 468

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 56/143 (39%), Positives = 76/143 (53%), Gaps = 3/143 (2%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
           RD R RDRD D++++R  R R +   E    ++RDR+ DR     DRD D +++RDR  D
Sbjct: 26  RDDRDRDRDRDSDRKRSHRDRDESSDERRERKRRDRDRDR-----DRDRDRDRDRDRDRD 80

Query: 261 NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER- 85
            DR      R RD D +++ DRR R +D S     R+RDR   RRHR       + + R 
Sbjct: 81  RDR-----DRDRDRDRDRDHDRRDRDRDRS-----RERDRKKSRRHRSRSHSRSDSRRRE 130

Query: 84  --DHRRRYKDDSEEDDRKRNRDR 22
             D RR  +  S E  R R+RDR
Sbjct: 131 RSDRRRSSRSRSPERSRDRDRDR 153

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 46/126 (36%), Positives = 70/126 (55%), Gaps = 1/126 (0%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           +R R +RDRD+ +++ R+R+ R +D D + + DR RDR+ DR     DRD D +++RDR 
Sbjct: 38  DRKRSHRDRDESSDERRERKRRDRDRDRDRDRDRDRDRDRDR-----DRDRDRDRDRDRD 92

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
            D+DRR     R R+ D +K R  R R    S+     + DR    R R  +R  D +++
Sbjct: 93  RDHDRRDRDRDRSRERDRKKSRRHRSRSHSRSDSRRRERSDRRRSSRSRSPERSRDRDRD 152

Query: 87  RDHRRR 70
           R   RR
Sbjct: 153 RGRERR 158

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 50/143 (34%), Positives = 72/143 (50%)
 Frame = -1

Query: 435 RRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDND 256
           RR RD  DD    RD R           DR RDR+ DR+    DRD  +++ R+R+  + 
Sbjct: 13  RRRRDDRDDPPSARDDR-----------DRDRDRDSDRKRSHRDRDESSDERRERKRRDR 61

Query: 255 RRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHR 76
            R     R RD D +++RDR      D + + DR RDR+ DRR R  DR  + ++++  R
Sbjct: 62  DRDRDRDRDRDRDRDRDRDR------DRDRDRDRDRDRDHDRRDRDRDRSRERDRKKSRR 115

Query: 75  RRYKDDSEEDDRKRNRDRRYRDT 7
            R +  S  D R+R R  R R +
Sbjct: 116 HRSRSHSRSDSRRRERSDRRRSS 138

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 47/110 (42%), Positives = 61/110 (55%), Gaps = 2/110 (1%)
 Frame = -1

Query: 327 DRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRD-DDNEKERDRRGRYKDDSEEEFDRK 151
           D R R DDRD       DR  D DR  + +R HRD D++  ER  R R   D + + DR 
Sbjct: 11  DPRRRRDDRDDPPSARDDRDRDRDRDSDRKRSHRDRDESSDERRERKRRDRDRDRDRDRD 70

Query: 150 RDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           RDR+ DR R R  DRD D +++RDH RR +D     +R R + RR+R  S
Sbjct: 71  RDRDRDRDRDRDRDRDRDRDRDRDHDRRDRDRDRSRERDRKKSRRHRSRS 120

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 38/96 (39%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           R+RDR R RDRD D +++ DRR R +D S     R+RDR   RRHR       + + R+ 
Sbjct: 77  RDRDRDRDRDRDRDRDRDHDRRDRDRDRS-----RERDRKKSRRHRSRSHSRSDSRRRE- 130

Query: 270 RGDNDR--RGNGERRHRDDDNEKERDRRGRYKDDSE 169
           R D  R  R     R RD D ++ R+RR     D+E
Sbjct: 131 RSDRRRSSRSRSPERSRDRDRDRGRERRRPSGFDTE 166

[96][TOP]
>UniRef100_C9SPB8 Putative uncharacterized protein n=1 Tax=Verticillium albo-atrum
            VaMs.102 RepID=C9SPB8_9PEZI
          Length = 977

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 64/176 (36%), Positives = 91/176 (51%), Gaps = 29/176 (16%)
 Frame = -1

Query: 450  KRNRDRRYRD--RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
            +R+R RR+R   R  D   +  RR R+K   +E+     D   D R R  D DGDN  ER
Sbjct: 688  QRHRRRRHRSVSRSGDERTDDHRRHRHKGRKQED-----DVEEDTRSRFKDEDGDNGGER 742

Query: 276  DRR---GDNDRRGNGERRHRDD---DNEKERDR-RGRYKDDSEEEF------------DR 154
             R     ++ R G+  RR RDD   D +++R+R + R++DD E +             DR
Sbjct: 743  TRSASPAESKRSGHRSRRDRDDRRRDKDRDREREKERHRDDEEHDHRHKSSRRSHRDRDR 802

Query: 153  KRDRNGDR--RHRVDDRDGDNEKERDHRRRYKDD------SEEDDRKRNRDRRYRD 10
            +RDR+ DR  R R  DRD D E++R+H  R + D       + D R ++RDRR RD
Sbjct: 803  ERDRDKDRGPRDRDRDRDRDRERDREHDARERSDRNRDREKDRDSRDKDRDRRRRD 858

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 50/140 (35%), Positives = 72/140 (51%), Gaps = 3/140 (2%)
 Frame = -1

Query: 432  RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
            R++D D DN  ER R     +        +RDR+  RR +  DR+ + E+ RD    + R
Sbjct: 730  RFKDEDGDNGGERTRSASPAESKRSGHRSRRDRDDRRRDKDRDREREKERHRDDEEHDHR 789

Query: 252  RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV---DDRDGDNEKERD 82
              +  R HRD D E++RD+    +D    + DR RDR  DR H      DR+ D EK+RD
Sbjct: 790  HKSSRRSHRDRDRERDRDKDRGPRD---RDRDRDRDRERDREHDARERSDRNRDREKDRD 846

Query: 81   HRRRYKDDSEEDDRKRNRDR 22
             R     D + D R+R++DR
Sbjct: 847  SR-----DKDRDRRRRDKDR 861

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 54/172 (31%), Positives = 85/172 (49%), Gaps = 24/172 (13%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEF------------DRKRDRNGDRRHRVD 307
            +R+RD R RD+D D E+E++R   ++DD E +             DR+RDR+ DR  R  
Sbjct: 759  RRDRDDRRRDKDRDREREKER---HRDDEEHDHRHKSSRRSHRDRDRERDRDKDRGPRDR 815

Query: 306  DRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR 127
            DRD D ++ERDR  ++D R   ER  R+ D EK+RD R + +D    + DR R     R+
Sbjct: 816  DRDRDRDRERDR--EHDAR---ERSDRNRDREKDRDSRDKDRDRRRRDKDRHR---SSRK 867

Query: 126  HRVDDRDGDNE------------KERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
              V+  +  ++            +      + KD    +   R+R+R  R+T
Sbjct: 868  QSVEPSNSTDKGFNPPTGPRSGPESTSGASKTKDPHALEREARDRERLLRET 919

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 48/165 (29%), Positives = 69/165 (41%), Gaps = 11/165 (6%)
 Frame = -1

Query: 471  IQRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
            + R     R+R R R R RD D+ +  D+R R +        R   R+GD R   DD   
Sbjct: 660  VSRTASKSRSRSRSRSRSRDRDHNRRTDQRHRRRRH------RSVSRSGDER--TDDHRR 711

Query: 294  DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
               K R +  D +       +  D DN  ER R     +        +RDR+  RR +  
Sbjct: 712  HRHKGRKQEDDVEEDTRSRFKDEDGDNGGERTRSASPAESKRSGHRSRRDRDDRRRDKDR 771

Query: 114  DRDGDNEKERD----------HRRRYKDDSEEDDRKRNRDRRYRD 10
            DR+ + E+ RD           RR ++D   E DR ++R  R RD
Sbjct: 772  DREREKERHRDDEEHDHRHKSSRRSHRDRDRERDRDKDRGPRDRD 816

[97][TOP]
>UniRef100_Q5T200-2 Isoform 2 of Zinc finger CCCH domain-containing protein 13 n=1
            Tax=Homo sapiens RepID=Q5T200-2
          Length = 1564

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 51/152 (33%), Positives = 84/152 (55%), Gaps = 6/152 (3%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKE 280
            R RDR R RDR+ + E+ER+R    + + E E +R R+R  +R   R R  DRD D+++E
Sbjct: 677  RERDRERERDRERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDRE 736

Query: 279  RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
            R+R  + DR    ER   + + E+ER+R    + + E E  R+RD+  +R+   +D+D  
Sbjct: 737  RERERERDREKEREREREERERERERERERERERERERERARERDKERERQRDWEDKDKG 796

Query: 99   NEKERDHRRRYKDDSEEDD--RKRNRDRRYRD 10
             +  R+ R   ++D    D   +R   +RYR+
Sbjct: 797  RDDRREKREEIREDRNPRDGHDERKSKKRYRN 828

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 57/155 (36%), Positives = 89/155 (57%), Gaps = 16/155 (10%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRG------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
            +RR+ +RD  + +ERD+R       + ++D  E  +R+ +R  DR   VDDR  +  +ER
Sbjct: 623  ERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDR---VDDRRDERARER 679

Query: 276  DRRGDNDRRGNGER-RHRDDDNEKERD---RRGRYKD-DSEEEFDRKRDRNGDR-----R 127
            DR  + DR    ER R RD + EKER+    R R ++ + E+E DR+RDR+ D      R
Sbjct: 680  DRERERDRERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDRERER 739

Query: 126  HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             R  DR+ + E+ER+ R R ++   E +R+R R+R
Sbjct: 740  ERERDREKEREREREERERERERERERERERERER 774

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 56/151 (37%), Positives = 87/151 (57%), Gaps = 7/151 (4%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD-RRHRVDDRDGDNEKERDRRG 265
            RD R R+RD + E++R+R    + + E E DR+R++  +  R R  +R+ + EKERDR  
Sbjct: 672  RDERARERDRERERDRER----ERERERERDREREKERELERERAREREREREKERDRER 727

Query: 264  DNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDN 97
            D DR  + ER   R RD + E+ER+R  R   + E E +R+R+R  +R R R  +RD + 
Sbjct: 728  DRDRDHDRERERERERDREKEREREREER---ERERERERERERERERERERARERDKER 784

Query: 96   EKERD--HRRRYKDDSEEDDRKRNRDRRYRD 10
            E++RD   + + +DD  E   +   DR  RD
Sbjct: 785  ERQRDWEDKDKGRDDRREKREEIREDRNPRD 815

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 48/152 (31%), Positives = 86/152 (56%), Gaps = 11/152 (7%)
 Frame = -1

Query: 432  RYRDRDDD---NEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERDR 271
            R++ R+D+   +E+  +RR    DD  +E  R+RDR  +R   R R  +R+ D E+E++R
Sbjct: 646  RHQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRERERERERERDREREKER 705

Query: 270  RGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
              + +R    ER     R R+ D +++ DR    + + E E DR+++R  +R  R  +R+
Sbjct: 706  ELERERAREREREREKERDRERDRDRDHDR----ERERERERDREKEREREREERERERE 761

Query: 105  GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             + E+ER+ R R ++ + E D++R R R + D
Sbjct: 762  RERERERE-RERERERARERDKERERQRDWED 792

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 53/163 (32%), Positives = 88/163 (53%), Gaps = 13/163 (7%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-----------RYRDRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNG 328
            +R+   +R RDR           R R+R+ + EKERDR R R +D D E E +R+RDR  
Sbjct: 688  ERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDRERERERERDREK 747

Query: 327  DRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKR 148
            +R    ++R+ + E+ER+R  + +R      R R  + +KER+R+  ++D  +   DR+ 
Sbjct: 748  EREREREERERERERERERERERERE-----RERARERDKERERQRDWEDKDKGRDDRRE 802

Query: 147  DRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
             R   R  R + RDG +  ER  ++RY+++     R+  + RR
Sbjct: 803  KREEIREDR-NPRDGHD--ERKSKKRYRNEGSPSPRQSPKRRR 842

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 52/145 (35%), Positives = 78/145 (53%), Gaps = 15/145 (10%)
 Frame = -1

Query: 411  DNEKERDRRGRYKDDSEEEFDRKRDRNGDR----------RH--RVDDRDGDNEKERDRR 268
            D   ERD R + +D S E    +RDR  +R          RH  R D+ + D  +E +RR
Sbjct: 606  DRYPERDNRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERRE-ERR 664

Query: 267  GD--NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
             D  +DRR   + R R+ D E+ERDR    + + E + +R+++R  + R R  +R+ + E
Sbjct: 665  VDRVDDRR---DERARERDRERERDRERERERERERDREREKERELE-RERARERERERE 720

Query: 93   KERDHRR-RYKDDSEEDDRKRNRDR 22
            KERD  R R +D   E +R+R RDR
Sbjct: 721  KERDRERDRDRDHDRERERERERDR 745

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 46/131 (35%), Positives = 68/131 (51%), Gaps = 23/131 (17%)
 Frame = -1

Query: 345 KRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER--------RHRDDDNEKERDRRG 190
           +RDR  +R +R   RD   E+   R G+ DRR N ER        RH+  ++E ERD R 
Sbjct: 604 ERDRYPERDNRDQARDSSFER---RHGERDRRDNRERDQRPSSPIRHQGRNDELERDERR 660

Query: 189 RYK-----DDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERDH-------RRRYKDDS 55
             +     DD  +E  R+RDR  +R   R R  +R+ D E+E++        R R ++  
Sbjct: 661 EERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERARERERERE 720

Query: 54  EEDDRKRNRDR 22
           +E DR+R+RDR
Sbjct: 721 KERDRERDRDR 731

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 48/150 (32%), Positives = 66/150 (44%), Gaps = 8/150 (5%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           ++ DRR+  R+D   K RDR    + DS EE + ++D++  R HR D    D    RD R
Sbjct: 408 QSHDRRHERREDTRGK-RDR----EKDSREEREYEQDQSSSRDHRDDREPRDGRDRRDAR 462

Query: 267 GDNDRRGNGERRHRDDDNEKE---RD-RRGRYKDDSEEEFDRK--RDRNGDRRHRVDDRD 106
              DRR   + R   D  E     RD +  R   DS    D    RDR G   HR +D  
Sbjct: 463 DTRDRRELRDSRDMRDSREMRDYSRDTKESRDPRDSRSTRDAHDYRDREGRDTHRKEDTY 522

Query: 105 GDNEKE--RDHRRRYKDDSEEDDRKRNRDR 22
            +  +   R+H R     +E  +  RN  R
Sbjct: 523 PEESRSYGRNHLREESSRTEIRNESRNESR 552

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 44/150 (29%), Positives = 69/150 (46%), Gaps = 10/150 (6%)
 Frame = -1

Query: 426  RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR-----GD 262
            RDR+     E     + + D  +  +  R  + DR+         +  E DR+     G 
Sbjct: 1233 RDREKTKSLEITGERKSRIDQLKRGEPSRSTSSDRQDSRSHSSRRSSPESDRQVHSRSGS 1292

Query: 261  NDRRGNGERRHR-DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKE 88
             D R   + R R + D E+ER+RR   + + + + D+   RN DR R R  +R+ + +K 
Sbjct: 1293 FDSRDRLQERDRYEHDRERERERRDTRQREWDRDADKDWPRNRDRDRLRERERERERDKR 1352

Query: 87   RD---HRRRYKDDSEEDDRKRNRDRRYRDT 7
            RD    R R   DS E DR R+RDR +  +
Sbjct: 1353 RDLDRERERLISDSVERDRDRDRDRTFESS 1382

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 44/162 (27%), Positives = 70/162 (43%), Gaps = 7/162 (4%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEK---ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
           QRK    R+R         D+E+     DRR   ++D+  + DR++D   +R +     +
Sbjct: 383 QRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREDTRGKRDREKDSREEREY-----E 437

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRD--RNGDRRH 124
            D    RD R D + R   +RR   D  ++   R  R   DS E  D  RD   + D R 
Sbjct: 438 QDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDMRDSREMRDYSRDTKESRDPRD 497

Query: 123 RVDDRDGDNEKERDHR--RRYKDDSEEDDRKRNRDRRYRDTS 4
               RD  + ++R+ R   R +D   E+ R   R+    ++S
Sbjct: 498 SRSTRDAHDYRDREGRDTHRKEDTYPEESRSYGRNHLREESS 539

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 44/146 (30%), Positives = 65/146 (44%), Gaps = 3/146 (2%)
 Frame = -1

Query: 438  DRRYRDRDD--DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
            DR+   R    D+      R RY+ D E E +R+     D R R  DRD D +  R+R  
Sbjct: 1283 DRQVHSRSGSFDSRDRLQERDRYEHDRERERERR-----DTRQREWDRDADKDWPRNR-- 1335

Query: 264  DNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
            D DR    ER R RD   + +R+R     D  E + DR RDR  +       +  + + E
Sbjct: 1336 DRDRLRERERERERDKRRDLDRERERLISDSVERDRDRDRDRTFESSQIESVKRCEAKLE 1395

Query: 87   RDHRRRYKDDSEEDDRKRNRDRRYRD 10
             +H R  +  S  D    +++R  +D
Sbjct: 1396 GEHERDLESTS-RDSLALDKERMDKD 1420

[98][TOP]
>UniRef100_Q5T200 Zinc finger CCCH domain-containing protein 13 n=2 Tax=Homo sapiens
            RepID=ZC3HD_HUMAN
          Length = 1668

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 51/152 (33%), Positives = 84/152 (55%), Gaps = 6/152 (3%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKE 280
            R RDR R RDR+ + E+ER+R    + + E E +R R+R  +R   R R  DRD D+++E
Sbjct: 677  RERDRERERDRERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDRE 736

Query: 279  RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
            R+R  + DR    ER   + + E+ER+R    + + E E  R+RD+  +R+   +D+D  
Sbjct: 737  RERERERDREKEREREREERERERERERERERERERERERARERDKERERQRDWEDKDKG 796

Query: 99   NEKERDHRRRYKDDSEEDD--RKRNRDRRYRD 10
             +  R+ R   ++D    D   +R   +RYR+
Sbjct: 797  RDDRREKREEIREDRNPRDGHDERKSKKRYRN 828

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 57/155 (36%), Positives = 89/155 (57%), Gaps = 16/155 (10%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRG------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
            +RR+ +RD  + +ERD+R       + ++D  E  +R+ +R  DR   VDDR  +  +ER
Sbjct: 623  ERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDR---VDDRRDERARER 679

Query: 276  DRRGDNDRRGNGER-RHRDDDNEKERD---RRGRYKD-DSEEEFDRKRDRNGDR-----R 127
            DR  + DR    ER R RD + EKER+    R R ++ + E+E DR+RDR+ D      R
Sbjct: 680  DRERERDRERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDRERER 739

Query: 126  HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             R  DR+ + E+ER+ R R ++   E +R+R R+R
Sbjct: 740  ERERDREKEREREREERERERERERERERERERER 774

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 56/151 (37%), Positives = 87/151 (57%), Gaps = 7/151 (4%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD-RRHRVDDRDGDNEKERDRRG 265
            RD R R+RD + E++R+R    + + E E DR+R++  +  R R  +R+ + EKERDR  
Sbjct: 672  RDERARERDRERERDRER----ERERERERDREREKERELERERAREREREREKERDRER 727

Query: 264  DNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDN 97
            D DR  + ER   R RD + E+ER+R  R   + E E +R+R+R  +R R R  +RD + 
Sbjct: 728  DRDRDHDRERERERERDREKEREREREER---ERERERERERERERERERERARERDKER 784

Query: 96   EKERD--HRRRYKDDSEEDDRKRNRDRRYRD 10
            E++RD   + + +DD  E   +   DR  RD
Sbjct: 785  ERQRDWEDKDKGRDDRREKREEIREDRNPRD 815

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 48/152 (31%), Positives = 86/152 (56%), Gaps = 11/152 (7%)
 Frame = -1

Query: 432  RYRDRDDD---NEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERDR 271
            R++ R+D+   +E+  +RR    DD  +E  R+RDR  +R   R R  +R+ D E+E++R
Sbjct: 646  RHQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRERERERERERDREREKER 705

Query: 270  RGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
              + +R    ER     R R+ D +++ DR    + + E E DR+++R  +R  R  +R+
Sbjct: 706  ELERERAREREREREKERDRERDRDRDHDR----ERERERERDREKEREREREERERERE 761

Query: 105  GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             + E+ER+ R R ++ + E D++R R R + D
Sbjct: 762  RERERERE-RERERERARERDKERERQRDWED 792

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 53/163 (32%), Positives = 88/163 (53%), Gaps = 13/163 (7%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-----------RYRDRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNG 328
            +R+   +R RDR           R R+R+ + EKERDR R R +D D E E +R+RDR  
Sbjct: 688  ERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDRERERERERDREK 747

Query: 327  DRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKR 148
            +R    ++R+ + E+ER+R  + +R      R R  + +KER+R+  ++D  +   DR+ 
Sbjct: 748  EREREREERERERERERERERERERE-----RERARERDKERERQRDWEDKDKGRDDRRE 802

Query: 147  DRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
             R   R  R + RDG +  ER  ++RY+++     R+  + RR
Sbjct: 803  KREEIREDR-NPRDGHD--ERKSKKRYRNEGSPSPRQSPKRRR 842

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 52/145 (35%), Positives = 78/145 (53%), Gaps = 15/145 (10%)
 Frame = -1

Query: 411  DNEKERDRRGRYKDDSEEEFDRKRDRNGDR----------RH--RVDDRDGDNEKERDRR 268
            D   ERD R + +D S E    +RDR  +R          RH  R D+ + D  +E +RR
Sbjct: 606  DRYPERDNRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERRE-ERR 664

Query: 267  GD--NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
             D  +DRR   + R R+ D E+ERDR    + + E + +R+++R  + R R  +R+ + E
Sbjct: 665  VDRVDDRR---DERARERDRERERDRERERERERERDREREKERELE-RERARERERERE 720

Query: 93   KERDHRR-RYKDDSEEDDRKRNRDR 22
            KERD  R R +D   E +R+R RDR
Sbjct: 721  KERDRERDRDRDHDRERERERERDR 745

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 46/131 (35%), Positives = 68/131 (51%), Gaps = 23/131 (17%)
 Frame = -1

Query: 345 KRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER--------RHRDDDNEKERDRRG 190
           +RDR  +R +R   RD   E+   R G+ DRR N ER        RH+  ++E ERD R 
Sbjct: 604 ERDRYPERDNRDQARDSSFER---RHGERDRRDNRERDQRPSSPIRHQGRNDELERDERR 660

Query: 189 RYK-----DDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERDH-------RRRYKDDS 55
             +     DD  +E  R+RDR  +R   R R  +R+ D E+E++        R R ++  
Sbjct: 661 EERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERARERERERE 720

Query: 54  EEDDRKRNRDR 22
           +E DR+R+RDR
Sbjct: 721 KERDRERDRDR 731

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 48/150 (32%), Positives = 66/150 (44%), Gaps = 8/150 (5%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           ++ DRR+  R+D   K RDR    + DS EE + ++D++  R HR D    D    RD R
Sbjct: 408 QSHDRRHERREDTRGK-RDR----EKDSREEREYEQDQSSSRDHRDDREPRDGRDRRDAR 462

Query: 267 GDNDRRGNGERRHRDDDNEKE---RD-RRGRYKDDSEEEFDRK--RDRNGDRRHRVDDRD 106
              DRR   + R   D  E     RD +  R   DS    D    RDR G   HR +D  
Sbjct: 463 DTRDRRELRDSRDMRDSREMRDYSRDTKESRDPRDSRSTRDAHDYRDREGRDTHRKEDTY 522

Query: 105 GDNEKE--RDHRRRYKDDSEEDDRKRNRDR 22
            +  +   R+H R     +E  +  RN  R
Sbjct: 523 PEESRSYGRNHLREESSRTEIRNESRNESR 552

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 44/150 (29%), Positives = 69/150 (46%), Gaps = 10/150 (6%)
 Frame = -1

Query: 426  RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR-----GD 262
            RDR+     E     + + D  +  +  R  + DR+         +  E DR+     G 
Sbjct: 1233 RDREKTKSLEITGERKSRIDQLKRGEPSRSTSSDRQDSRSHSSRRSSPESDRQVHSRSGS 1292

Query: 261  NDRRGNGERRHR-DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKE 88
             D R   + R R + D E+ER+RR   + + + + D+   RN DR R R  +R+ + +K 
Sbjct: 1293 FDSRDRLQERDRYEHDRERERERRDTRQREWDRDADKDWPRNRDRDRLRERERERERDKR 1352

Query: 87   RD---HRRRYKDDSEEDDRKRNRDRRYRDT 7
            RD    R R   DS E DR R+RDR +  +
Sbjct: 1353 RDLDRERERLISDSVERDRDRDRDRTFESS 1382

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 44/162 (27%), Positives = 70/162 (43%), Gaps = 7/162 (4%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEK---ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
           QRK    R+R         D+E+     DRR   ++D+  + DR++D   +R +     +
Sbjct: 383 QRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREDTRGKRDREKDSREEREY-----E 437

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRD--RNGDRRH 124
            D    RD R D + R   +RR   D  ++   R  R   DS E  D  RD   + D R 
Sbjct: 438 QDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDMRDSREMRDYSRDTKESRDPRD 497

Query: 123 RVDDRDGDNEKERDHR--RRYKDDSEEDDRKRNRDRRYRDTS 4
               RD  + ++R+ R   R +D   E+ R   R+    ++S
Sbjct: 498 SRSTRDAHDYRDREGRDTHRKEDTYPEESRSYGRNHLREESS 539

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 44/146 (30%), Positives = 65/146 (44%), Gaps = 3/146 (2%)
 Frame = -1

Query: 438  DRRYRDRDD--DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
            DR+   R    D+      R RY+ D E E +R+     D R R  DRD D +  R+R  
Sbjct: 1283 DRQVHSRSGSFDSRDRLQERDRYEHDRERERERR-----DTRQREWDRDADKDWPRNR-- 1335

Query: 264  DNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
            D DR    ER R RD   + +R+R     D  E + DR RDR  +       +  + + E
Sbjct: 1336 DRDRLRERERERERDKRRDLDRERERLISDSVERDRDRDRDRTFESSQIESVKRCEAKLE 1395

Query: 87   RDHRRRYKDDSEEDDRKRNRDRRYRD 10
             +H R  +  S  D    +++R  +D
Sbjct: 1396 GEHERDLESTS-RDSLALDKERMDKD 1420

[99][TOP]
>UniRef100_UPI00015B4CDB PREDICTED: similar to ENSANGP00000011728 n=1 Tax=Nasonia
           vitripennis RepID=UPI00015B4CDB
          Length = 932

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 56/152 (36%), Positives = 82/152 (53%), Gaps = 6/152 (3%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           R   RR R R  + E+ERDR    ++   E   R R R GDR     DR GD +++RDR 
Sbjct: 312 RRDKRRSRSRSKERERERDRGRGERERETESRHRDRHREGDR-----DRGGDRDRDRDR- 365

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK- 91
            + +R    ER  R+ D E+ERD+    + + E E DR+R+R  + R R  DRD D E+ 
Sbjct: 366 AERERNDRAERE-RERDRERERDKERERERERERERDREREREREMRERERDRDRDRERE 424

Query: 90  -----ERDHRRRYKDDSEEDDRKRNRDRRYRD 10
                ER+  R  +++ E  +RK+N +RR R+
Sbjct: 425 EARKSEREIMREREEEEEAKERKKN-ERRARE 455

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 48/161 (29%), Positives = 82/161 (50%), Gaps = 15/161 (9%)
 Frame = -1

Query: 447 RNRDRRY---RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           R+RDR     RDR  D +++RDR  R ++D  E   R+R+R+ +R     +RD + E+ER
Sbjct: 343 RHRDRHREGDRDRGGDRDRDRDRAERERNDRAE---RERERDRER-----ERDKERERER 394

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           +R  + DR    ER  R+ + +++RDR       SE E  R+R+   + + R  +     
Sbjct: 395 ERERERDREREREREMRERERDRDRDREREEARKSEREIMREREEEEEAKERKKNERRAR 454

Query: 96  EKE------------RDHRRRYKDDSEEDDRKRNRDRRYRD 10
           EK+            R+ R++ + D E D ++  R+ R R+
Sbjct: 455 EKDAAYQERLRAWEARERRKQKEYDKENDKKRAKREARERE 495

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 52/165 (31%), Positives = 83/165 (50%), Gaps = 8/165 (4%)
 Frame = -1

Query: 483 GIRMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 304
           G R   R    +   DR  R+R+ D E+ERD+    + + E E DR+R+R  + R R  D
Sbjct: 357 GDRDRDRDRAERERNDRAERERERDRERERDKERERERERERERDREREREREMRERERD 416

Query: 303 RDGDNEKERDRRGDNDRRGNGERRHRDDDNE-KERDRRGRYKDDSEEEFDRKRDRNGDRR 127
           RD D E+E  R+  ++R    ER   ++  E K+ +RR R KD + +E  R R      R
Sbjct: 417 RDRDREREEARK--SEREIMREREEEEEAKERKKNERRAREKDAAYQE--RLRAWEARER 472

Query: 126 HRVDDRDGDNEKERDHR-------RRYKDDSEEDDRKRNRDRRYR 13
            +  + D +N+K+R  R       +R K+  E+ D  R+  + Y+
Sbjct: 473 RKQKEYDKENDKKRAKREAREREAKRLKEFLEDYDDDRDDAKYYK 517

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 47/150 (31%), Positives = 74/150 (49%), Gaps = 19/150 (12%)
 Frame = -1

Query: 414 DDNEKERDRR-------GRYKD---DSEEEFDRKRDRNGDRRH------RVDDRDGDNEK 283
           DD E E  +R       G++++   ++EE   R+++RN DR+       ++D  D D   
Sbjct: 240 DDAEIEESKRDLITREIGKFREVMKENEEREKREKERNKDRKDDDANSTKLDGDDADPGS 299

Query: 282 ERDRRGDN---DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
               R D+    RR     R R  + E+ERDR    ++   E   R R R GDR     D
Sbjct: 300 PHKGRSDSTGSSRRDKRRSRSRSKERERERDRGRGERERETESRHRDRHREGDR-----D 354

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           R GD +++RD   R ++D  E +R+R+R+R
Sbjct: 355 RGGDRDRDRDRAERERNDRAERERERDRER 384

[100][TOP]
>UniRef100_UPI00015550CE PREDICTED: hypothetical protein, partial n=1 Tax=Ornithorhynchus
           anatinus RepID=UPI00015550CE
          Length = 178

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 58/151 (38%), Positives = 84/151 (55%), Gaps = 7/151 (4%)
 Frame = -1

Query: 450 KRNRDRRYR---DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDGDNEK 283
           +R  DRR     DR DD  +ER+R      + E E +R+RDR  ++   ++ DR  + E+
Sbjct: 20  ERREDRRVERADDRRDDRARERERERERDRERERERERERDREREKERELERDRARERER 79

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRD 106
           E+DR  D DR    +R H D D E+ER+R  R K+   E  +R+R+R  +R R R  +R 
Sbjct: 80  EKDRERDRDR----DREH-DRDRERERERE-REKEREREREERERERERERERERERERG 133

Query: 105 GDNEKERDHRRRY--KDDSEEDDRKRNRDRR 19
            D EKERD +R +  KD   ED R++  D R
Sbjct: 134 RDREKERDRQRDWEDKDKGREDRREKREDTR 164

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 56/153 (36%), Positives = 84/153 (54%), Gaps = 4/153 (2%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 307
           R  +R+   +R+R+R   R R+RD + EKER+       + E E DR+RDR+ DR H   
Sbjct: 37  RARERERERERDRERERERERERDREREKERELERDRAREREREKDRERDRDRDREH--- 93

Query: 306 DRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR 130
           DRD + E+ER+R  + +R      R R+ + E+ER+R RGR   D E+E DR+RD     
Sbjct: 94  DRDREREREREREKEREREREERERERERERERERERERGR---DREKERDRQRDWE--- 147

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRN 31
                    D +K R+ RR  ++D+ ED   R+
Sbjct: 148 ---------DKDKGREDRREKREDTREDRNPRD 171

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 48/123 (39%), Positives = 70/123 (56%), Gaps = 1/123 (0%)
 Frame = -1

Query: 387 RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER-RHRDDDNE 211
           R + ++D  E  +R+ DR   R  R DDR  D  +ER+R  + DR    ER R RD + E
Sbjct: 8   RHQGRNDDLERDERREDR---RVERADDRRDDRARERERERERDRERERERERERDRERE 64

Query: 210 KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRN 31
           KER+       + E E DR+RDR+ DR H   DRD + E+ER+  +  + + EE +R+R 
Sbjct: 65  KERELERDRAREREREKDRERDRDRDREH---DRDREREREREREKEREREREERERERE 121

Query: 30  RDR 22
           R+R
Sbjct: 122 RER 124

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 37/118 (31%), Positives = 66/118 (55%), Gaps = 1/118 (0%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 301
           R ++R    +R R++ R RDRD D E +RDR      + E E +R+++R  +R  R  +R
Sbjct: 67  RELERDRAREREREKDRERDRDRDREHDRDR------EREREREREKEREREREERERER 120

Query: 300 DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR 127
           + + E+ER+R    DR    +R+   +D +K R+ R   ++D+ E+    RD + +R+
Sbjct: 121 ERERERERERERGRDREKERDRQRDWEDKDKGREDRREKREDTRED-RNPRDVHDERK 177

[101][TOP]
>UniRef100_UPI0000F2B21F PREDICTED: similar to obscurin-MLCK n=1 Tax=Monodelphis domestica
           RepID=UPI0000F2B21F
          Length = 840

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 52/149 (34%), Positives = 89/149 (59%), Gaps = 5/149 (3%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           ++RR R+R+ + E+ER  R R ++   + E+E +R+R+R  DR R R  +RD D ++ERD
Sbjct: 306 KERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERD 365

Query: 273 RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           R  D DR  + +R + R    EK RDR    + + E E +R+R+R    R R  +R+ + 
Sbjct: 366 R--DRDRERSSDRNKDRSRSREKSRDRERERERERERERERERER---ERERERERERER 420

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           E+E+D +R  ++D E+   +R  +R+ R+
Sbjct: 421 EREKDKKRDREEDEEDAYERRKLERKLRE 449

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/154 (31%), Positives = 86/154 (55%), Gaps = 2/154 (1%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 275 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 334

Query: 294 DNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHR 121
           + EKER+R  + DR R   + R RD D E++RDR      D  ++  R R+++ DR R R
Sbjct: 335 EKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERER 394

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
             +R+ + E+ER+ R R ++   E +R+R +D++
Sbjct: 395 ERERERERERERE-REREREREREREREREKDKK 427

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 56/183 (30%), Positives = 92/183 (50%), Gaps = 28/183 (15%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGD 292
           +R+   +R R+R  RDRD D  KERDR    + D + + +R  DRN DR R R   RD +
Sbjct: 333 EREKEKERERERE-RDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRE 391

Query: 291 NEKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRK---------- 151
            E+ER+R  + +R    ER   R R+ + E+E+D++   ++D E+ ++R+          
Sbjct: 392 REREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKE 451

Query: 150 -----RDRNGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYR 13
                R +N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR
Sbjct: 452 AAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYR 511

Query: 12  DTS 4
            ++
Sbjct: 512 GSA 514

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 9/127 (7%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD------RRGDNDRRGNGERRHRDDDN 214
           ++D  +   R+  +  D   ++++  G  EKER       R  + +R    ERR R+ + 
Sbjct: 269 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 328

Query: 213 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEED---D 43
           E+ER+R    + + E E DR RDR  +R     DRD D E++RD  R    D  +D    
Sbjct: 329 EREREREKEKERERERERDRDRDRTKER-----DRDRDRERDRDRDRERSSDRNKDRSRS 383

Query: 42  RKRNRDR 22
           R+++RDR
Sbjct: 384 REKSRDR 390

[102][TOP]
>UniRef100_Q05AP3 Zgc:152777 n=1 Tax=Danio rerio RepID=Q05AP3_DANRE
          Length = 516

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 62/169 (36%), Positives = 86/169 (50%), Gaps = 16/169 (9%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +RK I  + +  + RDRD   EKER+R      D ++   RK DR GDRR R  DR+ D 
Sbjct: 275 ERKEI--KEKSHKDRDRDRAKEKERER----MRDKDKHSHRKEDRGGDRR-RERDREEDR 327

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-- 115
            ++R  R  +DR GN +RR+     ++ERDR+G          DR+RDR G+R  R +  
Sbjct: 328 ARDRRDRDRDDRHGNRDRRN-SSPKDRERDRKGELDRRDNSPKDRERDRKGERDRRDNSP 386

Query: 114 -------------DRDGDNEKERDHRRRYKDDSE-EDDRKRNRDRRYRD 10
                        DR G + K+RD  RR K   + E +RK  RD R R+
Sbjct: 387 KDRERETRDKSPKDRRGKSPKDRDRERRDKSPKDREPERKGERDIRERE 435

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 57/158 (36%), Positives = 87/158 (55%), Gaps = 3/158 (1%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +R+   K  +++ ++DRD D  KE++R      D ++   RK DR GDRR R  DR+ D 
Sbjct: 271 ERERERKEIKEKSHKDRDRDRAKEKERERMR--DKDKHSHRKEDRGGDRR-RERDREEDR 327

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
            ++R  R  +DR GN +RR+     ++ERDR+G          DR+RDR G+R     DR
Sbjct: 328 ARDRRDRDRDDRHGNRDRRN-SSPKDRERDRKGELDRRDNSPKDRERDRKGER-----DR 381

Query: 108 DGDNEKERDHRRRYKDDSEEDDR---KRNRDRRYRDTS 4
             ++ K+R+  R  +D S +D R    ++RDR  RD S
Sbjct: 382 RDNSPKDRE--RETRDKSPKDRRGKSPKDRDRERRDKS 417

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 52/147 (35%), Positives = 86/147 (58%), Gaps = 6/147 (4%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRK----RDRNGDRRHRVDDRDGD-NEK 283
           R  DRR R+RD + ++ RDRR R +DD     DR+    +DR  DR+  +D RD    ++
Sbjct: 313 RGGDRR-RERDREEDRARDRRDRDRDDRHGNRDRRNSSPKDRERDRKGELDRRDNSPKDR 371

Query: 282 ERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
           ERDR+G+ DRR N  + R R+  ++  +DRRG+   D + E   +RD++        DR+
Sbjct: 372 ERDRKGERDRRDNSPKDRERETRDKSPKDRRGKSPKDRDRE---RRDKS------PKDRE 422

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRD 25
            + + ERD R R  +D++ D +++N++
Sbjct: 423 PERKGERDIRER--EDNKVDSQRKNQE 447

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 50/151 (33%), Positives = 81/151 (53%), Gaps = 16/151 (10%)
 Frame = -1

Query: 414 DDNEKERDRRGRYKDDSEEEFDRKRDRNG--DRRHRVDDRDGDNEKERDRRGDNDR---- 253
           +++ K + R+     DS++  +R+R+R    ++ H+  DRD   EKER+R  D D+    
Sbjct: 250 NNHAKRQYRQKSPLSDSDDGDERERERKEIKEKSHKDRDRDRAKEKERERMRDKDKHSHR 309

Query: 252 ---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK----RDRNGDRRHRVDDRDG--- 103
              RG   RR RD + ++ RDRR R +DD     DR+    +DR  DR+  +D RD    
Sbjct: 310 KEDRGGDRRRERDREEDRARDRRDRDRDDRHGNRDRRNSSPKDRERDRKGELDRRDNSPK 369

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           D E++R   R  +D+S +D  +  RD+  +D
Sbjct: 370 DRERDRKGERDRRDNSPKDRERETRDKSPKD 400

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 48/158 (30%), Positives = 76/158 (48%), Gaps = 14/158 (8%)
 Frame = -1

Query: 483 GIRMIQRKMIWKRNRDRRYRDRDDDN-----------EKERDRRGRYKDDSEEEFDRKRD 337
           G R  +R     R RDRR RDRDD +           ++ERDR+G          DR+RD
Sbjct: 315 GDRRRERDREEDRARDRRDRDRDDRHGNRDRRNSSPKDRERDRKGELDRRDNSPKDRERD 374

Query: 336 RNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEE 166
           R G+R  R D+   D E+E   +   DRRG   +   R R D + K+R+   + + D  E
Sbjct: 375 RKGERDRR-DNSPKDRERETRDKSPKDRRGKSPKDRDRERRDKSPKDREPERKGERDIRE 433

Query: 165 EFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSE 52
             D K D    R+++ D++  +++ E     +  +++E
Sbjct: 434 REDNKVD--SQRKNQEDEKSSESKTEHGKEEKLVEETE 469

[103][TOP]
>UniRef100_Q6NVT1 RNA binding motif protein 25 n=2 Tax=Xenopus (Silurana) tropicalis
           RepID=Q6NVT1_XENTR
          Length = 769

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 48/149 (32%), Positives = 84/149 (56%), Gaps = 5/149 (3%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
           RD   +  ++  +KE++R+   K+  E E +R+R+R    R R  +R+ + E+ERDR  +
Sbjct: 231 RDTHKKLEEEKGKKEKERQEIEKERRERERERERERREREREREKEREKEKERERDRERN 290

Query: 261 NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDN 97
            DR  + + R RD D +K+RDR   +  D     ++ RDR+ DR     R R  +RD + 
Sbjct: 291 KDRDRDRD-RDRDRDRDKDRDRARDHSKDRSRSREKSRDRDRDRDRERDRERERERDRER 349

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           ++E+D +R  ++D EE   +R  +R+ R+
Sbjct: 350 DREKDKKRDREEDEEEAYERRKLERKLRE 378

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 53/149 (35%), Positives = 86/149 (57%), Gaps = 6/149 (4%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEK-ERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRR 268
           ++RR R+R+ + E+ ER+R    + + E+E +R R+RN DR R R  DRD D +K+RDR 
Sbjct: 253 KERRERERERERERREREREREKEREKEKERERDRERNKDRDRDRDRDRDRDRDKDRDRA 312

Query: 267 GDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD-RRHRVDDRDGD 100
            D+ +   R   + R RD D ++ERDR      + E E DR+RDR  D +R R +D +  
Sbjct: 313 RDHSKDRSRSREKSRDRDRDRDRERDR------ERERERDRERDREKDKKRDREEDEEEA 366

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
            E+ +  R+  + ++   +R +N + R R
Sbjct: 367 YERRKLERKLREKEAAYQERLKNWEIRER 395

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 49/150 (32%), Positives = 83/150 (55%), Gaps = 11/150 (7%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEK 283
           +R R+R R ++R+ + E+ERDR      D + + DR RDR+ DR   R    DR    EK
Sbjct: 266 RREREREREKEREKEKERERDRERNKDRDRDRDRDRDRDRDKDRDRARDHSKDRSRSREK 325

Query: 282 ERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRK------RDRNGDRRH 124
            RDR  D DR  + ER R RD + ++E+D++   ++D EE ++R+      R++    + 
Sbjct: 326 SRDRDRDRDRERDRERERERDRERDREKDKKRDREEDEEEAYERRKLERKLREKEAAYQE 385

Query: 123 RVDDRDGDNEKERDHRRRYKDDSEEDDRKR 34
           R+ + +    +ER   R Y+ D+E ++ +R
Sbjct: 386 RLKNWE---IRERKKAREYEKDAEREEERR 412

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 51/167 (30%), Positives = 85/167 (50%), Gaps = 12/167 (7%)
 Frame = -1

Query: 468 QRKMIWKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
           +R+   +RN+DR   R RDRD D +K+RDR   +  D     ++ RDR+ DR     DR+
Sbjct: 282 ERERDRERNKDRDRDRDRDRDRDRDKDRDRARDHSKDRSRSREKSRDRDRDR-----DRE 336

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
            D E+ER+R  + DR  + +R   +D+ E    R+   K   +E   ++R +N + R R 
Sbjct: 337 RDRERERERDRERDREKDKKRDREEDEEEAYERRKLERKLREKEAAYQERLKNWEIRERK 396

Query: 117 DDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRDTS 4
             R+ + + ER+  R         R K+  E+ D  R+  + YR ++
Sbjct: 397 KAREYEKDAEREEERRRETAKEAKRLKEFLEDYDDDRDDPKYYRGSA 443

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 45/150 (30%), Positives = 75/150 (50%), Gaps = 7/150 (4%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K+ +D++    +    +E       ++D  +   R+  +  D   ++++  G  EKER  
Sbjct: 191 KKKKDKKEEMSNSVQLQEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQE 250

Query: 270 ----RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
               R + +R    ERR R+ + EKER++    + D E   DR RDR+ DR     DRD 
Sbjct: 251 IEKERRERERERERERREREREREKEREKEKERERDRERNKDRDRDRDRDRDR---DRDK 307

Query: 102 DNEKERDH---RRRYKDDSEEDDRKRNRDR 22
           D ++ RDH   R R ++ S + DR R+R+R
Sbjct: 308 DRDRARDHSKDRSRSREKSRDRDRDRDRER 337

[104][TOP]
>UniRef100_B4LK14 GJ20184 n=1 Tax=Drosophila virilis RepID=B4LK14_DROVI
          Length = 2260

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 46/147 (31%), Positives = 71/147 (48%), Gaps = 2/147 (1%)
 Frame = -1

Query: 444  NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
            N D    D D+DN+ + D     KDD  ++ D   D NGD     D+ D DNE + D   
Sbjct: 1077 NDDDEDDDDDNDNDDDDDDNDNDKDDDNDDDDEDDDDNGDDDEDEDEDDDDNENDDDNDD 1136

Query: 264  DNDRRGNGERRHRDDDNEKERDRRGRYKD--DSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
            +ND   + +  + +DD+E + D     +D  D +E+ D   D NGD     D+ D DN+K
Sbjct: 1137 ENDEDNDNDNDNDEDDDENDEDNDDEDEDENDDDEDNDEDEDENGDDDEDDDENDNDNDK 1196

Query: 90   ERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            + D     +D+ +ED+   + D    D
Sbjct: 1197 DNDDDEDDEDNDDEDEEDEDEDEDEND 1223

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 44/143 (30%), Positives = 69/143 (48%), Gaps = 6/143 (4%)
 Frame = -1

Query: 444  NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD--- 274
            + D    + DD+N+++ D     ++D +E+ D   D NGD     D+ D DN+K+ D   
Sbjct: 1143 DNDNDNDEDDDENDEDNDDEDEDENDDDEDNDEDEDENGDDDEDDDENDNDNDKDNDDDE 1202

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEE---EFDRKRDRNGDRRHRVDDRDG 103
               DND     +    +D+N+ E D     KDD +E   E D+  D + D     DD + 
Sbjct: 1203 DDEDNDDEDEEDEDEDEDENDDEDDDIKNDKDDDDEDDDENDKDNDNDDDDNDNDDDDND 1262

Query: 102  DNEKERDHRRRYKDDSEEDDRKR 34
            DN+ + D+     DD EED  K+
Sbjct: 1263 DNDNDDDNDDDNDDDEEEDISKQ 1285

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 39/138 (28%), Positives = 66/138 (47%), Gaps = 5/138 (3%)
 Frame = -1

Query: 423  DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGN 244
            + DDDN+ E D      +D++E+ D   + N D     +D D DN+++ D  GD+D   +
Sbjct: 1129 ENDDDNDDENDEDNDNDNDNDEDDDENDEDNDDEDEDENDDDEDNDEDEDENGDDDEDDD 1188

Query: 243  GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD-----RRHRVDDRDGDNEKERDH 79
                  D DN+ + D      D+ EE+ D   D N D     +  + DD + D+E ++D+
Sbjct: 1189 ENDNDNDKDNDDDEDDEDN-DDEDEEDEDEDEDENDDEDDDIKNDKDDDDEDDDENDKDN 1247

Query: 78   RRRYKDDSEEDDRKRNRD 25
                 D+  +DD   + D
Sbjct: 1248 DNDDDDNDNDDDDNDDND 1265

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/142 (28%), Positives = 69/142 (48%), Gaps = 1/142 (0%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
            RN D    D DDD++  +D     +DD ++  D   D + +   + DD D D+E + D  
Sbjct: 1057 RNDDDNGDDDDDDDDNNKDDNDDDEDDDDDN-DNDDDDDDNDNDKDDDNDDDDEDDDDNG 1115

Query: 267  GDN-DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
             D+ D   + +    DDDN+ E D      +D++E+ D   + N D     +D D DN++
Sbjct: 1116 DDDEDEDEDDDDNENDDDNDDENDEDNDNDNDNDEDDDENDEDNDDEDEDENDDDEDNDE 1175

Query: 90   ERDHRRRYKDDSEEDDRKRNRD 25
            + D      +D +E+D   ++D
Sbjct: 1176 DEDENGDDDEDDDENDNDNDKD 1197

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 38/132 (28%), Positives = 66/132 (50%), Gaps = 1/132 (0%)
 Frame = -1

Query: 417  DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE-RDRRGDNDRRGNG 241
            DD++E E D      DD+++E D   D + D     D+ D DN+ E  D   D++     
Sbjct: 1117 DDEDEDEDDDDNENDDDNDDENDEDNDNDNDNDEDDDENDEDNDDEDEDENDDDEDNDED 1176

Query: 240  ERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKD 61
            E  + DDD + + +     KD+ ++E D   D + +     D+ + +N+ E D  +  KD
Sbjct: 1177 EDENGDDDEDDDENDNDNDKDNDDDEDD--EDNDDEDEEDEDEDEDENDDEDDDIKNDKD 1234

Query: 60   DSEEDDRKRNRD 25
            D +EDD + ++D
Sbjct: 1235 DDDEDDDENDKD 1246

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 39/134 (29%), Positives = 67/134 (50%), Gaps = 1/134 (0%)
 Frame = -1

Query: 423  DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGN 244
            D +DD++   D     +DD + E D   D N D     +D D DN+++ D   +++   +
Sbjct: 1107 DDEDDDDNGDDDEDEDEDDDDNEND---DDNDDENDEDNDNDNDNDEDDDENDEDNDDED 1163

Query: 243  GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH-RRRY 67
             +    D+DN+++ D  G   DD E++ +   D + D     DD D D+E E D      
Sbjct: 1164 EDENDDDEDNDEDEDENG---DDDEDDDENDNDNDKDNDDDEDDEDNDDEDEEDEDEDED 1220

Query: 66   KDDSEEDDRKRNRD 25
            ++D E+DD K ++D
Sbjct: 1221 ENDDEDDDIKNDKD 1234

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 41/144 (28%), Positives = 65/144 (45%), Gaps = 12/144 (8%)
 Frame = -1

Query: 420  RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK-----------ERD 274
            ++ D +K R++  R +    +E  RK  RN D     DD D DN K           + D
Sbjct: 1030 KESDVDK-REKLKRLQQTIRKERLRKHSRNDDDNGDDDDDDDDNNKDDNDDDEDDDDDND 1088

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKR-DRNGDRRHRVDDRDGDN 97
               D+D   N +    DDD+E + D     +D+ E++ D +  D N D     +D D DN
Sbjct: 1089 NDDDDDDNDNDKDDDNDDDDEDDDDNGDDDEDEDEDDDDNENDDDNDDENDEDNDNDNDN 1148

Query: 96   EKERDHRRRYKDDSEEDDRKRNRD 25
            +++ D      DD +ED+   + D
Sbjct: 1149 DEDDDENDEDNDDEDEDENDDDED 1172

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 35/128 (27%), Positives = 58/128 (45%)
 Frame = -1

Query: 408  NEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRH 229
            N+K  D  G   D+   +    ++ + D+R ++        KER R+   +   NG+   
Sbjct: 1010 NQKSNDDDG--SDEKIVKLSYPKESDVDKREKLKRLQQTIRKERLRKHSRNDDDNGDDDD 1067

Query: 228  RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEE 49
             DDDN K+ +      DD  +  D   D + D+    DD D D+E + D+    +D+ E+
Sbjct: 1068 DDDDNNKDDNDDDEDDDDDNDNDDDDDDNDNDKD---DDNDDDDEDDDDNGDDDEDEDED 1124

Query: 48   DDRKRNRD 25
            DD   N D
Sbjct: 1125 DDDNENDD 1132

[105][TOP]
>UniRef100_UPI0001A5E9E0 PREDICTED: hypothetical protein XP_002343921 n=1 Tax=Homo sapiens
           RepID=UPI0001A5E9E0
          Length = 600

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 56/157 (35%), Positives = 94/157 (59%), Gaps = 5/157 (3%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGD 292
           +R+ + + ++D    DR+ + +KER+RR R K  +E E DRKR+R  ++ RHR   RD  
Sbjct: 38  RRRGLGQAHKDADGDDRERNRQKERERR-REKRQTERETDRKRERRREKDRHR--KRDRH 94

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD-RRHRVD 115
            E++RDR  + +R+ +   R RD   EKER+R+   + ++E E +R RDR  D +R R  
Sbjct: 95  RERQRDREKERERQTD---RERDRQREKERNRQKERERETEREGERGRDRQTDGQRERER 151

Query: 114 DRDGDNEKERD---HRRRYKDDSEEDDRKRNRDRRYR 13
            RD + E+ER     R+R  + + + +R+R ++R+ R
Sbjct: 152 QRDAEKERERQTDRERQRQTERNRQKEREREKNRQER 188

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 51/153 (33%), Positives = 90/153 (58%), Gaps = 11/153 (7%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKER 277
           R+RDRR ++R+   +++R RR     ++E + +R+R+R  +R   R R  +R+ + E+ER
Sbjct: 270 RDRDRRQKERERQTDRKRQRRTERDRETERKRERQRERERERERNRKRERERERERERER 329

Query: 276 DRRGDNDRRGNGER-RHRDDDNEKERDRR----GRYKDDSEEEFDRKRDRNG--DRRHRV 118
            R  + DR    ER R R  + ++ER+R+    GR + + E E +R+RDR    +R  R 
Sbjct: 330 QRETERDREKERERKRKRQTEMDRERNRQTGREGRRQAERERERERERDRQSAREREERE 389

Query: 117 DDRDGDNEKERDHR-RRYKDDSEEDDRKRNRDR 22
            DRD D +KER+ +  + +D   E +++R R++
Sbjct: 390 RDRDRDRQKERERQTEKDRDGQRETEKQREREK 422

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 53/172 (30%), Positives = 92/172 (53%), Gaps = 23/172 (13%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           +RK    R RDR R  +R+ + + ER+R    + + ++E +R+RDR+ DR  R  +R+  
Sbjct: 223 ERKRQTDRERDRQRKTEREREKQAERERASERETERDKERERERDRDRDRDRRQKERERQ 282

Query: 291 NEKERDRRGDNDR---------------RGNGERRHRDDDNEKERDRRGRYKDDSEEEFD 157
            +++R RR + DR               R    +R R+ + E+ER+R+   + D E+E +
Sbjct: 283 TDRKRQRRTERDRETERKRERQRERERERERNRKRERERERERERERQRETERDREKERE 342

Query: 156 RKRDRNGD---RRHRVDDRDG----DNEKERDHRRRYKDDSEEDDRKRNRDR 22
           RKR R  +    R+R   R+G    + E+ER+  R  +   E ++R+R+RDR
Sbjct: 343 RKRKRQTEMDRERNRQTGREGRRQAERERERERERDRQSAREREERERDRDR 394

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 57/162 (35%), Positives = 87/162 (53%), Gaps = 10/162 (6%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 307
           R   RK   +  RDR   R R+R  + E+ER+R  + + + E E +R+R R  +R     
Sbjct: 281 RQTDRKRQRRTERDRETERKRERQRERERERERNRKRERERERERERERQRETER----- 335

Query: 306 DRDGDNEKERDRRGDNDRRGNGE-----RRHRDDDNEKERDR-RGRYKDDSEEEFDRKRD 145
           DR+ + E++R R+ + DR  N +     RR  + + E+ER+R R   ++  E E DR RD
Sbjct: 336 DREKERERKRKRQTEMDRERNRQTGREGRRQAERERERERERDRQSAREREERERDRDRD 395

Query: 144 RNGDRRHRVD-DRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           R  +R  + + DRDG  E E+  R R KD   E  R+R R+R
Sbjct: 396 RQKERERQTEKDRDGQRETEK-QREREKDRESERGRERGRER 436

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/165 (30%), Positives = 86/165 (52%), Gaps = 16/165 (9%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR-----RHR 313
           + K   +     R  +RD + E+ERDR   R R + + E + DRKR R  +R     R R
Sbjct: 242 REKQAERERASERETERDKERERERDRDRDRDRRQKERERQTDRKRQRRTERDRETERKR 301

Query: 312 VDDRDGDNEKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDR 142
              R+ + E+ER+R+ + +R    ER   R  + D EKER+R+ + + + + E +R+  R
Sbjct: 302 ERQRERERERERNRKRERERERERERERQRETERDREKERERKRKRQTEMDRERNRQTGR 361

Query: 141 NGDR-----RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            G R     R R  +RD  + +ER+ R R +D   + +R+R  ++
Sbjct: 362 EGRRQAERERERERERDRQSAREREERERDRDRDRQKERERQTEK 406

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 57/167 (34%), Positives = 89/167 (53%), Gaps = 14/167 (8%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDR-----RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD---R 322
           R  +RK   +R R+R     R R+R+ + E+ER+R+   + D E+E +RKR R  +    
Sbjct: 295 RETERKRERQRERERERERNRKRERERERERERERQRETERDREKERERKRKRQTEMDRE 354

Query: 321 RHRVDDRDGDN--EKERDRRGDNDRRGNGER----RHRDDDNEKERDRRGRYKDDSEEEF 160
           R+R   R+G    E+ER+R  + DR+   ER    R RD D +KER+R+     D + E 
Sbjct: 355 RNRQTGREGRRQAERERERERERDRQSAREREERERDRDRDRQKERERQTEKDRDGQRET 414

Query: 159 DRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           +++R+R         DR+ +  +ER  R R K    E DR+R  DR+
Sbjct: 415 EKQRERE-------KDRESERGRERG-REREKQKGRERDRERQTDRQ 453

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 53/152 (34%), Positives = 81/152 (53%), Gaps = 11/152 (7%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH---RVDDRDGDNEKE 280
           +R R+R  R+R+ + E ER R+   + D + + +R+R++  +R     R  +RD + E+E
Sbjct: 207 ERGRERE-RERETETETERKRQTDRERDRQRKTEREREKQAERERASERETERDKERERE 265

Query: 279 RDRRGDNDRRGNGERRHRDDDNEK--ERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVD 115
           RDR  D DRR     R  D   ++  ERDR    K + + E +R+R+RN  R   R R  
Sbjct: 266 RDRDRDRDRRQKERERQTDRKRQRRTERDRETERKRERQRERERERERNRKRERERERER 325

Query: 114 DRDGDNEKERD---HRRRYKDDSEEDDRKRNR 28
           +R+   E ERD    R R +    E DR+RNR
Sbjct: 326 ERERQRETERDREKERERKRKRQTEMDRERNR 357

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 48/156 (30%), Positives = 77/156 (49%), Gaps = 13/156 (8%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKE 280
           ++ R+RR   R  + E +R R  R + D   + DR R+R  DR   R R  DR+ D ++E
Sbjct: 59  QKERERRREKRQTERETDRKRERRREKDRHRKRDRHRERQRDREKERERQTDRERDRQRE 118

Query: 279 RDRRGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR----- 130
           ++R    +R    ER     R R  D ++ER+R+   + + E + DR+R R  +R     
Sbjct: 119 KERNRQKERERETEREGERGRDRQTDGQRERERQRDAEKERERQTDRERQRQTERNRQKE 178

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           R R  +R    E+ER   +  K +    +R R R+R
Sbjct: 179 REREKNRQERRERERQREKENKTEDRHSERGRERER 214

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 48/169 (28%), Positives = 87/169 (51%), Gaps = 12/169 (7%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDRRYRDRDDDN--EKERDRRGRYKDDSEEEFDRKRDRNGD------- 325
           R  +R+   +R ++ +  DR  +   E+ER+R    + + + + DR+RDR          
Sbjct: 185 RQERRERERQREKENKTEDRHSERGRERERERETETETERKRQTDRERDRQRKTEREREK 244

Query: 324 --RRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK 151
              R R  +R+ + +KER+R  D DR    +R  R  + E++ DR+ + + + + E +RK
Sbjct: 245 QAERERASERETERDKERERERDRDR----DRDRRQKERERQTDRKRQRRTERDRETERK 300

Query: 150 RDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
           R+R  +R R R  +R  + E+ER+  R  + ++E D  K    +R R T
Sbjct: 301 RERQRERERERERNRKRERERERERERERQRETERDREKERERKRKRQT 349

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 54/166 (32%), Positives = 91/166 (54%), Gaps = 22/166 (13%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKER 277
           +R  DR R R R+ D  ++RDR    + D E+E +R+ DR  DR R +  +R  + E+E 
Sbjct: 72  ERETDRKRERRREKDRHRKRDRHRERQRDREKERERQTDRERDRQREKERNRQKERERET 131

Query: 276 DRRGD--NDRRGNGER-RHRDDDNEKERDR-----------RGRYKDDSEE---EFDRKR 148
           +R G+   DR+ +G+R R R  D EKER+R           R R K+   E   +  R+R
Sbjct: 132 EREGERGRDRQTDGQRERERQRDAEKERERQTDRERQRQTERNRQKEREREKNRQERRER 191

Query: 147 DRNGDRRHRVDDRDGDNEKERDHRRRYKDDSE---EDDRKRNRDRR 19
           +R  ++ ++ +DR  +  +ER+  R  + ++E   + DR+R+R R+
Sbjct: 192 ERQREKENKTEDRHSERGRERERERETETETERKRQTDRERDRQRK 237

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 69/207 (33%), Positives = 103/207 (49%), Gaps = 51/207 (24%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDR-----RYRDRDDDNEKERDR-------------RGRYKD---DSE 361
           R   RK   +R +DR     R+R+R  D EKER+R             R R K+   ++E
Sbjct: 73  RETDRKRERRREKDRHRKRDRHRERQRDREKERERQTDRERDRQREKERNRQKERERETE 132

Query: 360 EEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER---------RHRDDDNEK 208
            E +R RDR  D + R  +R  D EKER+R+ D +R+   ER         ++R +  E+
Sbjct: 133 REGERGRDRQTDGQ-RERERQRDAEKERERQTDRERQRQTERNRQKEREREKNRQERRER 191

Query: 207 ERDR------------RGRYKD---DSEEEFDRKR--DRNGDRRHRVD-DRDGDNEKERD 82
           ER R            RGR ++   ++E E +RKR  DR  DR+ + + +R+   E+ER 
Sbjct: 192 ERQREKENKTEDRHSERGRERERERETETETERKRQTDRERDRQRKTEREREKQAERERA 251

Query: 81  HRRRYKDDSE---EDDRKRNRDRRYRD 10
             R  + D E   E DR R+RDRR ++
Sbjct: 252 SERETERDKERERERDRDRDRDRRQKE 278

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 49/159 (30%), Positives = 80/159 (50%), Gaps = 18/159 (11%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDNEKERDRR 268
           R RDR  D ++ER+R+   + + E + DR+R R  +R     R R  +R    E+ER R 
Sbjct: 137 RGRDRQTDGQRERERQRDAEKERERQTDRERQRQTERNRQKEREREKNRQERRERERQRE 196

Query: 267 GDN------DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR------- 127
            +N        RG    R R+ + E ER R+   + D + + +R+R++  +R        
Sbjct: 197 KENKTEDRHSERGRERERERETETETERKRQTDRERDRQRKTEREREKQAERERASERET 256

Query: 126 HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            R  +R+ + +++RD  RR K+   + DRKR R R  RD
Sbjct: 257 ERDKERERERDRDRDRDRRQKERERQTDRKRQR-RTERD 294

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 51/160 (31%), Positives = 85/160 (53%), Gaps = 11/160 (6%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRY-RDRDDDNEKERDRRGRYKDDSEEEFDRK-RDRNGDR-RHRVDDRD 298
           +R+    R R R+  R+R  + E+E++R+ R + + + E + K  DR+ +R R R  +R+
Sbjct: 158 ERERQTDRERQRQTERNRQKEREREKNRQERRERERQREKENKTEDRHSERGRERERERE 217

Query: 297 GDNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 121
            + E ER R+ D +R R     R R+   E+ER      + D E E +R RDR+ DRR +
Sbjct: 218 TETETERKRQTDRERDRQRKTEREREKQAERERASERETERDKERERERDRDRDRDRRQK 277

Query: 120 VDDRDGDNEKER-------DHRRRYKDDSEEDDRKRNRDR 22
             +R  D +++R         R+R +    E +R+RNR R
Sbjct: 278 ERERQTDRKRQRRTERDRETERKRERQRERERERERNRKR 317

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 49/161 (30%), Positives = 90/161 (55%), Gaps = 12/161 (7%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDD---- 304
           +R+   +RNR +  R+R+ + ++ R+R R R K++  E+   +R R  +R    +     
Sbjct: 166 ERQRQTERNRQKE-REREKNRQERRERERQREKENKTEDRHSERGRERERERETETETER 224

Query: 303 -RDGDNEKERDRRGDNDRRGNGERRH---RDDDNEKERDR---RGRYKDDSEEEFDRKRD 145
            R  D E++R R+ + +R    ER     R+ + +KER+R   R R +D  ++E +R+ D
Sbjct: 225 KRQTDRERDRQRKTEREREKQAERERASERETERDKERERERDRDRDRDRRQKERERQTD 284

Query: 144 RNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           R   +R R  +RD + E++R+ R+R ++   E +RKR R+R
Sbjct: 285 R---KRQRRTERDRETERKRE-RQRERERERERNRKRERER 321

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 54/154 (35%), Positives = 78/154 (50%), Gaps = 27/154 (17%)
 Frame = -1

Query: 465 RKMIWKRNRDR---RYRDRDDDNEKERDRR------------------GRYKDDSEEEFD 349
           RK   +R R+R   R R+ + D EKER+R+                  GR + + E E +
Sbjct: 315 RKRERERERERERERQRETERDREKERERKRKRQTEMDRERNRQTGREGRRQAERERERE 374

Query: 348 RKRDRNG--DRRHRVDDRDGDNEKERDRRGDNDRRGNGE---RRHRDDDNEKERDR-RGR 187
           R+RDR    +R  R  DRD D +KER+R+ + DR G  E   +R R+ D E ER R RGR
Sbjct: 375 RERDRQSAREREERERDRDRDRQKERERQTEKDRDGQRETEKQREREKDRESERGRERGR 434

Query: 186 YKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
              + E++  R+RD     R R  DR    +++R
Sbjct: 435 ---EREKQKGRERD-----RERQTDRQAGRQRKR 460

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 44/145 (30%), Positives = 76/145 (52%), Gaps = 9/145 (6%)
 Frame = -1

Query: 426 RDRDDDNEKERDRR-GRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRR 250
           R R    E  R R  G+   D++ + DR+R+R  +R  R + R    E+E DR+ +  RR
Sbjct: 28  RRRPGSQESPRRRGLGQAHKDADGD-DRERNRQKERERRREKRQ--TERETDRKRER-RR 83

Query: 249 GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERD- 82
                R RD   E++RDR    +  ++ E DR+R++  +R   R R  +R+G+  ++R  
Sbjct: 84  EKDRHRKRDRHRERQRDREKERERQTDRERDRQREKERNRQKERERETEREGERGRDRQT 143

Query: 81  ----HRRRYKDDSEEDDRKRNRDRR 19
                R R +D  +E +R+ +R+R+
Sbjct: 144 DGQRERERQRDAEKERERQTDRERQ 168

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 5/104 (4%)
 Frame = -1

Query: 303 RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-R 127
           R G  E  R RRG      + +   R+ + +KER+RR R K  +E E DRKR+R  ++ R
Sbjct: 30  RPGSQESPR-RRGLGQAHKDADGDDRERNRQKERERR-REKRQTERETDRKRERRREKDR 87

Query: 126 HRVDDRDGDNEKERDHRRRYKDDSEED---DRKRNRDR-RYRDT 7
           HR  DR  + +++R+  R  + D E D   +++RNR + R R+T
Sbjct: 88  HRKRDRHRERQRDREKERERQTDRERDRQREKERNRQKERERET 131

[106][TOP]
>UniRef100_Q54XF1 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum
            RepID=Q54XF1_DICDI
          Length = 775

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 59/151 (39%), Positives = 81/151 (53%), Gaps = 4/151 (2%)
 Frame = -1

Query: 444  NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
            +RDR  RDRD D EK+RDR    + D + ++   RDR+ DR     DRD D+ +E+DR  
Sbjct: 587  SRDRD-RDRDRDREKDRDRERERERDRDRDYKDSRDRDRDR-----DRDRDSNREKDR-- 638

Query: 264  DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
              DR      R RD D E+ERDR   YKD S     R R+ + D R   D +D  +   +
Sbjct: 639  --DRDYKDRDRERDRDRERERDRDRDYKDSSSRS-GRDRENDRDSRDGRDSKDNRDRDSK 695

Query: 84   DHRRRYKDDSEED-DRKRNR---DRRYRDTS 4
            D+R R  + S  D D  R+R   DR Y+D++
Sbjct: 696  DNRSRDSNRSSSDRDSGRSRGSSDRDYKDSN 726

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 52/146 (35%), Positives = 80/146 (54%), Gaps = 2/146 (1%)
 Frame = -1

Query: 435 RRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD-N 259
           + Y + + D + E + +  YKD S    DR RDR+ DR     DRD + E+ERDR  D  
Sbjct: 564 KEYNNENKDRKYESNTKSDYKDGSR---DRDRDRDRDREK---DRDRERERERDRDRDYK 617

Query: 258 DRRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 82
           D R     R RD D+ +E+DR   YKD D E + DR+R+R+ DR ++        ++E D
Sbjct: 618 DSRDRDRDRDRDRDSNREKDRDRDYKDRDRERDRDRERERDRDRDYKDSSSRSGRDREND 677

Query: 81  HRRRYKDDSEEDDRKRNRDRRYRDTS 4
              R   DS+++  + ++D R RD++
Sbjct: 678 RDSRDGRDSKDNRDRDSKDNRSRDSN 703

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 52/151 (34%), Positives = 76/151 (50%), Gaps = 9/151 (5%)
 Frame = -1

Query: 435 RRYRDRDDDNEKERDRRGRY-KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDN 259
           ++Y ++    +++   RG Y K+ + E  DRK + N    ++   RD D +++RDR  D 
Sbjct: 543 QQYYEQQQQQQQQYYGRGGYTKEYNNENKDRKYESNTKSDYKDGSRDRDRDRDRDREKDR 602

Query: 258 DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR--------RHRVDDRDG 103
           DR           + E+ERDR   YKD  + + DR RDR+ +R        + R  +RD 
Sbjct: 603 DR-----------ERERERDRDRDYKDSRDRDRDRDRDRDSNREKDRDRDYKDRDRERDR 651

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           D E+ERD  R YKD S    R R  DR  RD
Sbjct: 652 DRERERDRDRDYKDSSSRSGRDRENDRDSRD 682

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 54/149 (36%), Positives = 71/149 (47%), Gaps = 11/149 (7%)
 Frame = -1

Query: 450  KRNRDRRY---------RDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDR 301
            +R+RDR Y         RDRD D+ +E+DR   YKD D E + DR+R+R+ DR    D +
Sbjct: 609  ERDRDRDYKDSRDRDRDRDRDRDSNREKDRDRDYKDRDRERDRDRERERDRDR----DYK 664

Query: 300  DGDNEKERDRRGDNDRR-GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
            D  +   RDR  D D R G   + +RD D+   +D R R  + S  + D  R R    R 
Sbjct: 665  DSSSRSGRDRENDRDSRDGRDSKDNRDRDS---KDNRSRDSNRSSSDRDSGRSRGSSDR- 720

Query: 123  RVDDRDGDNEKERDHRRRYKDDSEEDDRK 37
               D    N KERD   R    S   D K
Sbjct: 721  ---DYKDSNGKERDSSYRSSSSSSSHDSK 746

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 50/142 (35%), Positives = 67/142 (47%), Gaps = 17/142 (11%)
 Frame = -1

Query: 450  KRNRDRRYRD----RDDDNEKERDRRGRYKDDSEEE-FDRKRDRNG-DRRHRVDDRDGDN 289
            +++RDR Y+D    RD D E+ERDR   YKD S     DR+ DR+  D R   D+RD D+
Sbjct: 635  EKDRDRDYKDRDRERDRDRERERDRDRDYKDSSSRSGRDRENDRDSRDGRDSKDNRDRDS 694

Query: 288  EKERDR---RGDNDR-----RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN-- 139
            +  R R   R  +DR     RG+ +R ++ D N KERD   R    S     + R+ N  
Sbjct: 695  KDNRSRDSNRSSSDRDSGRSRGSSDRDYK-DSNGKERDSSYRSSSSSSSHDSKYRENNNS 753

Query: 138  -GDRRHRVDDRDGDNEKERDHR 76
             G          G     RD R
Sbjct: 754  SGSSSTSSSSGSGSGRSSRDRR 775

[107][TOP]
>UniRef100_B3RQ53 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens
           RepID=B3RQ53_TRIAD
          Length = 1016

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 55/160 (34%), Positives = 91/160 (56%), Gaps = 16/160 (10%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKER---DRRGRYKDD--SEEEFDRK-RDRNGDRRHR-------- 313
           +R+RDR+YR+++   + E    D R R++ +  S E  DR+ +DR+ DRR          
Sbjct: 207 RRDRDRKYREKEQKKQSEELKDDHRPRHRIERPSHEGVDRQDKDRSRDRRRHHSKEGGSE 266

Query: 312 -VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERD-RRGRYKDDSEEEFDRKRDRN 139
             D  + D +KER RR + +      RR R ++ E+E++ RR R K+++EEE        
Sbjct: 267 IQDKENRDEDKERHRRHETEEEREEHRRRRKEETEEEKEERRRRRKEETEEE-------R 319

Query: 138 GDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            +RR R  +R+  +E++ +HRRR KD++EE+  +R R RR
Sbjct: 320 AERRRRRHEREQADEEKDEHRRRRKDETEEEREERRRKRR 359

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 51/173 (29%), Positives = 93/173 (53%), Gaps = 29/173 (16%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKE-RDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN----E 286
           K++RD R+R R++ ++++ R  +  Y +D++ + DRK+  + + RHR   RDG +     
Sbjct: 86  KKDRDERHRSRENRHDRKIRQTKDDYGEDAKHDRDRKKKDDNEERHRERKRDGKDADRER 145

Query: 285 KERDRRG-----------------DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFD 157
           K RD +G                 D++R+    RRH++D++  ER  R     + +E  D
Sbjct: 146 KHRDDKGDSHDRHRSSRSTANNQDDSERKLESSRRHKEDNHSIERPERHPRPSEDKEARD 205

Query: 156 RKRDRNGDRRHRVDDRDGDNEK-ERDHRRRYK------DDSEEDDRKRNRDRR 19
           R+RDR  DR++R  ++   +E+ + DHR R++      +  +  D+ R+RDRR
Sbjct: 206 RRRDR--DRKYREKEQKKQSEELKDDHRPRHRIERPSHEGVDRQDKDRSRDRR 256

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 56/190 (29%), Positives = 89/190 (46%), Gaps = 44/190 (23%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           R+R  R R+ DDD  K   R  R ++  +   D++++R+    HR   R+    +E + +
Sbjct: 29  RHRSERRRNHDDD--KGSSRHARKEEGGQVGDDKRKERHDRPEHRDKHREAREGREHESK 86

Query: 267 GDNDRRGNG-ERRH-------RDDDNEKER-DRRGRYKDDSEEEF-DRKR---DRNGDRR 127
            D D R    E RH       +DD  E  + DR  + KDD+EE   +RKR   D + +R+
Sbjct: 87  KDRDERHRSRENRHDRKIRQTKDDYGEDAKHDRDRKKKDDNEERHRERKRDGKDADRERK 146

Query: 126 HRVDDRDG---------------DNEKERDHRRRYKDDS----------------EEDDR 40
           HR D  D                D+E++ +  RR+K+D+                E  DR
Sbjct: 147 HRDDKGDSHDRHRSSRSTANNQDDSERKLESSRRHKEDNHSIERPERHPRPSEDKEARDR 206

Query: 39  KRNRDRRYRD 10
           +R+RDR+YR+
Sbjct: 207 RRDRDRKYRE 216

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 43/152 (28%), Positives = 75/152 (49%), Gaps = 10/152 (6%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           R+RDRR     +   + +D+  R +D +     + + +R   RR R ++ + + E+ R R
Sbjct: 251 RSRDRRRHHSKEGGSEIQDKENRDEDKERHRRHETEEEREEHRRRRKEETEEEKEERRRR 310

Query: 270 RGDNDRRGNGERRHR-----DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
           R +       ERR R       D EK+  RR R KD++EEE + +R +  + R R  +  
Sbjct: 311 RKEETEEERAERRRRRHEREQADEEKDEHRR-RRKDETEEEREERRRKRREEREREKEHI 369

Query: 105 GDNEKERDHRRRYKDDSEE----DDRKRNRDR 22
            + E   DHR R +++  E    +D  +++DR
Sbjct: 370 HEGE---DHRHRNRNEQPEGEAIEDYTKHKDR 398

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 44/173 (25%), Positives = 74/173 (42%), Gaps = 27/173 (15%)
 Frame = -1

Query: 450 KRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
           K NRD    R+R  + + E+E  RR R K+++EEE + +R R   R+   ++   +  + 
Sbjct: 270 KENRDEDKERHRRHETEEEREEHRRRR-KEETEEEKEERRRR---RKEETEEERAERRRR 325

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           R  R   D   +  RR R D+ E+ER+ R R + +  E          D RHR  +   +
Sbjct: 326 RHEREQADEEKDEHRRRRKDETEEEREERRRKRREEREREKEHIHEGEDHRHRNRNEQPE 385

Query: 99  NEKERDH------------------------RRRYKDDSEEDDRKRNRDRRYR 13
            E   D+                        RR Y   ++ DD+K ++++  R
Sbjct: 386 GEAIEDYTKHKDRPDRPKEAGSKRTIITEKERRAYMALNDSDDQKTDKEKELR 438

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 44/137 (32%), Positives = 61/137 (44%), Gaps = 13/137 (9%)
 Frame = -1

Query: 381 RYKDDSEEEFDRKRDRNG--------DRRHRVDDRDGDNEKERDRRG----DNDRRGNGE 238
           R K+D+ +E D KR   G        +RR   DD  G +   R   G    D+ R+   +
Sbjct: 7   RTKEDTWKEDDLKRAIKGKDEGRHRSERRRNHDDDKGSSRHARKEEGGQVGDDKRKERHD 66

Query: 237 R-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKD 61
           R  HRD   E    R    K D +E   R R+   DR+ R    D   + + D  R+ KD
Sbjct: 67  RPEHRDKHREAREGREHESKKDRDERH-RSRENRHDRKIRQTKDDYGEDAKHDRDRKKKD 125

Query: 60  DSEEDDRKRNRDRRYRD 10
           D+EE  R+R RD +  D
Sbjct: 126 DNEERHRERKRDGKDAD 142

[108][TOP]
>UniRef100_C7YUC7 Putative uncharacterized protein n=1 Tax=Nectria haematococca mpVI
            77-13-4 RepID=C7YUC7_NECH7
          Length = 878

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 58/148 (39%), Positives = 84/148 (56%), Gaps = 4/148 (2%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            +R+R R R R RD D +++RDR      ++  E +R+RDR+ D R R  DR GD  ++RD
Sbjct: 743  RRSRSRSRSRQRDRDKDRDRDR------ETVRERERERDRDKDNRERDRDR-GDTYRQRD 795

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
               D DR  + +RR RD + +++RDR   R R +D   E  DR+RDR+ DR     DR+ 
Sbjct: 796  M--DRDRERDRDRRDRDRERDRDRDRSRDRDRDRDRDRERRDRERDRDRDRDR---DRER 850

Query: 102  DNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            D  ++R +RR        D R R+R RR
Sbjct: 851  DRSRDRRNRRDRSLSPRRDRRDRSRSRR 878

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 59/144 (40%), Positives = 78/144 (54%), Gaps = 8/144 (5%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR-------RYRDRDDDN-EKERDRRGRYKDDSEEEFDRKRDRNGDR 322
            R  QR     R+RDR       R RDRD DN E++RDR   Y+   + + DR R+R+ DR
Sbjct: 750  RSRQRDRDKDRDRDRETVRERERERDRDKDNRERDRDRGDTYR---QRDMDRDRERDRDR 806

Query: 321  RHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR 142
            R R  +RD D ++ RDR  D DR  + ERR R+ D +++RDR            DR+RDR
Sbjct: 807  RDRDRERDRDRDRSRDR--DRDRDRDRERRDRERDRDRDRDR------------DRERDR 852

Query: 141  NGDRRHRVDDRDGDNEKERDHRRR 70
            + DRR+R   RD      RD R R
Sbjct: 853  SRDRRNR---RDRSLSPRRDRRDR 873

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 65/164 (39%), Positives = 87/164 (53%), Gaps = 12/164 (7%)
 Frame = -1

Query: 465  RKMIWKRNRDRRYRDRDDDNEK------ERDRRGRYKDDSEEEFDRKRDRNGDR-----R 319
            +K   +R+ D R R   DD ++      E  RR R +  S +  DR +DR+ DR     R
Sbjct: 712  KKSSGERSPDLRRRWNMDDIDRYTPGGREERRRSRSRSRSRQR-DRDKDRDRDRETVRER 770

Query: 318  HRVDDRDGDNEKERDR-RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR 142
             R  DRD DN +ERDR RGD  R+     R  D D E++RDRR     D + E DR RDR
Sbjct: 771  ERERDRDKDN-RERDRDRGDTYRQ-----RDMDRDRERDRDRR-----DRDRERDRDRDR 819

Query: 141  NGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            + DR     DRD D ++ER  R R +D   + DR+R+R R  R+
Sbjct: 820  SRDR-----DRDRDRDRERRDRERDRDRDRDRDRERDRSRDRRN 858

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 52/143 (36%), Positives = 74/143 (51%), Gaps = 5/143 (3%)
 Frame = -1

Query: 423  DRDDDNEKERDRRGRYKDDSEEEFD---RKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
            D+    E+  D R R+  D  + +    R+  R    R R   RD D +++RDR    +R
Sbjct: 711  DKKSSGERSPDLRRRWNMDDIDRYTPGGREERRRSRSRSRSRQRDRDKDRDRDRETVRER 770

Query: 252  RGNGERRHRDDDN-EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHR 76
                  R RD DN E++RDR   Y+   + + DR R+R+ DRR R  +RD D ++ RD  
Sbjct: 771  E---RERDRDKDNRERDRDRGDTYR---QRDMDRDRERDRDRRDRDRERDRDRDRSRDRD 824

Query: 75   RRYKDDSEEDDRKRNRDR-RYRD 10
            R    D E  DR+R+RDR R RD
Sbjct: 825  RDRDRDRERRDRERDRDRDRDRD 847

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 40/126 (31%), Positives = 61/126 (48%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDN 259
           ++R   R++  ++ER+R        EE  +R+R R  +R  R   RD + EK    R   
Sbjct: 188 EKRRIAREERKKEEREREKAELKRQEERDERRRKREQEREERERQRDLEREKRHKEREQR 247

Query: 258 DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH 79
           DR  + ER  RD D +++R+R          E  R RDR+ DRR        D ++ RD 
Sbjct: 248 DRERDREREPRDRDRDRDRER----------ERSRDRDRDRDRR--------DRDRHRDD 289

Query: 78  RRRYKD 61
           RR+ K+
Sbjct: 290 RRKEKE 295

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 43/162 (26%), Positives = 75/162 (46%), Gaps = 3/162 (1%)
 Frame = -1

Query: 486 VGIRMIQRKMIWKRNRDRRYRDRDDDNEKERDRRG---RYKDDSEEEFDRKRDRNGDRRH 316
           VG    Q + +     D  Y    +    ER+R     R K+ + EE +++R    +R+ 
Sbjct: 141 VGEETAQAEQVRGSKTDEEYAADTEARRAERERLREELRQKELAIEE-EKRRIAREERKK 199

Query: 315 RVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
              +R+    K ++ R +  R+   ER  R+   + ER++R + ++        +RDR  
Sbjct: 200 EEREREKAELKRQEERDERRRKREQEREERERQRDLEREKRHKERE--------QRDRER 251

Query: 135 DRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           DR     DRD D ++ER+  R    D +  DR R+RD R ++
Sbjct: 252 DREREPRDRDRDRDRERERSRDRDRDRDRRDRDRHRDDRRKE 293

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 37/103 (35%), Positives = 54/103 (52%), Gaps = 4/103 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRD---DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
           +  RD R R R+   ++ E++RD     +    E+ DR+RDR  + R R  DRD D E+E
Sbjct: 212 QEERDERRRKREQEREERERQRDLEREKRHKEREQRDRERDREREPRDR--DRDRDRERE 269

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDD-SEEEFDR 154
           R R  D DR      RHRDD  +++       K+  S+EE +R
Sbjct: 270 RSRDRDRDRDRRDRDRHRDDRRKEKEAVSAELKEKLSKEEHER 312

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 46/131 (35%), Positives = 63/131 (48%), Gaps = 10/131 (7%)
 Frame = -1

Query: 372  DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRR 193
            DD +   +R  D    RR  +DD D      R+ R    RR     R R  D +K+RDR 
Sbjct: 710  DDKKSSGERSPDLR--RRWNMDDIDRYTPGGREER----RRSRSRSRSRQRDRDKDRDR- 762

Query: 192  GRYKDDSEEEFDRKRDRNGDRRHRVDDRDG---------DNEKERDHRRRYKDDSEEDDR 40
                 D E   +R+R+R+ D+ +R  DRD          D ++ERD  RR +D   + DR
Sbjct: 763  -----DRETVRERERERDRDKDNRERDRDRGDTYRQRDMDRDRERDRDRRDRDRERDRDR 817

Query: 39   KRNRDR-RYRD 10
             R+RDR R RD
Sbjct: 818  DRSRDRDRDRD 828

[109][TOP]
>UniRef100_B2AS36 Predicted CDS Pa_1_22200 n=1 Tax=Podospora anserina
           RepID=B2AS36_PODAN
          Length = 398

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 61/166 (36%), Positives = 82/166 (49%), Gaps = 13/166 (7%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR---- 301
           ++K   K NR  R R   D + + R R  + K D +E  DR +DR  +R     DR    
Sbjct: 220 EKKKEEKHNRKHRERREKDKDREHRHRSHKSKRDEDEREDRHQDRRQERIEDDPDRKRRR 279

Query: 300 ----DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD 133
                G N+KE+DR G  D   +  RR  D      RDR  R   D   + D +RDR+ D
Sbjct: 280 DMSPSGGNDKEKDRDGRRDGHRDEARRISD-----RRDRDVRRDRDVRRDRDDRRDRD-D 333

Query: 132 RRHRVDDRDGDNEKER-----DHRRRYKDDSEEDDRKRNRDRRYRD 10
           RR R D RD D+  +R     D RR   D  + DDR+++RDRR+RD
Sbjct: 334 RRDRDDGRDRDDRPDRGRDRADERRPKDDRGDGDDRRKDRDRRHRD 379

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 57/146 (39%), Positives = 81/146 (55%), Gaps = 4/146 (2%)
 Frame = -1

Query: 447 RNRDRRYR--DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR-DGDNEKER 277
           R++DRR    + D D ++ RD      +D E++ D +RD + D   R+ DR D D  ++R
Sbjct: 260 RHQDRRQERIEDDPDRKRRRDMSPSGGNDKEKDRDGRRDGHRDEARRISDRRDRDVRRDR 319

Query: 276 D-RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           D RR  +DRR   +RR RDD         GR +DD     DR RDR  +RR + D  DGD
Sbjct: 320 DVRRDRDDRRDRDDRRDRDD---------GRDRDDRP---DRGRDRADERRPKDDRGDGD 367

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDR 22
            ++ +D  RR++DD   DDR+R R R
Sbjct: 368 -DRRKDRDRRHRDD---DDRRRRRSR 389

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 53/169 (31%), Positives = 83/169 (49%), Gaps = 17/169 (10%)
 Frame = -1

Query: 465 RKMIWKRNRDRRY--RDRDDDN----------EKERDRRGRYKDDSEEEFDRK----RDR 334
           R+ + K  R+ +   +D DDD+          +KE D   R +   EE+ +RK    R++
Sbjct: 178 RRAMLKEERELQLLIQDHDDDDPMKEFLIEEKKKEVDEALRREKKKEEKHNRKHRERREK 237

Query: 333 NGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDR 154
           + DR HR   R   ++++ D R D  +    ER   D D ++ RD      +D E++ D 
Sbjct: 238 DKDREHR--HRSHKSKRDEDEREDRHQDRRQERIEDDPDRKRRRDMSPSGGNDKEKDRDG 295

Query: 153 KRDRNGDRRHRVDD-RDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           +RD + D   R+ D RD D  ++RD RR   D  + DDR+   D R RD
Sbjct: 296 RRDGHRDEARRISDRRDRDVRRDRDVRRDRDDRRDRDDRRDRDDGRDRD 344

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 42/104 (40%), Positives = 57/104 (54%), Gaps = 5/104 (4%)
 Frame = -1

Query: 483 GIRMIQRKMIWKRNRD-RRYRD--RDDDNEKERDRRGRYKD--DSEEEFDRKRDRNGDRR 319
           G R   R++  +R+RD RR RD  RD D+ ++RD R    D  D ++  DR RDR  +RR
Sbjct: 299 GHRDEARRISDRRDRDVRRDRDVRRDRDDRRDRDDRRDRDDGRDRDDRPDRGRDRADERR 358

Query: 318 HRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGR 187
            + D  DGD           DRR + +RRHRDDD+ + R  R R
Sbjct: 359 PKDDRGDGD-----------DRRKDRDRRHRDDDDRRRRRSRSR 391

[110][TOP]
>UniRef100_B0XQY4 Arginine rich protein n=2 Tax=Aspergillus fumigatus
           RepID=B0XQY4_ASPFC
          Length = 789

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 69/166 (41%), Positives = 87/166 (52%), Gaps = 21/166 (12%)
 Frame = -1

Query: 453 WKRNRDR-RYRDRDDDNEKERDR-RGRYKDDSEEEFD-RKRDRNGDR-RHRVDDRDGDNE 286
           + R+RDR R RDR  + EK+R R R R  D+ E + D R RDR+ DR R R  DRD D E
Sbjct: 511 YDRDRDRSRGRDRSAEREKDRARDRSRLTDERERDRDHRTRDRSRDRDRERERDRDRDRE 570

Query: 285 KERDRRGDNDRRGNGER----------------RHRDDDNEK-ERDRRGRYKDDSEEEFD 157
           +ERDR  D  RR    R                R R+ D  + ERDRRGR +  S     
Sbjct: 571 RERDRNRDYRRRSYYSRSRSRARRGRSRSVSRARDRNQDRTRDERDRRGRSRSAS----- 625

Query: 156 RKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           R RDR  D R R  DR+ D E+ RD + R++D  +E  R R  DR+
Sbjct: 626 RARDRTRDERDR--DRERDRERNRD-QERHRDGDKEQGRVREGDRK 668

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 64/166 (38%), Positives = 80/166 (48%), Gaps = 19/166 (11%)
 Frame = -1

Query: 450 KRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRN-------GDRRHRVDDR 301
           +R+R R   R  DRD D  + RDR       +E E DR RDR+        DR HR  DR
Sbjct: 500 RRSRSRSTGRGYDRDRDRSRGRDR------SAEREKDRARDRSRLTDERERDRDHRTRDR 553

Query: 300 DGDNEKERDRRGDNDR-----RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
             D ++ER+R  D DR     R    RR       + R RRGR +  S     R RDRN 
Sbjct: 554 SRDRDRERERDRDRDRERERDRNRDYRRRSYYSRSRSRARRGRSRSVS-----RARDRNQ 608

Query: 135 DRRHRVDDRDGDN---EKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
           DR     DR G +    + RD  R  +D   E DR+RNRD+ R+RD
Sbjct: 609 DRTRDERDRRGRSRSASRARDRTRDERDRDRERDRERNRDQERHRD 654

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 63/156 (40%), Positives = 76/156 (48%), Gaps = 12/156 (7%)
 Frame = -1

Query: 435 RRYRDR-DDDNEKERDR------RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           RRY  R DDD  +ER R      R R  DD     D + +R GDR +R + R       R
Sbjct: 450 RRYTPRFDDDRRRERSRDASSRPRDRNPDDRVAIRDFRANRYGDRSYRPNRRSRSRSTGR 509

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDR---RGRYKDDSEEEFD-RKRDRNGDR-RHRVDD 112
               D DR      R RD   E+E+DR   R R  D+ E + D R RDR+ DR R R  D
Sbjct: 510 GYDRDRDR-----SRGRDRSAEREKDRARDRSRLTDERERDRDHRTRDRSRDRDRERERD 564

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           RD D E+ERD  R Y+  S    R R+R RR R  S
Sbjct: 565 RDRDRERERDRNRDYRRRSYY-SRSRSRARRGRSRS 599

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 59/147 (40%), Positives = 75/147 (51%), Gaps = 7/147 (4%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR--HRVDDRDGDNEK-E 280
           R+RDR R RDRD D E+ERDR   Y+  S     R R R G  R   R  DR+ D  + E
Sbjct: 555 RDRDRERERDRDRDRERERDRNRDYRRRSYYSRSRSRARRGRSRSVSRARDRNQDRTRDE 614

Query: 279 RDRRGDNDRRGNGERRHRDD-DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH-RVDDRD 106
           RDRRG +        R RD+ D ++ERDR        E   D++R R+GD+   RV  R+
Sbjct: 615 RDRRGRSRSASRARDRTRDERDRDRERDR--------ERNRDQERHRDGDKEQGRV--RE 664

Query: 105 GDNEKERDH-RRRYKDDSEEDDRKRNR 28
           GD + ER   R R  + S    R R R
Sbjct: 665 GDRKDERGRSRSRIPNPSRRPSRSRRR 691

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 59/158 (37%), Positives = 75/158 (47%), Gaps = 13/158 (8%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR---VDDRDGDNEKERD 274
           +R R YR RD   E+ R RR RY    +++  R+R R+   R R    DDR    +   +
Sbjct: 432 DRHRPYR-RDGSRERSRSRR-RYTPRFDDDRRRERSRDASSRPRDRNPDDRVAIRDFRAN 489

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDS-EEEFDRKRDRNG-------DRRHR 121
           R GD   R N   R R      +RDR R R +D S E E DR RDR+        DR HR
Sbjct: 490 RYGDRSYRPNRRSRSRSTGRGYDRDRDRSRGRDRSAEREKDRARDRSRLTDERERDRDHR 549

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
             DR  D ++ER+  R         DR R R+R R RD
Sbjct: 550 TRDRSRDRDRERERDR---------DRDRERERDRNRD 578

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 50/151 (33%), Positives = 76/151 (50%), Gaps = 3/151 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R  +   + R+ + +KE + R R K+  EE+   +R+R  +   R++++    EKER  
Sbjct: 199 RRKAEEERKKREIERQKEEEERARRKE-REEQRRAERERQREEERRLEEQ---REKERQE 254

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
           R +  RR   ER +RD D  ++RDR            DR RDR+ DR     DRD D ++
Sbjct: 255 RYERRRREERER-YRDWDRSRDRDR--------SRTRDRDRDRDRDR-----DRDRDRDR 300

Query: 90  ERDHRRRYKDDSEEDDRKRN---RDRRYRDT 7
           +RD  R Y       DR R+   R  RYRD+
Sbjct: 301 DRDRERDY-------DRPRSIGYRSPRYRDS 324

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 56/186 (30%), Positives = 85/186 (45%), Gaps = 39/186 (20%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR----------RYRDRDDDNEK-ERDRRGRYK------DDSEEEFD 349
            R  +R+  + R+R R          R RDR+ D  + ERDRRGR +      D + +E D
Sbjct: 577  RDYRRRSYYSRSRSRARRGRSRSVSRARDRNQDRTRDERDRRGRSRSASRARDRTRDERD 636

Query: 348  RKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSE 169
            R R+R+ +R +R  +R  D +KE+ R  + DR+    R      N   R  R R +  S 
Sbjct: 637  RDRERDRER-NRDQERHRDGDKEQGRVREGDRKDERGRSRSRIPNPSRRPSRSRRRSPST 695

Query: 168  EEFD-------------RKRDRNGDRRHRVDDRDG---------DNEKERDHRRRYKDDS 55
             + D             R+R R+ DR  R DDR G          +E+ER+  R  + + 
Sbjct: 696  LDIDRYVPPTSHRSRSPRRRVRSPDRPER-DDRRGFVEIDRYIPGSEREREKARDGEKEK 754

Query: 54   EEDDRK 37
            E ++RK
Sbjct: 755  ENEERK 760

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 53/134 (39%), Positives = 64/134 (47%), Gaps = 19/134 (14%)
 Frame = -1

Query: 348 RKRDRNGDRRHRVDDRDGDNEKERDRRG-----DNDRRGNGER----RHRD---DDNEKE 205
           R+RD   D RHR   RDG  E+ R RR      D+DRR    R    R RD   DD    
Sbjct: 424 RRRDSTVDDRHRPYRRDGSRERSRSRRRYTPRFDDDRRRERSRDASSRPRDRNPDDRVAI 483

Query: 204 RD-RRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH-RRRYKDDSEE-----D 46
           RD R  RY D S     R R R+  R +   DRD D  + RD    R KD + +     D
Sbjct: 484 RDFRANRYGDRSYRPNRRSRSRSTGRGY---DRDRDRSRGRDRSAEREKDRARDRSRLTD 540

Query: 45  DRKRNRDRRYRDTS 4
           +R+R+RD R RD S
Sbjct: 541 ERERDRDHRTRDRS 554

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 43/145 (29%), Positives = 76/145 (52%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +  R+ R R+  +   K+R+   +      EE  +KR+   +R+   ++R    E+E  R
Sbjct: 173 RAKREIREREWQETVRKQRELEEQEARRKAEEERKKREI--ERQKEEEERARRKEREEQR 230

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
           R + +R+   ERR  +   ++E++R+ RY+    EE +R RD +   R R  DR    ++
Sbjct: 231 RAERERQREEERRLEE---QREKERQERYERRRREERERYRDWD---RSRDRDRSRTRDR 284

Query: 90  ERDHRRRYKDDSEEDDRKRNRDRRY 16
           +RD R R +D   + DR R+R+R Y
Sbjct: 285 DRD-RDRDRDRDRDRDRDRDRERDY 308

[111][TOP]
>UniRef100_UPI0000221423 Hypothetical protein CBG19125 n=1 Tax=Caenorhabditis briggsae AF16
           RepID=UPI0000221423
          Length = 328

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 37/146 (25%), Positives = 93/146 (63%), Gaps = 3/146 (2%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           + +D++  D +D+ +K++D++ +   D +E+ ++++D+    + + DD D + +K++D++
Sbjct: 144 KKKDKKKNDEEDEEDKKKDKKKKDDKDDDEDEEKEKDKKKKDKKK-DDDDDEEDKKKDKK 202

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
              D   + E    D++ EK++ ++ + KDD +EE D+K+D+   +  + DD + + +KE
Sbjct: 203 KKKDDNDDNE----DEEKEKDKKKKDKKKDDDDEEADKKKDKK-KKNDKKDDDEDEEKKE 257

Query: 87  RDHRRRYK---DDSEEDDRKRNRDRR 19
           +D +++ K   DD +E+D+K+++ ++
Sbjct: 258 KDKKKKDKKKDDDDDEEDKKKDKKKK 283

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 38/150 (25%), Positives = 95/150 (63%), Gaps = 6/150 (4%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR-HRVDDRDGDNEKERD 274
           K+ +D++  D DD+ +K++D++ + KDD+++  D +++++  ++  + DD D + +K++D
Sbjct: 181 KKKKDKKKDDDDDEEDKKKDKK-KKKDDNDDNEDEEKEKDKKKKDKKKDDDDEEADKKKD 239

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR-----NGDRRHRVDDR 109
           ++  ND++ + E   + + ++K++D++   KDD ++E D+K+D+       D      D 
Sbjct: 240 KKKKNDKKDDDEDEEKKEKDKKKKDKK---KDDDDDEEDKKKDKKKKDDKDDDEDEKKDD 296

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           D D + ++D +++  DD +ED+ ++ +D++
Sbjct: 297 DVDKDMKKDKKKKDDDDDKEDEDEKKKDKK 326

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 36/152 (23%), Positives = 91/152 (59%), Gaps = 5/152 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K+NRD++ ++ ++  E+E + + + KD  ++E + + D++  +  + +D + + +K++D+
Sbjct: 105 KKNRDKK-KEEEEKKEEEEEEKKKKKDKKKDEDEEEEDKDKKKDKKKNDEEDEEDKKKDK 163

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
           +  +D+  +      D++ EK++ ++ + KDD ++E D+K+D+   +    D+ D + EK
Sbjct: 164 KKKDDKDDD-----EDEEKEKDKKKKDKKKDDDDDEEDKKKDKKKKKDDNDDNEDEEKEK 218

Query: 90  ERDHRRRYKDDSEED-----DRKRNRDRRYRD 10
           ++  + + KDD +E+     D+K+  D++  D
Sbjct: 219 DKKKKDKKKDDDDEEADKKKDKKKKNDKKDDD 250

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 34/148 (22%), Positives = 86/148 (58%), Gaps = 1/148 (0%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           ++N+         D+ +E+ +R + +D  +EE ++K +   +++ + D +  ++E+E D+
Sbjct: 83  RKNKKSGSDSDSSDSSEEKKKRKKNRDKKKEEEEKKEEEEEEKKKKKDKKKDEDEEEEDK 142

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRY-KDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
               D++ N E    +D+ +K++D++ +  KDD E+E   K  +  D++   DD D + +
Sbjct: 143 DKKKDKKKNDE----EDEEDKKKDKKKKDDKDDDEDEEKEKDKKKKDKKK--DDDDDEED 196

Query: 93  KERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           K++D +++  D+ + +D ++ +D++ +D
Sbjct: 197 KKKDKKKKKDDNDDNEDEEKEKDKKKKD 224

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 37/162 (22%), Positives = 83/162 (51%), Gaps = 15/162 (9%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           KR+ D   +  +   EK  + + + K+  E    R   +N       D  D   EK++ +
Sbjct: 46  KRDSDGLAKTVEKIIEKVEEMKDKIKEHREMRHGRHGRKNKKSGSDSDSSDSSEEKKKRK 105

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKR-----------DRNGDRRH 124
           +  + ++   E++  +++ +K++  + + +D+ EE+ D+K+           D+  D++ 
Sbjct: 106 KNRDKKKEEEEKKEEEEEEKKKKKDKKKDEDEEEEDKDKKKDKKKNDEEDEEDKKKDKKK 165

Query: 123 RVD-DRDGDNEKERDHRRRYK---DDSEEDDRKRNRDRRYRD 10
           + D D D D EKE+D +++ K   DD +E+D+K+++ ++  D
Sbjct: 166 KDDKDDDEDEEKEKDKKKKDKKKDDDDDEEDKKKDKKKKKDD 207

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 29/103 (28%), Positives = 63/103 (61%), Gaps = 1/103 (0%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDN-EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           K+  D++  D D++  EK++ ++ + KDD ++E D+K+D+      + DD+D D ++++D
Sbjct: 241 KKKNDKKDDDEDEEKKEKDKKKKDKKKDDDDDEEDKKKDKK-----KKDDKDDDEDEKKD 295

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRD 145
              D D +   +++ +DDD++KE        D+ E++ D+K++
Sbjct: 296 DDVDKDMKK--DKKKKDDDDDKE--------DEDEKKKDKKKN 328

[112][TOP]
>UniRef100_Q63ZQ9 LOC494751 protein n=1 Tax=Xenopus laevis RepID=Q63ZQ9_XENLA
          Length = 2234

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 56/156 (35%), Positives = 84/156 (53%), Gaps = 2/156 (1%)
 Frame = -1

Query: 465  RKMIWKRNRD-RRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGD 292
            R+  W +NRD +R  +   D +K RDR      + E+E +R RDR+ D+ R R  DRD D
Sbjct: 2083 RERNWDKNRDWQRSNEPSRDWDKNRDRDA----NKEKELERNRDRDRDKERDREKDRDRD 2138

Query: 291  NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
             E+ERDR  D D R     R RD D ++ R+R G  + D     DR +DR  DR     D
Sbjct: 2139 RERERDRERDRD-RDRVRERDRDRDRDRARERDGYRRRDRSRSRDRDKDRERDR-----D 2192

Query: 111  RDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            RD D  ++R+ R + +D   ++  K ++  + +D+S
Sbjct: 2193 RDRDRNRDRE-RGKDRDSKSKESHKDSKSDKSKDSS 2227

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 54/165 (32%), Positives = 88/165 (53%), Gaps = 18/165 (10%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEE----------------EFDRKRDRNGDRRH 316
            R  D R R+ D D ++ER+R      D E                 ++D+ RDR+ ++  
Sbjct: 2056 RGFDDRRREGDPDGQRERERSRNCNRDRERNWDKNRDWQRSNEPSRDWDKNRDRDANKEK 2115

Query: 315  RVD-DRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN 139
             ++ +RD D +KERDR  D DR      R R+ D E++RDR    + D + + DR R+R+
Sbjct: 2116 ELERNRDRDRDKERDREKDRDR-----DRERERDRERDRDRDRVRERDRDRDRDRARERD 2170

Query: 138  G-DRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
            G  RR R   RD D ++ERD R R +D + + +R ++RD + +++
Sbjct: 2171 GYRRRDRSRSRDRDKDRERD-RDRDRDRNRDRERGKDRDSKSKES 2214

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 45/151 (29%), Positives = 70/151 (46%), Gaps = 7/151 (4%)
 Frame = -1

Query: 453  WKRNRDRRYRDRDDD------NEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
            W+ N  R+ +D  +        E+   R  ++ D      D    R  D R R  D DG 
Sbjct: 2011 WESNEFRQNKDHRNPPFEGRPRERYEGRNEKFDDSEPHPPDNIPSRGFDDRRREGDPDGQ 2070

Query: 291  NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD- 115
             E+ER R  + DR  N ++ +RD     E  R          ++D+ RDR+ ++   ++ 
Sbjct: 2071 RERERSRNCNRDRERNWDK-NRDWQRSNEPSR----------DWDKNRDRDANKEKELER 2119

Query: 114  DRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            +RD D +KERD R + +D   E +R R RDR
Sbjct: 2120 NRDRDRDKERD-REKDRDRDRERERDRERDR 2149

[113][TOP]
>UniRef100_Q54F78 Putative uncharacterized protein thoc2 n=1 Tax=Dictyostelium
            discoideum RepID=Q54F78_DICDI
          Length = 2110

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/156 (32%), Positives = 90/156 (57%), Gaps = 5/156 (3%)
 Frame = -1

Query: 459  MIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 283
            MI   + +    ++  + EKER+R    + + E E +R+R+R  +R + +  +R+ + E+
Sbjct: 1407 MIDINDENNNNNNKSKEKEKEREREKEREKEKEREKEREREREKEREKEKEKERERERER 1466

Query: 282  ERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVD 115
            ER+R  + DR    ER   R R+ + E+ER+R    + + E E +R+R+R  +R R R  
Sbjct: 1467 EREREKERDREREKEREREREREREREREREREKEKEKEKERERERERERERERERERER 1526

Query: 114  DRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
            +R+ + EKERD  +R K + E + R++ RDR  R++
Sbjct: 1527 EREREKEKERDREQREK-EREREQREKERDRSDRNS 1561

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 45/143 (31%), Positives = 84/143 (58%), Gaps = 1/143 (0%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            +R R++  R+++ + EKER+R    + + E+E +R+R+R  + R R  +RD + EKER+R
Sbjct: 1427 EREREKE-REKEKEREKEREREREKEREKEKEKERERERERE-REREKERDREREKERER 1484

Query: 270  RGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
              + +R    ER R ++ + EKER+R    + + E E +R+R+R  ++    D    + E
Sbjct: 1485 EREREREREREREREKEKEKEKEREREREREREREREREREREREREKEKERDREQREKE 1544

Query: 93   KERDHRRRYKDDSEEDDRKRNRD 25
            +ER+ R + +D S+ +  K N +
Sbjct: 1545 REREQREKERDRSDRNSDKNNNN 1567

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 48/164 (29%), Positives = 84/164 (51%), Gaps = 15/164 (9%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            K     R R+R+ + EKERDR    + + E E +R+R+R    R R  +++ + E+ER+R
Sbjct: 1456 KEKEREREREREREREKERDREREKERERERERERERERE---REREKEKEKEKERERER 1512

Query: 270  RGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG--- 103
              + +R    ER R R+ + EKERDR  R K+   E+ +++RDR+     + ++ DG   
Sbjct: 1513 EREREREREREREREREREKEKERDREQREKEREREQREKERDRSDRNSDKNNNNDGGGS 1572

Query: 102  -----------DNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
                       D+  ++D +   K+  + + R+  RD R  D +
Sbjct: 1573 GSSRSDKSSSKDSGSKKDQQTPRKEIEKSESRENIRDSRSNDNN 1616

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 50/189 (26%), Positives = 93/189 (49%), Gaps = 31/189 (16%)
 Frame = -1

Query: 480  IRMIQRKMIWKRNRDRRYRDRDDDNEKERDRR-----------GRYKDDSEEEFDRKRDR 334
            IR   +++  K  R++  RD+D +N +ERD R            + +D  E +  R++ +
Sbjct: 1625 IRERDKELKEKEQREKEQRDKDREN-RERDNRDVRDSRNDQRGNQERDGGEPQQRRQQQQ 1683

Query: 333  NGDRRHRVDDRDGDN---------EKERDRRGDNDRRGNGER----------RHRDDDNE 211
                R R D R+ DN         ++++ R+ DNDRR  G +           +R+D+ E
Sbjct: 1684 QQQERDRNDIRNQDNNNNDSQQQQQQQQRRQQDNDRRDRGNQDNINNRDNNSNNRNDNRE 1743

Query: 210  KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE-KERDHRRRYKDDSEEDDRKR 34
            ++ ++  R  +++    + + DRN   R R D+R+  N+ +ER   R  + D + D+ K 
Sbjct: 1744 RQPNQDNRDNNNNNSNRNERNDRNDSSRERQDNRNERNDSRERQDTRDNRKDQQRDNDKS 1803

Query: 33   NRDRRYRDT 7
            N+ +R RD+
Sbjct: 1804 NQVQRNRDS 1812

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 50/190 (26%), Positives = 90/190 (47%), Gaps = 37/190 (19%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
            +R+   +R+R+R + R+R+ + E+ER+R    + + E+E +R+R+R    R R  +R+ +
Sbjct: 1467 EREREKERDREREKEREREREREREREREREREKEKEKEKERERERE---RERERERERE 1523

Query: 291  NEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDS------------------- 172
             E+ER+R  + +R R   E+    +  EKERDR  R  D +                   
Sbjct: 1524 REREREREKEKERDREQREKEREREQREKERDRSDRNSDKNNNNDGGGSGSSRSDKSSSK 1583

Query: 171  ------EEEFDRKRDRNGDRRHRV-DDRDGDNE---------KERDHRRRYKDDSEEDDR 40
                  +++  RK     + R  + D R  DN          +ERD   + K+  E++ R
Sbjct: 1584 DSGSKKDQQTPRKEIEKSESRENIRDSRSNDNNQSLSSSREIRERDKELKEKEQREKEQR 1643

Query: 39   KRNRDRRYRD 10
             ++R+ R RD
Sbjct: 1644 DKDRENRERD 1653

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 43/155 (27%), Positives = 84/155 (54%), Gaps = 10/155 (6%)
 Frame = -1

Query: 444  NRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
            NRD  +  D  D N++  +   + K+  E+E +R+++R         +++ + EKER+R 
Sbjct: 1398 NRDSIKDADMIDINDENNNNNNKSKE-KEKEREREKER---------EKEKEREKERERE 1447

Query: 267  GDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDD 112
             + +R    E+     R R+ + EKERDR    + + E E +R+R+R  +R   + +  +
Sbjct: 1448 REKEREKEKEKEREREREREREREKERDREREKEREREREREREREREREREKEKEKEKE 1507

Query: 111  RDGDNEKERD-HRRRYKDDSEEDDRKRNRDRRYRD 10
            R+ + E+ER+  R R ++   E ++++ RDR  R+
Sbjct: 1508 REREREREREREREREREREREREKEKERDREQRE 1542

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 47/165 (28%), Positives = 76/165 (46%), Gaps = 21/165 (12%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRK--RDRNGDRRHRVDDRDGDNEKERDRR 268
            RD R  D +      R+ R R K+  E+E   K  RD++ + R R      DN   RD R
Sbjct: 1608 RDSRSNDNNQSLSSSREIRERDKELKEKEQREKEQRDKDRENRER------DNRDVRDSR 1661

Query: 267  GDNDRRGNGER-------RHRDDDNEKERDRRGRYKDDS-------EEEFDRKRDRNGDR 130
              ND+RGN ER       R +    ++ERDR      D+       +++  ++R ++ DR
Sbjct: 1662 --NDQRGNQERDGGEPQQRRQQQQQQQERDRNDIRNQDNNNNDSQQQQQQQQRRQQDNDR 1719

Query: 129  RHR-----VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            R R     +++RD ++    D+R R  +    D+   N +R  R+
Sbjct: 1720 RDRGNQDNINNRDNNSNNRNDNRERQPNQDNRDNNNNNSNRNERN 1764

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 52/191 (27%), Positives = 85/191 (44%), Gaps = 36/191 (18%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
            +R+   +R R+R R R+R+ + EKERDR  R K+   E+ +++RDR+     + ++ DG 
Sbjct: 1511 EREREREREREREREREREREKEKERDREQREKEREREQREKERDRSDRNSDKNNNNDGG 1570

Query: 291  N---------------------------EKERDRRGDNDRRGNGERRHRDDDNE-KERDR 196
                                        EK   R    D R N   +      E +ERD+
Sbjct: 1571 GSGSSRSDKSSSKDSGSKKDQQTPRKEIEKSESRENIRDSRSNDNNQSLSSSREIRERDK 1630

Query: 195  RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK----ERDH---RRRYKDDSEEDDRK 37
              + K+  E+E  R +DR    R   D RD  N++    ERD    ++R +   ++ +R 
Sbjct: 1631 ELKEKEQREKE-QRDKDRENRERDNRDVRDSRNDQRGNQERDGGEPQQRRQQQQQQQERD 1689

Query: 36   RNRDRRYRDTS 4
            RN D R +D +
Sbjct: 1690 RN-DIRNQDNN 1699

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 39/154 (25%), Positives = 78/154 (50%), Gaps = 5/154 (3%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR-----VDDRDGDNE 286
            +R + ++ ++RD ++ + +D         +++  ++R ++ DRR R     +++RD ++ 
Sbjct: 1678 RRQQQQQQQERDRNDIRNQDNNNNDSQQQQQQ-QQRRQQDNDRRDRGNQDNINNRDNNSN 1736

Query: 285  KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
               D R   +R+ N + R  +++N    +R  R  D S E  D + +RN D R R D RD
Sbjct: 1737 NRNDNR---ERQPNQDNRDNNNNNSNRNERNDR-NDSSRERQDNRNERN-DSRERQDTRD 1791

Query: 105  GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
               +++RD+     D S +  R R+     R++S
Sbjct: 1792 NRKDQQRDN-----DKSNQVQRNRDSQPSSRNSS 1820

[114][TOP]
>UniRef100_Q7SD01 Putative uncharacterized protein n=1 Tax=Neurospora crassa
            RepID=Q7SD01_NEUCR
          Length = 901

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 60/144 (41%), Positives = 76/144 (52%), Gaps = 9/144 (6%)
 Frame = -1

Query: 432  RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
            R RDRD D E++RDRR     D E E DR RDR+   R R  DRD D ++ERDR  D D 
Sbjct: 690  RDRDRDRDRERDRDRRDYRDRDRERERDRDRDRD---RERDRDRDRDRDRERDRERDRDH 746

Query: 252  RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDR-KRDRNGDR----RHRVDDRDGDNEKE 88
            R     R RD + +++RD   R + D    +DR +R R+ DR    R RV DRD D    
Sbjct: 747  RD----RDRDRERDRDRDYDRRPRHDELNHYDRERRSRDEDRERIYRRRVMDRDVDELPY 802

Query: 87   RDHR----RRYKDDSEEDDRKRNR 28
             D R    RR + + +E DR   R
Sbjct: 803  GDERPSSSRRTRPEEDEHDRHDGR 826

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 63/177 (35%), Positives = 93/177 (52%), Gaps = 25/177 (14%)
 Frame = -1

Query: 468  QRKMIWKRNRDRRYRDRDDDNEKERDR--RGRYKDDSEEEFDRK-----RDRNGDRRHRV 310
            +R  + +R+R   YRDR + + +   R  R R  +    E DR+     R+RN  +    
Sbjct: 613  ERDRLRRRDRGDLYRDRGERSHRSSARSVRSRSPEHDPYEADRRKAIAERERNFRKSSMA 672

Query: 309  D----DR---DGDNEKERDRRGDNDRRGNGERR-HRDDDNEKERDR---RGRYKD-DSEE 166
            +    DR   DG ++  RDR  D DR  + +RR +RD D E+ERDR   R R +D D + 
Sbjct: 673  ESLLSDRRSVDGHHDSIRDRDRDRDRERDRDRRDYRDRDRERERDRDRDRDRERDRDRDR 732

Query: 165  EFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDS------EEDDRKRNRDRRYR 13
            + DR+RDR  DR HR  DRD + +++RD+ RR + D       E   R  +R+R YR
Sbjct: 733  DRDRERDRERDRDHRDRDRDRERDRDRDYDRRPRHDELNHYDRERRSRDEDRERIYR 789

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 54/156 (34%), Positives = 80/156 (51%), Gaps = 14/156 (8%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR-HRVDDRDGDNEKERDRRGD 262
            DRR  D   D+ ++RDR            DR R+R+ DRR +R  DR+ + +++RDR  +
Sbjct: 678  DRRSVDGHHDSIRDRDR------------DRDRERDRDRRDYRDRDRERERDRDRDRDRE 725

Query: 261  NDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDD--------R 109
             D       R RD D ++ERDR R R   D + + +R RDR+ DRR R D+        R
Sbjct: 726  RD-------RDRDRDRDRERDRERDRDHRDRDRDRERDRDRDYDRRPRHDELNHYDRERR 778

Query: 108  DGDNEKERDHRRRYKDDSEED----DRKRNRDRRYR 13
              D ++ER +RRR  D   ++    D + +  RR R
Sbjct: 779  SRDEDRERIYRRRVMDRDVDELPYGDERPSSSRRTR 814

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 47/132 (35%), Positives = 67/132 (50%), Gaps = 2/132 (1%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            R+RDR R RDRD D ++ERDR R R   D + + +R RDR+ DRR R D+    N  +R 
Sbjct: 720  RDRDRERDRDRDRDRDRERDRERDRDHRDRDRDRERDRDRDYDRRPRHDEL---NHYDR- 775

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
                       ERR RD+D E+   RR   +D  E  +  +R  +  RR R ++ + D  
Sbjct: 776  -----------ERRSRDEDRERIYRRRVMDRDVDELPYGDERP-SSSRRTRPEEDEHDRH 823

Query: 93   KERDHRRRYKDD 58
              R   +R K +
Sbjct: 824  DGRPPAKRVKTE 835

[115][TOP]
>UniRef100_C0SBJ3 Putative uncharacterized protein n=1 Tax=Paracoccidioides
            brasiliensis Pb03 RepID=C0SBJ3_PARBP
          Length = 1089

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 57/144 (39%), Positives = 77/144 (53%), Gaps = 1/144 (0%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            R RDR R RDRD D +++RDR      D + + DR RDR+ DR     DRD D +++RDR
Sbjct: 874  RQRDRDRDRDRDRDRDRDRDR------DRDRDRDRDRDRDRDR-----DRDRDRDRDRDR 922

Query: 270  RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
              D DR      R RD D +K+R+R        E + DR RDR   RR R   R+ D E 
Sbjct: 923  DRDKDR-----DRDRDRDKDKDRERVRERDPKRERDKDRDRDRKRSRRDRSGSRE-DTEH 976

Query: 90   ERDHRRRYKDDSEEDDRKRNRDRR 19
             R H RR K +  E+    +R+++
Sbjct: 977  SRRHARRLKRNEAEEQMAIDREKK 1000

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 54/156 (34%), Positives = 80/156 (51%), Gaps = 10/156 (6%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            R+RDR R RDRD D +++RDR      D + + DR RDR+ DR     DRD D +++RDR
Sbjct: 884  RDRDRDRDRDRDRDRDRDRDR------DRDRDRDRDRDRDRDRDR---DRDKDRDRDRDR 934

Query: 270  RGDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFD------RKRDRNGDRRHRV 118
              D DR   R    +R RD D +++R R  R +  S E+ +      R+  RN       
Sbjct: 935  DKDKDRERVRERDPKRERDKDRDRDRKRSRRDRSGSREDTEHSRRHARRLKRNEAEEQMA 994

Query: 117  DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             DR+  + + R+ R   KD    +   RNR+R  ++
Sbjct: 995  IDREKKSTEHRESRLHEKDPHTLEREARNRERLLKE 1030

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 51/135 (37%), Positives = 69/135 (51%), Gaps = 1/135 (0%)
 Frame = -1

Query: 420  RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNG 241
            R  D+   + R G     S +  DR RDR+ DR     DRD D +++RDR  D DR    
Sbjct: 855  RSSDHRSNKGRSGIEGKPSRQR-DRDRDRDRDR-----DRDRDRDRDRDRDRDRDR---- 904

Query: 240  ERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR-RYK 64
              R RD D +++RDR            DR RDR+ DR     DRD D +K++D  R R +
Sbjct: 905  -DRDRDRDRDRDRDR------------DRDRDRDKDR-----DRDRDRDKDKDRERVRER 946

Query: 63   DDSEEDDRKRNRDRR 19
            D   E D+ R+RDR+
Sbjct: 947  DPKRERDKDRDRDRK 961

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 2/100 (2%)
 Frame = -1

Query: 303  RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-R 127
            R  D+   + R G   +      R RD D +++RDR      D + + DR RDR+ DR R
Sbjct: 855  RSSDHRSNKGRSGIEGKPSRQRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDR 914

Query: 126  HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD-RRYRD 10
             R  DRD D +K+RD R R +D  ++ +R R RD +R RD
Sbjct: 915  DRDRDRDRDRDKDRD-RDRDRDKDKDRERVRERDPKRERD 953

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 53/158 (33%), Positives = 74/158 (46%), Gaps = 20/158 (12%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE-KERD 274
            R+RDR + RDRD D +K++DR    + D + E D+ RDR  DR+    DR G  E  E  
Sbjct: 920  RDRDRDKDRDRDRDRDKDKDRERVRERDPKRERDKDRDR--DRKRSRRDRSGSREDTEHS 977

Query: 273  RRGDNDRRGNGERRHRDDDNEKE----RDRRGRYKDDSEEEFD-RKRDR---NGDRRHRV 118
            RR     + N        D EK+    R+ R   KD    E + R R+R      RR  +
Sbjct: 978  RRHARRLKRNEAEEQMAIDREKKSTEHRESRLHEKDPHTLEREARNRERLLKEQQRREAM 1037

Query: 117  D-DRDGDNEKERDHRR---------RYKDDSEEDDRKR 34
            + DRDG   + R+ R+          YK + EE D+ R
Sbjct: 1038 NADRDGRCSRSRESRQGRTLGGRHLSYKYEDEESDQAR 1075

[116][TOP]
>UniRef100_UPI00017F0C2E PREDICTED: similar to LOC506564 protein n=1 Tax=Sus scrofa
            RepID=UPI00017F0C2E
          Length = 1376

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 69/173 (39%), Positives = 89/173 (51%), Gaps = 21/173 (12%)
 Frame = -1

Query: 465  RKMIWKRNRDRR-YRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
            R+  W   R+ R   DR+ D EKERDR  + +D++E E +R RDR  D R R  DRDGD 
Sbjct: 1174 REESWGPPRESRPSEDREWDREKERDRDNQDRDENEREPERDRDRERD-RERDRDRDGDR 1232

Query: 288  EKERDRRGDND---RRGNGERRH--RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR- 127
            E +R RR  ++   RRG  E     RD     +RDR  R +DD  +  +R+ DR  DRR 
Sbjct: 1233 E-DRFRRPRDEGGWRRGPAEESSSWRDASRRDDRDRDDRRRDDRRDLRERRDDR--DRRG 1289

Query: 126  -------------HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
                          R DDR  D  +ERD  RR    +   DR+R+RDR R RD
Sbjct: 1290 PPLRSEREEVSSWRRADDRKDDRAEERDAPRRVPPPALSRDRERDRDRDRERD 1342

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 59/166 (35%), Positives = 79/166 (47%), Gaps = 37/166 (22%)
 Frame = -1

Query: 432  RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR------------HRVDDRDGDN 289
            R RDR+ D E++RDR G    D E+ F R RD  G RR             R DDRD D+
Sbjct: 1214 RDRDRERDRERDRDRDG----DREDRFRRPRDEGGWRRGPAEESSSWRDASRRDDRDRDD 1269

Query: 288  EKE------RDRRGDNDRRGNGERRHRD------------DDNEKERDRRGRYKDDSEEE 163
             +       R+RR D DRRG   R  R+            DD  +ERD   R    +   
Sbjct: 1270 RRRDDRRDLRERRDDRDRRGPPLRSEREEVSSWRRADDRKDDRAEERDAPRRVPPPALSR 1329

Query: 162  FDRKRDRNGDRRHRVDDRDGDNEK-------ERDHRRRYKDDSEED 46
             DR+RDR+ DR     +RDG+ EK       +R+  RR K++++ED
Sbjct: 1330 -DRERDRDRDR-----ERDGEKEKTSWRADKDRESLRRTKNETDED 1369

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 52/161 (32%), Positives = 67/161 (41%), Gaps = 8/161 (4%)
 Frame = -1

Query: 480  IRMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 301
            +R  Q ++      +R+ R R+ + E+   RR   +   E+   RK  R GDR      R
Sbjct: 841  LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGEDPLSRKDSRWGDRDSEGTWR 900

Query: 300  DGDNEKERDRRGDND---RRGNG---ERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN 139
             G       RRG  +   RRG G   ER HR DD     DR  R  DD E E   + D +
Sbjct: 901  KGPEIDSEWRRGPPEKDWRRGEGRDEERPHRRDD-----DRPRRLGDDEERESSLRPDED 955

Query: 138  -GDRRHRVDDRDGDNEKERDH-RRRYKDDSEEDDRKRNRDR 22
             G RR   DDR      + D   RR  DD     R  + DR
Sbjct: 956  RGPRRGMDDDRGPRRGLDEDRFSRRGADDDRPSWRNTDDDR 996

[117][TOP]
>UniRef100_UPI000051003C COG1158: Transcription termination factor n=1 Tax=Brevibacterium
           linens BL2 RepID=UPI000051003C
          Length = 667

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 52/147 (35%), Positives = 70/147 (47%), Gaps = 5/147 (3%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           R R RR R R    E + D  G   DDS E  DR  DR   R  + DD +  N++  DR 
Sbjct: 121 RQRSRRSRSRSRGAEAQNDDNGHSSDDSNERTDRN-DRGNGRNRQNDDNNDRNDRGNDRN 179

Query: 267 GDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
            D   RGNG  R  DD++  +R+      R R  DD++   DR  DR   R  + DD D 
Sbjct: 180 ND---RGNGRNRQGDDNDRGDRNNDRGNGRNRQGDDNDRG-DRNNDRGNGRNRQGDDNDR 235

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDR 22
            N++  D R R  +D ++   +R R R
Sbjct: 236 GNDRNNDRRNRNNNDDDDRGNRRGRGR 262

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 46/138 (33%), Positives = 64/138 (46%), Gaps = 1/138 (0%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
           R R  DD+N++                DR  DRN DR +   +R GD+    DR  D   
Sbjct: 161 RNRQNDDNNDRN---------------DRGNDRNNDRGNG-RNRQGDDNDRGDRNND--- 201

Query: 252 RGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHR 76
           RGNG  R  DD++  +R+  RG  ++   ++ DR  DRN DRR+R ++ D D    R   
Sbjct: 202 RGNGRNRQGDDNDRGDRNNDRGNGRNRQGDDNDRGNDRNNDRRNRNNNDDDDRGNRRGRG 261

Query: 75  RRYKDDSEEDDRKRNRDR 22
           R       + DRKR   R
Sbjct: 262 R-------DRDRKRRGGR 272

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 40/111 (36%), Positives = 63/111 (56%), Gaps = 6/111 (5%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRK--RDRNGDRRHRVDDRDGDNEKERDR 271
           +R+ R  DR++D    R+R+G   D  +   DR   R+R GD   R  DR+ D    R+R
Sbjct: 170 DRNDRGNDRNNDRGNGRNRQGDDNDRGDRNNDRGNGRNRQGDDNDR-GDRNNDRGNGRNR 228

Query: 270 RGDNDRRG---NGERRHRDDDNEKER-DRRGRYKDDSEEEFDRKRDRNGDR 130
           +GD++ RG   N +RR+R+++++ +R +RRGR +       DR R R G R
Sbjct: 229 QGDDNDRGNDRNNDRRNRNNNDDDDRGNRRGRGR-------DRDRKRRGGR 272

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 37/97 (38%), Positives = 47/97 (48%), Gaps = 4/97 (4%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           RNR     DR D N    + R R  DD++   DR  DR   R  + DD D  N++  DRR
Sbjct: 186 RNRQGDDNDRGDRNNDRGNGRNRQGDDNDRG-DRNNDRGNGRNRQGDDNDRGNDRNNDRR 244

Query: 267 ----GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSE 169
                D+D RGN   R RD D ++   R GR  D+ E
Sbjct: 245 NRNNNDDDDRGNRRGRGRDRDRKR---RGGRGNDEPE 278

[118][TOP]
>UniRef100_UPI00006A142D UPI00006A142D related cluster n=1 Tax=Xenopus (Silurana) tropicalis
            RepID=UPI00006A142D
          Length = 1030

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 55/149 (36%), Positives = 87/149 (58%), Gaps = 8/149 (5%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
            RD R R+R+ D E+ER+R  R       E +R+++R  +R  RV +R+ + E+E+DR  +
Sbjct: 720  RDERARERERDREREREREQR-------EREREKERESERE-RVREREREREREKDRERE 771

Query: 261  NDRRGNGERRHRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDR---RHRVDDRDGD- 100
             ++    ER  R+ + E+ER+R R R +D D E E +R+R+R  DR   R R  DR  D 
Sbjct: 772  REKEREREREERERERERERERERERERDRDREREREREREREKDRERGRERERDRPRDW 831

Query: 99   --NEKERDHRRRYKDDSEEDDRKRNRDRR 19
               EK R+ RR  ++D  E+ R+ + DR+
Sbjct: 832  EEKEKTREDRRDKREDVREEKRETHEDRK 860

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 46/144 (31%), Positives = 77/144 (53%), Gaps = 1/144 (0%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            +R+ DR  RDRD D       R + + D  E  +R+ +R  DR    D+R  +  +ER+R
Sbjct: 673  RRHGDRDRRDRDRDQRPTSPVRHQGRSDDTEREERREERRVDR---TDERRDERARERER 729

Query: 270  RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
              + +R      R R+ + E ER+R    + + E E DR+R+R  +R    ++R+ + E+
Sbjct: 730  DREREREREQREREREKERESERERVREREREREREKDREREREKEREREREERERERER 789

Query: 90   ERD-HRRRYKDDSEEDDRKRNRDR 22
            ER+  R R +D   E +R+R R+R
Sbjct: 790  ERERERERERDRDRERERERERER 813

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 52/167 (31%), Positives = 88/167 (52%), Gaps = 23/167 (13%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH----RVDDRDGDNEK 283
            +R R++R R+R+ + E ER+R    + + E E DR+R+R  +R      R  +R+ + E+
Sbjct: 734  EREREQREREREKERESERERVREREREREREKDREREREKEREREREERERERERERER 793

Query: 282  ERDRRGDNDRRGNGER-RHRDDDNEKERDR-RGRYKDDSEEE------FDRKRDRNGDRR 127
            ER+R  D DR    ER R R+ D E+ R+R R R +D  E+E       D++ D   ++R
Sbjct: 794  ERERERDRDREREREREREREKDRERGRERERDRPRDWEEKEKTREDRRDKREDVREEKR 853

Query: 126  HRVDDRDGDNEK-----------ERDHRRRYKDDSEEDDRKRNRDRR 19
               +DR   +EK            +D R+R++++S    R+  + RR
Sbjct: 854  ETHEDRKPKSEKGKIEGQINQNLHKDQRKRHRNESSPSPRQSPKRRR 900

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 47/144 (32%), Positives = 75/144 (52%), Gaps = 3/144 (2%)
 Frame = -1

Query: 432  RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
            RY  RD   +   DRR   +D  + + D++       + R DD + +  +E  R    D 
Sbjct: 659  RYDSRDQGRDSSFDRRHGDRDRRDRDRDQRPTSPVRHQGRSDDTEREERREERRVDRTDE 718

Query: 252  RGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDH 79
            R +   R R+ D E+ER+R  R ++ + E E +R+R R  +R R R  DR+ + EKER+ 
Sbjct: 719  RRDERARERERDREREREREQREREREKERESERERVREREREREREKDREREREKERER 778

Query: 78   RRRYKDDSEEDDRKRNRDR-RYRD 10
             R  ++   E +R+R R+R R RD
Sbjct: 779  EREERERERERERERERERERDRD 802

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 55/200 (27%), Positives = 78/200 (39%), Gaps = 58/200 (29%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDD---------------SEEEFDRKRDRNGDRRHR 313
            R+RD R   R D+   ER  R   +DD               +E   D + DRNG  R R
Sbjct: 559  RDRDNRESHRKDEQYDERSYRNHGRDDTSRAESRNETRNDSRNENRSDTRNDRNGRTRGR 618

Query: 312  VDD-----------------------------RDGDNEKERDRRGDNDRRGNGERRHRD- 223
              D                             R    E++R    D  R  + +RRH D 
Sbjct: 619  APDPPEKAGRAARSSQADNHSSSSNYHDNWESRSSYTERDRYDSRDQGRDSSFDRRHGDR 678

Query: 222  DDNEKERDRR--------GRYKDDSEEEFDRKR-----DRNGDRRHRVDDRDGDNEKERD 82
            D  +++RD+R        GR  D   EE   +R     D   D R R  +RD + E+ER+
Sbjct: 679  DRRDRDRDQRPTSPVRHQGRSDDTEREERREERRVDRTDERRDERARERERDRERERERE 738

Query: 81   HRRRYKDDSEEDDRKRNRDR 22
             R R ++   E +R+R R+R
Sbjct: 739  QREREREKERESERERVRER 758

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 46/146 (31%), Positives = 66/146 (45%), Gaps = 5/146 (3%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDR-NGDRRHRVDDRDG----DNEKE 280
           +R+R  RDRD D E    R  R   +S E  DR+  R N DRR   D RD     D+ + 
Sbjct: 478 DRERDERDRDHDREPSGSRDHRDDRESREGRDRREVRDNRDRREPRDSRDSRETRDSREY 537

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           RD +   D++ +  R  RD    ++RD R  ++ D + +    R+   D   R + R   
Sbjct: 538 RDVKESRDQKDS--RSTRDAHEYRDRDNRESHRKDEQYDERSYRNHGRDDTSRAESR--- 592

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDR 22
           NE   D R   + D+  D   R R R
Sbjct: 593 NETRNDSRNENRSDTRNDRNGRTRGR 618

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 52/165 (31%), Positives = 74/165 (44%), Gaps = 22/165 (13%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG---DRRH-RVDDRDGDNEK 283
           +R     Y  R   +   +    +++  + E+    R+R     DRRH R DDR+ D   
Sbjct: 426 RRQSTSPYATRASSSPHRKRSPSKHRSPAREKGRHDRERTSASQDRRHERRDDRERD--- 482

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKE-RDRR----------------GRYKDDSEEEFDR 154
           ERDR  D+DR  +G R HRDD   +E RDRR                 R   DS E  D 
Sbjct: 483 ERDR--DHDREPSGSRDHRDDRESREGRDRREVRDNRDRREPRDSRDSRETRDSREYRDV 540

Query: 153 KRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRK-RNRDR 22
           K  R  D++     RD    ++RD+R  ++ D + D+R  RN  R
Sbjct: 541 KESR--DQKDSRSTRDAHEYRDRDNRESHRKDEQYDERSYRNHGR 583

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 56/189 (29%), Positives = 74/189 (39%), Gaps = 43/189 (22%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR------------------ 322
            RN  R     D  N++    RGR  D  E+     R    D                   
Sbjct: 596  RNDSRNENRSDTRNDRNGRTRGRAPDPPEKAGRAARSSQADNHSSSSNYHDNWESRSSYT 655

Query: 321  -RHRVDDRDGDNEKERDRR-GDNDRRGNGER-------RH--RDDDNEKERDRRGRYKDD 175
             R R D RD   +   DRR GD DRR            RH  R DD E+E  R  R  D 
Sbjct: 656  ERDRYDSRDQGRDSSFDRRHGDRDRRDRDRDQRPTSPVRHQGRSDDTEREERREERRVDR 715

Query: 174  SEEEFD-RKRDRNGDR----------RHRVDDRDGDNEKERD---HRRRYKDDSEEDDRK 37
            ++E  D R R+R  DR          R R  +R+ + E+ R+    R R KD   E +++
Sbjct: 716  TDERRDERARERERDREREREREQREREREKERESERERVREREREREREKDREREREKE 775

Query: 36   RNRDRRYRD 10
            R R+R  R+
Sbjct: 776  REREREERE 784

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 39/114 (34%), Positives = 58/114 (50%), Gaps = 10/114 (8%)
 Frame = -1

Query: 321 RHRVDDRD-GDNEKER-----DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEF 160
           +HR   R+ G +++ER     DRR  ++RR + ER  RD D+++E      ++DD E   
Sbjct: 449 KHRSPAREKGRHDRERTSASQDRR--HERRDDRERDERDRDHDREPSGSRDHRDDRESRE 506

Query: 159 DRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR----YRD 10
            R R    D R R + RD  + +E    R Y+D  E  D+K +R  R    YRD
Sbjct: 507 GRDRREVRDNRDRREPRDSRDSRETRDSREYRDVKESRDQKDSRSTRDAHEYRD 560

[119][TOP]
>UniRef100_Q4QRG7 RNA binding motif protein, X-linked 2 n=1 Tax=Danio rerio
           RepID=Q4QRG7_DANRE
          Length = 434

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 59/165 (35%), Positives = 89/165 (53%), Gaps = 19/165 (11%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD---DRDGDNEKER 277
           +  DRR+ +     ++ERDR G  + D E E DR R R+G+R+   D    RDG+ ++ER
Sbjct: 241 KKTDRRHAETQ---QRERDREGEREGDKERERDRGRQRDGERQRERDGGRQRDGEKDRER 297

Query: 276 DRRGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD- 115
           +R G   R G  +R     R RD + ++ER+R G  + D +   DR+++R+G R+  V+ 
Sbjct: 298 ERDGGRQRDGERQRERDGGRQRDGERDRERERDGGRQRDGDR--DREQERDGGRQRDVER 355

Query: 114 ----DRDGDNEK--ERDHRRRYKDDSEED---DRKRNRD-RRYRD 10
               +RDG  ++  ERD  R      + D   DRKR RD  R RD
Sbjct: 356 DQERERDGGRQRDGERDRERERDGGRQRDGVRDRKRERDGGRQRD 400

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 64/170 (37%), Positives = 97/170 (57%), Gaps = 21/170 (12%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDRRHRVD---DRDGDN 289
           +R RDR  R RD + ++ERD  GR +D   D E E D  R R+G+R+   D    RDG+ 
Sbjct: 266 ERERDRG-RQRDGERQRERDG-GRQRDGEKDRERERDGGRQRDGERQRERDGGRQRDGER 323

Query: 288 EKERDRRGDNDRRGNGER-------RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
           ++ER+R G   R G+ +R       R RD + ++ER+R G  + D E   DR+R+R+G R
Sbjct: 324 DRERERDGGRQRDGDRDREQERDGGRQRDVERDQERERDGGRQRDGER--DRERERDGGR 381

Query: 129 RHRVDDRDG--DNEKERDH-RRRYKDDSEEDDRKRNRDR-----RYRDTS 4
           +     RDG  D ++ERD  R+R ++   E +R R+R+R     ++RD S
Sbjct: 382 Q-----RDGVRDRKRERDGGRQRDEERVRERERDRDRERDRGNGKHRDHS 426

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 65/166 (39%), Positives = 91/166 (54%), Gaps = 23/166 (13%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDRRHRVD---DRDGDN 289
           +R RDR   +R+ D E+ERD RGR +D     E +  R+RD   DR    D    RDG+ 
Sbjct: 252 QRERDRE-GEREGDKERERD-RGRQRDGERQRERDGGRQRDGEKDRERERDGGRQRDGER 309

Query: 288 EKERD----RRGDNDR---RGNGERRHRDDDNEKERDRRGRYKD---DSEEEFDRKRDRN 139
           ++ERD    R G+ DR   R  G +R  D D E+ERD  GR +D   D E E D  R R+
Sbjct: 310 QRERDGGRQRDGERDRERERDGGRQRDGDRDREQERD-GGRQRDVERDQERERDGGRQRD 368

Query: 138 GDRRHRVDDRDGDNEKE--RDHRR-----RYKDDSEEDDRKRNRDR 22
           G+ R R  +RDG  +++  RD +R     R +D+    +R+R+RDR
Sbjct: 369 GE-RDRERERDGGRQRDGVRDRKRERDGGRQRDEERVRERERDRDR 413

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 57/161 (35%), Positives = 91/161 (56%), Gaps = 15/161 (9%)
 Frame = -1

Query: 468 QRKMIWKRNRDR---RYRDRDD----DNEKERDRRGRYKDDSEEEFDRKRD----RNGDR 322
           QR+    R RD    R R+RD     D E++R+R G  + D E + +R+RD    R+GD 
Sbjct: 280 QRERDGGRQRDGEKDRERERDGGRQRDGERQRERDGGRQRDGERDRERERDGGRQRDGD- 338

Query: 321 RHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR 142
           R R  +RDG  +++ +R  + +R G    R RD + ++ER+R G  + D     DRKR+R
Sbjct: 339 RDREQERDGGRQRDVERDQERERDGG---RQRDGERDRERERDGGRQRDGVR--DRKRER 393

Query: 141 NGDRR---HRVDDRDGDNEKERDH-RRRYKDDSEEDDRKRN 31
           +G R+    RV +R+ D ++ERD    +++D S E + +RN
Sbjct: 394 DGGRQRDEERVRERERDRDRERDRGNGKHRDHSREREHRRN 434

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 59/160 (36%), Positives = 86/160 (53%), Gaps = 19/160 (11%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRG------RYKDDSEEEFDRKRDRNGDR---RHRVDDRDGD 292
           NR  R  +++   EKER+R        R+ +  + E DR+ +R GD+   R R   RDG+
Sbjct: 219 NRRDRADEQEQLKEKEREREEGKKTDRRHAETQQRERDREGEREGDKERERDRGRQRDGE 278

Query: 291 NEKERD----RRGDNDR-RGNGERRHRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNG 136
            ++ERD    R G+ DR R     R RD + ++ERD  GR +D   D E E D  R R+G
Sbjct: 279 RQRERDGGRQRDGEKDRERERDGGRQRDGERQRERD-GGRQRDGERDRERERDGGRQRDG 337

Query: 135 DRRHRVDDRDGDNEK--ERDHRRRYKDDSEEDDRKRNRDR 22
           D R R  +RDG  ++  ERD  R  +D   + D +R+R+R
Sbjct: 338 D-RDREQERDGGRQRDVERDQERE-RDGGRQRDGERDRER 375

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 45/170 (26%), Positives = 81/170 (47%), Gaps = 27/170 (15%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNE--KERDRRGRYKDDSEEEFDRKRDRN-------------GDRRH 316
           K+ + ++ +++ +  +  KE  R GR +  +      K+++               +RR 
Sbjct: 163 KKEKKKKKKEKKEKKKALKEEKREGRSESSASSPVRVKKEKEDVAYEKYSVKGPAANRRD 222

Query: 315 RVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
           R D+++   EKER+R       G    R   +  ++ERDR G  + D E E DR R R+G
Sbjct: 223 RADEQEQLKEKERERE-----EGKKTDRRHAETQQRERDREGEREGDKERERDRGRQRDG 277

Query: 135 DRRHRVD---DRDGDNEKERD---------HRRRYKDDSEEDDRKRNRDR 22
           +R+   D    RDG+ ++ER+          R+R +D   + D +R+R+R
Sbjct: 278 ERQRERDGGRQRDGEKDRERERDGGRQRDGERQRERDGGRQRDGERDRER 327

[120][TOP]
>UniRef100_A7L5V7 Putative uncharacterized protein (Fragment) n=1 Tax=Acinetobacter
           baumannii RepID=A7L5V7_ACIBA
          Length = 325

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 63/157 (40%), Positives = 82/157 (52%), Gaps = 15/157 (9%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
           R R R RY D D+D+++ R     RGR +DD +E+ DR R     R    DD D D+  +
Sbjct: 52  RGRGRSRYDDDDEDDDRGRSGGRGRGRGRDDDDEDDDRGRSGGRGRGRSRDDDDEDD--D 109

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRD-RNGDRRHRV 118
           R R G    RG G  R  DDD + +R R     RGR +DD +E+ DR R    G  R R 
Sbjct: 110 RGRSGG---RGRGRSRRDDDDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRR 166

Query: 117 DDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 167 DDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 203

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 61/157 (38%), Positives = 76/157 (48%), Gaps = 15/157 (9%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR-RGRYK-DDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKER 277
           R R R   D DDD  +   R RGR + DD +E+ DR R    G  R R DD D D     
Sbjct: 140 RGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDED----- 194

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRHRV 118
           D RG +  RG G  R  DDD + +R R       R RY DD E++   +    G  R R 
Sbjct: 195 DDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRR 254

Query: 117 DDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 255 DDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 291

 Score = 82.0 bits (201), Expect(2) = 1e-14
 Identities = 59/156 (37%), Positives = 74/156 (47%), Gaps = 14/156 (8%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR-RGRYK-DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           R R R   D DDD  +   R RGR + DD +E+ DR R     R    DD D D     D
Sbjct: 97  RGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRDDDDED-----D 151

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRHRVD 115
            RG +  RG G  R  DDD + +R R       R RY DD E++   +    G  R R D
Sbjct: 152 DRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRD 211

Query: 114 DRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           D D D+++ R       R RY DD E+DDR R+  R
Sbjct: 212 DDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 247

 Score = 20.8 bits (42), Expect(2) = 1e-14
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -3

Query: 484 RYKDDSEEDD 455
           RY DD E+DD
Sbjct: 58  RYDDDDEDDD 67

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 64/166 (38%), Positives = 83/166 (50%), Gaps = 18/166 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNE 286
           R R R  RD DDD + +R R     RGR +DD +E+ DR R     R R R DD D D  
Sbjct: 116 RGRGRSRRD-DDDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDED-- 172

Query: 285 KERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR--- 130
              D RG +  RG G  R+ DDD + +R R     RGR + D ++E D  R R+G R   
Sbjct: 173 ---DDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRG 228

Query: 129 RHRVDDRDGDNEKERD----HRRRYKDDSEEDDRKRNRDRRYRDTS 4
           R R DD D D+++ R       R  +DD +EDD +     R R  S
Sbjct: 229 RSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRS 274

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 62/162 (38%), Positives = 81/162 (50%), Gaps = 19/162 (11%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           R R R  RD DDD + +R R G       RY DD E++    R R+G R      RD D+
Sbjct: 159 RGRGRSRRD-DDDEDDDRGRSGGRGRGRSRYDDDDEDD---DRGRSGGRGRGRSRRDDDD 214

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYK-DDSEEEFDRKRD-RNGDR 130
           E   D RG +  RG G  R+ DDD + +R R     RGR + DD +E+ DR R    G  
Sbjct: 215 ED--DDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRG 272

Query: 129 RHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDRR 19
           R R DD D D+++ R       R R  DD ++DDR+   D R
Sbjct: 273 RSRYDDDDEDDDRGRSGGRGRGRSRRDDDDDDDDRRGRSDGR 314

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 59/150 (39%), Positives = 75/150 (50%), Gaps = 17/150 (11%)
 Frame = -1

Query: 408 NEKERDR--RGRYKDDSEEEFDRKRDR-NGDRRHRVDDRDGDNEKERDRRGDNDRRGNGE 238
           + K  DR  RGR + D +E+ DR R    G  R R DD D D     D RG +  RG G 
Sbjct: 24  SHKNDDRNGRGRSRYDDDEDDDRGRSSGRGRGRSRYDDDDED-----DDRGRSGGRGRGR 78

Query: 237 RRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKERD-- 82
            R  DDD + +R R     RGR +DD +E+ DR R    G  R R DD D D+++ R   
Sbjct: 79  GRD-DDDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGG 137

Query: 81  -HRRRYKDDSEEDDRK-----RNRDRRYRD 10
             R R +DD +EDD +     R R R  RD
Sbjct: 138 RGRGRSRDDDDEDDDRGRSGGRGRGRSRRD 167

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 48/138 (34%), Positives = 67/138 (48%), Gaps = 16/138 (11%)
 Frame = -1

Query: 387 RGRYKDDSEEEFDRKRDRN-GDRRHRVDDRDGD-----NEKERDRRGDNDRRGNGERRHR 226
           R  +   +  EF  +  R  G   H+ DDR+G      ++ E D RG +  RG G  R+ 
Sbjct: 1   RAAHASGNAHEFTSEEAREAGALSHKNDDRNGRGRSRYDDDEDDDRGRSSGRGRGRSRYD 60

Query: 225 DDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD-----HR 76
           DDD + +R R     RGR +DD +E+ DR R     R    DD D D+++ R       R
Sbjct: 61  DDDEDDDRGRSGGRGRGRGRDDDDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGR 120

Query: 75  RRYKDDSEEDDRKRNRDR 22
            R  DD E+DDR R+  R
Sbjct: 121 SRRDDDDEDDDRGRSGGR 138

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 57/156 (36%), Positives = 76/156 (48%), Gaps = 15/156 (9%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDN 289
           R R R RY D D+D+++ R     RGR + D ++E D  R R+G R   R R DD D D 
Sbjct: 181 RGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSRYDDDDED- 238

Query: 288 EKERDRRGDNDRRGNGE-RRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGD 133
               D RG +  RG G  RR  DD+++ +R R       R RY DD E++   +    G 
Sbjct: 239 ----DDRGRSGGRGRGRSRRDDDDEDD-DRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGR 293

Query: 132 RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
            R R DD D D     D RR   D   ++ R + RD
Sbjct: 294 GRSRRDDDDDD-----DDRRGRSDGRGQNSRNQKRD 324

[121][TOP]
>UniRef100_B4KT85 GI21186 n=1 Tax=Drosophila mojavensis RepID=B4KT85_DROMO
          Length = 1260

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 53/122 (43%), Positives = 71/122 (58%), Gaps = 3/122 (2%)
 Frame = -1

Query: 360 EEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGDNDRRGNGER-RHRDDDNEKE-RDRRG 190
           +E DR R+R+ DR RHR  +RD D ++E DR  + D+    ER R RD + +KE R RR 
Sbjct: 158 KEQDRSRERDRDRDRHRERERDRDRKRESDRHRERDKDNQRERERDRDRERDKEHRRRRS 217

Query: 189 RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           R +++ + + DR RDR  DR H   DRD D + +RDHR+R     E  DR   R RR R 
Sbjct: 218 RSREERDRDRDRDRDR--DRDH---DRDRDRDHDRDHRKRRSSSRERQDRHEQRRRRSRS 272

Query: 9   TS 4
            S
Sbjct: 273 RS 274

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 42/135 (31%), Positives = 66/135 (48%), Gaps = 3/135 (2%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG--DNEKER 277
           R+RDR R R+RD D ++E DR      D++ E +R RDR  D+ HR        + +++R
Sbjct: 168 RDRDRHRERERDRDRKRESDRHRERDKDNQRERERDRDRERDKEHRRRRSRSREERDRDR 227

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           DR  D DR      R RD D++++  +R     + ++  +++R R+  R H    R    
Sbjct: 228 DRDRDRDR---DHDRDRDRDHDRDHRKRRSSSRERQDRHEQRRRRSRSRSHERSSRHQQQ 284

Query: 96  EKERDHRRRYKDDSE 52
           EK         DD E
Sbjct: 285 EKMPPPAAGMSDDPE 299

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 43/123 (34%), Positives = 65/123 (52%), Gaps = 3/123 (2%)
 Frame = -1

Query: 369 DSEEEFDRKRDRNGDRRHRVDDRDGDNEK-ERDRRGDNDRRGNGERRHRDDDNEKERDR- 196
           D  E+ + K  +   + ++ D  D D    E +     +R+     R RD D ++ R+R 
Sbjct: 118 DEGEQSEEKESKQKLKINKNDMSDVDAAMLELEALEPGERKEQDRSRERDRDRDRHRERE 177

Query: 195 RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR-R 19
           R R   D + E DR R+R+ D + R  +RD D E++++HRRR     EE DR R+RDR R
Sbjct: 178 RDR---DRKRESDRHRERDKDNQ-RERERDRDRERDKEHRRRRSRSREERDRDRDRDRDR 233

Query: 18  YRD 10
            RD
Sbjct: 234 DRD 236

[122][TOP]
>UniRef100_Q7RWE7 Predicted protein n=1 Tax=Neurospora crassa RepID=Q7RWE7_NEUCR
          Length = 1101

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 55/153 (35%), Positives = 80/153 (52%), Gaps = 7/153 (4%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
            R  R   ++ D+EK RDR      D ++E DR+R+   DR+ R +     + ++RD R D
Sbjct: 820  RSHRSSRKERDSEKRRDR-----SDRDKERDRERESRSDRKERKEGHSSSSRRDRD-RSD 873

Query: 261  NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG------DRRHRVDDRDGD 100
             D R +G R HRDD   ++RDR  R +D   +  DRK  + G       RR R     GD
Sbjct: 874  RDNRDSGGRSHRDD---RDRDRSDRDRDRDRDRSDRKDRKEGSGHGSSSRRDRDRGDRGD 930

Query: 99   NEKERDHRRRYKDDSEED-DRKRNRDRRYRDTS 4
             +++RD   R + D + D DR+R+RDR  R  S
Sbjct: 931  RDRDRDRSHRDERDRDRDRDRERDRDRSDRHRS 963

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 48/132 (36%), Positives = 68/132 (51%), Gaps = 22/132 (16%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKE-RDRRGRYKDDSEEEFDRKRDRN-------GDRRHRVDDRDG 295
            ++ RDR  RD++ D E+E R  R   K+       R RDR+       G R HR DDRD 
Sbjct: 832  EKRRDRSDRDKERDRERESRSDRKERKEGHSSSSRRDRDRSDRDNRDSGGRSHR-DDRDR 890

Query: 294  DN-----EKERDRRGDNDRR-----GNGERRHRD----DDNEKERDRRGRYKDDSEEEFD 157
            D      +++RDR    DR+     G+  RR RD     D +++RDR  R + D + + D
Sbjct: 891  DRSDRDRDRDRDRSDRKDRKEGSGHGSSSRRDRDRGDRGDRDRDRDRSHRDERDRDRDRD 950

Query: 156  RKRDRNGDRRHR 121
            R+RDR+   RHR
Sbjct: 951  RERDRDRSDRHR 962

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 55/198 (27%), Positives = 81/198 (40%), Gaps = 52/198 (26%)
 Frame = -1

Query: 447  RNRDRRYRDRDD-DNEKER-DRRGRYKDDSEEEFDRKRDRNGDRRHRV------------ 310
            R+RD  +R+R D D E+ER DRR R      +E    RDR  +RR R             
Sbjct: 702  RDRDYYHRERSDRDRERERRDRRERSYSPGADERKEHRDRRRERRQRSASPGGADAAHGA 761

Query: 309  --DDRDGDNEKE------------------RDRRGDNDRRG--------------NGERR 232
               + DGD+++                    D  G N  R               +  R 
Sbjct: 762  EGTNNDGDDQQHGHSSSSRRHRRKHTSTTVADEEGGNQERSRSASPPASGVAGEESSRRS 821

Query: 231  HRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDD-- 58
            HR    E++ ++R R + D ++E DR+R+   DR+ R +     + ++RD   R   D  
Sbjct: 822  HRSSRKERDSEKR-RDRSDRDKERDRERESRSDRKERKEGHSSSSRRDRDRSDRDNRDSG 880

Query: 57   --SEEDDRKRNRDRRYRD 10
              S  DDR R+R  R RD
Sbjct: 881  GRSHRDDRDRDRSDRDRD 898

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 50/163 (30%), Positives = 71/163 (43%), Gaps = 19/163 (11%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR--- 271
            R RR        ++E   + R +  S        + +  R HR   ++ D+EK RDR   
Sbjct: 781  RHRRKHTSTTVADEEGGNQERSRSASPPASGVAGEESSRRSHRSSRKERDSEKRRDRSDR 840

Query: 270  ----------RGDNDRRGNG----ERRHRDDDNEKERDRRGR-YKDDSE-EEFDRKRDRN 139
                      R D   R  G     RR RD  +   RD  GR ++DD + +  DR RDR+
Sbjct: 841  DKERDRERESRSDRKERKEGHSSSSRRDRDRSDRDNRDSGGRSHRDDRDRDRSDRDRDRD 900

Query: 138  GDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             DR  R D ++G         RR +D  +  DR R+RDR +RD
Sbjct: 901  RDRSDRKDRKEGSGHGSSS--RRDRDRGDRGDRDRDRDRSHRD 941

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 34/99 (34%), Positives = 49/99 (49%), Gaps = 1/99 (1%)
 Frame = -1

Query: 444  NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRN-GDRRHRVDDRDGDNEKERDRR 268
            +RDR   DRD D +++R  R   K+ S      +RDR+ GDR  R  DRD  +  ERDR 
Sbjct: 887  DRDRDRSDRDRDRDRDRSDRKDRKEGSGHGSSSRRDRDRGDRGDRDRDRDRSHRDERDRD 946

Query: 267  GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK 151
             D DR  + +R  R   ++K         D ++   DR+
Sbjct: 947  RDRDRERDRDRSDRHRSSKKSSSSNNHDADAADAHLDRR 985

[123][TOP]
>UniRef100_B2B5M7 Predicted CDS Pa_2_5160 n=1 Tax=Podospora anserina RepID=B2B5M7_PODAN
          Length = 871

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 54/151 (35%), Positives = 79/151 (52%), Gaps = 14/151 (9%)
 Frame = -1

Query: 432  RYRDRDDDNEKERDRRGRYKD------------DSEEEFDRKRDRNGDRRHRVDDRDGDN 289
            R RDRD D +++RDR+ R ++            D + +  R RDR+ DR  R DD  GD 
Sbjct: 730  RDRDRDRDRDRDRDRKDRDRERDRMDYRGGDRYDGDRDRPRDRDRDRDRDRRRDDSRGDR 789

Query: 288  EKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVD 115
             + R R    +R R     R+RD D +++RD    ++ D +   DR RDR+ DR RHR  
Sbjct: 790  RRSRSRNRSRERDRDRDRSRNRDRDRDRDRD----FRRDRDRSRDRSRDRDRDRSRHRER 845

Query: 114  DRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             RD D +++R   RR      + DR+R+R R
Sbjct: 846  SRDRDRDRDRSRTRR------DRDRRRSRSR 870

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/159 (30%), Positives = 85/159 (53%), Gaps = 14/159 (8%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRY-KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           KR  +R  ++++D   +E +R  R  +   E+E D +R++  +RR R + R+ + E+ER+
Sbjct: 179 KRKLERAIKEKEDAKRREEERAAREARRKKEKEEDERREK--ERRERREQREREREEERE 236

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKD---DSEEEFDRKRDR----------NGD 133
           +R          R+ R+ + E+ER+R  R KD   D   + DR+RDR          +GD
Sbjct: 237 QR----------RKEREREREREREREERDKDRGRDDSRDRDRRRDRIQVGYDSYRGSGD 286

Query: 132 RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRY 16
           R +R  DR  + ++ RD   R +D   + DR R+R R++
Sbjct: 287 RSNRDRDRSRNRDRSRD---RGRDRDRDRDRDRDRSRKH 322

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 47/146 (32%), Positives = 78/146 (53%), Gaps = 11/146 (7%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R ++RR R    + E+E +R  R K     E +R+R+R  +R  R  DR  D+ ++RDR
Sbjct: 215 RREKERRERREQREREREEEREQRRK-----EREREREREREREERDKDRGRDDSRDRDR 269

Query: 270 RGD------NDRRGNGERRHRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRV 118
           R D      +  RG+G+R +RD D  + RDR   RGR +D      DR RDR+  R+H  
Sbjct: 270 RRDRIQVGYDSYRGSGDRSNRDRDRSRNRDRSRDRGRDRDR-----DRDRDRDRSRKHSA 324

Query: 117 DDRDGDNEK--ERDHRRRYKDDSEED 46
           + +  + +K   ++ + R + ++  D
Sbjct: 325 ERKTEEVKKPLTKEEQERLEQEALAD 350

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 56/147 (38%), Positives = 79/147 (53%), Gaps = 20/147 (13%)
 Frame = -1

Query: 384  GRYKDDSEEEFDRKRDRNGDRRHRVD-DRDGDNEKERDR-RGDNDR-----------RGN 244
            GR   +   E  ++R  N DR    + DRD D +++RDR R D DR           R +
Sbjct: 704  GRRTGERSPEVVKRRVENSDRYQPGERDRDRDRDRDRDRDRKDRDRERDRMDYRGGDRYD 763

Query: 243  GER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDNEKERD 82
            G+R R RD D +++RDRR   +DDS  +  R R RN  R     R R  +RD D +++RD
Sbjct: 764  GDRDRPRDRDRDRDRDRR---RDDSRGDRRRSRSRNRSRERDRDRDRSRNRDRDRDRDRD 820

Query: 81   HRRRYKDDSEEDDRKRNRDR-RYRDTS 4
             RR  +D S +  R R+RDR R+R+ S
Sbjct: 821  FRRD-RDRSRDRSRDRDRDRSRHRERS 846

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 50/146 (34%), Positives = 64/146 (43%), Gaps = 6/146 (4%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
           R  R R+RDDD  + R R  R + D      R+R R+  R  R D RD    + RD R D
Sbjct: 446 RRERSRERDDDRRRPRTRSPRPRHDDRSR-SRRRSRSRVRDRRDDRRDRSRSRRRDERRD 504

Query: 261 NDRRGNGERRHRDDDN-----EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD-RDGD 100
            DRR +     RDD        K +D     K+   +   R+R R+  R  R DD RD  
Sbjct: 505 -DRRDDRRDDRRDDRKVEETPTKRKDEAAIPKETPAKSEARERSRSRPRTARTDDRRDRS 563

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDR 22
             + RD  R     S  D R R+R R
Sbjct: 564 RSRHRDRDRTRSPRSRPDRRDRSRSR 589

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 45/145 (31%), Positives = 71/145 (48%), Gaps = 6/145 (4%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R  +R  R+     EKE D R R K+  E    R+R+R  +R  R  +R    E+ER+R
Sbjct: 194 RREEERAAREARRKKEKEEDER-REKERRERREQREREREEEREQRRKER----ERERER 248

Query: 270 RGDNDRRGNGERRHRDDDNEKERDR----RGRYKDDSE-EEFDRKRDRNGDR-RHRVDDR 109
             + + R     R    D ++ RDR       Y+   +    DR R RN DR R R  DR
Sbjct: 249 EREREERDKDRGRDDSRDRDRRRDRIQVGYDSYRGSGDRSNRDRDRSRNRDRSRDRGRDR 308

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKR 34
           D D +++RD  R++  + + ++ K+
Sbjct: 309 DRDRDRDRDRSRKHSAERKTEEVKK 333

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 65/234 (27%), Positives = 93/234 (39%), Gaps = 78/234 (33%)
 Frame = -1

Query: 480  IRMIQRKMIWKRNRDRRYRDRDDDNEKERDR-------RGRYKDDSEEEFDRK------- 343
            +R  +R     R+RDRR RDRD D ++ RDR       R R K D+  + D K       
Sbjct: 590  LRFNRRDRTRSRSRDRRDRDRDRDRDR-RDRSRSRNRSREREKKDTATDKDEKDGSKLHL 648

Query: 342  RDRNGD--------------------RRHRVDDRDGD------NEKERDRRGDNDRRGNG 241
            RDR+                      ++  V  R+ +       +KE   +G  + R  G
Sbjct: 649  RDRSRSPASMVARPPSRLNQTEKEAWKQAEVKKREQEAKAYLAAQKEAREKGLEEGRRTG 708

Query: 240  ER---------------------RHRDDDNEKERDRRGRYKD------------DSEEEF 160
            ER                     R RD D +++RDR+ R ++            D + + 
Sbjct: 709  ERSPEVVKRRVENSDRYQPGERDRDRDRDRDRDRDRKDRDRERDRMDYRGGDRYDGDRDR 768

Query: 159  DRKRDRNGDRRHRVDDRDGDNEKERDHRR-----RYKDDSEEDDRKRNRDRRYR 13
             R RDR+ DR  R DD  GD  + R   R     R +D S   DR R+RDR +R
Sbjct: 769  PRDRDRDRDRDRRRDDSRGDRRRSRSRNRSRERDRDRDRSRNRDRDRDRDRDFR 822

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 54/178 (30%), Positives = 71/178 (39%), Gaps = 29/178 (16%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR------HRVDD----- 304
            +R+R R    RDD  ++ R RR   + D   + DR+ DR  DR+       R D+     
Sbjct: 477  RRSRSRVRDRRDDRRDRSRSRRRDERRDDRRD-DRRDDRRDDRKVEETPTKRKDEAAIPK 535

Query: 303  --------RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEF---- 160
                    R+    + R  R D DRR     RHRD D  +    R   +D S        
Sbjct: 536  ETPAKSEARERSRSRPRTARTD-DRRDRSRSRHRDRDRTRSPRSRPDRRDRSRSRLRFNR 594

Query: 159  -DRKRDRNGDRRHRVDDRDGD-----NEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
             DR R R+ DRR R  DRD D       + R   R  KD + + D K       RD S
Sbjct: 595  RDRTRSRSRDRRDRDRDRDRDRRDRSRSRNRSREREKKDTATDKDEKDGSKLHLRDRS 652

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 44/139 (31%), Positives = 70/139 (50%), Gaps = 8/139 (5%)
 Frame = -1

Query: 414 DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER 235
           ++N+++ +R  + K+D++   + +  R   R+          EKE D R + +RR   E+
Sbjct: 176 EENKRKLERAIKEKEDAKRREEERAAREARRK---------KEKEEDERREKERRERREQ 226

Query: 234 RHRDDDNEKERDRRGRYKDDSEEEFDRKRDR--NGDRRHRVDDRDGDNEKER-----DHR 76
           R R+ + E+E+ R+ R     E E +R+R+R      R R D RD D  ++R     D  
Sbjct: 227 REREREEEREQRRKER-----EREREREREREERDKDRGRDDSRDRDRRRDRIQVGYDSY 281

Query: 75  RRYKDDSEED-DRKRNRDR 22
           R   D S  D DR RNRDR
Sbjct: 282 RGSGDRSNRDRDRSRNRDR 300

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 34/88 (38%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = -1

Query: 288 EKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
           EKER R     R    ER R RDDD  + R R  R + D      R+R R+  R  R D 
Sbjct: 432 EKERRRSRSPSRPARRERSRERDDDRRRPRTRSPRPRHDDRSR-SRRRSRSRVRDRRDDR 490

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRKRNR 28
           RD    + RD RR  + D   DDR+ +R
Sbjct: 491 RDRSRSRRRDERRDDRRDDRRDDRRDDR 518

[124][TOP]
>UniRef100_A8NVE9 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130
           RepID=A8NVE9_COPC7
          Length = 423

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 56/144 (38%), Positives = 77/144 (53%), Gaps = 2/144 (1%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNE-KERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           R  +RR RDRD D + ++RDR      D E + DR+RDR+ DR R R  DRD D +K   
Sbjct: 29  RPYERRDRDRDRDRDHRDRDRYRERDRDKERDRDRERDRDRDRERDRERDRDRDRQKSGS 88

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
            R D D   +  RRHR +  ++ER+   R K       +R+R+R   R     D   D E
Sbjct: 89  HREDYD--SSSRRRHRTESYDREREEYYRQK-------ERERERERRREKYYSDSYRDRE 139

Query: 93  KERDHRRRYKDDSEEDDRKRNRDR 22
           K R+  R Y++   E DR+R+RDR
Sbjct: 140 KYRERDRGYRERDRERDRERDRDR 163

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 59/158 (37%), Positives = 84/158 (53%), Gaps = 10/158 (6%)
 Frame = -1

Query: 447 RNRDRRYRDRDD----DNEKERDRRGRYKDDSEEEFDRKRDRNGDRR----HRVDDRDGD 292
           R+RDR +RDRD     D +KERDR      D + E DR+RDR+ DR+    HR D     
Sbjct: 38  RDRDRDHRDRDRYRERDRDKERDRDRERDRDRDRERDRERDRDRDRQKSGSHREDYDSSS 97

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
             + R    D +R    E  +R  + E+ER+RR R K  S+   DR++ R  DR +R  D
Sbjct: 98  RRRHRTESYDRER----EEYYRQKERERERERR-REKYYSDSYRDREKYRERDRGYRERD 152

Query: 111 RDGDNEKERDHRRRYKDDS--EEDDRKRNRDRRYRDTS 4
           R+ D E++RD  +    D    E +R + R+RR R+ S
Sbjct: 153 RERDRERDRDREKGRDRDRYYRERERDKERERRKREPS 190

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 52/119 (43%), Positives = 63/119 (52%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
           R  R RDRD D E+ERDR  R +D   E  D +R R+  RR R  DRD D +++RDR   
Sbjct: 302 RRERERDRDRDRERERDRERRRRDRYYE--DEERYRSSGRRERDRDRDRDRDRDRDR--- 356

Query: 261 NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
                  ERR+R      ERDR   Y+D    + DR RDR+GDR     DRD D E  R
Sbjct: 357 -------ERRYR------ERDREREYRD---RDRDRDRDRDGDRDR---DRDRDPESSR 396

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 46/139 (33%), Positives = 70/139 (50%), Gaps = 3/139 (2%)
 Frame = -1

Query: 417 DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGE 238
           D D  +  +RR R         DR RDR+   R R  +RD D E++RDR  D DR     
Sbjct: 24  DPDTGRPYERRDR---------DRDRDRDHRDRDRYRERDRDKERDRDRERDRDR---DR 71

Query: 237 RRHRDDDNEKERDRRGRYKDDSEEEFDRK-RDRNGDRRHRVDDRDGDNEKERDHRRR--Y 67
            R R+ D +++R + G +++D +    R+ R  + DR      R  + E+ER+ RR   Y
Sbjct: 72  ERDRERDRDRDRQKSGSHREDYDSSSRRRHRTESYDREREEYYRQKERERERERRREKYY 131

Query: 66  KDDSEEDDRKRNRDRRYRD 10
            D   + ++ R RDR YR+
Sbjct: 132 SDSYRDREKYRERDRGYRE 150

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 42/93 (45%), Positives = 54/93 (58%), Gaps = 2/93 (2%)
 Frame = -1

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
           E    G  +RR   ER  RD D E+ERDR  R +D   E  D +R R+  RR R  DRD 
Sbjct: 292 EEGEEGYGERRRERER-DRDRDRERERDRERRRRDRYYE--DEERYRSSGRRERDRDRDR 348

Query: 102 DNEKERDHRRRYKD-DSEEDDRKRNRDR-RYRD 10
           D +++RD  RRY++ D E + R R+RDR R RD
Sbjct: 349 DRDRDRDRERRYRERDREREYRDRDRDRDRDRD 381

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 44/104 (42%), Positives = 57/104 (54%), Gaps = 3/104 (2%)
 Frame = -1

Query: 324 RRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRD---DDNEKERDRRGRYKDDSEEEFDR 154
           RR R  DRD D E+ERDR          ERR RD   +D E+ R   GR + D + + DR
Sbjct: 302 RRERERDRDRDRERERDR----------ERRRRDRYYEDEERYRSS-GRRERDRDRDRDR 350

Query: 153 KRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            RDR+ +RR+R  DR    E+E   R R +D   + DR R+RDR
Sbjct: 351 DRDRDRERRYRERDR----EREYRDRDRDRDRDRDGDRDRDRDR 390

[125][TOP]
>UniRef100_Q568R1 Coiled-coil domain-containing protein 55 n=1 Tax=Danio rerio
           RepID=CCD55_DANRE
          Length = 516

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 55/156 (35%), Positives = 84/156 (53%), Gaps = 1/156 (0%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +R+   K  +++ ++DRD D  KE++R      D ++   RK DR GDRR R  DR+ D 
Sbjct: 271 ERERERKEIKEKSHKDRDRDRAKEKERERMR--DKDKHSHRKEDRGGDRR-RERDREEDR 327

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
            ++R  R  NDR G  +RR+     ++ERDR+G          DR+RDR G+R     DR
Sbjct: 328 ARDRRDRDRNDRHGIRDRRN-SSPKDRERDRKGERDRRDNSPKDRERDRKGER-----DR 381

Query: 108 DGDNEKERDHRRRYKDDSEEDDRK-RNRDRRYRDTS 4
             ++ K+R+   R K   +  D+  ++RDR  RD S
Sbjct: 382 RDNSPKDRERETRDKSPKDRRDKSPKDRDRERRDKS 417

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 55/171 (32%), Positives = 92/171 (53%), Gaps = 22/171 (12%)
 Frame = -1

Query: 471 IQRKMIWKRNRDR-------RYRDRDDDNEKERDRRGRYKDDSEEEFDR---KRDRNGDR 322
           I+ K    R+RDR       R RD+D  + ++ DR G  + + + E DR   +RDR+ + 
Sbjct: 279 IKEKSHKDRDRDRAKEKERERMRDKDKHSHRKEDRGGDRRRERDREEDRARDRRDRDRND 338

Query: 321 RHRVDDRDGDNEK--ERDRRGDNDRRGNGER---------RHRDDDNEKERDRRGRYKDD 175
           RH + DR   + K  ERDR+G+ DRR N  +         R R D++ K+R+R  R K  
Sbjct: 339 RHGIRDRRNSSPKDRERDRKGERDRRDNSPKDRERDRKGERDRRDNSPKDRERETRDKSP 398

Query: 174 SEEEFDRKRDRNGDRRHR-VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
            +      +DR+ +RR +   DR+ + + ERD R R  +D++ D +++N++
Sbjct: 399 KDRRDKSPKDRDRERRDKSPKDREPERKGERDIRER--EDNKVDSQRKNQE 447

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 49/152 (32%), Positives = 81/152 (53%), Gaps = 17/152 (11%)
 Frame = -1

Query: 414 DDNEKERDRRGRYKDDSEEEFDRKRDRNG--DRRHRVDDRDGDNEKERDRRGDNDR---- 253
           +++ K + R+     DS++  +R+R+R    ++ H+  DRD   EKER+R  D D+    
Sbjct: 250 NNHAKRQYRQKSPLSDSDDGDERERERKEIKEKSHKDRDRDRAKEKERERMRDKDKHSHR 309

Query: 252 ---RGNGERRHRDDDNEKERDRRGRYKDD--------SEEEFDRKRDRNGDRRHRVDDRD 106
              RG   RR RD + ++ RDRR R ++D        +    DR+RDR G+R  R D+  
Sbjct: 310 KEDRGGDRRRERDREEDRARDRRDRDRNDRHGIRDRRNSSPKDRERDRKGERDRR-DNSP 368

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            D E++R   R  +D+S +D  +  RD+  +D
Sbjct: 369 KDRERDRKGERDRRDNSPKDRERETRDKSPKD 400

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 50/161 (31%), Positives = 74/161 (45%), Gaps = 11/161 (6%)
 Frame = -1

Query: 483 GIRMIQRKMIWKRNRDRRYRDRDDDN-----------EKERDRRGRYKDDSEEEFDRKRD 337
           G R  +R     R RDRR RDR+D +           ++ERDR+G          DR+RD
Sbjct: 315 GDRRRERDREEDRARDRRDRDRNDRHGIRDRRNSSPKDRERDRKGERDRRDNSPKDRERD 374

Query: 336 RNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFD 157
           R G+R  R D+   D E+E   +   DRR         D + K+RDR  R K   + E +
Sbjct: 375 RKGERDRR-DNSPKDRERETRDKSPKDRR---------DKSPKDRDRERRDKSPKDREPE 424

Query: 156 RKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKR 34
           RK +R  D R R D++     K ++  +  K  +E    ++
Sbjct: 425 RKGER--DIREREDNKVDSQRKNQEDEKSSKSKTEHGKEEK 463

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 43/151 (28%), Positives = 66/151 (43%), Gaps = 21/151 (13%)
 Frame = -1

Query: 408 NEKERDRRGRYKDDSEE---EFDRKRDRNGDRRHR-----VDDRDGDNEKERDRRGDNDR 253
           N +E +      DD  +    F +    N  +R       + D D  +E+ER+R+   ++
Sbjct: 223 NRRESEAESHSDDDQVDVKPAFSKTTANNHAKRQYRQKSPLSDSDDGDERERERKEIKEK 282

Query: 252 RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR 73
                 + RD D  KE++R      D ++   RK DR GDRR    +RD + ++ RD R 
Sbjct: 283 ----SHKDRDRDRAKEKER--ERMRDKDKHSHRKEDRGGDRRR---ERDREEDRARDRRD 333

Query: 72  RYKDD-------------SEEDDRKRNRDRR 19
           R ++D               E DRK  RDRR
Sbjct: 334 RDRNDRHGIRDRRNSSPKDRERDRKGERDRR 364

[126][TOP]
>UniRef100_UPI0001797420 PREDICTED: similar to KIAA0853 n=1 Tax=Equus caballus
            RepID=UPI0001797420
          Length = 1656

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 54/142 (38%), Positives = 87/142 (61%), Gaps = 3/142 (2%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRG 265
            RD R R+RD   E+ERDR    + + E + +R+++R  +R R R  +R+ + EKERDR  
Sbjct: 673  RDERARERD--RERERDRERERERERERDREREKERELERERAREREREREREKERDRER 730

Query: 264  DNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
            + DR  + ER R R+ D EKER+R    +++ E E +R+R+R  +R  R  +R  + +KE
Sbjct: 731  ERDRDHDRERERERERDREKERERE---REERERERERERERERERE-RERERARERDKE 786

Query: 87   RDHRRRYKD-DSEEDDRKRNRD 25
            R+ +R ++D D   DDR+  R+
Sbjct: 787  RERQRDWEDKDKGRDDRREKRE 808

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/147 (35%), Positives = 85/147 (57%), Gaps = 8/147 (5%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRG------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
            +RR+ +RD  + +ERD+R       + ++D  E  +R+ +R  DR   VDDR  +  +ER
Sbjct: 624  ERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDR---VDDRRDERARER 680

Query: 276  DRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDG 103
            DR  + DR    ER R RD + EKER+       + E E +R+++R+ +R R R  DR+ 
Sbjct: 681  DRERERDRERERERERERDREREKERELERERAREREREREREKERDRERERDRDHDRER 740

Query: 102  DNEKERDHRRRYKDDSEEDDRKRNRDR 22
            + E+ERD  +  + + EE +R+R R+R
Sbjct: 741  ERERERDREKEREREREERERERERER 767

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 53/158 (33%), Positives = 86/158 (54%), Gaps = 12/158 (7%)
 Frame = -1

Query: 447  RNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNE 286
            R RDR   R R+R+ + E+ERDR    + + E E  R+R+R  +R   R R  +RD D++
Sbjct: 678  RERDRERERDRERERERERERDREREKERELERERAREREREREREKERDRERERDRDHD 737

Query: 285  KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
            +ER+R  + DR    ER   + + E+ER+R    + + E E  R+RD+  +R+   +D+D
Sbjct: 738  RERERERERDREKEREREREERERERERERERERERERERERARERDKERERQRDWEDKD 797

Query: 105  GDNEKERDHRRRYKDDSEEDDR------KRNRDRRYRD 10
                K RD RR  ++D  E+        +R   +RYR+
Sbjct: 798  ----KGRDDRREKREDIREERNLRDGHDERKSKKRYRN 831

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 55/152 (36%), Positives = 88/152 (57%), Gaps = 11/152 (7%)
 Frame = -1

Query: 432  RYRDRDDD---NEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
            R++ R+D+   +E+  +RR    DD  +E  R+RDR    R R  +R+ + E+ERDR  +
Sbjct: 647  RHQGRNDELERDERREERRVDRVDDRRDERARERDRE---RERDRERERERERERDRERE 703

Query: 261  NDRRGNGER---RHRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDN 97
             +R    ER   R R+ + EKERDR R R +D D E E +R+RDR  +R    ++R+ + 
Sbjct: 704  KERELERERAREREREREREKERDRERERDRDHDRERERERERDREKEREREREERERER 763

Query: 96   EKERD---HRRRYKDDSEEDDRKRNRDRRYRD 10
            E+ER+    R R ++ + E D++R R R + D
Sbjct: 764  ERERERERERERERERARERDKERERQRDWED 795

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 48/153 (31%), Positives = 87/153 (56%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
            R ++R+   +R R+R  R+++ D E+ERDR      D E E +R+RDR  +R    ++R+
Sbjct: 706  RELERERARERERERE-REKERDRERERDR----DHDRERERERERDREKEREREREERE 760

Query: 297  GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
             + E+ER+R  + +R      R R  + +KER+R+ R  +D ++  D +R++  D R   
Sbjct: 761  RERERERERERERERE-----RERARERDKERERQ-RDWEDKDKGRDDRREKREDIREER 814

Query: 117  DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            + RDG +  ER  ++RY+++     R+  + RR
Sbjct: 815  NLRDGHD--ERKSKKRYRNEGSPSPRQSPKRRR 845

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 52/156 (33%), Positives = 81/156 (51%), Gaps = 22/156 (14%)
 Frame = -1

Query: 411  DNEKERDRRGRYKDDSEE----EFDRKRDRNGDRRHR--VDDRDGDNEKERDRRGD---- 262
            D   ERD R + +D S E    E DR+ +R  D+R    +  +  ++E ERD R +    
Sbjct: 607  DRYPERDNRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRV 666

Query: 261  ---NDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDR 109
               +DRR    R     R RD + E+ER+R    + + E E +R+R R  +R R R  +R
Sbjct: 667  DRVDDRRDERARERDRERERDRERERERERERDREREKERELERERAREREREREREKER 726

Query: 108  DGDNEKERDH---RRRYKDDSEEDDRKRNRDRRYRD 10
            D + E++RDH   R R ++   E +R+R R+ R R+
Sbjct: 727  DRERERDRDHDRERERERERDREKEREREREERERE 762

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 47/133 (35%), Positives = 73/133 (54%), Gaps = 11/133 (8%)
 Frame = -1

Query: 387 RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRR--GNGERRHRDDDN 214
           R RY +   +  D+ RD + +RRH   +RD  + +ERD+R  +  R  G  +   RD+  
Sbjct: 606 RDRYPE--RDNRDQARDSSFERRH--GERDRRDNRERDQRPSSPIRHQGRNDELERDERR 661

Query: 213 EKER-DRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD-------HRRRYKD 61
           E+ R DR    +D+   E DR+R+R+ +R R R  +RD + EKER+        R R ++
Sbjct: 662 EERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERARERERERE 721

Query: 60  DSEEDDRKRNRDR 22
             +E DR+R RDR
Sbjct: 722 REKERDRERERDR 734

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 52/185 (28%), Positives = 84/185 (45%), Gaps = 39/185 (21%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
            R R+R R RDR+ + E+ER+ R R ++ + E E +R+R+R          R+ D E+ER 
Sbjct: 738  RERERERERDREKEREREREERERERERERERERERERERE-------RARERDKERERQ 790

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN--------GDRRHRV 118
            R  ++  +G  +RR + +D  +ER+ R    D  +E   +KR RN          +R R 
Sbjct: 791  RDWEDKDKGRDDRREKREDIREERNLR----DGHDERKSKKRYRNEGSPSPRQSPKRRRE 846

Query: 117  DDRDGD--------NEKER---------------------DHRRRYKDDSEEDDRKRNRD 25
               D D        NEK R                     D + R+K++  + +RK +  
Sbjct: 847  HSPDSDTYNSGDDKNEKHRLLSQVVRPQESRSLSPSHLIEDRQGRWKEEDRKLERKES-S 905

Query: 24   RRYRD 10
            RRY +
Sbjct: 906  RRYEE 910

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 46/153 (30%), Positives = 71/153 (46%), Gaps = 12/153 (7%)
 Frame = -1

Query: 426  RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR-----GD 262
            RDR+     E     + + D  +  +  R  + DR+         +  E DR+     G 
Sbjct: 1221 RDREKTKSLEITGERKSRIDQLKRGEPSRSTSSDRQDSRSHSSRRSSPESDRQVHSRSGS 1280

Query: 261  NDRRGNGERRHR-DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNE 94
             D R   + R R + D E+ER+RR    D  + E+DR  D++  R   R R+ +R+ + +
Sbjct: 1281 FDSRDRLQERDRYEHDRERERERR----DTRQREWDRDADKDWPRNRDRDRLRERERERD 1336

Query: 93   KERD---HRRRYKDDSEEDDRKRNRDRRYRDTS 4
            K RD    R R   DS E DR R+RDR +  +S
Sbjct: 1337 KRRDLDRERERLIPDSLERDRDRDRDRTFESSS 1369

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 43/145 (29%), Positives = 65/145 (44%), Gaps = 7/145 (4%)
 Frame = -1

Query: 438  DRRYRDRDD--DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
            DR+   R    D+      R RY+ D E E +R+     D R R  DRD D +  R+R  
Sbjct: 1271 DRQVHSRSGSFDSRDRLQERDRYEHDRERERERR-----DTRQREWDRDADKDWPRNR-- 1323

Query: 264  DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-----DRDGD 100
            D DR    ER  RD   + +R+R     D  E + DR RDR  +   +++     +   +
Sbjct: 1324 DRDRLRERERE-RDKRRDLDRERERLIPDSLERDRDRDRDRTFESSSQIESVKRSEAKLE 1382

Query: 99   NEKERDHRRRYKDDSEEDDRKRNRD 25
            +E ERD     +D    D  + ++D
Sbjct: 1383 SEHERDLEGTSRDSVALDKERMDKD 1407

[127][TOP]
>UniRef100_UPI000154E56B RNA binding motif protein 25 n=1 Tax=Rattus norvegicus
           RepID=UPI000154E56B
          Length = 484

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 51/147 (34%), Positives = 83/147 (56%), Gaps = 4/147 (2%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGD 262
           ++  R+R+ + E+ER+RR R   + E E +R+R++  +R R R  DRD D  KERDR  +
Sbjct: 305 EKERRERERERERERERRER---EREREREREREKEKERERERERDRDRDRTKERDRDRE 361

Query: 261 NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEK 91
            DR      R R  D  K+R R      D E E +R+R+R  +R   R R  +R+ + E+
Sbjct: 362 RDR---DRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERER 418

Query: 90  ERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           E+D +R  ++D E+   +R  +R+ R+
Sbjct: 419 EKDKKRDREEDEEDAYERRKLERKLRE 445

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 48/159 (30%), Positives = 84/159 (52%), Gaps = 4/159 (2%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 275 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 334

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRV 118
           + EKER+R  + D R     + RD D E++RDR      D  ++  R R+++ DR R R 
Sbjct: 335 EKEKERERERERD-RDRDRTKERDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERERE 393

Query: 117 DDRDGDNEKERD---HRRRYKDDSEEDDRKRNRDRRYRD 10
            +R+ + E+ER+    R R ++   E D+KR+R+    D
Sbjct: 394 REREREREREREREREREREREREREKDKKRDREEDEED 432

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 51/159 (32%), Positives = 83/159 (52%), Gaps = 21/159 (13%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRD 298
           +R+   +R R+R  RDRD D  KERDR      D E + DR R+R+ DR   R R  ++ 
Sbjct: 333 EREKEKERERERE-RDRDRDRTKERDR------DRERDRDRDRERSSDRNKDRSRSREKS 385

Query: 297 GDNEKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRK-------- 151
            D E+ER+R  + +R    ER   R R+ + E+E+D++   ++D E+ ++R+        
Sbjct: 386 RDREREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLRE 445

Query: 150 -------RDRNGDRRHRVDDRDGDNEKERDHRRRYKDDS 55
                  R +N + R R   R+ + E ER+  RR + +S
Sbjct: 446 KEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMNS 484

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 40/127 (31%), Positives = 67/127 (52%), Gaps = 9/127 (7%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR 196
           ++D  +   R+  +  D   ++++  G  EKER            ERR R+ + E+ER+R
Sbjct: 269 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEI-------EKERRERERERERERER 321

Query: 195 RGRYKD-----DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEED---D 43
           R R ++     + E+E +R+R+R  DR R R  +RD D E++RD  R    D  +D    
Sbjct: 322 REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSRS 381

Query: 42  RKRNRDR 22
           R+++RDR
Sbjct: 382 REKSRDR 388

[128][TOP]
>UniRef100_UPI0000F2B799 PREDICTED: similar to Death-inducer obliterator 1 (DIO-1)
            (Death-associated transcription factor 1) (DATF-1)
            (hDido1) n=1 Tax=Monodelphis domestica
            RepID=UPI0000F2B799
          Length = 2478

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 60/150 (40%), Positives = 82/150 (54%), Gaps = 2/150 (1%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
            R  + R RDRD     ERDR   +  D E ++DR RD     RHR  D + D +K ++R 
Sbjct: 2183 RGFEDRRRDRDHGKPWERDRGRNWSRDRERDWDRNRDW---ERHREKDSNRDWDKNKERN 2239

Query: 267  GDNDRRGNGERRHRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
             + D+    ER     + E ER+R RGR +D D E + DR+RDR+   R R  DRD D  
Sbjct: 2240 PNRDKERESER-----NKEWERNRERGRNRDRDRERDRDRRRDRD---RSRSRDRDRDRT 2291

Query: 93   KERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            +ERD R R +D  +E +R R +DR+ R  S
Sbjct: 2292 RERD-RERDRDREKERERDRGKDRKDRSKS 2320

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 47/153 (30%), Positives = 80/153 (52%), Gaps = 16/153 (10%)
 Frame = -1

Query: 453  WKRNRDRRY-RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR--------------- 322
            W+R+R R + RDR+ D ++ RD     + DS  ++D+ ++RN +R               
Sbjct: 2198 WERDRGRNWSRDRERDWDRNRDWERHREKDSNRDWDKNKERNPNRDKERESERNKEWERN 2257

Query: 321  RHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR 142
            R R  +RD D E++RDRR D DR      R RD D  +ERDR    + D + E +R+RDR
Sbjct: 2258 RERGRNRDRDRERDRDRRRDRDR---SRSRDRDRDRTRERDR----ERDRDREKERERDR 2310

Query: 141  NGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDD 43
              DR+ R   ++   + + + ++  +  +E ++
Sbjct: 2311 GKDRKDRSKSKESSRDSKPEEQKEVQKPAETEE 2343

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 41/105 (39%), Positives = 60/105 (57%), Gaps = 1/105 (0%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDR 301
            R  +R   W+RNR+R  R+RD D E++RDRR R +D S     R RDR+ DR R R  +R
Sbjct: 2246 RESERNKEWERNRERG-RNRDRDRERDRDRR-RDRDRS-----RSRDRDRDRTRERDRER 2298

Query: 300  DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEE 166
            D D EKER+R    DR+   + +    D++ E  +  +   ++EE
Sbjct: 2299 DRDREKERERDRGKDRKDRSKSKESSRDSKPEEQKEVQKPAETEE 2343

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 47/133 (35%), Positives = 63/133 (47%), Gaps = 10/133 (7%)
 Frame = -1

Query: 378  YKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERD 199
            Y++ + E   R+R   G +    D+ +    + R  RG  DRR     R RD     ERD
Sbjct: 2147 YRNQAFEGRQRERFEGGTKEKSSDEPETQLSENRQGRGFEDRR-----RDRDHGKPWERD 2201

Query: 198  RRGRYKDDSEEEFDRKRDRNGDRRHRVDD--RDGDNEKERDHRRRYKDDSEED------- 46
            R   +  D E ++DR RD     RHR  D  RD D  KER+  R  + +SE +       
Sbjct: 2202 RGRNWSRDRERDWDRNRDW---ERHREKDSNRDWDKNKERNPNRDKERESERNKEWERNR 2258

Query: 45   DRKRNRDR-RYRD 10
            +R RNRDR R RD
Sbjct: 2259 ERGRNRDRDRERD 2271

[129][TOP]
>UniRef100_UPI0000E80629 PREDICTED: hypothetical protein n=1 Tax=Gallus gallus
           RepID=UPI0000E80629
          Length = 835

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 51/148 (34%), Positives = 84/148 (56%), Gaps = 4/148 (2%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           ++RR R+R+ + E+ER  R R ++   + E+E +R+R+R  DR R R  DRD D E++RD
Sbjct: 307 KERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKDRDRDRERDRD 366

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
           R  D         R R  D  K+R R      D E E +R+R+R  + R R  +R+ + E
Sbjct: 367 RDRD---------RERSSDRNKDRSRSREKSRDRERERERERERERE-RERERERERERE 416

Query: 93  KERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           +E+D +R  ++D E+   +R  +R+ R+
Sbjct: 417 REKDKKRDREEDEEDAYERRKLERKLRE 444

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 49/153 (32%), Positives = 84/153 (54%), Gaps = 4/153 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R R+R  R+R+ + E+ER+R    + + E E DR RDR  DR     DR+ D +++RDR
Sbjct: 315 ERERERERREREREREREREREKEKERERERERDRDRDRTKDRDR---DRERDRDRDRDR 371

Query: 270 RGDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD-RRHRVDDRDG 103
              +DR   R     + RD + E+ER+R    + + E E +R+R+R  D +R R +D + 
Sbjct: 372 ERSSDRNKDRSRSREKSRDREREREREREREREREREREREREREREKDKKRDREEDEED 431

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
             E+ +  R+  + ++   +R +N + R R  S
Sbjct: 432 AYERRKLERKLREKEAAYQERLKNWEIRERKKS 464

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 48/157 (30%), Positives = 86/157 (54%), Gaps = 2/157 (1%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 276 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 335

Query: 294 DNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHR 121
           + EKER+R  + DR R   + R RD + +++RDR      D  ++  R R+++ DR R R
Sbjct: 336 EKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDRSRSREKSRDRERER 395

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             +R+ + E+ER+ R R ++   E D+KR+R+    D
Sbjct: 396 ERERERERERERE-REREREREREKDKKRDREEDEED 431

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 53/151 (35%), Positives = 87/151 (57%), Gaps = 9/151 (5%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDR---RGRYKDDSEE-EFDRKRDRNGDR-RHRVDDRDGDN 289
           +R R+R R R+R+ + EKER+R   R R +D +++ + DR+RDR+ DR R R  DR+ D 
Sbjct: 322 RREREREREREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDR 381

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
            + R++  D +R      R R+ + E+ER+R    + + E E D+KRDR  D     + R
Sbjct: 382 SRSREKSRDRER-----EREREREREREREREREREREREREKDKKRDREEDEEDAYERR 436

Query: 108 DGD---NEKERDHRRRYKDDSEEDDRKRNRD 25
             +    EKE  ++ R K + E  +RK++R+
Sbjct: 437 KLERKLREKEAAYQERLK-NWEIRERKKSRE 466

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 52/179 (29%), Positives = 89/179 (49%), Gaps = 24/179 (13%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +R+   +R R+R  RDRD D  K+RDR      D + + +R  DRN DR  R  ++  D 
Sbjct: 334 EREKEKERERERE-RDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDRS-RSREKSRDR 391

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK-------------- 151
           E+ER+R  + +R    E R R+ + E+E+D++   ++D E+ ++R+              
Sbjct: 392 ERERERERERERERERE-REREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQ 450

Query: 150 -RDRNGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRDTS 4
            R +N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR ++
Sbjct: 451 ERLKNWEIRERKKSREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSA 509

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 43/125 (34%), Positives = 67/125 (53%), Gaps = 7/125 (5%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR----RGDNDRRGNGERRHRDDDNEK 208
           ++D  +   R+  +  D   ++++  G  EKER      R + +R    ER  R+ + E+
Sbjct: 270 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 329

Query: 207 ERDR-RGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRK 37
           ER+R R + K+ + E E DR RDR  DR R R  DRD D ++ER   R  KD S   ++ 
Sbjct: 330 EREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRN-KDRSRSREKS 388

Query: 36  RNRDR 22
           R+R+R
Sbjct: 389 RDRER 393

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 52/198 (26%), Positives = 88/198 (44%), Gaps = 58/198 (29%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDR 301
           +R+   +R+RDR R +DRD D E++RDR    +  S+   DR R R   R   R R  +R
Sbjct: 340 ERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDRSRSREKSRDRERERERER 399

Query: 300 DGDNEKERDRRGDNDR-RGNGERRHRDDDNE----------------------------K 208
           + + E+ER+R  + +R R   ++R R++D E                            +
Sbjct: 400 EREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIR 459

Query: 207 ERDRRGRYKDDSEEEFDRKR--------------DRNGDR-----------RHRVDDRDG 103
           ER +   Y+ ++E E +R+R              D + DR           + R+ DR+ 
Sbjct: 460 ERKKSREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREK 519

Query: 102 DNEKERDHRRRYKDDSEE 49
           + E +   R+R K++ EE
Sbjct: 520 EMEADERDRKREKEELEE 537

[130][TOP]
>UniRef100_UPI00005BDD30 PREDICTED: zinc finger CCCH-type containing 13 isoform 1 n=1 Tax=Bos
            taurus RepID=UPI00005BDD30
          Length = 1652

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 46/146 (31%), Positives = 85/146 (58%), Gaps = 5/146 (3%)
 Frame = -1

Query: 432  RYRDRDDD---NEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRG 265
            R++ R+D+   +E+  +RR    DD  +E  R+RDR  +R R R  +R+ D E+E++R  
Sbjct: 647  RHQGRNDELERDERREERRVDRTDDRRDERARERDRERERERERERERERDREREKEREL 706

Query: 264  DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
            + +R      R R+ + E++R+R    + D E E +R+R+R  +R    ++R+ + E+ER
Sbjct: 707  ERERAAREREREREREKERDRERERDREHDREREREREREREKEREREREERERERERER 766

Query: 84   D-HRRRYKDDSEEDDRKRNRDRRYRD 10
            +  R R ++ + E +R+R R R + D
Sbjct: 767  ERERERERERARERERERERQREWED 792

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/142 (37%), Positives = 81/142 (57%), Gaps = 1/142 (0%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
            RD R R+RD + E+ER+R    + D E E +R+ +R    R R  +R+ + EKERDR  +
Sbjct: 673  RDERARERDRERERERERERERERDREREKERELERERAARER--EREREREKERDRERE 730

Query: 261  NDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
             DR  + ER R R+ + EKER+R    +++ E E +R+R+R    R R  +R  + E+ER
Sbjct: 731  RDREHDREREREREREREKERERE---REERERERERERERE---RERERERARERERER 784

Query: 84   DHRRRYKDDSEEDDRKRNRDRR 19
            + +R +     ED  K   DRR
Sbjct: 785  ERQREW-----EDKEKAREDRR 801

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 52/157 (33%), Positives = 89/157 (56%), Gaps = 10/157 (6%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            +R+   R RDR+ + E+ER+R      + E+E + +R+R    R R  +R+ + ++ER+R
Sbjct: 672  RRDERARERDRERERERERERERERDREREKERELERERAAREREREREREKERDRERER 731

Query: 270  RGDNDRRGNGER-RHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRD-G 103
              ++DR    ER R R+ + E+ER+ R R ++ + E E +R+R+R  +R R R   R+  
Sbjct: 732  DREHDREREREREREREKEREREREERERERERERERERERERERARERERERERQREWE 791

Query: 102  DNEKERDHRRRYKDDSEED------DRKRNRDRRYRD 10
            D EK R+ RR  ++D  ED        +R   +RYR+
Sbjct: 792  DKEKAREDRREKREDLREDRNPRDGHEERKSKKRYRN 828

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 50/149 (33%), Positives = 84/149 (56%), Gaps = 10/149 (6%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRG------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
            +RR+ +RD  + +ERD+R       + ++D  E  +R+ +R  DR    DDR  +  +ER
Sbjct: 624  ERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDR---TDDRRDERARER 680

Query: 276  DRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDR 109
            DR  + +R    ER   R R+ + E ER+R  R ++ + E E +R R+R  DR H   DR
Sbjct: 681  DRERERERERERERERDREREKERELERERAAREREREREREKERDRERERDREH---DR 737

Query: 108  DGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            + + E+ER+  +  + + EE +R+R R+R
Sbjct: 738  EREREREREREKEREREREERERERERER 766

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 52/153 (33%), Positives = 84/153 (54%), Gaps = 9/153 (5%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR------HRVDDRDGDN 289
            +  R  R  DR D+  +ERDR    + + E E +R R+R  +R        R  +R+ + 
Sbjct: 662  EERRVDRTDDRRDERARERDRERERERERERERERDREREKERELERERAARERERERER 721

Query: 288  EKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            EKERDR  + DR  + ER R R+ + EKER+R    +++ E E +R+R+R    R R  +
Sbjct: 722  EKERDRERERDREHDREREREREREREKERERE---REERERERERERER---ERERERE 775

Query: 111  RDGDNEKERDHRRRY--KDDSEEDDRKRNRDRR 19
            R  + E+ER+ +R +  K+ + ED R++  D R
Sbjct: 776  RARERERERERQREWEDKEKAREDRREKREDLR 808

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 48/160 (30%), Positives = 85/160 (53%), Gaps = 10/160 (6%)
 Frame = -1

Query: 468  QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-RHRVDD 304
            +R+   +R R+R R R+R+ + E ER+R  R ++   + E+E DR+R+R+ +  R R  +
Sbjct: 683  ERERERERERERERDREREKERELERERAAREREREREREKERDRERERDREHDRERERE 742

Query: 303  RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
            R+ + EKER+R  +   R     R R+ + E+ER R    + + + E++ K     DRR 
Sbjct: 743  REREREKEREREREERERERERERERERERERERARERERERERQREWEDKEKAREDRRE 802

Query: 123  -----RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
                 R D    D  +ER  ++RY+++     R+  + RR
Sbjct: 803  KREDLREDRNPRDGHEERKSKKRYRNEGSPSPRQSPKRRR 842

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 50/143 (34%), Positives = 75/143 (52%), Gaps = 13/143 (9%)
 Frame = -1

Query: 411  DNEKERDRRGRYKDDSEEEFDRKRDRNGDR----------RH--RVDDRDGDNEKERDRR 268
            D   ERD R + +D S E    +RDR  +R          RH  R D+ + D  +E +RR
Sbjct: 607  DRYPERDNREQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERRE-ERR 665

Query: 267  GD-NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
             D  D R +   R RD + E+ER+R    + D E E +R+ +R  +R  R  +R+ + EK
Sbjct: 666  VDRTDDRRDERARERDRERERERERERERERDREREKERELER--ERAAREREREREREK 723

Query: 90   ERDHRRRYKDDSEEDDRKRNRDR 22
            ERD R R +D   + +R+R R+R
Sbjct: 724  ERD-RERERDREHDRERERERER 745

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 48/134 (35%), Positives = 68/134 (50%), Gaps = 24/134 (17%)
 Frame = -1

Query: 345 KRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER--------RHRDDDNEKERDRRG 190
           +RDR  +R +R   RD   E+   R G+ DRR N ER        RH+  ++E ERD R 
Sbjct: 605 ERDRYPERDNREQARDSSFER---RHGERDRRDNRERDQRPSSPIRHQGRNDELERDERR 661

Query: 189 RYK-----DDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERD--------HRRRYKDD 58
             +     DD  +E  R+RDR  +R   R R  +RD + EKER+         R R ++ 
Sbjct: 662 EERRVDRTDDRRDERARERDRERERERERERERERDREREKERELERERAARERERERER 721

Query: 57  SEEDDRKRNRDRRY 16
            +E DR+R RDR +
Sbjct: 722 EKERDRERERDREH 735

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 52/186 (27%), Positives = 87/186 (46%), Gaps = 39/186 (20%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKER 277
            +R RDR + DR+ + E+ER+R + R ++  E E +R+R+R  +R R R   R+ + E+ER
Sbjct: 728  ERERDREH-DREREREREREREKEREREREERERERERERERERERERERARERERERER 786

Query: 276  DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN--------GDRRHR 121
             R  ++  +   +RR + +D  ++R+ R    D  EE   +KR RN          +R R
Sbjct: 787  QREWEDKEKAREDRREKREDLREDRNPR----DGHEERKSKKRYRNEGSPSPRQSPKRRR 842

Query: 120  VDDRDGD--------NEKER---------------------DHRRRYKDDSEEDDRKRNR 28
                D D        NEK R                     D + R+++D  + +RK + 
Sbjct: 843  EHSPDSDAYNSGDDKNEKHRLLSQVVRPQESRSLSPSHLTEDRQGRWREDDRKPERKES- 901

Query: 27   DRRYRD 10
             RRY +
Sbjct: 902  SRRYEE 907

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 43/146 (29%), Positives = 61/146 (41%), Gaps = 3/146 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRN-GDRRHRVDDRDGDNEKERD 274
           +R   R  RDR+ D  +ER+    Y+ D     D + DR   D R R D R  D    R+
Sbjct: 417 RREETRGKRDREKDTREERE----YEQDQSSSRDHRDDREPRDGRDRRDAR--DTRDRRE 470

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
            R   D R + E R    DN++ RD R         ++   RDR     HR +D   +  
Sbjct: 471 LRDSRDVRDSREMRDYSRDNKESRDPRDSRSTRDAHDY---RDRESRDAHRKEDAYQEES 527

Query: 93  KE--RDHRRRYKDDSEEDDRKRNRDR 22
           +   R+H R     +E  +  RN  R
Sbjct: 528 RSYGRNHLREESSRAEIRNDSRNESR 553

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 48/171 (28%), Positives = 78/171 (45%), Gaps = 28/171 (16%)
 Frame = -1

Query: 444  NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD-RDGDNEKE---- 280
            + D  +R  DD N ++R      +D    E  +  +  G+R+ R+D  + G+  +     
Sbjct: 1195 SNDSAHRSGDDQNGRKRVLHSGSRD---REKTKSLEITGERKSRIDQLKRGEPSRSTSSD 1251

Query: 279  -RDRRGDNDRRGNGER------RHRDDDNEKERDRRGRYKDDSEEEFDRK--------RD 145
             +D R  + RR + E       R    D+ +    R RY+ + E E +R+        RD
Sbjct: 1252 RQDSRSHSSRRSSPESDRQVHSRSGSFDSRERLQERDRYEHERERERERRDVRQRDWERD 1311

Query: 144  RNGD-RRHRVDDRDGDNEKERDHRR-------RYKDDSEEDDRKRNRDRRY 16
             + D  R+R  DR  + E+ERD RR       R   D+ E DR+R+RDR +
Sbjct: 1312 ADKDWPRNRDRDRLRERERERDKRRDLDRERERLLSDALERDRERDRDRTF 1362

[131][TOP]
>UniRef100_UPI0000ECB9CD Probable RNA-binding protein 25 (RNA-binding motif protein 25)
           (RNA- binding region-containing protein 7) (Protein
           S164). n=1 Tax=Gallus gallus RepID=UPI0000ECB9CD
          Length = 782

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 51/148 (34%), Positives = 84/148 (56%), Gaps = 4/148 (2%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           ++RR R+R+ + E+ER  R R ++   + E+E +R+R+R  DR R R  DRD D E++RD
Sbjct: 254 KERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKDRDRDRERDRD 313

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
           R  D         R R  D  K+R R      D E E +R+R+R  + R R  +R+ + E
Sbjct: 314 RDRD---------RERSSDRNKDRSRSREKSRDRERERERERERERE-RERERERERERE 363

Query: 93  KERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           +E+D +R  ++D E+   +R  +R+ R+
Sbjct: 364 REKDKKRDREEDEEDAYERRKLERKLRE 391

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 49/153 (32%), Positives = 84/153 (54%), Gaps = 4/153 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R R+R  R+R+ + E+ER+R    + + E E DR RDR  DR     DR+ D +++RDR
Sbjct: 262 ERERERERREREREREREREREKEKERERERERDRDRDRTKDRDR---DRERDRDRDRDR 318

Query: 270 RGDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD-RRHRVDDRDG 103
              +DR   R     + RD + E+ER+R    + + E E +R+R+R  D +R R +D + 
Sbjct: 319 ERSSDRNKDRSRSREKSRDREREREREREREREREREREREREREREKDKKRDREEDEED 378

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
             E+ +  R+  + ++   +R +N + R R  S
Sbjct: 379 AYERRKLERKLREKEAAYQERLKNWEIRERKKS 411

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 48/157 (30%), Positives = 86/157 (54%), Gaps = 2/157 (1%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 223 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 282

Query: 294 DNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHR 121
           + EKER+R  + DR R   + R RD + +++RDR      D  ++  R R+++ DR R R
Sbjct: 283 EKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDRSRSREKSRDRERER 342

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             +R+ + E+ER+ R R ++   E D+KR+R+    D
Sbjct: 343 ERERERERERERE-REREREREREKDKKRDREEDEED 378

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 53/151 (35%), Positives = 87/151 (57%), Gaps = 9/151 (5%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDR---RGRYKDDSEE-EFDRKRDRNGDR-RHRVDDRDGDN 289
           +R R+R R R+R+ + EKER+R   R R +D +++ + DR+RDR+ DR R R  DR+ D 
Sbjct: 269 RREREREREREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDR 328

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
            + R++  D +R      R R+ + E+ER+R    + + E E D+KRDR  D     + R
Sbjct: 329 SRSREKSRDRER-----EREREREREREREREREREREREREKDKKRDREEDEEDAYERR 383

Query: 108 DGD---NEKERDHRRRYKDDSEEDDRKRNRD 25
             +    EKE  ++ R K + E  +RK++R+
Sbjct: 384 KLERKLREKEAAYQERLK-NWEIRERKKSRE 413

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 52/179 (29%), Positives = 89/179 (49%), Gaps = 24/179 (13%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +R+   +R R+R  RDRD D  K+RDR      D + + +R  DRN DR  R  ++  D 
Sbjct: 281 EREKEKERERERE-RDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDRS-RSREKSRDR 338

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK-------------- 151
           E+ER+R  + +R    E R R+ + E+E+D++   ++D E+ ++R+              
Sbjct: 339 ERERERERERERERERE-REREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQ 397

Query: 150 -RDRNGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRDTS 4
            R +N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR ++
Sbjct: 398 ERLKNWEIRERKKSREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSA 456

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 43/125 (34%), Positives = 67/125 (53%), Gaps = 7/125 (5%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR----RGDNDRRGNGERRHRDDDNEK 208
           ++D  +   R+  +  D   ++++  G  EKER      R + +R    ER  R+ + E+
Sbjct: 217 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 276

Query: 207 ERDR-RGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRK 37
           ER+R R + K+ + E E DR RDR  DR R R  DRD D ++ER   R  KD S   ++ 
Sbjct: 277 EREREREKEKERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRN-KDRSRSREKS 335

Query: 36  RNRDR 22
           R+R+R
Sbjct: 336 RDRER 340

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 52/198 (26%), Positives = 88/198 (44%), Gaps = 58/198 (29%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDR 301
           +R+   +R+RDR R +DRD D E++RDR    +  S+   DR R R   R   R R  +R
Sbjct: 287 ERERERERDRDRDRTKDRDRDRERDRDRDRDRERSSDRNKDRSRSREKSRDRERERERER 346

Query: 300 DGDNEKERDRRGDNDR-RGNGERRHRDDDNE----------------------------K 208
           + + E+ER+R  + +R R   ++R R++D E                            +
Sbjct: 347 EREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIR 406

Query: 207 ERDRRGRYKDDSEEEFDRKR--------------DRNGDR-----------RHRVDDRDG 103
           ER +   Y+ ++E E +R+R              D + DR           + R+ DR+ 
Sbjct: 407 ERKKSREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREK 466

Query: 102 DNEKERDHRRRYKDDSEE 49
           + E +   R+R K++ EE
Sbjct: 467 EMEADERDRKREKEELEE 484

[132][TOP]
>UniRef100_Q4S026 Chromosome 21 SCAF14785, whole genome shotgun sequence. (Fragment)
           n=1 Tax=Tetraodon nigroviridis RepID=Q4S026_TETNG
          Length = 970

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 60/153 (39%), Positives = 80/153 (52%), Gaps = 6/153 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV-DDRDGDNEKERD 274
           +R+RD R RDRD+   K+RD R R   D  E  DR      DR  R   DRD    K+RD
Sbjct: 276 RRDRDER-RDRDERERKDRDERERKDRDERERRDRDERERKDRDERERKDRDERERKDRD 334

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDR----KRDRNG-DRRHRVDDR 109
            R   DR    ERR RD+   K+RD R R   D  E  DR    ++DR+  +RR+RV+DR
Sbjct: 335 ERERKDR-DERERRDRDERERKDRDERERKDRDERERRDRDERERKDRDERERRNRVEDR 393

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             +    RD +   KD+ E +DR+R  +   R+
Sbjct: 394 RFERRDVRDDK---KDEREREDRERKDECERRE 423

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 51/151 (33%), Positives = 77/151 (50%), Gaps = 5/151 (3%)
 Frame = -1

Query: 453 WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           W+ +R+R+    D ++ ++R+R  R  +    + D +RDR+   R   D+R+  +  ER+
Sbjct: 246 WRDDRERKDERPDRESREKRERERREDERERRDRDERRDRDERERKDRDERERKDRDERE 305

Query: 273 RRGDNDR----RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV-DDR 109
           RR  ++R    R   ER+ RD+   K+RD R R   D  E  DR      DR  R   DR
Sbjct: 306 RRDRDERERKDRDERERKDRDERERKDRDERERKDRDERERRDRDERERKDRDERERKDR 365

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRY 16
           D    ++RD R R KD  E + R R  DRR+
Sbjct: 366 DERERRDRDERER-KDRDERERRNRVEDRRF 395

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/147 (35%), Positives = 74/147 (50%), Gaps = 4/147 (2%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD--DRDGDNEKERDRRG 265
           DR  R+   + ++ER+ RG+   D  E  + +R+   DR  + +  DR+   ++ER+RR 
Sbjct: 212 DRHRREERRNGKEEREDRGKKSRDDGERREERREWRDDRERKDERPDRESREKRERERRE 271

Query: 264 DN-DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV-DDRDGDNEK 91
           D  +RR   ERR RD+   K+RD R R   D  E  DR      DR  R   DRD    K
Sbjct: 272 DERERRDRDERRDRDERERKDRDERERKDRDERERRDRDERERKDRDERERKDRDERERK 331

Query: 90  ERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           +RD R R   D  E   +  R+R+ RD
Sbjct: 332 DRDERERKDRDERERRDRDERERKDRD 358

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 54/152 (35%), Positives = 76/152 (50%), Gaps = 6/152 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K  R+ R +   DD E+  +RR  ++DD E + +R    + ++R R    D    ++RD 
Sbjct: 223 KEEREDRGKKSRDDGERREERR-EWRDDRERKDERPDRESREKRERERREDERERRDRDE 281

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV-DDRDGDNE 94
           R D D R   ER+ RD+   K+RD R R   D  E  DR      DR  R   DRD    
Sbjct: 282 RRDRDER---ERKDRDERERKDRDERERRDRDERERKDRDERERKDRDERERKDRDERER 338

Query: 93  KERDHR-RRYKDDSEEDDR----KRNRDRRYR 13
           K+RD R RR +D+ E  DR    +++RD R R
Sbjct: 339 KDRDERERRDRDERERKDRDERERKDRDERER 370

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 53/145 (36%), Positives = 74/145 (51%), Gaps = 2/145 (1%)
 Frame = -1

Query: 450 KRNRDRRYR-DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV-DDRDGDNEKER 277
           +++RD R R DRD+   ++RD R R   D  E  DR      DR  R   DRD    ++R
Sbjct: 290 RKDRDERERKDRDERERRDRDERERKDRDERERKDRDERERKDRDERERKDRDERERRDR 349

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           D R   D R   ER+ RD+   ++RD R R   D  E  +R  DR  +RR   DD+   +
Sbjct: 350 DERERKD-RDERERKDRDERERRDRDERERKDRDERERRNRVEDRRFERRDVRDDK--KD 406

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDR 22
           E+ER+ R R     +E +R+  RDR
Sbjct: 407 EREREDRER----KDECERREGRDR 427

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 50/159 (31%), Positives = 82/159 (51%), Gaps = 12/159 (7%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDR----KRDRNGDRRHRVDDRDGDNEK 283
           + +R++R R+R +D  + RDR  R   D  E  DR    ++DR+   R   D+R+  +  
Sbjct: 259 RESREKRERERREDERERRDRDERRDRDERERKDRDERERKDRDERERRDRDERERKDRD 318

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
           ER+R+ D D R   +R  R+  +  ER+RR R + + ++  +R+R    +R  R  DRD 
Sbjct: 319 ERERK-DRDERERKDRDERERKDRDERERRDRDERERKDRDERERKDRDERERR--DRDE 375

Query: 102 DNEKERDHR--------RRYKDDSEEDDRKRNRDRRYRD 10
              K+RD R        RR++     DD+K  R+R  R+
Sbjct: 376 RERKDRDERERRNRVEDRRFERRDVRDDKKDEREREDRE 414

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 57/147 (38%), Positives = 74/147 (50%), Gaps = 3/147 (2%)
 Frame = -1

Query: 450 KRNRDRRYR-DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           +R+RD R R DRD+   K+RD R R   D  E  DR      D R R  DRD    K+RD
Sbjct: 306 RRDRDERERKDRDERERKDRDERERKDRDERERKDR------DERER-RDRDERERKDRD 358

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK--RDRNGDRRHRVDDRDGD 100
            R   D R   ERR RD+   K+RD R R     +  F+R+  RD   D R R +DR+  
Sbjct: 359 ERERKD-RDERERRDRDERERKDRDERERRNRVEDRRFERRDVRDDKKDERER-EDRERK 416

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDRR 19
           +E ER   R   D+ E+ + K  R+ R
Sbjct: 417 DECERREGRDRWDEREKREEKERRESR 443

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 48/142 (33%), Positives = 69/142 (48%), Gaps = 10/142 (7%)
 Frame = -1

Query: 405 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER-DRRGDNDRRGNGERRH 229
           +++R RR   ++  EE  DR +    D   R + R+  +++ER D R D + R   ER  
Sbjct: 210 QEDRHRREERRNGKEEREDRGKKSRDDGERREERREWRDDRERKDERPDRESREKRERER 269

Query: 228 RDDDNE-------KERDRRGRYKDDSEEEFDR--KRDRNGDRRHRVDDRDGDNEKERDHR 76
           R+D+ E       ++RD R R   D  E  DR  +  R+ D R R  DRD    K+RD R
Sbjct: 270 REDERERRDRDERRDRDERERKDRDERERKDRDERERRDRDERER-KDRDERERKDRDER 328

Query: 75  RRYKDDSEEDDRKRNRDRRYRD 10
            R   D  E   +  R+RR RD
Sbjct: 329 ERKDRDERERKDRDERERRDRD 350

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 47/134 (35%), Positives = 64/134 (47%), Gaps = 4/134 (2%)
 Frame = -1

Query: 399 ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR----RGDNDRRGNGERR 232
           + DRRGR   D +     +R    + RHR ++R    E+  DR    R D +RR   ERR
Sbjct: 187 DADRRGRLPSDLDRGASLQRGPPQEDRHRREERRNGKEEREDRGKKSRDDGERR--EERR 244

Query: 231 HRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSE 52
              DD E++ +R      D E    R+R+R  D R R   RD D  ++RD R R   D  
Sbjct: 245 EWRDDRERKDER-----PDRESREKRERERREDERER---RDRDERRDRDERERKDRDER 296

Query: 51  EDDRKRNRDRRYRD 10
           E   +  R+RR RD
Sbjct: 297 ERKDRDERERRDRD 310

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 51/142 (35%), Positives = 72/142 (50%), Gaps = 6/142 (4%)
 Frame = -1

Query: 450 KRNRDRRYR-DRDDDNEKERDRRGRYKDDSEEEFDR----KRDRNGDRRHRVDDRDGDNE 286
           +++RD R R DRD+   K+RD R R   D  E  DR    ++DR+   R   D+R+  + 
Sbjct: 322 RKDRDERERKDRDERERKDRDERERRDRDERERKDRDERERKDRDERERRDRDERERKDR 381

Query: 285 KERDRRGD-NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
            ER+RR    DRR   ERR   DD + ER+R  R + D   E +R+  R+     R D+R
Sbjct: 382 DERERRNRVEDRR--FERRDVRDDKKDEREREDRERKD---ECERREGRD-----RWDER 431

Query: 108 DGDNEKERDHRRRYKDDSEEDD 43
           +   EKER   R     + E D
Sbjct: 432 EKREEKERRESREASRPASEVD 453

[133][TOP]
>UniRef100_B4ME55 GJ17512 n=1 Tax=Drosophila virilis RepID=B4ME55_DROVI
          Length = 364

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 53/153 (34%), Positives = 87/153 (56%), Gaps = 9/153 (5%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRG------RYKD--DSEEEFDRKRDRNGDRRHRVDDRDG 295
           +R R  R + +    E++RDRRG      R +D  D  EE+DR+R+R  +R  +    + 
Sbjct: 218 RRPRRGRSKSKSRSRERDRDRRGAPSSNARSRDYYDELEEYDRQRNRVRNRDTQNHSTNY 277

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRV 118
           +++ +R + G N+ R +GER  RD D E+ER+R        E   DR+RDRNG+R R+  
Sbjct: 278 NDDYDRRQSGRNENRRDGERDRRDRDRERERER--------ERHGDRERDRNGERERNGE 329

Query: 117 DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            +R+G+ E+ER+  R  + +  + D +  R+RR
Sbjct: 330 RERNGERERERERERSSRYEHRDRDSRNERERR 362

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 51/138 (36%), Positives = 71/138 (51%), Gaps = 13/138 (9%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDR-RGR--------YKDDSEEEF----DRKRDRNGDRRHRVDDR 301
           R R Y D  ++ +++R+R R R        Y DD +       + +RD   DRR    DR
Sbjct: 247 RSRDYYDELEEYDRQRNRVRNRDTQNHSTNYNDDYDRRQSGRNENRRDGERDRR----DR 302

Query: 300 DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 121
           D + E+ER+R GD +R  NGER     +   ER+R G      E E +R+R+R+    HR
Sbjct: 303 DRERERERERHGDRERDRNGER-----ERNGERERNG------ERERERERERSSRYEHR 351

Query: 120 VDDRDGDNEKERDHRRRY 67
             DRD  NE+E   RRRY
Sbjct: 352 --DRDSRNERE---RRRY 364

[134][TOP]
>UniRef100_Q0D0X3 Predicted protein n=1 Tax=Aspergillus terreus NIH2624
           RepID=Q0D0X3_ASPTN
          Length = 731

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 64/169 (37%), Positives = 81/169 (47%), Gaps = 26/169 (15%)
 Frame = -1

Query: 447 RNRDRRY-RDRDDDNEKERDRRGRYKDDS-----EEEFDR---KRDRNGDRRHRVDDRDG 295
           R+  R Y RDRD D+++ R  RGRY+D S     E E+D     R R+ DRR R  DRD 
Sbjct: 469 RSTTRGYDRDRDRDHDRNRS-RGRYRDRSPDRHREREYDSYRGDRSRDRDRRERDRDRDV 527

Query: 294 DNEKERDRRGDND--------RRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN 139
           D ++ER+R  D D        RR     R+R     + R R  R + D E E DR RD  
Sbjct: 528 DRDRERERDRDRDREREDYRRRRSRSRPRYRSRSRRRSRSRSRRRERDRERERDRSRDHG 587

Query: 138 GDRRHRVDDRDGDNEKERD---------HRRRYKDDSEEDDRKRNRDRR 19
            DR     DRD D EKER+          R R    +    R+R+R RR
Sbjct: 588 RDR-----DRDRDREKERERDSEPGRTRERERSASRASASSRRRSRSRR 631

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/131 (38%), Positives = 70/131 (53%), Gaps = 5/131 (3%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKE 280
           R+RDRR RDRD D +++R+R R R +D   E++ R+R R+  R   R R   R     +E
Sbjct: 514 RDRDRRERDRDRDVDRDRERERDRDRDREREDYRRRRSRSRPRYRSRSRRRSRSRSRRRE 573

Query: 279 RDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
           RDR  + DR R +G  R RD D EKER+R      DSE    R+R+R+  R      R  
Sbjct: 574 RDRERERDRSRDHGRDRDRDRDREKERER------DSEPGRTRERERSASRASASSRRRS 627

Query: 102 DNEKERDHRRR 70
            + +    RRR
Sbjct: 628 RSRRRSRSRRR 638

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 65/172 (37%), Positives = 78/172 (45%), Gaps = 26/172 (15%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG----------RYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
           R RD R R R   +  E DRRG          R  DD     D + DR GDR +R   R 
Sbjct: 407 RRRDSRSRSRRRSSRYEDDRRGSRERSARPRERETDDRLPIRDFRHDRYGDRSYRPSRRS 466

Query: 297 GDNEK----ERDRRGDNDR-RGNGERRHRDDDNEKERD----RRGRYKDDSEEEFDRKRD 145
                    +RDR  D+DR R  G  R R  D  +ER+    R  R +D    E DR RD
Sbjct: 467 RSRSTTRGYDRDRDRDHDRNRSRGRYRDRSPDRHREREYDSYRGDRSRDRDRRERDRDRD 526

Query: 144 RNGDRRHRVDDRDGDNEKERDHRR-------RYKDDSEEDDRKRNRDRRYRD 10
            + D R R  DRD D E+E D+RR       RY+  S    R R+R RR RD
Sbjct: 527 VDRD-RERERDRDRDRERE-DYRRRRSRSRPRYRSRSRRRSRSRSR-RRERD 575

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 58/159 (36%), Positives = 81/159 (50%), Gaps = 19/159 (11%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERDR 271
           RD R+ DR  D      RR R +  +   +DR RDR+ DR   R R  DR  D  +ER+ 
Sbjct: 448 RDFRH-DRYGDRSYRPSRRSRSRSTTRG-YDRDRDRDHDRNRSRGRYRDRSPDRHREREY 505

Query: 270 ---RGDNDRRGNGERRHRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR------- 130
              RGD  R  + +RR RD D + +RDR   R R +D   E++ R+R R+  R       
Sbjct: 506 DSYRGDRSR--DRDRRERDRDRDVDRDRERERDRDRDREREDYRRRRSRSRPRYRSRSRR 563

Query: 129 --RHRVDDRDGDNEKERDHRRRYKDDSEED-DRKRNRDR 22
             R R   R+ D E+ERD  R +  D + D DR++ R+R
Sbjct: 564 RSRSRSRRRERDRERERDRSRDHGRDRDRDRDREKERER 602

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 60/167 (35%), Positives = 75/167 (44%), Gaps = 22/167 (13%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDD---SEEEFDRKRDRNGDRRHRV----DDRDGDNEKE 280
           DR    R D   + R R  RY+DD   S E   R R+R  D R  +     DR GD    
Sbjct: 402 DRLKPRRRDSRSRSRRRSSRYEDDRRGSRERSARPRERETDDRLPIRDFRHDRYGDRSYR 461

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDS-----EEEFD-------RKRDRNG 136
             RR  +     G  R RD D+++ R R GRY+D S     E E+D       R RDR  
Sbjct: 462 PSRRSRSRSTTRGYDRDRDRDHDRNRSR-GRYRDRSPDRHREREYDSYRGDRSRDRDRRE 520

Query: 135 DRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR---RYRDTS 4
             R R  DRD + E++RD       D E +D +R R R   RYR  S
Sbjct: 521 RDRDRDVDRDRERERDRDR------DREREDYRRRRSRSRPRYRSRS 561

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 46/169 (27%), Positives = 72/169 (42%), Gaps = 21/169 (12%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKE 280
            R R R R R R+ D E+ERDR   +  D + + DR+++R  D    R R  +R       
Sbjct: 562  RRRSRSRSRRRERDRERERDRSRDHGRDRDRDRDREKERERDSEPGRTRERERSASRASA 621

Query: 279  RDRRGDNDRRGNGERRHR------------DDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
              RR    RR +  RR                +  +   RR R  + +E E +R+R+R  
Sbjct: 622  SSRRRSRSRRRSRSRRRSPSLLDIDRYVPPTSNRSRSPRRRVRSPERAERERERERERER 681

Query: 135  DRRHRVDDRD-----GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            D R R  + D     G  ++ER+       D+++   +R+   R R  S
Sbjct: 682  DDRPRFVEIDRYIPGGQRDQEREKEAERSHDADDRRARRSSPSRRRSRS 730

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 43/140 (30%), Positives = 68/140 (48%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRG 247
           + + D+ EK      R + + EEE  ++R    DR+ R  +R  + E+ER RR + + + 
Sbjct: 174 KTKRDEREKIHQEEMRKQREIEEE-QKRRKAEEDRKQRELERKKE-EEERARRREREEQR 231

Query: 246 NGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRY 67
             E+R  D+  EKER  R  Y+    EE +R RD +     R  DRD    ++RD  R  
Sbjct: 232 RAEQRLLDEQREKERQER--YERRRREERERFRDYD-----RYRDRDRSRTRDRDFDRYR 284

Query: 66  KDDSEEDDRKRNRDRRYRDT 7
           +D S      R    R+R++
Sbjct: 285 RDRSPGYRSDRAISPRHRES 304

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 41/134 (30%), Positives = 65/134 (48%), Gaps = 6/134 (4%)
 Frame = -1

Query: 435 RRYRDRDDDNEK---ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           R+ R+ +++ ++   E DR+ R  +  +EE +R R R  + + R + R  D ++E++R+ 
Sbjct: 189 RKQREIEEEQKRRKAEEDRKQRELERKKEEEERARRREREEQRRAEQRLLDEQREKERQE 248

Query: 264 DNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD--RRHRVDDRDGDNE 94
             +RR   ER R RD D  ++RDR             R RDR+ D  RR R      D  
Sbjct: 249 RYERRRREERERFRDYDRYRDRDR------------SRTRDRDFDRYRRDRSPGYRSDRA 296

Query: 93  KERDHRRRYKDDSE 52
               HR   K+ SE
Sbjct: 297 ISPRHRESRKETSE 310

[135][TOP]
>UniRef100_C1GNA8 Predicted protein n=1 Tax=Paracoccidioides brasiliensis Pb01
            RepID=C1GNA8_PARBA
          Length = 1115

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 60/155 (38%), Positives = 81/155 (52%), Gaps = 11/155 (7%)
 Frame = -1

Query: 450  KRNRDR--------RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
            + N+DR        R RDRD D +++RDR          + DR RDR+ DR     DRD 
Sbjct: 888  RSNKDRSGIEGKPSRQRDRDRDRDRDRDR----------DRDRDRDRDRDR-----DRDR 932

Query: 294  DNEKERDRRGDNDRRGNGER-RHRDDDNE--KERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
            D +K+RDR  D DR  + +R R RD D E  +ERD +     D E E DR RDR   RR 
Sbjct: 933  DRDKDRDRDRDRDRDRDRDRDRDRDKDRERVRERDPKRERDKDREREHDRDRDRKRSRRD 992

Query: 123  RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            R   R+ D E  R H RR K +  E+ +  +R+++
Sbjct: 993  RSVSRE-DTEISRRHARRLKRNEAEEQKAIDREKK 1026

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 57/155 (36%), Positives = 77/155 (49%), Gaps = 7/155 (4%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR--DGDNEKERD 274
            R+   R+RD +  + +        K  S EE      RN D R   D    +G   ++RD
Sbjct: 846  RSLSPRHRDHELGDGEVVGVDPNIKPPSSEEKLDLAIRNSDHRSNKDRSGIEGKPSRQRD 905

Query: 273  RRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGD 100
            R  D DR  + +R R RD D +++RDR      D +++ DR RDR+ DR R R  DRD D
Sbjct: 906  RDRDRDRDRDRDRDRDRDRDRDRDRDR------DRDKDRDRDRDRDRDRDRDRDRDRDKD 959

Query: 99   NEKERDH---RRRYKDDSEEDDRKRNRDRRYRDTS 4
             E+ R+    R R KD   E DR R+R R  RD S
Sbjct: 960  RERVRERDPKRERDKDREREHDRDRDRKRSRRDRS 994

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 47/149 (31%), Positives = 80/149 (53%), Gaps = 6/149 (4%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGD-RRHRVDDRDGDNEKE 280
            R+RDR R RDRD D +++RDR R R +D D + + DR+R R  D +R R  DR+ +++++
Sbjct: 924  RDRDRDRDRDRDKDRDRDRDRDRDRDRDRDRDRDKDRERVRERDPKRERDKDREREHDRD 983

Query: 279  RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
            RDR+    RR     R   + + +   R  R + + ++  DR++     R  R+ ++D  
Sbjct: 984  RDRK--RSRRDRSVSREDTEISRRHARRLKRNEAEEQKAIDREKKSTEHRESRLQEKDPH 1041

Query: 99   N-EKE-RDHRRRYKDDSEEDDRKRNRDRR 19
              E+E R+  R  K+    +    +RD R
Sbjct: 1042 TLEREARNRERLLKEQQRREAMNADRDGR 1070

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 53/159 (33%), Positives = 72/159 (45%), Gaps = 21/159 (13%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNE--KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD----- 292
            R+RDR R RDRD D E  +ERD +     D E E DR RDR   RR R   R+       
Sbjct: 946  RDRDRDRDRDRDKDRERVRERDPKRERDKDREREHDRDRDRKRSRRDRSVSREDTEISRR 1005

Query: 291  -------NEKERDRRGDNDRRGNGERRHR---DDDNEKERDRRGRYKDDSEEEFDRKRDR 142
                   NE E  +  D +++    R  R    D +  ER+ R R +   E++  R+   
Sbjct: 1006 HARRLKRNEAEEQKAIDREKKSTEHRESRLQEKDPHTLEREARNRERLLKEQQ--RREAM 1063

Query: 141  NGDRRHRVDDRDGDNEKERDHRRR---YKDDSEEDDRKR 34
            N DR  R  +R  +N + R    R   YK + EE D+ R
Sbjct: 1064 NADRDGRC-NRSRENRQGRTLGGRHLSYKYEDEESDQAR 1101

[136][TOP]
>UniRef100_B0VBH1 Putative uncharacterized protein n=2 Tax=Acinetobacter baumannii
           RepID=B0VBH1_ACIBY
          Length = 411

 Score = 86.3 bits (212), Expect(2) = 8e-16
 Identities = 61/156 (39%), Positives = 76/156 (48%), Gaps = 14/156 (8%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKERD 274
           R R R   D DDD  +   R RGR +DD +E+ DR R    G  R R DD D D     D
Sbjct: 133 RGRGRDDDDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDED-----D 187

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRHRVD 115
            RG +  RG G  R  DDD + +R R       R RY DD E++   +    G  R R D
Sbjct: 188 DRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRD 247

Query: 114 DRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           D D D+++ R       R RY DD E+DDR R+  R
Sbjct: 248 DDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 283

 Score = 20.8 bits (42), Expect(2) = 8e-16
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -3

Query: 484 RYKDDSEEDD 455
           RY DD E+DD
Sbjct: 115 RYDDDDEDDD 124

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 60/158 (37%), Positives = 76/158 (48%), Gaps = 16/158 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGR---YKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKE 280
           R R RR  D +DD+      RGR    +DD +E+ DR R    G  R R DD D D    
Sbjct: 175 RGRSRRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDED---- 230

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRHR 121
            D RG +  RG G  R  DDD + +R R       R RY DD E++   +    G  R R
Sbjct: 231 -DDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSR 289

Query: 120 VDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 290 RDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 327

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 61/178 (34%), Positives = 80/178 (44%), Gaps = 36/178 (20%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           R R R  RD DDD + +R R G       RY DD E++   +    G  R R DD D D+
Sbjct: 195 RGRGRSRRD-DDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDD 253

Query: 288 EK-----------------ERDRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYK 181
           ++                 E D RG +  RG G  R  DDD + +R R       R RY 
Sbjct: 254 DRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYD 313

Query: 180 DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           DD E++   +    G  R R DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 314 DDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 371

 Score = 80.9 bits (198), Expect(2) = 3e-14
 Identities = 62/162 (38%), Positives = 81/162 (50%), Gaps = 19/162 (11%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           R R R  RD DDD + +R R G       RY DD E++    R R+G R      RD D+
Sbjct: 239 RGRGRSRRD-DDDEDDDRGRSGGRGRGRSRYDDDDEDD---DRGRSGGRGRGRSRRDDDD 294

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYK-DDSEEEFDRKRD-RNGDR 130
           E   D RG +  RG G  R+ DDD + +R R     RGR + DD +E+ DR R    G  
Sbjct: 295 ED--DDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRG 352

Query: 129 RHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDRR 19
           R R DD D D+++ R       R R  DD ++DDR+   D R
Sbjct: 353 RSRYDDDDEDDDRGRSGGRGRGRSRRDDDDDDDDRRGRSDGR 394

 Score = 20.8 bits (42), Expect(2) = 3e-14
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -3

Query: 484 RYKDDSEEDD 455
           RY DD E+DD
Sbjct: 223 RYDDDDEDDD 232

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 61/164 (37%), Positives = 81/164 (49%), Gaps = 16/164 (9%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
           R R R RY D D+D+++ R     RGR +DD +E+ DR R     R    DD D D    
Sbjct: 109 RGRGRSRYDDDDEDDDRGRSGGRGRGRGRDDDDEDDDRGRSGGRGRGRSRDDDDED---- 164

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR---RH 124
            D RG +  RG G  R  DDD + +R R     RGR + D ++E D  R R+G R   R 
Sbjct: 165 -DDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRS 222

Query: 123 RVDDRDGDNEKERD----HRRRYKDDSEEDDRKRNRDRRYRDTS 4
           R DD D D+++ R       R  +DD +EDD +     R R  S
Sbjct: 223 RYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRS 266

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 61/158 (38%), Positives = 79/158 (50%), Gaps = 16/158 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           R R R   D DDD  +   R   R RY DD E++    R R+G R      R  D++ E 
Sbjct: 90  RGRSRYDDDEDDDRGRSSGRGRGRSRYDDDDEDD---DRGRSGGRGR---GRGRDDDDED 143

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR---RHR 121
           D RG +  RG G  R  DDD + +R R     RGR + D ++E D  R R+G R   R R
Sbjct: 144 DDRGRSGGRGRGRSRD-DDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSR 201

Query: 120 VDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 202 RDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 239

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 55/138 (39%), Positives = 71/138 (51%), Gaps = 12/138 (8%)
 Frame = -1

Query: 399 ERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGDNDRRGNGERRHRD 223
           +R+ RGR + D +E+ DR R     R R R DD D D     D RG +  RG G  R  D
Sbjct: 86  DRNGRGRSRYDDDEDDDRGRSSGRGRGRSRYDDDDED-----DDRGRSGGRGRGRGRD-D 139

Query: 222 DDNEKERDR-----RGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKERD-----HR 76
           DD + +R R     RGR +DD +E+ DR R    G  R R DD D D+++ R       R
Sbjct: 140 DDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGR 199

Query: 75  RRYKDDSEEDDRKRNRDR 22
            R  DD E+DDR R+  R
Sbjct: 200 SRRDDDDEDDDRGRSGGR 217

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 60/163 (36%), Positives = 79/163 (48%), Gaps = 15/163 (9%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDN 289
           R R R RY D D+D+++ R     RGR + D ++E D  R R+G R   R R DD D D 
Sbjct: 261 RGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSRYDDDDED- 318

Query: 288 EKERDRRGDNDRRGNGE-RRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGD 133
               D RG +  RG G  RR  DD+++ +R R       R RY DD E++   +    G 
Sbjct: 319 ----DDRGRSGGRGRGRSRRDDDDEDD-DRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGR 373

Query: 132 RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            R R DD D D     D RR   D   ++ R + RD   R TS
Sbjct: 374 GRSRRDDDDDD-----DDRRGRSDGRGQNSRNQKRDAYGRFTS 411

[137][TOP]
>UniRef100_B7I3G3 Putative uncharacterized protein n=1 Tax=Acinetobacter baumannii
           AB0057 RepID=B7I3G3_ACIB5
          Length = 367

 Score = 86.3 bits (212), Expect(2) = 8e-16
 Identities = 61/156 (39%), Positives = 76/156 (48%), Gaps = 14/156 (8%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKERD 274
           R R R   D DDD  +   R RGR +DD +E+ DR R    G  R R DD D D     D
Sbjct: 133 RGRGRDDDDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDED-----D 187

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRHRVD 115
            RG +  RG G  R  DDD + +R R       R RY DD E++   +    G  R R D
Sbjct: 188 DRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRD 247

Query: 114 DRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           D D D+++ R       R RY DD E+DDR R+  R
Sbjct: 248 DDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 283

 Score = 20.8 bits (42), Expect(2) = 8e-16
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -3

Query: 484 RYKDDSEEDD 455
           RY DD E+DD
Sbjct: 115 RYDDDDEDDD 124

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 60/158 (37%), Positives = 76/158 (48%), Gaps = 16/158 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGR---YKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKE 280
           R R RR  D +DD+      RGR    +DD +E+ DR R    G  R R DD D D    
Sbjct: 175 RGRSRRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDED---- 230

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRHR 121
            D RG +  RG G  R  DDD + +R R       R RY DD E++   +    G  R R
Sbjct: 231 -DDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSR 289

Query: 120 VDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 290 RDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 327

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 62/162 (38%), Positives = 81/162 (50%), Gaps = 19/162 (11%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           R R R  RD DDD + +R R G       RY DD E++    R R+G R      RD D+
Sbjct: 195 RGRGRSRRD-DDDEDDDRGRSGGRGRGRSRYDDDDEDD---DRGRSGGRGRGRSRRDDDD 250

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYK-DDSEEEFDRKRD-RNGDR 130
           E   D RG +  RG G  R+ DDD + +R R     RGR + DD +E+ DR R    G  
Sbjct: 251 ED--DDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRG 308

Query: 129 RHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDRR 19
           R R DD D D+++ R       R R  DD ++DDR+   D R
Sbjct: 309 RSRYDDDDEDDDRGRSGGRGRGRSRRDDDDDDDDRRGRSDGR 350

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 61/158 (38%), Positives = 79/158 (50%), Gaps = 16/158 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           R R R   D DDD  +   R   R RY DD E++    R R+G R      R  D++ E 
Sbjct: 90  RGRSRYDDDEDDDRGRSSGRGRGRSRYDDDDEDD---DRGRSGGRGR---GRGRDDDDED 143

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR---RHR 121
           D RG +  RG G  R  DDD + +R R     RGR + D ++E D  R R+G R   R R
Sbjct: 144 DDRGRSGGRGRGRSRD-DDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSR 201

Query: 120 VDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 202 RDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 239

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 55/138 (39%), Positives = 71/138 (51%), Gaps = 12/138 (8%)
 Frame = -1

Query: 399 ERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGDNDRRGNGERRHRD 223
           +R+ RGR + D +E+ DR R     R R R DD D D     D RG +  RG G  R  D
Sbjct: 86  DRNGRGRSRYDDDEDDDRGRSSGRGRGRSRYDDDDED-----DDRGRSGGRGRGRGRD-D 139

Query: 222 DDNEKERDR-----RGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKERD-----HR 76
           DD + +R R     RGR +DD +E+ DR R    G  R R DD D D+++ R       R
Sbjct: 140 DDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGR 199

Query: 75  RRYKDDSEEDDRKRNRDR 22
            R  DD E+DDR R+  R
Sbjct: 200 SRRDDDDEDDDRGRSGGR 217

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 60/163 (36%), Positives = 79/163 (48%), Gaps = 15/163 (9%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDN 289
           R R R RY D D+D+++ R     RGR + D ++E D  R R+G R   R R DD D D 
Sbjct: 217 RGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSRYDDDDED- 274

Query: 288 EKERDRRGDNDRRGNGE-RRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGD 133
               D RG +  RG G  RR  DD+++ +R R       R RY DD E++   +    G 
Sbjct: 275 ----DDRGRSGGRGRGRSRRDDDDEDD-DRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGR 329

Query: 132 RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            R R DD D D     D RR   D   ++ R + RD   R TS
Sbjct: 330 GRSRRDDDDDD-----DDRRGRSDGRGQNSRNQKRDAYGRFTS 367

[138][TOP]
>UniRef100_UPI0001A2D3B9 LOC407680 protein n=1 Tax=Danio rerio RepID=UPI0001A2D3B9
          Length = 448

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/153 (35%), Positives = 76/153 (49%), Gaps = 8/153 (5%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKD----DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           D  + D+D + + E  R  + +     D  +  D + +R+ DRR   DDR   N  +RD 
Sbjct: 285 DGEFTDKDPEEQDEHVRSEQERPVKSADRRDVQDERSERSYDRRSDYDDRRDPNTSQRDD 344

Query: 270 RGD--NDRRGN-GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           R D  NDRR    ++R R DD ++  D R     D ++ +D +RDRN DRR R DDR  D
Sbjct: 345 RDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRYDDRRDRNDDRRDRYDDRYDD 404

Query: 99  NEKERDHRRRYKDDSEEDDRKRNR-DRRYRDTS 4
                D RR   DD  + DR  +R D R R  S
Sbjct: 405 RRDRYDDRRDRHDDRYDSDRYSDRYDSRDRPPS 437

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 54/131 (41%), Positives = 68/131 (51%), Gaps = 4/131 (3%)
 Frame = -1

Query: 450 KRNRDRR--YRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           +R+ DRR  Y DR D N  +RD R    +D  + +D KRDR+ DR+ R DDR       R
Sbjct: 322 ERSYDRRSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDR-------R 374

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR-DGD 100
           +R GD   R        DD  ++  DRR RY D     +D +RDR  DRR R DDR D D
Sbjct: 375 ERNGDRQDR-------YDDRRDRNDDRRDRYDD----RYDDRRDRYDDRRDRHDDRYDSD 423

Query: 99  NEKER-DHRRR 70
              +R D R R
Sbjct: 424 RYSDRYDSRDR 434

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 52/152 (34%), Positives = 76/152 (50%), Gaps = 6/152 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K+N++  Y     ++ +  D+    +D+       +  ++ DRR   D+R   +E+  DR
Sbjct: 271 KKNKEEEYAMGTPEDGEFTDKDPEEQDEHVRSEQERPVKSADRRDVQDER---SERSYDR 327

Query: 270 RGDNDRR---GNGERRHRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
           R D D R      +R  RDD     RDR   +    DD +E +D +R+RNGDR+ R DDR
Sbjct: 328 RSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRYDDR 387

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
              N+  RD   RY DD  +D R R  DRR R
Sbjct: 388 RDRNDDRRD---RY-DDRYDDRRDRYDDRRDR 415

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 42/133 (31%), Positives = 63/133 (47%), Gaps = 10/133 (7%)
 Frame = -1

Query: 381 RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRH-RDDDNEKE 205
           R K + EEE+      +G+      D+D + + E  R        + +RR  +D+ +E+ 
Sbjct: 269 RRKKNKEEEYAMGTPEDGE----FTDKDPEEQDEHVRSEQERPVKSADRRDVQDERSERS 324

Query: 204 RDRRGRY---KDDSEEEFDRKRDRNGDRRHRVD---DRDGDNEKERDHRRRYKDDSE--- 52
            DRR  Y   +D +  + D + DR  DRR R D   DR  D ++  D RR    D +   
Sbjct: 325 YDRRSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRY 384

Query: 51  EDDRKRNRDRRYR 13
           +D R RN DRR R
Sbjct: 385 DDRRDRNDDRRDR 397

[139][TOP]
>UniRef100_UPI0001A2D3B8 UPI0001A2D3B8 related cluster n=1 Tax=Danio rerio
           RepID=UPI0001A2D3B8
          Length = 447

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/153 (35%), Positives = 76/153 (49%), Gaps = 8/153 (5%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKD----DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           D  + D+D + + E  R  + +     D  +  D + +R+ DRR   DDR   N  +RD 
Sbjct: 284 DGEFTDKDPEEQDEHVRSEQERPVKSADRRDVQDERSERSYDRRSDYDDRRDPNTSQRDD 343

Query: 270 RGD--NDRRGN-GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           R D  NDRR    ++R R DD ++  D R     D ++ +D +RDRN DRR R DDR  D
Sbjct: 344 RDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRYDDRRDRNDDRRDRYDDRYDD 403

Query: 99  NEKERDHRRRYKDDSEEDDRKRNR-DRRYRDTS 4
                D RR   DD  + DR  +R D R R  S
Sbjct: 404 RRDRYDDRRDRHDDRYDSDRYSDRYDSRDRPPS 436

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 54/131 (41%), Positives = 68/131 (51%), Gaps = 4/131 (3%)
 Frame = -1

Query: 450 KRNRDRR--YRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           +R+ DRR  Y DR D N  +RD R    +D  + +D KRDR+ DR+ R DDR       R
Sbjct: 321 ERSYDRRSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDR-------R 373

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR-DGD 100
           +R GD   R        DD  ++  DRR RY D     +D +RDR  DRR R DDR D D
Sbjct: 374 ERNGDRQDR-------YDDRRDRNDDRRDRYDD----RYDDRRDRYDDRRDRHDDRYDSD 422

Query: 99  NEKER-DHRRR 70
              +R D R R
Sbjct: 423 RYSDRYDSRDR 433

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 52/152 (34%), Positives = 76/152 (50%), Gaps = 6/152 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K+N++  Y     ++ +  D+    +D+       +  ++ DRR   D+R   +E+  DR
Sbjct: 270 KKNKEEEYAMGTPEDGEFTDKDPEEQDEHVRSEQERPVKSADRRDVQDER---SERSYDR 326

Query: 270 RGDNDRR---GNGERRHRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
           R D D R      +R  RDD     RDR   +    DD +E +D +R+RNGDR+ R DDR
Sbjct: 327 RSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRYDDR 386

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
              N+  RD   RY DD  +D R R  DRR R
Sbjct: 387 RDRNDDRRD---RY-DDRYDDRRDRYDDRRDR 414

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 42/133 (31%), Positives = 63/133 (47%), Gaps = 10/133 (7%)
 Frame = -1

Query: 381 RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRH-RDDDNEKE 205
           R K + EEE+      +G+      D+D + + E  R        + +RR  +D+ +E+ 
Sbjct: 268 RRKKNKEEEYAMGTPEDGE----FTDKDPEEQDEHVRSEQERPVKSADRRDVQDERSERS 323

Query: 204 RDRRGRY---KDDSEEEFDRKRDRNGDRRHRVD---DRDGDNEKERDHRRRYKDDSE--- 52
            DRR  Y   +D +  + D + DR  DRR R D   DR  D ++  D RR    D +   
Sbjct: 324 YDRRSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRY 383

Query: 51  EDDRKRNRDRRYR 13
           +D R RN DRR R
Sbjct: 384 DDRRDRNDDRRDR 396

[140][TOP]
>UniRef100_UPI0001A2C723 hypothetical protein LOC553240 n=1 Tax=Danio rerio
           RepID=UPI0001A2C723
          Length = 434

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 58/176 (32%), Positives = 91/176 (51%), Gaps = 34/176 (19%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD---DRDGDNEKER 277
           +  DRR+ +     ++ERDR G  + D E E DR R R+G+R+   D    RDG+ ++ER
Sbjct: 241 KKTDRRHAETQ---QRERDREGEREGDKERERDRGRQRDGERQRERDGGRQRDGERDRER 297

Query: 276 DRRGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEE--------------EFDR 154
           +R G   R G  +R     R RD + ++ER+R G  + D +               E DR
Sbjct: 298 ERDGGRQRDGERQRERDGGRQRDGERDRERERDGGRQRDGDRDREQERDGGRQRDVERDR 357

Query: 153 KRDRNGDRRHRVD-----DRDG----DNEKERDHRR---RYKDDSEEDDRKRNRDR 22
           +R+R+G R+  V+     +RDG    D E++R+  R   R +D+     R+R+RDR
Sbjct: 358 ERERDGGRQRDVEKVKERERDGGRQRDGERDRERERDGGRQRDEERVRQRERDRDR 413

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 62/168 (36%), Positives = 91/168 (54%), Gaps = 19/168 (11%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDRRHRVD---DRDGDN 289
           +R RDR  R RD + ++ERD  GR +D   D E E D  R R+G+R+   D    RDG+ 
Sbjct: 266 ERERDRG-RQRDGERQRERDG-GRQRDGERDRERERDGGRQRDGERQRERDGGRQRDGER 323

Query: 288 EKERDRRGDNDRRGNGER-------RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
           ++ER+R G   R G+ +R       R RD + ++ER+R G  + D E+  +R+RD    R
Sbjct: 324 DRERERDGGRQRDGDRDREQERDGGRQRDVERDRERERDGGRQRDVEKVKERERDGGRQR 383

Query: 129 RHRVDDRDGDNEKERDHRRRYKDD---SEEDDRKRNRDR---RYRDTS 4
                D + D E+ERD  R+  ++     E DR R RDR   ++RD S
Sbjct: 384 -----DGERDRERERDGGRQRDEERVRQRERDRDRERDRGNGKHRDHS 426

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 58/161 (36%), Positives = 90/161 (55%), Gaps = 15/161 (9%)
 Frame = -1

Query: 468 QRKMIWKRNRDR---RYRDRDD----DNEKERDRRGRYKDDSEEEFDRKRD----RNGDR 322
           QR+    R RD    R R+RD     D E++R+R G  + D E + +R+RD    R+GD 
Sbjct: 280 QRERDGGRQRDGERDRERERDGGRQRDGERQRERDGGRQRDGERDRERERDGGRQRDGD- 338

Query: 321 RHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR 142
           R R  +RDG  +++ +R  + +R G    R RD +  KER+R G  + D E   DR+R+R
Sbjct: 339 RDREQERDGGRQRDVERDRERERDGG---RQRDVEKVKERERDGGRQRDGER--DRERER 393

Query: 141 NGDRR---HRVDDRDGDNEKERDH-RRRYKDDSEEDDRKRN 31
           +G R+    RV  R+ D ++ERD    +++D S E + +RN
Sbjct: 394 DGGRQRDEERVRQRERDRDRERDRGNGKHRDHSREREHRRN 434

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 62/175 (35%), Positives = 89/175 (50%), Gaps = 34/175 (19%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRG------RYKDDSEEEFDRKRDRNGDR---RHRVDDRDGD 292
           NR  R  +++   EKER+R        R+ +  + E DR+ +R GD+   R R   RDG+
Sbjct: 219 NRRDRADEQEQLKEKEREREEGKKTDRRHAETQQRERDREGEREGDKERERDRGRQRDGE 278

Query: 291 NEKERD--RRGDNDRRGNGER---RHRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNG 136
            ++ERD  R+ D +R    ER   R RD + ++ERD  GR +D   D E E D  R R+G
Sbjct: 279 RQRERDGGRQRDGERDRERERDGGRQRDGERQRERD-GGRQRDGERDRERERDGGRQRDG 337

Query: 135 DRRHRVDDRDG--------DNEKERDHRR---------RYKDDSEEDDRKRNRDR 22
           D R R  +RDG        D E+ERD  R         R +D   + D +R+R+R
Sbjct: 338 D-RDREQERDGGRQRDVERDRERERDGGRQRDVEKVKERERDGGRQRDGERDRER 391

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 45/170 (26%), Positives = 81/170 (47%), Gaps = 27/170 (15%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNE--KERDRRGRYKDDSEEEFDRKRDRN-------------GDRRH 316
           K+ + ++ +++ +  +  KE  R GR +  +      K+++               +RR 
Sbjct: 163 KKEKKKKKKEKKEKKKALKEEKREGRSESSASSPIRVKKEKEDVAYEKYSVKGPAANRRD 222

Query: 315 RVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
           R D+++   EKER+R       G    R   +  ++ERDR G  + D E E DR R R+G
Sbjct: 223 RADEQEQLKEKERERE-----EGKKTDRRHAETQQRERDREGEREGDKERERDRGRQRDG 277

Query: 135 DRRHRVD---DRDGDNEKERD---------HRRRYKDDSEEDDRKRNRDR 22
           +R+   D    RDG+ ++ER+          R+R +D   + D +R+R+R
Sbjct: 278 ERQRERDGGRQRDGERDRERERDGGRQRDGERQRERDGGRQRDGERDRER 327

[141][TOP]
>UniRef100_UPI0000D8DE03 UPI0000D8DE03 related cluster n=1 Tax=Danio rerio
           RepID=UPI0000D8DE03
          Length = 523

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 54/156 (34%), Positives = 84/156 (53%), Gaps = 1/156 (0%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +R+   K  +++ ++DRD D  KE++R      D ++   RK DR GDRR R  DR+ D 
Sbjct: 278 ERERERKEIKEKSHKDRDRDRAKEKERERMR--DKDKHSHRKEDRGGDRR-RERDREEDR 334

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
            ++R  R  +DR G  +RR+     ++ERDR+G          DR+RDR G+R     DR
Sbjct: 335 ARDRRDRDRDDRHGKRDRRN-SSPKDRERDRKGERDRRDNSPKDRERDRKGER-----DR 388

Query: 108 DGDNEKERDHRRRYKDDSEEDDRK-RNRDRRYRDTS 4
             ++ K+R+   R K   +  D+  ++RDR  RD S
Sbjct: 389 RDNSPKDRERETRDKSPKDRRDKSPKDRDRERRDKS 424

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 59/157 (37%), Positives = 86/157 (54%), Gaps = 15/157 (9%)
 Frame = -1

Query: 435 RRYR------DRDDDNEKERDRRG----RYKD---DSEEEFDRKRDRNGDRR-HRVDDRD 298
           R+YR      D DD +E+ER+R+      +KD   D  +E +R+R R+ D+  HR +DR 
Sbjct: 262 RQYRQKSPLSDSDDGDERERERKEIKEKSHKDRDRDRAKEKERERMRDKDKHSHRKEDRG 321

Query: 297 GDNEKERDRRGDNDRRGNGERRHRD-DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 121
           GD  +ERDR  D  R    +RR RD DD   +RDRR      +    DR+RDR G+R  R
Sbjct: 322 GDRRRERDREEDRAR----DRRDRDRDDRHGKRDRR------NSSPKDRERDRKGERDRR 371

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            D+   D E++R   R  +D+S +D  +  RD+  +D
Sbjct: 372 -DNSPKDRERDRKGERDRRDNSPKDRERETRDKSPKD 407

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 56/171 (32%), Positives = 91/171 (53%), Gaps = 22/171 (12%)
 Frame = -1

Query: 471 IQRKMIWKRNRDR-------RYRDRDDDNEKERDRRGRYKDDSEEEFDR---KRDRNGDR 322
           I+ K    R+RDR       R RD+D  + ++ DR G  + + + E DR   +RDR+ D 
Sbjct: 286 IKEKSHKDRDRDRAKEKERERMRDKDKHSHRKEDRGGDRRRERDREEDRARDRRDRDRDD 345

Query: 321 RHRVDDRDGDNEK--ERDRRGDNDRRGNGER---------RHRDDDNEKERDRRGRYKDD 175
           RH   DR   + K  ERDR+G+ DRR N  +         R R D++ K+R+R  R K  
Sbjct: 346 RHGKRDRRNSSPKDRERDRKGERDRRDNSPKDRERDRKGERDRRDNSPKDRERETRDKSP 405

Query: 174 SEEEFDRKRDRNGDRRHR-VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
            +      +DR+ +RR +   DR+ + + ERD R R  +D++ D +++N++
Sbjct: 406 KDRRDKSPKDRDRERRDKSPKDREPERKGERDIRER--EDNKVDSQRKNQE 454

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 51/158 (32%), Positives = 74/158 (46%), Gaps = 13/158 (8%)
 Frame = -1

Query: 483 GIRMIQRKMIWKRNRDRRYRDRDDDN-----------EKERDRRGRYKDDSEEEFDRKRD 337
           G R  +R     R RDRR RDRDD +           ++ERDR+G          DR+RD
Sbjct: 322 GDRRRERDREEDRARDRRDRDRDDRHGKRDRRNSSPKDRERDRKGERDRRDNSPKDRERD 381

Query: 336 RNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFD 157
           R G+R  R D+   D E+E   +   DRR         D + K+RDR  R K   + E +
Sbjct: 382 RKGERDRR-DNSPKDRERETRDKSPKDRR---------DKSPKDRDRERRDKSPKDREPE 431

Query: 156 RKRDRNGDRR--HRVDDRDGDNEKERDHRRRYKDDSEE 49
           RK +R+   R  ++VD +  + E E+    + +   EE
Sbjct: 432 RKGERDIREREDNKVDSQRKNQEDEKSSESKTEHGKEE 469

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 44/151 (29%), Positives = 66/151 (43%), Gaps = 21/151 (13%)
 Frame = -1

Query: 408 NEKERDRRGRYKDDSEE---EFDRKRDRNGDRRHR-----VDDRDGDNEKERDRRGDNDR 253
           N +E +      DD  +    F +    N  +R       + D D  +E+ER+R+   ++
Sbjct: 230 NRRESEAESHSDDDQVDVKPAFSKTTANNHAKRQYRQKSPLSDSDDGDERERERKEIKEK 289

Query: 252 RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR 73
                 + RD D  KE++R      D ++   RK DR GDRR    +RD + ++ RD R 
Sbjct: 290 ----SHKDRDRDRAKEKER--ERMRDKDKHSHRKEDRGGDRRR---ERDREEDRARDRRD 340

Query: 72  RYKDD-------------SEEDDRKRNRDRR 19
           R +DD               E DRK  RDRR
Sbjct: 341 RDRDDRHGKRDRRNSSPKDRERDRKGERDRR 371

[142][TOP]
>UniRef100_UPI000056C11A Coiled-coil domain-containing protein 55. n=1 Tax=Danio rerio
           RepID=UPI000056C11A
          Length = 527

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 54/156 (34%), Positives = 84/156 (53%), Gaps = 1/156 (0%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +R+   K  +++ ++DRD D  KE++R      D ++   RK DR GDRR R  DR+ D 
Sbjct: 282 ERERERKEIKEKSHKDRDRDRAKEKERERMR--DKDKHSHRKEDRGGDRR-RERDREEDR 338

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
            ++R  R  +DR G  +RR+     ++ERDR+G          DR+RDR G+R     DR
Sbjct: 339 ARDRRDRDRDDRHGKRDRRN-SSPKDRERDRKGERDRRDNSPKDRERDRKGER-----DR 392

Query: 108 DGDNEKERDHRRRYKDDSEEDDRK-RNRDRRYRDTS 4
             ++ K+R+   R K   +  D+  ++RDR  RD S
Sbjct: 393 RDNSPKDRERETRDKSPKDRRDKSPKDRDRERRDKS 428

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 59/157 (37%), Positives = 86/157 (54%), Gaps = 15/157 (9%)
 Frame = -1

Query: 435 RRYR------DRDDDNEKERDRRG----RYKD---DSEEEFDRKRDRNGDRR-HRVDDRD 298
           R+YR      D DD +E+ER+R+      +KD   D  +E +R+R R+ D+  HR +DR 
Sbjct: 266 RQYRQKSPLSDSDDGDERERERKEIKEKSHKDRDRDRAKEKERERMRDKDKHSHRKEDRG 325

Query: 297 GDNEKERDRRGDNDRRGNGERRHRD-DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 121
           GD  +ERDR  D  R    +RR RD DD   +RDRR      +    DR+RDR G+R  R
Sbjct: 326 GDRRRERDREEDRAR----DRRDRDRDDRHGKRDRR------NSSPKDRERDRKGERDRR 375

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            D+   D E++R   R  +D+S +D  +  RD+  +D
Sbjct: 376 -DNSPKDRERDRKGERDRRDNSPKDRERETRDKSPKD 411

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 56/171 (32%), Positives = 91/171 (53%), Gaps = 22/171 (12%)
 Frame = -1

Query: 471 IQRKMIWKRNRDR-------RYRDRDDDNEKERDRRGRYKDDSEEEFDR---KRDRNGDR 322
           I+ K    R+RDR       R RD+D  + ++ DR G  + + + E DR   +RDR+ D 
Sbjct: 290 IKEKSHKDRDRDRAKEKERERMRDKDKHSHRKEDRGGDRRRERDREEDRARDRRDRDRDD 349

Query: 321 RHRVDDRDGDNEK--ERDRRGDNDRRGNGER---------RHRDDDNEKERDRRGRYKDD 175
           RH   DR   + K  ERDR+G+ DRR N  +         R R D++ K+R+R  R K  
Sbjct: 350 RHGKRDRRNSSPKDRERDRKGERDRRDNSPKDRERDRKGERDRRDNSPKDRERETRDKSP 409

Query: 174 SEEEFDRKRDRNGDRRHR-VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
            +      +DR+ +RR +   DR+ + + ERD R R  +D++ D +++N++
Sbjct: 410 KDRRDKSPKDRDRERRDKSPKDREPERKGERDIRER--EDNKVDSQRKNQE 458

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 51/158 (32%), Positives = 74/158 (46%), Gaps = 13/158 (8%)
 Frame = -1

Query: 483 GIRMIQRKMIWKRNRDRRYRDRDDDN-----------EKERDRRGRYKDDSEEEFDRKRD 337
           G R  +R     R RDRR RDRDD +           ++ERDR+G          DR+RD
Sbjct: 326 GDRRRERDREEDRARDRRDRDRDDRHGKRDRRNSSPKDRERDRKGERDRRDNSPKDRERD 385

Query: 336 RNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFD 157
           R G+R  R D+   D E+E   +   DRR         D + K+RDR  R K   + E +
Sbjct: 386 RKGERDRR-DNSPKDRERETRDKSPKDRR---------DKSPKDRDRERRDKSPKDREPE 435

Query: 156 RKRDRNGDRR--HRVDDRDGDNEKERDHRRRYKDDSEE 49
           RK +R+   R  ++VD +  + E E+    + +   EE
Sbjct: 436 RKGERDIREREDNKVDSQRKNQEDEKSSESKTEHGKEE 473

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 44/151 (29%), Positives = 66/151 (43%), Gaps = 21/151 (13%)
 Frame = -1

Query: 408 NEKERDRRGRYKDDSEE---EFDRKRDRNGDRRHR-----VDDRDGDNEKERDRRGDNDR 253
           N +E +      DD  +    F +    N  +R       + D D  +E+ER+R+   ++
Sbjct: 234 NRRESEAESHSDDDQVDVKPAFSKTTANNHAKRQYRQKSPLSDSDDGDERERERKEIKEK 293

Query: 252 RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR 73
                 + RD D  KE++R      D ++   RK DR GDRR    +RD + ++ RD R 
Sbjct: 294 ----SHKDRDRDRAKEKER--ERMRDKDKHSHRKEDRGGDRRR---ERDREEDRARDRRD 344

Query: 72  RYKDD-------------SEEDDRKRNRDRR 19
           R +DD               E DRK  RDRR
Sbjct: 345 RDRDDRHGKRDRRNSSPKDRERDRKGERDRR 375

[143][TOP]
>UniRef100_Q6NW88 Sc:d0144 protein (Fragment) n=1 Tax=Danio rerio RepID=Q6NW88_DANRE
          Length = 442

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/153 (35%), Positives = 76/153 (49%), Gaps = 8/153 (5%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKD----DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           D  + D+D + + E  R  + +     D  +  D + +R+ DRR   DDR   N  +RD 
Sbjct: 279 DGEFTDKDPEEQDEHVRSEQERPVKSADRRDVQDERSERSYDRRSDYDDRRDPNTSQRDD 338

Query: 270 RGD--NDRRGN-GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           R D  NDRR    ++R R DD ++  D R     D ++ +D +RDRN DRR R DDR  D
Sbjct: 339 RDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRYDDRRDRNDDRRDRYDDRYDD 398

Query: 99  NEKERDHRRRYKDDSEEDDRKRNR-DRRYRDTS 4
                D RR   DD  + DR  +R D R R  S
Sbjct: 399 RRDRYDDRRDRHDDRYDSDRYSDRYDSRDRPPS 431

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 54/131 (41%), Positives = 68/131 (51%), Gaps = 4/131 (3%)
 Frame = -1

Query: 450 KRNRDRR--YRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           +R+ DRR  Y DR D N  +RD R    +D  + +D KRDR+ DR+ R DDR       R
Sbjct: 316 ERSYDRRSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDR-------R 368

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR-DGD 100
           +R GD   R        DD  ++  DRR RY D     +D +RDR  DRR R DDR D D
Sbjct: 369 ERNGDRQDR-------YDDRRDRNDDRRDRYDD----RYDDRRDRYDDRRDRHDDRYDSD 417

Query: 99  NEKER-DHRRR 70
              +R D R R
Sbjct: 418 RYSDRYDSRDR 428

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 52/152 (34%), Positives = 76/152 (50%), Gaps = 6/152 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K+N++  Y     ++ +  D+    +D+       +  ++ DRR   D+R   +E+  DR
Sbjct: 265 KKNKEEEYAMGTPEDGEFTDKDPEEQDEHVRSEQERPVKSADRRDVQDER---SERSYDR 321

Query: 270 RGDNDRR---GNGERRHRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
           R D D R      +R  RDD     RDR   +    DD +E +D +R+RNGDR+ R DDR
Sbjct: 322 RSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRYDDR 381

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
              N+  RD   RY DD  +D R R  DRR R
Sbjct: 382 RDRNDDRRD---RY-DDRYDDRRDRYDDRRDR 409

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 42/133 (31%), Positives = 63/133 (47%), Gaps = 10/133 (7%)
 Frame = -1

Query: 381 RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRH-RDDDNEKE 205
           R K + EEE+      +G+      D+D + + E  R        + +RR  +D+ +E+ 
Sbjct: 263 RRKKNKEEEYAMGTPEDGE----FTDKDPEEQDEHVRSEQERPVKSADRRDVQDERSERS 318

Query: 204 RDRRGRY---KDDSEEEFDRKRDRNGDRRHRVD---DRDGDNEKERDHRRRYKDDSE--- 52
            DRR  Y   +D +  + D + DR  DRR R D   DR  D ++  D RR    D +   
Sbjct: 319 YDRRSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRY 378

Query: 51  EDDRKRNRDRRYR 13
           +D R RN DRR R
Sbjct: 379 DDRRDRNDDRRDR 391

[144][TOP]
>UniRef100_A4JYJ3 CDNA, clone cssl:d0144 n=1 Tax=Danio rerio RepID=A4JYJ3_DANRE
          Length = 447

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/153 (35%), Positives = 76/153 (49%), Gaps = 8/153 (5%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKD----DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           D  + D+D + + E  R  + +     D  +  D + +R+ DRR   DDR   N  +RD 
Sbjct: 284 DGEFTDKDPEEQDEHVRSEQERPVKSADRRDVQDERSERSYDRRSDYDDRRDPNTSQRDD 343

Query: 270 RGD--NDRRGN-GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           R D  NDRR    ++R R DD ++  D R     D ++ +D +RDRN DRR R DDR  D
Sbjct: 344 RDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRYDDRRDRNDDRRDRYDDRYDD 403

Query: 99  NEKERDHRRRYKDDSEEDDRKRNR-DRRYRDTS 4
                D RR   DD  + DR  +R D R R  S
Sbjct: 404 RRDRYDDRRDRHDDRYDSDRYSDRYDSRDRPPS 436

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 54/131 (41%), Positives = 68/131 (51%), Gaps = 4/131 (3%)
 Frame = -1

Query: 450 KRNRDRR--YRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           +R+ DRR  Y DR D N  +RD R    +D  + +D KRDR+ DR+ R DDR       R
Sbjct: 321 ERSYDRRSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDR-------R 373

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR-DGD 100
           +R GD   R        DD  ++  DRR RY D     +D +RDR  DRR R DDR D D
Sbjct: 374 ERNGDRQDR-------YDDRRDRNDDRRDRYDD----RYDDRRDRYDDRRDRHDDRYDSD 422

Query: 99  NEKER-DHRRR 70
              +R D R R
Sbjct: 423 RYSDRYDSRDR 433

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 52/152 (34%), Positives = 76/152 (50%), Gaps = 6/152 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K+N++  Y     ++ +  D+    +D+       +  ++ DRR   D+R   +E+  DR
Sbjct: 270 KKNKEEEYAMGTPEDGEFTDKDPEEQDEHVRSEQERPVKSADRRDVQDER---SERSYDR 326

Query: 270 RGDNDRR---GNGERRHRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
           R D D R      +R  RDD     RDR   +    DD +E +D +R+RNGDR+ R DDR
Sbjct: 327 RSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRYDDR 386

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
              N+  RD   RY DD  +D R R  DRR R
Sbjct: 387 RDRNDDRRD---RY-DDRYDDRRDRYDDRRDR 414

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 42/133 (31%), Positives = 63/133 (47%), Gaps = 10/133 (7%)
 Frame = -1

Query: 381 RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRH-RDDDNEKE 205
           R K + EEE+      +G+      D+D + + E  R        + +RR  +D+ +E+ 
Sbjct: 268 RRKKNKEEEYAMGTPEDGE----FTDKDPEEQDEHVRSEQERPVKSADRRDVQDERSERS 323

Query: 204 RDRRGRY---KDDSEEEFDRKRDRNGDRRHRVD---DRDGDNEKERDHRRRYKDDSE--- 52
            DRR  Y   +D +  + D + DR  DRR R D   DR  D ++  D RR    D +   
Sbjct: 324 YDRRSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRY 383

Query: 51  EDDRKRNRDRRYR 13
           +D R RN DRR R
Sbjct: 384 DDRRDRNDDRRDR 396

[145][TOP]
>UniRef100_A1L1N9 Sc:d0144 protein (Fragment) n=1 Tax=Danio rerio RepID=A1L1N9_DANRE
          Length = 444

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/153 (35%), Positives = 76/153 (49%), Gaps = 8/153 (5%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKD----DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           D  + D+D + + E  R  + +     D  +  D + +R+ DRR   DDR   N  +RD 
Sbjct: 281 DGEFTDKDPEEQDEHVRSEQERPVKSADRRDVQDERSERSYDRRSDYDDRRDPNTSQRDD 340

Query: 270 RGD--NDRRGN-GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           R D  NDRR    ++R R DD ++  D R     D ++ +D +RDRN DRR R DDR  D
Sbjct: 341 RDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRYDDRRDRNDDRRDRYDDRYDD 400

Query: 99  NEKERDHRRRYKDDSEEDDRKRNR-DRRYRDTS 4
                D RR   DD  + DR  +R D R R  S
Sbjct: 401 RRDRYDDRRDRHDDRYDSDRYSDRYDSRDRPPS 433

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 54/131 (41%), Positives = 68/131 (51%), Gaps = 4/131 (3%)
 Frame = -1

Query: 450 KRNRDRR--YRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           +R+ DRR  Y DR D N  +RD R    +D  + +D KRDR+ DR+ R DDR       R
Sbjct: 318 ERSYDRRSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDR-------R 370

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR-DGD 100
           +R GD   R        DD  ++  DRR RY D     +D +RDR  DRR R DDR D D
Sbjct: 371 ERNGDRQDR-------YDDRRDRNDDRRDRYDD----RYDDRRDRYDDRRDRHDDRYDSD 419

Query: 99  NEKER-DHRRR 70
              +R D R R
Sbjct: 420 RYSDRYDSRDR 430

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 52/152 (34%), Positives = 76/152 (50%), Gaps = 6/152 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K+N++  Y     ++ +  D+    +D+       +  ++ DRR   D+R   +E+  DR
Sbjct: 267 KKNKEEEYAMGTPEDGEFTDKDPEEQDEHVRSEQERPVKSADRRDVQDER---SERSYDR 323

Query: 270 RGDNDRR---GNGERRHRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
           R D D R      +R  RDD     RDR   +    DD +E +D +R+RNGDR+ R DDR
Sbjct: 324 RSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRYDDR 383

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
              N+  RD   RY DD  +D R R  DRR R
Sbjct: 384 RDRNDDRRD---RY-DDRYDDRRDRYDDRRDR 411

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 42/133 (31%), Positives = 63/133 (47%), Gaps = 10/133 (7%)
 Frame = -1

Query: 381 RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRH-RDDDNEKE 205
           R K + EEE+      +G+      D+D + + E  R        + +RR  +D+ +E+ 
Sbjct: 265 RRKKNKEEEYAMGTPEDGE----FTDKDPEEQDEHVRSEQERPVKSADRRDVQDERSERS 320

Query: 204 RDRRGRY---KDDSEEEFDRKRDRNGDRRHRVD---DRDGDNEKERDHRRRYKDDSE--- 52
            DRR  Y   +D +  + D + DR  DRR R D   DR  D ++  D RR    D +   
Sbjct: 321 YDRRSDYDDRRDPNTSQRDDRDDRYNDRRDRYDDKRDRSDDRQERYDDRRERNGDRQDRY 380

Query: 51  EDDRKRNRDRRYR 13
           +D R RN DRR R
Sbjct: 381 DDRRDRNDDRRDR 393

[146][TOP]
>UniRef100_B3LCU9 Putative uncharacterized protein n=1 Tax=Plasmodium knowlesi strain
           H RepID=B3LCU9_PLAKH
          Length = 585

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/141 (39%), Positives = 76/141 (53%), Gaps = 3/141 (2%)
 Frame = -1

Query: 435 RRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDND 256
           R  +   DD+ +       Y+  S +E   ++ R  DR H   DR  D EKE++R  + +
Sbjct: 369 RERKSNPDDDTRTYYNGENYRKRSSDESRERKYRKMDRHHH-RDRKSDREKEKEREKEKE 427

Query: 255 RRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 82
           R      +HR  D E+ R  RGR KD DSE E DR RD++ DR R R  DRD D +++RD
Sbjct: 428 RE-----KHRLKDKERSRKERGREKDKDSERERDRDRDKDRDRDRDRDRDRDKDRDRDRD 482

Query: 81  HRR-RYKDDSEEDDRKRNRDR 22
             R R +D   E DR+R RD+
Sbjct: 483 RDRDRDRDRDRERDRERERDK 503

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 53/158 (33%), Positives = 79/158 (50%), Gaps = 8/158 (5%)
 Frame = -1

Query: 465 RKMIWKRNRDRRY--------RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 310
           RK     +R+R+Y        RDR  D EKE++R    + + E E  R +D+   R+ R 
Sbjct: 389 RKRSSDESRERKYRKMDRHHHRDRKSDREKEKER----EKEKEREKHRLKDKERSRKERG 444

Query: 309 DDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
            ++D D+E+ERDR  D DR      R RD D +K+RDR      D + + DR+RDR  + 
Sbjct: 445 REKDKDSERERDRDRDKDR---DRDRDRDRDRDKDRDRDRDRDRDRDRDRDRERDRERE- 500

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRY 16
           R +  DR    E+E+   +    + E+   K  RD  Y
Sbjct: 501 RDKGKDRTKTKEREKAKSKHKSKNKEKGKSKGKRDENY 538

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 48/137 (35%), Positives = 73/137 (53%), Gaps = 1/137 (0%)
 Frame = -1

Query: 429 YRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRR 250
           YR R  D  +ER  R   K D     DRK DR  ++     +R+ + E+E+ R  D +R 
Sbjct: 388 YRKRSSDESRERKYR---KMDRHHHRDRKSDREKEK-----EREKEKEREKHRLKDKERS 439

Query: 249 GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRR 73
                R +D D+E+ERDR      D + + DR RD++ DR R R  DRD D ++ERD R 
Sbjct: 440 RKERGREKDKDSERERDRDRDKDRDRDRDRDRDRDKDRDRDRDRDRDRDRDRDRERD-RE 498

Query: 72  RYKDDSEEDDRKRNRDR 22
           R +D  ++  + + R++
Sbjct: 499 RERDKGKDRTKTKEREK 515

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 48/148 (32%), Positives = 75/148 (50%), Gaps = 5/148 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDR---RGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGDNE 286
           +R+R  R R++D D+E+ERDR   + R +D D + + D+ RDR+ DR R R  DRD + +
Sbjct: 437 ERSRKERGREKDKDSERERDRDRDKDRDRDRDRDRDRDKDRDRDRDRDRDRDRDRDRERD 496

Query: 285 KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
           +ER+R    DR    ER      ++ +   +G+ K   +E +D        RR   D  D
Sbjct: 497 RERERDKGKDRTKTKEREKAKSKHKSKNKEKGKSKGKRDENYDSSNYSEPKRRSTKDHGD 556

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRDR 22
                 RDH    K + + DD+  + DR
Sbjct: 557 ----DHRDHSNTSK-NGDADDKADDFDR 579

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 46/144 (31%), Positives = 63/144 (43%), Gaps = 9/144 (6%)
 Frame = -1

Query: 414 DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRG--NG 241
           +DN +  +R  +Y+ D      R  +     R     R   + +ER    D+D R   NG
Sbjct: 327 EDNHRAGERYSKYRQDDTHSNIRDEEEESGWREGYK-RSDSHLRERKSNPDDDTRTYYNG 385

Query: 240 ER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDNEKERDH 79
           E  R R  D  +ER  R   K D     DRK DR  ++     + R   R  D E+ R  
Sbjct: 386 ENYRKRSSDESRERKYR---KMDRHHHRDRKSDREKEKEREKEKEREKHRLKDKERSRKE 442

Query: 78  RRRYKDDSEEDDRKRNRDR-RYRD 10
           R R KD   E +R R+RD+ R RD
Sbjct: 443 RGREKDKDSERERDRDRDKDRDRD 466

[147][TOP]
>UniRef100_B3L0D0 Putative uncharacterized protein n=1 Tax=Plasmodium knowlesi strain H
            RepID=B3L0D0_PLAKH
          Length = 971

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 61/156 (39%), Positives = 81/156 (51%), Gaps = 13/156 (8%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKER 277
            +RN +R R R+RD   E ERDR    + D   E +R R R  +R R R  +RD   E ER
Sbjct: 654  RRNMERDRSRERDRPREAERDRPREAERDRPREAERDRPREAERDRPREAERDRPREAER 713

Query: 276  DRR--GDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHR 121
            DR+   + DR+   ER       RD   E ERDR+   + D + E +R R R  +R R R
Sbjct: 714  DRQREAERDRQREAERDRPREAERDRQREAERDRQREAERDRQREAERDRQREAERDRQR 773

Query: 120  VDDRDGDNEKERDH---RRRYKDDSEEDDRKRNRDR 22
              +RD   E ERD    R R ++   E DR+R+RDR
Sbjct: 774  EAERDRQREAERDRQTLRERDRERDRERDRERDRDR 809

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 59/162 (36%), Positives = 81/162 (50%), Gaps = 10/162 (6%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDD 304
            R  +R    +  RDR R  +RD   E ERDR    + D   E +R R R  +R R R  +
Sbjct: 669  REAERDRPREAERDRPREAERDRPREAERDRPREAERDRPREAERDRQREAERDRQREAE 728

Query: 303  RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-- 130
            RD   E ERDR+ + +R    E   RD   E ERDR+   + D + E +R R R  +R  
Sbjct: 729  RDRPREAERDRQREAERDRQREAE-RDRQREAERDRQREAERDRQREAERDRQREAERDR 787

Query: 129  -----RHRVDDRDGDNEKERDHRR-RYKDDSEEDDRKRNRDR 22
                 R R  DR+ D E++RD  R R ++   E +R+R RDR
Sbjct: 788  QTLRERDRERDRERDRERDRDRERDRNREAERERERERERDR 829

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 60/153 (39%), Positives = 78/153 (50%), Gaps = 11/153 (7%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
            R RDR R  +RD   E ERDR    + D   E +R R R  +R R R  +RD   E ERD
Sbjct: 663  RERDRPREAERDRPREAERDRPREAERDRPREAERDRPREAERDRPREAERDRQREAERD 722

Query: 273  RR--GDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRV 118
            R+   + DR    ER       RD   E ERDR+   + D + E +R R R  +R R R 
Sbjct: 723  RQREAERDRPREAERDRQREAERDRQREAERDRQREAERDRQREAERDRQREAERDRQRE 782

Query: 117  DDRDGDNEKERDHRRRYKDDSEED-DRKRNRDR 22
             +RD    +ERD  R  + D E D DR+R+R+R
Sbjct: 783  AERDRQTLRERDRERDRERDRERDRDRERDRNR 815

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 60/171 (35%), Positives = 86/171 (50%), Gaps = 15/171 (8%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDD 304
            R  +R    +  RDR R  +RD   E ERDR+   + D   E +R R R  +R R R  +
Sbjct: 693  REAERDRPREAERDRPREAERDRQREAERDRQREAERDRPREAERDRQREAERDRQREAE 752

Query: 303  RDGDNEKERDRR--GDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRD 145
            RD   E ERDR+   + DR+   ER       RD    +ERDR    + D E + DR+RD
Sbjct: 753  RDRQREAERDRQREAERDRQREAERDRQREAERDRQTLRERDRERDRERDRERDRDRERD 812

Query: 144  RNGD-----RRHRVDDRDGDNEKERDH-RRRYKDDSEEDDRKRNRDRRYRD 10
            RN +      R R  DR+ D E+ER+    R +D + E +  R+R+R + +
Sbjct: 813  RNREAERERERERERDRNRDAERERNRDAERERDRNREAEWDRHRERHFEN 863

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 55/153 (35%), Positives = 77/153 (50%), Gaps = 11/153 (7%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD-- 274
            R RD R ++  +  EK R+R G  + + E +F+R + RN +R  R  +RD   E ERD  
Sbjct: 621  RERDNRNKEEGEKLEK-RNRPG--EAEREGDFERAKRRNMER-DRSRERDRPREAERDRP 676

Query: 273  RRGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDD 112
            R  + DR    ER       RD   E ERDR    + D + E +R R R  +R R R  +
Sbjct: 677  REAERDRPREAERDRPREAERDRPREAERDRPREAERDRQREAERDRQREAERDRPREAE 736

Query: 111  RDGDNEKERDHRRRYKDDSE---EDDRKRNRDR 22
            RD   E ERD +R  + D +   E DR+R  +R
Sbjct: 737  RDRQREAERDRQREAERDRQREAERDRQREAER 769

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 44/148 (29%), Positives = 76/148 (51%), Gaps = 7/148 (4%)
 Frame = -1

Query: 444  NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
            N ++R+  + D+  K+ +R    + + +     + DR  D R++    +G+  ++R+R G
Sbjct: 585  NANQRWTKQCDERNKKDNRHPSGRKNIQNGEHLRADRERDNRNK---EEGEKLEKRNRPG 641

Query: 264  DNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDN 97
            + +R G+ ER   R+ + D  +ERDR    + D   E +R R R  +R R R  +RD   
Sbjct: 642  EAEREGDFERAKRRNMERDRSRERDRPREAERDRPREAERDRPREAERDRPREAERDRPR 701

Query: 96   EKERDHRRRYKDDSE---EDDRKRNRDR 22
            E ERD  R  + D +   E DR+R  +R
Sbjct: 702  EAERDRPREAERDRQREAERDRQREAER 729

[148][TOP]
>UniRef100_A5K2V7 Pv-fam-d protein n=1 Tax=Plasmodium vivax RepID=A5K2V7_PLAVI
          Length = 812

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 58/148 (39%), Positives = 79/148 (53%), Gaps = 1/148 (0%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDD-NEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           +R+ DR YR R DD +++ RD    Y+   ++  DR+RD + D R R DDRDG       
Sbjct: 139 RRDDDRDYRRRGDDRDDRRRDDDRDYRRRGDDRDDRRRDDDRDYRRRGDDRDG------R 192

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
           RRGD DR  +G RR  D DN K RD  G  +D  + +    R   GDRRH          
Sbjct: 193 RRGD-DR--DGRRRGDDRDNRKYRDDDGYPEDRDDRDNRDNRKYRGDRRH---------P 240

Query: 93  KERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           +ERD+R++  DD   +DR    +R+YRD
Sbjct: 241 QERDNRKKRHDDRYPEDRDDRDNRKYRD 268

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 56/164 (34%), Positives = 82/164 (50%), Gaps = 21/164 (12%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFD------RKRDRNGDRRHRVDDRDGDNE-K 283
           ++ +Y     D+ K       Y D+ +E++D      R+R  + D R R DDRDG     
Sbjct: 74  KEVKYASSKHDSRKSDYYSDNYDDEEDEDYDYNYRDRRRRGDDRDGRRRGDDRDGRRRGD 133

Query: 282 ERD-RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
           +RD RR D+DR     RR  DD +++ RD    Y+   ++  DR+RD + D R R DDRD
Sbjct: 134 DRDGRRRDDDR---DYRRRGDDRDDRRRDDDRDYRRRGDDRDDRRRDDDRDYRRRGDDRD 190

Query: 105 G-------DNEKERDHR--RRYKDD----SEEDDRKRNRDRRYR 13
           G       D  +  D R  R+Y+DD     + DDR    +R+YR
Sbjct: 191 GRRRGDDRDGRRRGDDRDNRKYRDDDGYPEDRDDRDNRDNRKYR 234

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 46/148 (31%), Positives = 73/148 (49%), Gaps = 10/148 (6%)
 Frame = -1

Query: 450 KRNRDRRYR----DRDD---DNEKERDRRGRYKDDSEEEFDRKRDRNGDRR--HRVDDRD 298
           +R+ DR YR    DRDD   D++++  RRG  +D      DR   R GD R   +  D D
Sbjct: 157 RRDDDRDYRRRGDDRDDRRRDDDRDYRRRGDDRDGRRRGDDRDGRRRGDDRDNRKYRDDD 216

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK-RDRNGDRRHR 121
           G  E   DR   ++R+  G+RRH  + + +++    RY +D ++  +RK RD +G     
Sbjct: 217 GYPEDRDDRDNRDNRKYRGDRRHPQERDNRKKRHDDRYPEDRDDRDNRKYRDDDG----Y 272

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRK 37
            DD+D D   +     + + D  +D  K
Sbjct: 273 TDDQDDDRYDQGRAGPKKRGDDRKDQGK 300

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 57/168 (33%), Positives = 77/168 (45%), Gaps = 25/168 (14%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKER---DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG-DNEK 283
           +R+ DR YR R DD +  R   DR GR + D  +   + RD +G    R DDRD  DN K
Sbjct: 175 RRDDDRDYRRRGDDRDGRRRGDDRDGRRRGDDRDN-RKYRDDDGYPEDR-DDRDNRDNRK 232

Query: 282 ERDRRGDNDRRGNGERRH-------RDD-DNEKERDRRGRYKDDSEEEFDRKR----DRN 139
            R  R     R N ++RH       RDD DN K RD  G   D  ++ +D+ R     R 
Sbjct: 233 YRGDRRHPQERDNRKKRHDDRYPEDRDDRDNRKYRDDDGYTDDQDDDRYDQGRAGPKKRG 292

Query: 138 GDRRHR-----VDDRDGDNEKERDHRRRYKDDSEEDDR----KRNRDR 22
            DR+ +         D  N++  D  ++   D  +DDR    KR  DR
Sbjct: 293 DDRKDQGKTGPKQPGDDGNDQGLDSPKKRGGDRYDDDRDSPKKRGGDR 340

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 52/168 (30%), Positives = 70/168 (41%), Gaps = 27/168 (16%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER-DRR 268
           +RD R R  D DN K RD  G  +D  + +    R   GDRRH    ++ DN K+R D R
Sbjct: 197 DRDGRRRGDDRDNRKYRDDDGYPEDRDDRDNRDNRKYRGDRRH---PQERDNRKKRHDDR 253

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRY--------------------------KDDSEE 166
              DR     R++RDDD   +     RY                           D +++
Sbjct: 254 YPEDRDDRDNRKYRDDDGYTDDQDDDRYDQGRAGPKKRGDDRKDQGKTGPKQPGDDGNDQ 313

Query: 165 EFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             D  + R GDR    DDRD   ++  D   RY DD  +  +KR  DR
Sbjct: 314 GLDSPKKRGGDRYD--DDRDSPKKRGGD---RY-DDDRDSPKKRGGDR 355

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 54/158 (34%), Positives = 73/158 (46%), Gaps = 15/158 (9%)
 Frame = -1

Query: 450 KRNRDRRYRDRDD-DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           KR+ DR   DRDD DN K RD  G   D  ++ +D+ R      + R DDR    +    
Sbjct: 248 KRHDDRYPEDRDDRDNRKYRDDDGYTDDQDDDRYDQGR---AGPKKRGDDRKDQGKTGPK 304

Query: 273 RRGD--ND------RRGNGERRHRDDDNEKERDRRG-RYKDDSEEEFDRKRDRNGDRRHR 121
           + GD  ND      ++  G+R   DDD +  + R G RY DD +    R  DR  D R  
Sbjct: 305 QPGDDGNDQGLDSPKKRGGDRY--DDDRDSPKKRGGDRYDDDRDSPKKRGGDRYDDDRDS 362

Query: 120 VDDRDGDN-EKERDHRRRYKDDSEEDDR----KRNRDR 22
              R GD  + +RD  ++   D  +DDR    KR  DR
Sbjct: 363 PKKRGGDRYDDDRDSPKKRGGDRYDDDRDSPKKRGGDR 400

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 54/144 (37%), Positives = 69/144 (47%), Gaps = 6/144 (4%)
 Frame = -1

Query: 435 RRYRDRDDDNEKERDRRG--RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
           +R  DR DD+     +RG  RY DD     D  + R GDR    DDRD   ++  DR  D
Sbjct: 320 KRGGDRYDDDRDSPKKRGGDRYDDDR----DSPKKRGGDRYD--DDRDSPKKRGGDRYDD 373

Query: 261 N---DRRGNGERRHRDDDNEKERDRRG-RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
           +    ++  G+R   DDD +  + R G RY DD     D  + R GDR    DDRD   +
Sbjct: 374 DRDSPKKRGGDRY--DDDRDSPKKRGGDRYDDDR----DSPKKRGGDRYD--DDRDSPKK 425

Query: 93  KERDHRRRYKDDSEEDDRKRNRDR 22
           +  D   RY DD   DDRK   DR
Sbjct: 426 RGGD---RYDDD--RDDRKHQYDR 444

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 47/128 (36%), Positives = 63/128 (49%), Gaps = 7/128 (5%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRH--RVDDRDGDN-EKERDRRGDNDRRGNGERRHRDDDNEKE 205
           K +   E   K  +    +H  R  D   DN + E D   D + R   +RR R DD +  
Sbjct: 64  KPEENTELPAKEVKYASSKHDSRKSDYYSDNYDDEEDEDYDYNYR---DRRRRGDDRDGR 120

Query: 204 R---DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG-DNEKERDHRRRYKDDSEEDDRK 37
           R   DR GR + D  +   R+RD + D R R DDRD    + +RD+RRR  D    DDR+
Sbjct: 121 RRGDDRDGRRRGDDRD--GRRRDDDRDYRRRGDDRDDRRRDDDRDYRRRGDD---RDDRR 175

Query: 36  RNRDRRYR 13
           R+ DR YR
Sbjct: 176 RDDDRDYR 183

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 49/144 (34%), Positives = 66/144 (45%), Gaps = 9/144 (6%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRG-RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           KR  DR     DDD +  + R G RY DD     D  + R GDR    DDRD   ++  D
Sbjct: 335 KRGGDRY----DDDRDSPKKRGGDRYDDDR----DSPKKRGGDRYD--DDRDSPKKRGGD 384

Query: 273 RRG---DNDRRGNGERRHRDDDNEKERDRRG-RYKDDSEEE----FDRKRDRNGDRRHRV 118
           R     D+ ++  G+R   DDD +  + R G RY DD +       DR  D   DR+H+ 
Sbjct: 385 RYDDDRDSPKKRGGDR--YDDDRDSPKKRGGDRYDDDRDSPKKRGGDRYDDDRDDRKHQY 442

Query: 117 DDRDGDNEKERDHRRRYKDDSEED 46
           D     N+K  D      +D +ED
Sbjct: 443 DRSGQKNKKYFDDDYSVYEDGDED 466

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 53/162 (32%), Positives = 76/162 (46%), Gaps = 17/162 (10%)
 Frame = -1

Query: 450 KRNRDRRYRDR-------DDDNEKERD---RRG--RYKDDSEEEFDRKRDRNGDRRHRVD 307
           KR  DR+ + +       DD N++  D   +RG  RY DD     D  + R GDR    D
Sbjct: 290 KRGDDRKDQGKTGPKQPGDDGNDQGLDSPKKRGGDRYDDDR----DSPKKRGGDRYD--D 343

Query: 306 DRDGDNEKERDRRGDN---DRRGNGERRHRDDDNEKERDRRG-RYKDDSEEEFDRKRDRN 139
           DRD   ++  DR  D+    ++  G+R   DDD +  + R G RY DD +    R  DR 
Sbjct: 344 DRDSPKKRGGDRYDDDRDSPKKRGGDRY--DDDRDSPKKRGGDRYDDDRDSPKKRGGDRY 401

Query: 138 GDRRHRVDDRDGDN-EKERDHRRRYKDDSEEDDRKRNRDRRY 16
            D R     R GD  + +RD  ++   D  +DDR  +R  +Y
Sbjct: 402 DDDRDSPKKRGGDRYDDDRDSPKKRGGDRYDDDRD-DRKHQY 442

[149][TOP]
>UniRef100_Q6C7F8 YALI0E01166p n=1 Tax=Yarrowia lipolytica RepID=Q6C7F8_YARLI
          Length = 408

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 54/140 (38%), Positives = 75/140 (53%), Gaps = 6/140 (4%)
 Frame = -1

Query: 423 DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK--ERDRRGDNDRR 250
           ++  + E+E +R G    + E  +D +RDR+  R H   DRD D E+  +R  R D DRR
Sbjct: 270 EKQVEKERESERDGAIDQEREGSYDSRRDRDSRRPHSSRDRDRDRERSPKRSSRRDRDRR 329

Query: 249 GNGERRHRDDDNEKERDRRGRY-KDDSEEEFD---RKRDRNGDRRHRVDDRDGDNEKERD 82
            +   R R D     RDRRGR  +DD   + D   R+RDR G+R    D RD D    RD
Sbjct: 330 DDDRDRDRGD-----RDRRGRRGEDDRSSQTDNDRRRRDRGGERDR--DRRDRDERDRRD 382

Query: 81  HRRRYKDDSEEDDRKRNRDR 22
             RR + D + D+ +R+RDR
Sbjct: 383 RDRRDRRDRDRDNNRRDRDR 402

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 39/87 (44%), Positives = 51/87 (58%), Gaps = 4/87 (4%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRY-KDDSEEEFD---RKRDRNGDRRHRVDDRDGDNEK 283
           +R+RDRR  DRD D   +RDRRGR  +DD   + D   R+RDR G+R     DRD  + +
Sbjct: 323 RRDRDRRDDDRDRD-RGDRDRRGRRGEDDRSSQTDNDRRRRDRGGERDRDRRDRDERDRR 381

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKER 202
           +RDRR   DR  +  RR RD D  + R
Sbjct: 382 DRDRRDRRDRDRDNNRRDRDRDRARRR 408

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 49/115 (42%), Positives = 60/115 (52%), Gaps = 12/115 (10%)
 Frame = -1

Query: 450 KRNRDRRY----RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG-DRRHR--VDDRDG- 295
           +R+RD R     RDRD D E+   R  R +D    + DR RDR   DRR R   DDR   
Sbjct: 296 RRDRDSRRPHSSRDRDRDRERSPKRSSR-RDRDRRDDDRDRDRGDRDRRGRRGEDDRSSQ 354

Query: 294 -DNEKERDRRG---DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR 142
            DN++ R  RG   D DRR   ER  RD D    RDRR R +D++  + DR R R
Sbjct: 355 TDNDRRRRDRGGERDRDRRDRDERDRRDRDR---RDRRDRDRDNNRRDRDRDRAR 406

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 40/102 (39%), Positives = 56/102 (54%), Gaps = 5/102 (4%)
 Frame = -1

Query: 312 VDDRDGDNEKERDRRG--DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN 139
           VD++  + E+E +R G  D +R G+ + R RD D+ +    R R   D + E   KR   
Sbjct: 268 VDEKQVEKERESERDGAIDQEREGSYDSR-RDRDSRRPHSSRDR---DRDRERSPKRSSR 323

Query: 138 GDRRHRVDDRDGDNEKERDHR-RRYKDD--SEEDDRKRNRDR 22
            DR  R DDRD D   +RD R RR +DD  S+ D+ +R RDR
Sbjct: 324 RDRDRRDDDRDRDRG-DRDRRGRRGEDDRSSQTDNDRRRRDR 364

[150][TOP]
>UniRef100_B2RY56-2 Isoform 2 of RNA-binding protein 25 n=1 Tax=Mus musculus
           RepID=B2RY56-2
          Length = 838

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 51/148 (34%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           +R R+R  R+R+ + E+ER+R    + + E E DR RDR  +R R R  DRD D E+  D
Sbjct: 314 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSD 373

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
           R  D  R      + RD + E+ER+R        E E +R+R+R    R R  +R+ + E
Sbjct: 374 RNKDRSR---SREKSRDRERERERER--------ERERERERER---ERERERERERERE 419

Query: 93  KERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           +E+D +R  ++D E+   +R  +R+ R+
Sbjct: 420 REKDKKRDREEDEEDAYERRKLERKLRE 447

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 46/153 (30%), Positives = 84/153 (54%), Gaps = 1/153 (0%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 275 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 334

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRV 118
           + EKER+R  + D R     + RD D E++RDR      D  ++  R R+++ DR R R 
Sbjct: 335 EKEKERERERERD-RDRDRTKERDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERERE 393

Query: 117 DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            +R+ + E+ER+ R R ++   E +R+R +D++
Sbjct: 394 RERERERERERE-REREREREREREREREKDKK 425

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 56/150 (37%), Positives = 86/150 (57%), Gaps = 8/150 (5%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 283
           +R R+R R R+R+ + EKER+R R R +D D  +E DR R+R+ DR R R  DR+ D  +
Sbjct: 321 RREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSR 380

Query: 282 ERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
            R++  D +R    ER R R+ + E+ER+R    + + E E D+KRDR  D     + R 
Sbjct: 381 SREKSRDREREREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRK 440

Query: 105 GD---NEKERDHRRRYKDDSEEDDRKRNRD 25
            +    EKE  ++ R K + E  +RK+ R+
Sbjct: 441 LERKLREKEAAYQERLK-NWEIRERKKTRE 469

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 57/187 (30%), Positives = 92/187 (49%), Gaps = 32/187 (17%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDD 304
           +R+   +R R+R  RDRD D  KERDR      D E + DR R+R+ DR     R R   
Sbjct: 333 EREKEKERERERE-RDRDRDRTKERDR------DRERDRDRDRERSSDRNKDRSRSREKS 385

Query: 303 RDGDNEKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRK------ 151
           RD + E+ER+R  + +R    ER   R R+ + E+E+D++   ++D E+ ++R+      
Sbjct: 386 RDREREREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKL 445

Query: 150 ---------RDRNGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRD 25
                    R +N + R R   R+ + E ER+  R         R K+  E+ D  R+  
Sbjct: 446 REKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDP 505

Query: 24  RRYRDTS 4
           + YR ++
Sbjct: 506 KYYRGSA 512

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 39/127 (30%), Positives = 65/127 (51%), Gaps = 9/127 (7%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD------RRGDNDRRGNGERRHRDDDN 214
           ++D  +   R+  +  D   ++++  G  EKER       R  + +R    ERR R+ + 
Sbjct: 269 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 328

Query: 213 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR---RYKDDSEEDD 43
           E+ER+R    + + E E DR RDR  +R     DRD + +++RD  R   R KD S   +
Sbjct: 329 EREREREKEKERERERERDRDRDRTKER-----DRDRERDRDRDRERSSDRNKDRSRSRE 383

Query: 42  RKRNRDR 22
           + R+R+R
Sbjct: 384 KSRDRER 390

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 51/202 (25%), Positives = 89/202 (44%), Gaps = 62/202 (30%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDR 301
           +R+   +R+RDR R ++RD D E++RDR      D  ++  R R+++ DR   R R  +R
Sbjct: 339 ERERERERDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERER 398

Query: 300 DGDNEKERDRRGDNDRRGNGER-----RHRDDDNE------------------------- 211
           + + E+ER+R  + +R    ER     R R++D E                         
Sbjct: 399 EREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKN 458

Query: 210 ---KERDRRGRYKDDSEEEFDRKR--------------DRNGDR-----------RHRVD 115
              +ER +   Y+ ++E E +R+R              D + DR           + R+ 
Sbjct: 459 WEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLR 518

Query: 114 DRDGDNEKERDHRRRYKDDSEE 49
           DR+ + E +   R+R K++ EE
Sbjct: 519 DREKEMEADERDRKREKEELEE 540

[151][TOP]
>UniRef100_B2RY56 RNA-binding protein 25 n=1 Tax=Mus musculus RepID=RBM25_MOUSE
          Length = 841

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 51/148 (34%), Positives = 82/148 (55%), Gaps = 1/148 (0%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           +R R+R  R+R+ + E+ER+R    + + E E DR RDR  +R R R  DRD D E+  D
Sbjct: 317 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSD 376

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
           R  D  R      + RD + E+ER+R        E E +R+R+R    R R  +R+ + E
Sbjct: 377 RNKDRSR---SREKSRDRERERERER--------ERERERERER---ERERERERERERE 422

Query: 93  KERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           +E+D +R  ++D E+   +R  +R+ R+
Sbjct: 423 REKDKKRDREEDEEDAYERRKLERKLRE 450

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 46/153 (30%), Positives = 84/153 (54%), Gaps = 1/153 (0%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 278 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 337

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRV 118
           + EKER+R  + D R     + RD D E++RDR      D  ++  R R+++ DR R R 
Sbjct: 338 EKEKERERERERD-RDRDRTKERDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERERE 396

Query: 117 DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            +R+ + E+ER+ R R ++   E +R+R +D++
Sbjct: 397 RERERERERERE-REREREREREREREREKDKK 428

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 56/150 (37%), Positives = 86/150 (57%), Gaps = 8/150 (5%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 283
           +R R+R R R+R+ + EKER+R R R +D D  +E DR R+R+ DR R R  DR+ D  +
Sbjct: 324 RREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSR 383

Query: 282 ERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
            R++  D +R    ER R R+ + E+ER+R    + + E E D+KRDR  D     + R 
Sbjct: 384 SREKSRDREREREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRK 443

Query: 105 GD---NEKERDHRRRYKDDSEEDDRKRNRD 25
            +    EKE  ++ R K + E  +RK+ R+
Sbjct: 444 LERKLREKEAAYQERLK-NWEIRERKKTRE 472

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 57/187 (30%), Positives = 92/187 (49%), Gaps = 32/187 (17%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDD 304
           +R+   +R R+R  RDRD D  KERDR      D E + DR R+R+ DR     R R   
Sbjct: 336 EREKEKERERERE-RDRDRDRTKERDR------DRERDRDRDRERSSDRNKDRSRSREKS 388

Query: 303 RDGDNEKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRK------ 151
           RD + E+ER+R  + +R    ER   R R+ + E+E+D++   ++D E+ ++R+      
Sbjct: 389 RDREREREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKL 448

Query: 150 ---------RDRNGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRD 25
                    R +N + R R   R+ + E ER+  R         R K+  E+ D  R+  
Sbjct: 449 REKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDP 508

Query: 24  RRYRDTS 4
           + YR ++
Sbjct: 509 KYYRGSA 515

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 39/127 (30%), Positives = 65/127 (51%), Gaps = 9/127 (7%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD------RRGDNDRRGNGERRHRDDDN 214
           ++D  +   R+  +  D   ++++  G  EKER       R  + +R    ERR R+ + 
Sbjct: 272 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERER 331

Query: 213 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR---RYKDDSEEDD 43
           E+ER+R    + + E E DR RDR  +R     DRD + +++RD  R   R KD S   +
Sbjct: 332 EREREREKEKERERERERDRDRDRTKER-----DRDRERDRDRDRERSSDRNKDRSRSRE 386

Query: 42  RKRNRDR 22
           + R+R+R
Sbjct: 387 KSRDRER 393

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 51/202 (25%), Positives = 89/202 (44%), Gaps = 62/202 (30%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDR 301
           +R+   +R+RDR R ++RD D E++RDR      D  ++  R R+++ DR   R R  +R
Sbjct: 342 ERERERERDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERER 401

Query: 300 DGDNEKERDRRGDNDRRGNGER-----RHRDDDNE------------------------- 211
           + + E+ER+R  + +R    ER     R R++D E                         
Sbjct: 402 EREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKN 461

Query: 210 ---KERDRRGRYKDDSEEEFDRKR--------------DRNGDR-----------RHRVD 115
              +ER +   Y+ ++E E +R+R              D + DR           + R+ 
Sbjct: 462 WEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLR 521

Query: 114 DRDGDNEKERDHRRRYKDDSEE 49
           DR+ + E +   R+R K++ EE
Sbjct: 522 DREKEMEADERDRKREKEELEE 543

[152][TOP]
>UniRef100_UPI00019856C6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019856C6
          Length = 902

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 56/148 (37%), Positives = 90/148 (60%), Gaps = 7/148 (4%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDR-RGRYKDDSEEEF-DRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R+RR  DRD+  EK+R+R + R KD   E++ D++R+R+ DR+ R  +++ + E+E D+
Sbjct: 92  SRERRKEDRDE-REKDRNRDKVREKDYDREKYRDKERERDKDRKDRGKEKEREREREVDK 150

Query: 270 RGDNDR---RGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVD-DRD 106
             D  R   RG  + R RD + EKERDR    KD D E+E ++ +DR  +R +  D DRD
Sbjct: 151 ESDRGRDKERGKEKNRDRDKEREKERDRT---KDRDREKEKEKSKDREKERENDKDRDRD 207

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRDR 22
             ++++   R R K+   + DR R +DR
Sbjct: 208 AIDKEKGKERIRDKEREADQDRDRYKDR 235

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 51/160 (31%), Positives = 88/160 (55%), Gaps = 17/160 (10%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGR----------YKDDSEEEFDRKRDRNGDRRHRVDDR 301
           +++   R +DR     +E+D RG+           K+  +E  D ++DR   R  R +DR
Sbjct: 41  EKSSKHRSKDRKKSRREEKDHRGKDRERSKAGDGLKEREKETKDSEKDRVTSRERRKEDR 100

Query: 300 DGDNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGD 133
           D   E+E+DR  D  R  + +R ++RD + E+++DR+ R K+   + E E D++ DR  D
Sbjct: 101 D---EREKDRNRDKVREKDYDREKYRDKERERDKDRKDRGKEKEREREREVDKESDRGRD 157

Query: 132 R---RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           +   + +  DRD + EKERD   R KD   E ++++++DR
Sbjct: 158 KERGKEKNRDRDKEREKERD---RTKDRDREKEKEKSKDR 194

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 53/150 (35%), Positives = 82/150 (54%), Gaps = 28/150 (18%)
 Frame = -1

Query: 447 RNRDR---------RYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR---RHRVD 307
           RNRD+         +YRD++ + +K+R  RG+ K+ + E E D++ DR  D+   + +  
Sbjct: 107 RNRDKVREKDYDREKYRDKERERDKDRKDRGKEKEREREREVDKESDRGRDKERGKEKNR 166

Query: 306 DRDGDNEKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKD-------DSEEEFD 157
           DRD + EKERDR  D DR    E+   R ++ +N+K+RDR    K+       D E E D
Sbjct: 167 DRDKEREKERDRTKDRDREKEKEKSKDREKERENDKDRDRDAIDKEKGKERIRDKEREAD 226

Query: 156 RKRDR-----NGDRRHRVDDRDGDNEKERD 82
           + RDR      G R++R  D DG + ++RD
Sbjct: 227 QDRDRYKDRDKGSRKNR--DEDGGDNRDRD 254

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 53/164 (32%), Positives = 86/164 (52%), Gaps = 21/164 (12%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKER--------DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD- 298
           K  R    RDRDD   ++         +  G  K       DRK+ R  ++ HR  DR+ 
Sbjct: 9   KPERSDELRDRDDSPTRDYHDGAYDDLEENGIEKSSKHRSKDRKKSRREEKDHRGKDRER 68

Query: 297 ---GDNEKERDRR---GDNDRRGNGERRHRD-DDNEKERDR-RGRYKDDSEEEF-DRKRD 145
              GD  KER++     + DR  + ERR  D D+ EK+R+R + R KD   E++ D++R+
Sbjct: 69  SKAGDGLKEREKETKDSEKDRVTSRERRKEDRDEREKDRNRDKVREKDYDREKYRDKERE 128

Query: 144 RNGDRRHRVDDRDGDNEKERD---HRRRYKDDSEEDDRKRNRDR 22
           R+ DR+ R  +++ + E+E D    R R K+  +E +R R+++R
Sbjct: 129 RDKDRKDRGKEKEREREREVDKESDRGRDKERGKEKNRDRDKER 172

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 47/148 (31%), Positives = 80/148 (54%), Gaps = 7/148 (4%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           + R++  +D + D    R+RR   K+D +E   R++DRN D+   V ++D D EK RD+ 
Sbjct: 76  KEREKETKDSEKDRVTSRERR---KEDRDE---REKDRNRDK---VREKDYDREKYRDKE 126

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-------RHRVDDR 109
            + D+    +R+ R  + E+ER+R    + D   + +R +++N DR       R R  DR
Sbjct: 127 RERDK----DRKDRGKEKEREREREVDKESDRGRDKERGKEKNRDRDKEREKERDRTKDR 182

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRD 25
           D + EKE+   R   +   E+D+ R+RD
Sbjct: 183 DREKEKEKSKDR---EKERENDKDRDRD 207

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 54/184 (29%), Positives = 85/184 (46%), Gaps = 44/184 (23%)
 Frame = -1

Query: 447 RNRDR-----RYRDRDDDNEKERDR---RGRYKD-----DSEEEFDRKRDRNGDR----- 322
           R RD+     + RDRD + EKERDR   R R K+     D E+E +  +DR+ D      
Sbjct: 154 RGRDKERGKEKNRDRDKEREKERDRTKDRDREKEKEKSKDREKERENDKDRDRDAIDKEK 213

Query: 321 -RHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDS--------- 172
            + R+ D++ + +++RDR  D D+   G R++RD+D    RDR G     S         
Sbjct: 214 GKERIRDKEREADQDRDRYKDRDK---GSRKNRDEDGGDNRDRDGASGPQSSTAQLQERI 270

Query: 171 ----EEEFDRKRDRNGD------RRHRVDD-RDGDNEKERDHRRRYK-----DDSEEDDR 40
               EE   RK + + +      R  +V++ R+ + EK     + ++     D  E DD 
Sbjct: 271 LRMKEERVKRKSEGSSEVLAWVNRSRKVEEQRNAEKEKALQLSKIFEEQDNIDQGESDDE 330

Query: 39  KRNR 28
           K  R
Sbjct: 331 KPTR 334

[153][TOP]
>UniRef100_UPI000179E4C3 LOC540258 protein n=1 Tax=Bos taurus RepID=UPI000179E4C3
          Length = 826

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 50/157 (31%), Positives = 85/157 (54%), Gaps = 2/157 (1%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 267 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 326

Query: 294 DNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHR 121
           + EKER+R  + DR R   + R RD D E++RDR      D  ++  R R+R  +R R R
Sbjct: 327 EKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSRERERERERER 386

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             +R+ + E+ER+ R R ++   E D+KR+R+    D
Sbjct: 387 ERERERERERERE-REREREREREKDKKRDREEDEED 422

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 51/145 (35%), Positives = 86/145 (59%), Gaps = 2/145 (1%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGD 262
           ++  R+R+ + E+ER+RR R   + E E +R+R++  +R R R  DRD D  KERDR  D
Sbjct: 297 EKERRERERERERERERRER---EREREREREREKEKERERERERDRDRDRTKERDR--D 351

Query: 261 NDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
            DR  + +R R R  D  K+R R    + + E E +R+R+R  + R R  +R+ + E+E+
Sbjct: 352 RDRERDRDRDRERSSDRNKDRSRSRERERERERERERERERERE-REREREREREREREK 410

Query: 84  DHRRRYKDDSEEDDRKRNRDRRYRD 10
           D +R  ++D E+   +R  +R+ R+
Sbjct: 411 DKKRDREEDEEDAYERRKLERKLRE 435

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 53/180 (29%), Positives = 91/180 (50%), Gaps = 25/180 (13%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGD 292
           +R+   +R R+R  RDRD D  KERDR    + D + + +R  DRN DR R R  +R+ +
Sbjct: 325 EREKEKERERERE-RDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSRERERERE 383

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK------------- 151
            E+ER+R  + +R      R R+ + E+E+D++   ++D E+ ++R+             
Sbjct: 384 RERERERERERERE---REREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAY 440

Query: 150 --RDRNGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRDTS 4
             R +N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR ++
Sbjct: 441 QERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSA 500

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 43/150 (28%), Positives = 73/150 (48%), Gaps = 7/150 (4%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRG-RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           K+ ++++       N  E D      ++D  +   R+  +  D   ++++  G  EKER 
Sbjct: 235 KKKKEKKEDGESSVNILEEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQ 294

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDN 97
                 R    ER    +  E+ER+R    + + E+E +R+R+R+ DR R +  DRD D 
Sbjct: 295 EIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDR 354

Query: 96  EKERDHRR-----RYKDDSEEDDRKRNRDR 22
           E++RD  R     R KD S   +R+R R+R
Sbjct: 355 ERDRDRDRERSSDRNKDRSRSRERERERER 384

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 50/189 (26%), Positives = 85/189 (44%), Gaps = 56/189 (29%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           R+RDR + RDRD D E++RDR      D  ++  R R+R  +R R R  +R+ + E+ER+
Sbjct: 340 RDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSRERERERERERERERERERERERE 399

Query: 273 RRGDNDR-RGNGERRHRDDDNE----------------------------KERDRRGRYK 181
           R  + +R R   ++R R++D E                            +ER +   Y+
Sbjct: 400 REREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYE 459

Query: 180 DDSEEEFDRKR--------------DRNGDR-----------RHRVDDRDGDNEKERDHR 76
            ++E E +R+R              D + DR           + R+ DR+ + E +   R
Sbjct: 460 KEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDR 519

Query: 75  RRYKDDSEE 49
           +R K++ EE
Sbjct: 520 KREKEELEE 528

[154][TOP]
>UniRef100_Q2GW32 Putative uncharacterized protein n=1 Tax=Chaetomium globosum
            RepID=Q2GW32_CHAGB
          Length = 888

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 57/140 (40%), Positives = 70/140 (50%), Gaps = 5/140 (3%)
 Frame = -1

Query: 426  RDRDDDNEKERDR---RG--RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
            RDRD D ++ERDR   RG  RY  D +   DR RDR+ DR  R  DR  D ++ RD R D
Sbjct: 753  RDRDRDRDRERDRMDYRGGDRYDGDRDRPRDRDRDRDRDRDRR--DRSRDRDRARDDRRD 810

Query: 261  NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 82
              RR     R R+ D  ++RDR            DR RDR+ DR     DRD D+   R 
Sbjct: 811  TRRRSRSRSRDRERDRSRDRDRNR----------DRDRDRDQDR-----DRDRDSHYRRS 855

Query: 81   HRRRYKDDSEEDDRKRNRDR 22
             R R      + DR R+RDR
Sbjct: 856  RRERSVSSRRDRDRDRDRDR 875

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 59/150 (39%), Positives = 75/150 (50%), Gaps = 3/150 (2%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            KR R+    DR    +++RDR      D + E DR   R GDR     DR  D +++RDR
Sbjct: 737  KRRREPEEHDRYLPGDRDRDR------DRDRERDRMDYRGGDRYDGDRDRPRDRDRDRDR 790

Query: 270  RGDNDRRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGDN 97
              D DRR     R R  D+ ++  RR R +  D E +  R RDRN DR R R  DRD D 
Sbjct: 791  --DRDRRDRSRDRDRARDDRRDTRRRSRSRSRDRERDRSRDRDRNRDRDRDRDQDRDRDR 848

Query: 96   EKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
            +      RR +  S   DR R+RDR R RD
Sbjct: 849  DSHYRRSRRERSVSSRRDRDRDRDRDRDRD 878

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 49/126 (38%), Positives = 65/126 (51%), Gaps = 1/126 (0%)
 Frame = -1

Query: 444  NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
            +RDR  RDRD D +++RDRR R +D      DR RD   D R R   R  D E++R R  
Sbjct: 777  DRDRP-RDRDRDRDRDRDRRDRSRDR-----DRARDDRRDTRRRSRSRSRDRERDRSRDR 830

Query: 264  DNDRRGNGERRHRDDDNEKERDRRGRY-KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
            D +R      R RD D +++RDR   Y +   E     +RDR         DRD D +++
Sbjct: 831  DRNRD-----RDRDRDQDRDRDRDSHYRRSRRERSVSSRRDR---------DRDRDRDRD 876

Query: 87   RDHRRR 70
            RDH RR
Sbjct: 877  RDHGRR 882

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 54/167 (32%), Positives = 86/167 (51%), Gaps = 14/167 (8%)
 Frame = -1

Query: 480 IRMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRY-KDDSEEEFDRKRDRNG-DRRHRVD 307
           +R ++ K   KR  +R  + R++   +E +R  R  +   E E D +RD+   +RR +  
Sbjct: 181 LRAVEEK---KRQLEREIKAREETKRREVERAAREERRKKEREEDERRDKERRERREKER 237

Query: 306 DRDGDNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKD---DSEEEFDRKRDRN 139
           +R+ + EKER++  + +R    +R R RD D E++RD R R+++   DS     R R R+
Sbjct: 238 EREREREKEREKEREKERESRRDRDRSRDRDRERDRD-RDRFRERGYDSYRGTPRDRSRD 296

Query: 138 GDR-RHRVDDRDGDNEKERDHRRRYK-------DDSEEDDRKRNRDR 22
            DR R R  DRD D  +   H  R K       DD+E+   K + DR
Sbjct: 297 RDRGRDRDRDRDRDRGRRDSHDNRPKLGTEDRGDDTEKTLTKEDHDR 343

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 43/144 (29%), Positives = 74/144 (51%), Gaps = 11/144 (7%)
 Frame = -1

Query: 405 EKERDRRG-RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRH 229
           E+ER R   R  ++ + + +R+     + + R  +R    E+ +  R +++RR    R  
Sbjct: 173 ERERVRAELRAVEEKKRQLEREIKAREETKRREVERAAREERRKKEREEDERRDKERRER 232

Query: 228 RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDH--------- 79
           R+ + E+ER+R    + + E+E + +RDR+  R R R  DRD D  +ER +         
Sbjct: 233 REKEREREREREKEREKEREKERESRRDRDRSRDRDRERDRDRDRFRERGYDSYRGTPRD 292

Query: 78  RRRYKDDSEEDDRKRNRDRRYRDT 7
           R R +D   + DR R+RDR  RD+
Sbjct: 293 RSRDRDRGRDRDRDRDRDRGRRDS 316

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 53/182 (29%), Positives = 74/182 (40%), Gaps = 24/182 (13%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERD-----RRGRYKDDSEEEFDRKRDRNGDRRHR 313
            R   R+    R RDRR   RDD     RD     RR   KDD  +E   +R      R R
Sbjct: 490  RSRSRRRSRSRLRDRRDDRRDDHRRSRRDDSRATRRDDRKDDRRDERKSERKDRSGSRPR 549

Query: 312  VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEF-------DR 154
             + R+    + R  R D+ R  +  RR    D  +   +R   +D S            R
Sbjct: 550  AEKRERSRSRPRTARTDDKRDRSRSRRRDPRDRSRSPRQRTERRDRSRSRLRFGRRDRSR 609

Query: 153  KRDRNGDRRH---------RVDDRDGDNEKERDHRR---RYKDDSEEDDRKRNRDRRYRD 10
             R RN DRR          R D RD   +++RD  R   R KD  ++  ++ +++RR R 
Sbjct: 610  SRSRNRDRRDRRERSRSRARTDQRDRSRDRDRDRDRDQTREKDRDKDKVKEEDKERRPRS 669

Query: 9    TS 4
             S
Sbjct: 670  RS 671

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 69/207 (33%), Positives = 98/207 (47%), Gaps = 51/207 (24%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR-----RYRDRDDD--NEKERDRRGRYKDDS--------------- 364
            R  QR     R+RDR     R +DRD D   E++++RR R +  S               
Sbjct: 629  RTDQRDRSRDRDRDRDRDQTREKDRDKDKVKEEDKERRPRSRSRSPPSAVRPPSRLNHTE 688

Query: 363  ----EEEFDRKRDRNG--------DRRHR------VDD-RDGDNEKERDRR---GDNDRR 250
                ++   +KR++          + R +      +DD R GD   +  RR    ++DR 
Sbjct: 689  KEAWKQAEVKKREQEAKAYLAAQKEAREKGMPVPGIDDRRAGDKSPDLKRRREPEEHDRY 748

Query: 249  GNGER-RHRDDDNEKER-DRRG--RYKDDSE--EEFDRKRDRNGDRRHRVDDRDGDNEKE 88
              G+R R RD D E++R D RG  RY  D +   + DR RDR+ DRR R  DRD   +  
Sbjct: 749  LPGDRDRDRDRDRERDRMDYRGGDRYDGDRDRPRDRDRDRDRDRDRRDRSRDRDRARDDR 808

Query: 87   RDHRRRYKDDSEEDDRKRNRDR-RYRD 10
            RD RRR +  S + +R R+RDR R RD
Sbjct: 809  RDTRRRSRSRSRDRERDRSRDRDRNRD 835

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 48/150 (32%), Positives = 67/150 (44%), Gaps = 10/150 (6%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG-RYKDDSEE---------EFDRKRDRNGDRRHRVDDRD 298
           R  DR+   RD+   + +DR G R + +  E           D KRDR+  RR    DR 
Sbjct: 524 RRDDRKDDRRDERKSERKDRSGSRPRAEKRERSRSRPRTARTDDKRDRSRSRRRDPRDRS 583

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
               +  +RR  +  R    RR R     + RDRR R +         +RDR+ D R R 
Sbjct: 584 RSPRQRTERRDRSRSRLRFGRRDRSRSRSRNRDRRDRRERSRSRARTDQRDRSRD-RDRD 642

Query: 117 DDRDGDNEKERDHRRRYKDDSEEDDRKRNR 28
            DRD   EK+RD  +  ++D E   R R+R
Sbjct: 643 RDRDQTREKDRDKDKVKEEDKERRPRSRSR 672

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 49/154 (31%), Positives = 68/154 (44%), Gaps = 11/154 (7%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEE-----------FDRKRDRNGDRRHRVDDRDG 295
           RD R  DR D+ + ER  R   +  +E+             D KRDR+  RR    DR  
Sbjct: 525 RDDRKDDRRDERKSERKDRSGSRPRAEKRERSRSRPRTARTDDKRDRSRSRRRDPRDRSR 584

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
              +  +RR  +  R    RR R     + RDRR R +         +RDR+ DR     
Sbjct: 585 SPRQRTERRDRSRSRLRFGRRDRSRSRSRNRDRRDRRERSRSRARTDQRDRSRDRDR--- 641

Query: 114 DRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
           DRD D  +E+D   R KD  +E+D++R    R R
Sbjct: 642 DRDRDQTREKD---RDKDKVKEEDKERRPRSRSR 672

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 48/150 (32%), Positives = 65/150 (43%), Gaps = 5/150 (3%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER--D 274
           R+R  R R+R     + R R    +DD  ++  R R R+  R  R DDR  D   ER  +
Sbjct: 481 RSRTPRLRERSRSRRRSRSRLRDRRDDRRDDHRRSR-RDDSRATRRDDRKDDRRDERKSE 539

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRD---RNGDRRHRVDDRDG 103
           R+  +  R   E+R R     + R R  R  D  +    R+RD   R+   R R + RD 
Sbjct: 540 RKDRSGSRPRAEKRERS----RSRPRTARTDDKRDRSRSRRRDPRDRSRSPRQRTERRDR 595

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
              + R  RR          R RNRDRR R
Sbjct: 596 SRSRLRFGRR-----DRSRSRSRNRDRRDR 620

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 42/102 (41%), Positives = 54/102 (52%), Gaps = 10/102 (9%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKE--RDRRGRYKD---DSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
            R+RDRR R RD D  ++  RD R R +    D E +  R RDRN DR     DRD D ++
Sbjct: 790  RDRDRRDRSRDRDRARDDRRDTRRRSRSRSRDRERDRSRDRDRNRDR-----DRDRDQDR 844

Query: 282  ERDR----RGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDS 172
            +RDR    R     R    RR RD D +++RDR  GR +  S
Sbjct: 845  DRDRDSHYRRSRRERSVSSRRDRDRDRDRDRDRDHGRRRSRS 886

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 57/175 (32%), Positives = 71/175 (40%), Gaps = 29/175 (16%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH---------RVDDRDG 295
           RN DRR RD      + R+R    +       DR+ DR  D R          R DDR  
Sbjct: 471 RNDDRRRRDARSRTPRLRERSRSRRRSRSRLRDRRDDRRDDHRRSRRDDSRATRRDDRKD 530

Query: 294 DNEKER--DRRGDNDRRGNGERRHR----------DDDNEKERDRRGRYKDDSE------ 169
           D   ER  +R+  +  R   E+R R          DD  ++ R RR   +D S       
Sbjct: 531 DRRDERKSERKDRSGSRPRAEKRERSRSRPRTARTDDKRDRSRSRRRDPRDRSRSPRQRT 590

Query: 168 EEFDRKRDR-NGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
           E  DR R R    RR R   R   N   RD R R +  +  D R R+RDR R RD
Sbjct: 591 ERRDRSRSRLRFGRRDRSRSR-SRNRDRRDRRERSRSRARTDQRDRSRDRDRDRD 644

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 36/108 (33%), Positives = 52/108 (48%), Gaps = 6/108 (5%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEF-----DRKRDRNGDRRHRVDDRDGDN 289
           K    RR RDR  D ++ERDR R R+++   + +     DR RDR+  R     DRD D 
Sbjct: 253 KERESRRDRDRSRDRDRERDRDRDRFRERGYDSYRGTPRDRSRDRDRGR-----DRDRDR 307

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRD 145
           +++R RR  +D R       R DD EK   +    + + E   D  R+
Sbjct: 308 DRDRGRRDSHDNRPKLGTEDRGDDTEKTLTKEDHDRLEQEALADLLRE 355

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 38/142 (26%), Positives = 69/142 (48%), Gaps = 4/142 (2%)
 Frame = -1

Query: 423 DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGN 244
           D   ++  E +R    K D E   +    R    R R + R  + +K   R+ + + +  
Sbjct: 142 DEIGEDAAEEERIRGLKTDEEYAAETAARRAERERVRAELRAVEEKK---RQLEREIKAR 198

Query: 243 GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD---HRR 73
            E + R+ +     +RR + +++ E     +R+R    R R  +R+ + EKER+     R
Sbjct: 199 EETKRREVERAAREERRKKEREEDERRDKERRERREKEREREREREKEREKEREKERESR 258

Query: 72  RYKDDSEEDDRKRNRDR-RYRD 10
           R +D S + DR+R+RDR R+R+
Sbjct: 259 RDRDRSRDRDRERDRDRDRFRE 280

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 44/134 (32%), Positives = 56/134 (41%), Gaps = 5/134 (3%)
 Frame = -1

Query: 405 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHR 226
           EK R R       +    +R R RN DRR R  D      + R+R     R  +  R  R
Sbjct: 448 EKRRSRSPSRASRAHHGKERSRSRNDDRRRR--DARSRTPRLRERSRSRRRSRSRLRDRR 505

Query: 225 DDDNEKERDRRGRYKDDSE--EEFDRKRDRNGDRRHRVDDRDGDN---EKERDHRRRYKD 61
           DD   +  D R   +DDS      DRK DR  +R+    DR G     EK    R R + 
Sbjct: 506 DD---RRDDHRRSRRDDSRATRRDDRKDDRRDERKSERKDRSGSRPRAEKRERSRSRPRT 562

Query: 60  DSEEDDRKRNRDRR 19
              +D R R+R RR
Sbjct: 563 ARTDDKRDRSRSRR 576

[155][TOP]
>UniRef100_UPI000021E63C UPI000021E63C related cluster n=1 Tax=Rattus norvegicus
           RepID=UPI000021E63C
          Length = 157

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 57/156 (36%), Positives = 90/156 (57%), Gaps = 2/156 (1%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           QR+   +  R+R R R+RD + E ERDR    + ++E E +R+R R  + R R  +R+ +
Sbjct: 1   QRERERETERERQRERERDRERETERDRERERQRETERERERERQRETE-RERQRERERE 59

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            E++R+R+ + DR    E R R+   E+ER R    +   E E +R+RDR  D R R  +
Sbjct: 60  TERDRERQRERDRERETE-RDRERQRERERQRETERERQRETERERERDRERD-RERQRE 117

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRKRNRDR-RYRDT 7
           RD + ++ER  R R ++   E DR+R R+R R R+T
Sbjct: 118 RDRERQRER-QRERDRERQRERDRERQRERDRERET 152

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 49/152 (32%), Positives = 88/152 (57%), Gaps = 10/152 (6%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDR-------RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR- 322
           R  +R+   +R RDR       R R+R  + E+ER+R  + + + E + +R+R+   DR 
Sbjct: 6   RETERERQRERERDRERETERDRERERQRETERERERERQRETERERQRERERETERDRE 65

Query: 321 RHRVDDRDGDNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRD 145
           R R  DR+ + E++R+R+ + +R+   ER R R+ + E+ERDR    +   E + +R+R+
Sbjct: 66  RQRERDRERETERDRERQRERERQRETERERQRETERERERDRERDRERQRERDRERQRE 125

Query: 144 RNGDR-RHRVDDRDGDNEKERDHRRRYKDDSE 52
           R  +R R R  +RD + ++ERD  R  + ++E
Sbjct: 126 RQRERDRERQRERDRERQRERDRERETERETE 157

[156][TOP]
>UniRef100_UPI00016E7DC1 UPI00016E7DC1 related cluster n=1 Tax=Takifugu rubripes
            RepID=UPI00016E7DC1
          Length = 1013

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 56/151 (37%), Positives = 82/151 (54%), Gaps = 9/151 (5%)
 Frame = -1

Query: 444  NRDR------RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
            NRDR      RY+ R +D+E+E  R  R  D +EE   R+ DR  DR  R  DR+ + EK
Sbjct: 675  NRDRGEASPSRYQGRSEDSEREERREDRRTDRTEE---RREDRTRDRE-RERDREREKEK 730

Query: 282  ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
            ERD+  + +R    ER  R+ + E+ERDR    ++   E  +R+R+R    R R  +R+ 
Sbjct: 731  ERDKEREKEREAERERA-RERERERERDREREREEREREREEREREREERDRER-KERER 788

Query: 102  DNEKERDHRRRYKD---DSEEDDRKRNRDRR 19
            + EKER+ R R +    +  E  R+  RDRR
Sbjct: 789  EREKEREQRERERQREWEERERGREERRDRR 819

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 50/130 (38%), Positives = 77/130 (59%), Gaps = 5/130 (3%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEF--DRKRDRNGDRRHRVDDRDGDNEKER 277
            R RDR R RDR+ + EKERD+    + ++E E   +R+R+R  DR    ++R+ + E ER
Sbjct: 714  RTRDRERERDREREKEKERDKEREKEREAERERARERERERERDREREREERERERE-ER 772

Query: 276  DR-RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
            +R R + DR    ER+ R+ + EKER++R R +    EE +R R+   DRR   D RD  
Sbjct: 773  EREREERDR----ERKEREREREKEREQRERERQREWEERERGREERRDRRE--DSRDER 826

Query: 99   NEKE-RDHRR 73
            + ++ RD R+
Sbjct: 827  SIRDSRDDRK 836

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 39/135 (28%), Positives = 70/135 (51%), Gaps = 1/135 (0%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD-RRHRVDDRDGDNEKERDRRGD 262
            + R  DR  D E+ERDR    + + E+E D++R++  +  R R  +R+ + E++R+R  +
Sbjct: 708  EERREDRTRDRERERDR----EREKEKERDKEREKEREAERERARERERERERDRERERE 763

Query: 261  NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 82
               R   ER    ++ ++ER  R R ++   E+ +R+R R  + R R  +   D  ++  
Sbjct: 764  EREREREEREREREERDRERKEREREREKEREQRERERQREWEERERGREERRDRREDSR 823

Query: 81   HRRRYKDDSEEDDRK 37
              R  +D    DDRK
Sbjct: 824  DERSIRD--SRDDRK 836

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 44/153 (28%), Positives = 77/153 (50%), Gaps = 4/153 (2%)
 Frame = -1

Query: 456  IWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
            +W+ +R    R+R  +   +R      +    +  D  RDR      R   R  D+E+E 
Sbjct: 640  VWE-SRSSAARERSVERSNDRSAADERRSGERDRRDN-RDRGEASPSRYQGRSEDSEREE 697

Query: 276  ---DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDR 109
               DRR D   R    R  R  D E+ERDR    + + ++E +++R+   +R R R  +R
Sbjct: 698  RREDRRTD---RTEERREDRTRDRERERDREREKEKERDKEREKEREAERERARERERER 754

Query: 108  DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            + D E+ER+ R R +++ E +  +R+R+R+ R+
Sbjct: 755  ERDREREREEREREREEREREREERDRERKERE 787

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 38/145 (26%), Positives = 78/145 (53%), Gaps = 1/145 (0%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            +  R+ R RDR+ + ++ER++      + E + +R+++R  +R      R+ + E+ERDR
Sbjct: 708  EERREDRTRDRERERDREREK------EKERDKEREKEREAERERA---RERERERERDR 758

Query: 270  RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNE 94
              + +     ER    ++ E+ER+ R R + + E E +++R+ R  +R+   ++R+   E
Sbjct: 759  ERERE-----EREREREEREREREERDRERKEREREREKEREQRERERQREWEERERGRE 813

Query: 93   KERDHRRRYKDDSEEDDRKRNRDRR 19
            + RD R   +D+    D + +R  R
Sbjct: 814  ERRDRREDSRDERSIRDSRDDRKMR 838

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 57/198 (28%), Positives = 84/198 (42%), Gaps = 50/198 (25%)
 Frame = -1

Query: 465  RKMIWKRNRDR-RYRDRDDDNEKERDR-----------------RGRYKDDSEEEFDRKR 340
            R+ +  R RDR R +D++ + E+ERDR                 RG  ++DS+ +   K 
Sbjct: 551  RESLGSRERDRDREKDKEREKERERDRSDTQRKEDTTQEDRSYVRGHGREDSKTDRAEKN 610

Query: 339  -----------DRNGDRRHRVDDRDGDNE---------KERDRRGDNDRRGNGERRHRDD 220
                       D+  +R  R    +  N+         +ER     NDR    ERR  + 
Sbjct: 611  GRVRSRANESSDKGSNRNTRGSQLESSNDVWESRSSAARERSVERSNDRSAADERRSGER 670

Query: 219  DNEKERDR--------RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRR-- 73
            D    RDR        +GR +D   EE  R+ DR  DR   R +DR  D E+ERD  R  
Sbjct: 671  DRRDNRDRGEASPSRYQGRSEDSEREE--RREDRRTDRTEERREDRTRDRERERDREREK 728

Query: 72   -RYKDDSEEDDRKRNRDR 22
             + +D   E +R+  R+R
Sbjct: 729  EKERDKEREKEREAERER 746

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 46/165 (27%), Positives = 77/165 (46%), Gaps = 18/165 (10%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR-HRVDDRDGDNEK--- 283
            K  R R   +   D    R+ RG   + S + ++ +     +R   R +DR   +E+   
Sbjct: 609  KNGRVRSRANESSDKGSNRNTRGSQLESSNDVWESRSSAARERSVERSNDRSAADERRSG 668

Query: 282  ERDRRGDNDRRGNGERRH--RDDDNEKERDRRGRYKD-----------DSEEEFDRKRDR 142
            ERDRR + DR      R+  R +D+E+E  R  R  D           D E E DR+R++
Sbjct: 669  ERDRRDNRDRGEASPSRYQGRSEDSEREERREDRRTDRTEERREDRTRDRERERDREREK 728

Query: 141  NGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
              +R + R  +R+ + E+ R+  R  + D E +  +R R+R  R+
Sbjct: 729  EKERDKEREKEREAERERARERERERERDREREREEREREREERE 773

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 42/145 (28%), Positives = 67/145 (46%), Gaps = 5/145 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRD---DDNEKERD-RRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           +R+ +R  R++D   DD   ERD R  R + D+ E   R R+   D R   D +D   E 
Sbjct: 488 RRDENRNKREKDSVRDDTRSERDTRESRDRRDARE---RGRETTRDSRDNRDTKDS-RES 543

Query: 282 ERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
             + R   +  G+ ER R R+ D E+E++R     D   +E   + DR+  R H  +D  
Sbjct: 544 RTETRSSRESLGSRERDRDREKDKEREKERERDRSDTQRKEDTTQEDRSYVRGHGREDSK 603

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRN 31
            D  ++    R   ++S +    RN
Sbjct: 604 TDRAEKNGRVRSRANESSDKGSNRN 628

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 43/147 (29%), Positives = 64/147 (43%), Gaps = 8/147 (5%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRGRYKDDSE------EEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           R  +R   +++    R R++ + E      E  + +RD N ++R +   RD D   ERD 
Sbjct: 453 RRSERSSPSQRHSRGRERFRGERERSLPAQERRNERRDENRNKREKDSVRD-DTRSERDT 511

Query: 270 RGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
           R   DRR   ER R    D+   RD +     DS E     R        R  DRD + +
Sbjct: 512 RESRDRRDARERGRETTRDSRDNRDTK-----DSRESRTETRSSRESLGSRERDRDREKD 566

Query: 93  KERD-HRRRYKDDSEEDDRKRNRDRRY 16
           KER+  R R + D++  +     DR Y
Sbjct: 567 KEREKERERDRSDTQRKEDTTQEDRSY 593

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 43/152 (28%), Positives = 70/152 (46%), Gaps = 5/152 (3%)
 Frame = -1

Query: 453 WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           ++  R+R    ++  NE+  + R + + DS  +  R      + R R D R+   E  RD
Sbjct: 471 FRGERERSLPAQERRNERRDENRNKREKDSVRDDTRSERDTRESRDRRDARERGRETTRD 530

Query: 273 RRGDNDRRGNGE-----RRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
            R + D + + E     R  R+    +ERDR    + D E E +R+RDR+ D + + D  
Sbjct: 531 SRDNRDTKDSRESRTETRSSRESLGSRERDR--DREKDKEREKERERDRS-DTQRKEDTT 587

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
             D    R H R   +DS+ D  ++N   R R
Sbjct: 588 QEDRSYVRGHGR---EDSKTDRAEKNGRVRSR 616

[157][TOP]
>UniRef100_A7L5V6 Putative uncharacterized protein (Fragment) n=1 Tax=Acinetobacter
           baumannii RepID=A7L5V6_ACIBA
          Length = 326

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 60/158 (37%), Positives = 77/158 (48%), Gaps = 16/158 (10%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
           R R R RY D D+D+ + R     RGR +DD +E+ DR R     R    DD D     E
Sbjct: 52  RGRGRSRYDDDDEDDVRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRDDDD-----E 106

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRHR 121
            D RG +  RG G  R  DDD + +R R       R RY DD E++   +    G  R R
Sbjct: 107 EDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSR 166

Query: 120 VDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 167 RDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 204

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 61/178 (34%), Positives = 80/178 (44%), Gaps = 36/178 (20%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           R R R  RD DDD + +R R G       RY DD E++   +    G  R R DD D D+
Sbjct: 116 RGRGRSRRD-DDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDD 174

Query: 288 EK-----------------ERDRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYK 181
           ++                 E D RG +  RG G  R  DDD + +R R       R RY 
Sbjct: 175 DRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYD 234

Query: 180 DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           DD E++   +    G  R R DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 235 DDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 292

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 59/157 (37%), Positives = 76/157 (48%), Gaps = 20/157 (12%)
 Frame = -1

Query: 432 RYRDRDDDNEKE-------RDRRGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKER 277
           R R RDDD+E++       R R    +DD +E+ DR R    G  R R DD D D     
Sbjct: 97  RGRSRDDDDEEDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDED----- 151

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRHRV 118
           D RG +  RG G  R  DDD + +R R       R RY DD E++   +    G  R R 
Sbjct: 152 DDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRR 211

Query: 117 DDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 212 DDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 248

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 63/162 (38%), Positives = 80/162 (49%), Gaps = 14/162 (8%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           R R R   D DDD  +   R RGR +DD +EE DR R     R R R DD D D     D
Sbjct: 76  RGRSRDDDDEDDDRGRSGGRGRGRSRDDDDEEDDRGRSGGRGRGRSRRDDDDED-----D 130

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR---RHRV 118
            RG +  RG G  R+ DDD + +R R     RGR + D ++E D  R R+G R   R R 
Sbjct: 131 DRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSRY 189

Query: 117 DDRDGDNEKERD----HRRRYKDDSEEDDRKRNRDRRYRDTS 4
           DD D D+++ R       R  +DD +EDD +     R R  S
Sbjct: 190 DDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRS 231

 Score = 80.9 bits (198), Expect(2) = 3e-14
 Identities = 62/162 (38%), Positives = 81/162 (50%), Gaps = 19/162 (11%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           R R R  RD DDD + +R R G       RY DD E++    R R+G R      RD D+
Sbjct: 160 RGRGRSRRD-DDDEDDDRGRSGGRGRGRSRYDDDDEDD---DRGRSGGRGRGRSRRDDDD 215

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYK-DDSEEEFDRKRD-RNGDR 130
           E   D RG +  RG G  R+ DDD + +R R     RGR + DD +E+ DR R    G  
Sbjct: 216 ED--DDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRG 273

Query: 129 RHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDRR 19
           R R DD D D+++ R       R R  DD ++DDR+   D R
Sbjct: 274 RSRYDDDDEDDDRGRSGGRGRGRSRRDDDDDDDDRRGRSDGR 315

 Score = 20.8 bits (42), Expect(2) = 3e-14
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -3

Query: 484 RYKDDSEEDD 455
           RY DD E+DD
Sbjct: 144 RYDDDDEDDD 153

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 57/138 (41%), Positives = 72/138 (52%), Gaps = 12/138 (8%)
 Frame = -1

Query: 399 ERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGDNDRRGNGERRHRD 223
           +R+ RGR + D +E+ DR R     R R R DD D D     D RG +  RG G  R  D
Sbjct: 29  DRNGRGRSRYDDDEDDDRGRSTGRGRGRSRYDDDDED-----DVRGRSGGRGRGRSRD-D 82

Query: 222 DDNEKERDR-----RGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKERD-----HR 76
           DD + +R R     RGR +DD +EE DR R    G  R R DD D D+++ R       R
Sbjct: 83  DDEDDDRGRSGGRGRGRSRDDDDEEDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGR 142

Query: 75  RRYKDDSEEDDRKRNRDR 22
            RY DD E+DDR R+  R
Sbjct: 143 SRYDDDDEDDDRGRSGGR 160

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 61/158 (38%), Positives = 78/158 (49%), Gaps = 16/158 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           R R R   D DDD  +   R   R RY DD E++    R R+G R      R  D++ E 
Sbjct: 33  RGRSRYDDDEDDDRGRSTGRGRGRSRYDDDDEDDV---RGRSGGRGR---GRSRDDDDED 86

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR---RHR 121
           D RG +  RG G  R  DDD E +R R     RGR + D ++E D  R R+G R   R R
Sbjct: 87  DDRGRSGGRGRGRSRD-DDDEEDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSR 144

Query: 120 VDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            DD D D+++ R       R R  DD E+DDR R+  R
Sbjct: 145 YDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGR 182

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 47/138 (34%), Positives = 66/138 (47%), Gaps = 16/138 (11%)
 Frame = -1

Query: 387 RGRYKDDSEEEFDRKRDRN-GDRRHRVDDRDGD-----NEKERDRRGDNDRRGNGERRHR 226
           R  +   +  EF  +  R  G   H+ DDR+G      ++ E D RG +  RG G  R+ 
Sbjct: 1   RAAHASGNAHEFTSEEAREAGALSHKNDDRNGRGRSRYDDDEDDDRGRSTGRGRGRSRYD 60

Query: 225 DDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD-----HR 76
           DDD +  R R     RGR +DD +E+ DR R     R    DD D ++++ R       R
Sbjct: 61  DDDEDDVRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRDDDDEEDDRGRSGGRGRGR 120

Query: 75  RRYKDDSEEDDRKRNRDR 22
            R  DD E+DDR R+  R
Sbjct: 121 SRRDDDDEDDDRGRSGGR 138

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 57/156 (36%), Positives = 76/156 (48%), Gaps = 15/156 (9%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDN 289
           R R R RY D D+D+++ R     RGR + D ++E D  R R+G R   R R DD D D 
Sbjct: 182 RGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSRYDDDDED- 239

Query: 288 EKERDRRGDNDRRGNGE-RRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGD 133
               D RG +  RG G  RR  DD+++ +R R       R RY DD E++   +    G 
Sbjct: 240 ----DDRGRSGGRGRGRSRRDDDDEDD-DRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGR 294

Query: 132 RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
            R R DD D D     D RR   D   ++ R + RD
Sbjct: 295 GRSRRDDDDDD-----DDRRGRSDGRGQNSRNQKRD 325

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 43/121 (35%), Positives = 58/121 (47%), Gaps = 9/121 (7%)
 Frame = -1

Query: 339 DRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDD 175
           DRNG  R R DD + D+      RG +  RG G  R+ DDD +  R R     RGR +DD
Sbjct: 29  DRNGRGRSRYDDDEDDD------RGRSTGRGRGRSRYDDDDEDDVRGRSGGRGRGRSRDD 82

Query: 174 SEEEFDRKRDRNGDRRHRVDDRDGDNEKERD----HRRRYKDDSEEDDRKRNRDRRYRDT 7
            +E+ DR R     R    DD D ++++ R       R  +DD +EDD +     R R  
Sbjct: 83  DDEDDDRGRSGGRGRGRSRDDDDEEDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGR 142

Query: 6   S 4
           S
Sbjct: 143 S 143

[158][TOP]
>UniRef100_B6KLF4 RNA recognition motif-containing protein n=1 Tax=Toxoplasma gondii
            ME49 RepID=B6KLF4_TOXGO
          Length = 754

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 48/164 (29%), Positives = 86/164 (52%), Gaps = 16/164 (9%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG-------- 295
            +R R+ R R+R+ + E+ER+R  R +    EE DR+R+R  +R  R  +R+         
Sbjct: 577  EREREERDREREREREREREREERDRQREREERDRQREREREREEREREREERDRQRERE 636

Query: 294  DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
            + ++ER+ R + +    GE+     + ++E +RR R  D+  +E   ++D  GDR  R  
Sbjct: 637  ERDREREERDEGESGSEGEKERGRGERKREGERRRRRADEDAKERRGEKDERGDREERRK 696

Query: 114  DRDGDNEKERDHRR---RYKDDSEED-----DRKRNRDRRYRDT 7
             R G+    +D RR   R  DD EED     +R+  +D++ +++
Sbjct: 697  KRRGETSSSKDERRHHGRRGDDKEEDGASEKEREETQDKKDKES 740

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/141 (34%), Positives = 80/141 (56%), Gaps = 2/141 (1%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG-DRRHRVDDRDGDNEKERDRR 268
           N++R  R+R+ +NE++R+R      DSE E DR+R+R   DR    ++RD + E+ER+R 
Sbjct: 541 NQERGERERETENERDRER------DSENERDREREREERDREREREERDRERERERERE 594

Query: 267 GDNDRRG-NGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
            + + R    ER  RD   E+ER+R  R ++   EE DR+R+R    R R +  +G++  
Sbjct: 595 REREERDRQREREERDRQREREREREERERE--REERDRQREREERDREREERDEGESGS 652

Query: 90  ERDHRRRYKDDSEEDDRKRNR 28
           E +  R   +   E +R+R R
Sbjct: 653 EGEKERGRGERKREGERRRRR 673

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 50/154 (32%), Positives = 85/154 (55%), Gaps = 10/154 (6%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            +R+R R   +RD   E+ER+R  R ++  E +  R+R+     R   D+ +  +E E++ 
Sbjct: 599  ERDRQREREERDRQREREREREEREREREERDRQREREERDREREERDEGESGSEGEKE- 657

Query: 270  RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG-------DRRH---R 121
            RG  +R+  GERR R  D E  ++RRG  KD+  +  +R++ R G       +RRH   R
Sbjct: 658  RGRGERKREGERRRRRAD-EDAKERRGE-KDERGDREERRKKRRGETSSSKDERRHHGRR 715

Query: 120  VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
             DD++ D   E++ R   +D  +++ RKR ++RR
Sbjct: 716  GDDKEEDGASEKE-REETQDKKDKESRKRKKERR 748

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 57/176 (32%), Positives = 91/176 (51%), Gaps = 23/176 (13%)
 Frame = -1

Query: 468  QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
            +R+   +  RDR  RD +++ ++ER+R  R ++   EE DR+R+R  +R    ++RD   
Sbjct: 546  ERERETENERDRE-RDSENERDREREREERDREREREERDREREREREREREREERDRQR 604

Query: 288  EK-ERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDD-------SEEEFDR---KRD 145
            E+ ERDR+ + +R R   ER   + D ++ER+ R R +++       SE E +R   +R 
Sbjct: 605  EREERDRQREREREREEREREREERDRQREREERDREREERDEGESGSEGEKERGRGERK 664

Query: 144  RNGDRRHRVDDRD-----------GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            R G+RR R  D D           GD E+ R  RR   + S   D +R+  RR  D
Sbjct: 665  REGERRRRRADEDAKERRGEKDERGDREERRKKRR--GETSSSKDERRHHGRRGDD 718

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 51/174 (29%), Positives = 81/174 (46%), Gaps = 21/174 (12%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDD----------NEKERDRR-----GRYKDDSEEEFDRKR-- 340
           +R+  W  + DR  ++   D          +EKE  R      GR  +     F      
Sbjct: 475 KRRSRWDLHDDRTEKNYGADESRIAGEGLRSEKEAQREMFVAAGRGSETGRSNFSSSASG 534

Query: 339 ----DRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDS 172
               + N +R  R  +R+ +NE++R+R  +N+R    ER  RD + E+E   R R ++  
Sbjct: 535 LGGGEVNQERGER--ERETENERDRERDSENERDREREREERDREREREERDRERERERE 592

Query: 171 EEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            E    +RDR  +R  R  DR  + E+ER+ R R   + EE DR+R R+ R R+
Sbjct: 593 REREREERDRQREREER--DRQREREREREERER---EREERDRQREREERDRE 641

[159][TOP]
>UniRef100_A7LFP1 Putative uncharacterized protein (Fragment) n=1 Tax=Acinetobacter
           baumannii RepID=A7LFP1_ACIBA
          Length = 326

 Score = 85.1 bits (209), Expect(2) = 2e-15
 Identities = 63/174 (36%), Positives = 83/174 (47%), Gaps = 32/174 (18%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG----RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE-- 286
           R R RR  D +DD+      RG    RY DD E++   +    G  R R DD D D++  
Sbjct: 97  RGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRG 156

Query: 285 ------KERDRRGDND---------RRGNGERRHRDDDNEKERDR-----RGRYKDDSEE 166
                 + R RR D+D          RG G  R+ DDD + +R R     RGR +DD +E
Sbjct: 157 RSGGRGRGRSRRDDDDDDDDRRGSSGRGRGRSRYDDDDEDDDRGRSGGRGRGRGRDDDDE 216

Query: 165 EFDRKRD-RNGDRRHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           + DR R    G  R R DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 217 DDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 270

 Score = 20.8 bits (42), Expect(2) = 2e-15
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -3

Query: 484 RYKDDSEEDD 455
           RY DD E+DD
Sbjct: 58  RYDDDDEDDD 67

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 64/159 (40%), Positives = 83/159 (52%), Gaps = 17/159 (10%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 283
           R R R RY D D+D+++ R     RGR +DD +E+ DR R     R R R DD D D   
Sbjct: 52  RGRGRSRYDDDDEDDDRGRSGGRGRGRGRDDDDEDDDRGRSGGRGRGRSRRDDDDED--- 108

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYK-DDSEEEFDRKRD-RNGDRRH 124
             D RG +  RG G  R+ DDD + +R R     RGR + DD +E+ DR R    G  R 
Sbjct: 109 --DDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRS 166

Query: 123 RVDDRDGDNEKERDH-----RRRYKDDSEEDDRKRNRDR 22
           R DD D D+++         R RY DD E+DDR R+  R
Sbjct: 167 RRDDDDDDDDRRGSSGRGRGRSRYDDDDEDDDRGRSGGR 205

 Score = 83.6 bits (205), Expect(2) = 5e-15
 Identities = 54/155 (34%), Positives = 73/155 (47%), Gaps = 12/155 (7%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           R R R  RD DDD++  R   GR +  S  + D + D  G    R   R  D++ E D R
Sbjct: 161 RGRGRSRRDDDDDDDDRRGSSGRGRGRSRYDDDDEDDDRGRSGGRGRGRGRDDDDEDDDR 220

Query: 267 GDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
           G +  RG G  R  DDD + +R R       R RY DD E++   +    G  R R DD 
Sbjct: 221 GRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRYDDD 280

Query: 108 DGDNEKERD-----HRRRYKDDSEEDDRKRNRDRR 19
           D D+++ R       R R  DD ++DDR+   D R
Sbjct: 281 DEDDDRGRSGGRGRGRSRRDDDDDDDDRRGRSDGR 315

 Score = 20.8 bits (42), Expect(2) = 5e-15
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -3

Query: 484 RYKDDSEEDD 455
           RY DD E+DD
Sbjct: 123 RYDDDDEDDD 132

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 60/166 (36%), Positives = 78/166 (46%), Gaps = 20/166 (12%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           R R R   D DDD  +   R   R RY DD E++    R R+G R      R  D++ E 
Sbjct: 33  RGRSRYDDDEDDDRGRSSGRGRGRSRYDDDDEDD---DRGRSGGRGR---GRGRDDDDED 86

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRHRV 118
           D RG +  RG G  R  DDD + +R R       R RY DD E++   +    G  R R 
Sbjct: 87  DDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRY 146

Query: 117 DDRDGDNEKERD-----HRRRYKDDSEEDDRK----RNRDR-RYRD 10
           DD D D+++ R       R R  DD ++DDR+    R R R RY D
Sbjct: 147 DDDDEDDDRGRSGGRGRGRSRRDDDDDDDDRRGSSGRGRGRSRYDD 192

 Score = 75.9 bits (185), Expect(2) = 9e-13
 Identities = 57/153 (37%), Positives = 74/153 (48%), Gaps = 12/153 (7%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEK 283
           R R R RY D D+D+++ R     RGR +DD +E+ DR R    G  R R DD D D   
Sbjct: 183 RGRGRSRYDDDDEDDDRGRSGGRGRGRGRDDDDEDDDRGRSGGRGRGRSRRDDDDED--- 239

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRH 124
             D RG +  RG G  R+ DDD + +R R       R RY DD E++   +    G  R 
Sbjct: 240 --DDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRS 297

Query: 123 RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
           R DD D D     D RR   D   ++ R + RD
Sbjct: 298 RRDDDDDD-----DDRRGRSDGRGQNSRNQKRD 325

 Score = 20.8 bits (42), Expect(2) = 9e-13
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -3

Query: 484 RYKDDSEEDD 455
           RY DD E+DD
Sbjct: 145 RYDDDDEDDD 154

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 58/166 (34%), Positives = 75/166 (45%), Gaps = 18/166 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           R R R  RD DDD + +R R G       RY DD E++   +    G  R R DD D D 
Sbjct: 95  RGRGRSRRD-DDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRYDDDDED- 152

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDR 130
               D RG +  RG G  R  DDD++ +R         R RY DD E++ DR R     R
Sbjct: 153 ----DDRGRSGGRGRGRSRRDDDDDDDDRRGSSGRGRGRSRYDDDDEDD-DRGRSGGRGR 207

Query: 129 RHRVDDRDGDNEKERD----HRRRYKDDSEEDDRKRNRDRRYRDTS 4
               DD D D+++ R       R  +DD +EDD +     R R  S
Sbjct: 208 GRGRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRS 253

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 51/139 (36%), Positives = 70/139 (50%), Gaps = 17/139 (12%)
 Frame = -1

Query: 387 RGRYKDDSEEEFDRKRDRN-GDRRHRVDDRDGD-----NEKERDRRGDNDRRGNGERRHR 226
           R  +   +  EF  +  R  G   H+ DDR+G      ++ E D RG +  RG G  R+ 
Sbjct: 1   RAAHASGNAHEFTSEEAREAGALSHKNDDRNGRGRSRYDDDEDDDRGRSSGRGRGRSRYD 60

Query: 225 DDDNEKERDR-----RGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKERD-----H 79
           DDD + +R R     RGR +DD +E+ DR R    G  R R DD D D+++ R       
Sbjct: 61  DDDEDDDRGRSGGRGRGRGRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRG 120

Query: 78  RRRYKDDSEEDDRKRNRDR 22
           R RY DD E+DDR R+  R
Sbjct: 121 RSRYDDDDEDDDRGRSGGR 139

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 58/145 (40%), Positives = 74/145 (51%), Gaps = 16/145 (11%)
 Frame = -1

Query: 408 NEKERDR--RGRYKDDSEEEFDRKRDR-NGDRRHRVDDRDGDNEKERDRRGDNDRRGNGE 238
           + K  DR  RGR + D +E+ DR R    G  R R DD D D     D RG +  RG G 
Sbjct: 24  SHKNDDRNGRGRSRYDDDEDDDRGRSSGRGRGRSRYDDDDED-----DDRGRSGGRGRGR 78

Query: 237 RRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERD 82
            R  DDD + +R R     RGR + D ++E D  R R+G R   R R DD D D+++ R 
Sbjct: 79  GRD-DDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSRYDDDDEDDDRGRS 136

Query: 81  -----HRRRYKDDSEEDDRKRNRDR 22
                 R RY DD E+DDR R+  R
Sbjct: 137 GGRGRGRSRYDDDDEDDDRGRSGGR 161

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 39/117 (33%), Positives = 51/117 (43%), Gaps = 5/117 (4%)
 Frame = -1

Query: 339 DRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDD 175
           DRNG  R R DD + D+      RG +  RG G  R+ DDD + +R R     RGR +DD
Sbjct: 29  DRNGRGRSRYDDDEDDD------RGRSSGRGRGRSRYDDDDEDDDRGRSGGRGRGRGRDD 82

Query: 174 SEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            +E+ DR R                    R   R  +DD +EDD +     R R  S
Sbjct: 83  DDEDDDRGRSGG-----------------RGRGRSRRDDDDEDDDRGRSGGRGRGRS 122

[160][TOP]
>UniRef100_UPI000166213E PREDICTED: hypothetical protein n=1 Tax=Homo sapiens
           RepID=UPI000166213E
          Length = 285

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 58/165 (35%), Positives = 96/165 (58%), Gaps = 12/165 (7%)
 Frame = -1

Query: 480 IRMIQRKMIWKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEF---DRKRDRNGDR- 322
           IR  +R+   +R R R   R+R++D + EK+RDR+ R +D   + +   DRKR+R GDR 
Sbjct: 57  IRERERQRERERQRKRAKERHREKDREIEKDRDRQ-RKRDRERQRWRDRDRKRERWGDRD 115

Query: 321 RHRVDDRDGDNEKERDRRGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFD 157
           R    +R  + E++RDR+ + DR    +R     + R+ + EK+RDR  R   ++E   D
Sbjct: 116 RETETERQEERERQRDRKREKDRERQRQREIGIDKDREIETEKDRDRE-REMGETERYRD 174

Query: 156 RKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           R+R+R   R  R  DRD + ++E++ R R +D  +E ++ R R+R
Sbjct: 175 RERERQKQRETR-RDRDRERQREKEDRERDRDRQKEREKDRYRER 218

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 55/150 (36%), Positives = 88/150 (58%), Gaps = 16/150 (10%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHR---VD-DR 301
           KR+R+R R+RDRD   E+  DR    + + +EE +R+RDR  ++     R R   +D DR
Sbjct: 93  KRDRERQRWRDRDRKRERWGDRDRETETERQEERERQRDRKREKDRERQRQREIGIDKDR 152

Query: 300 DGDNEKERDRR---GDNDRRGNGER-RHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNG 136
           + + EK+RDR    G+ +R  + ER R +  +  ++RDR R R K+D E + DR+++R  
Sbjct: 153 EIETEKDRDREREMGETERYRDRERERQKQRETRRDRDRERQREKEDRERDRDRQKEREK 212

Query: 135 DR-RHRVDDRDGDNEKERDHRRRYKDDSEE 49
           DR R R   RD D E++R+ +R    D ++
Sbjct: 213 DRYRERETGRDRDKERDRERQREKDRDRQK 242

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 63/164 (38%), Positives = 89/164 (54%), Gaps = 25/164 (15%)
 Frame = -1

Query: 426 RDRDDDNEKERDR---RGRYKD-DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGD 262
           R+R+   E+ER R   + R+++ D E E DR R R  DR R R  DRD    ++R+R GD
Sbjct: 58  RERERQRERERQRKRAKERHREKDREIEKDRDRQRKRDRERQRWRDRD----RKRERWGD 113

Query: 261 NDRRGNGER-----RHRDDDNEKERDRR-----GRYKD-DSEEEFDRKRDRNGDRRHRVD 115
            DR    ER     R RD   EK+R+R+     G  KD + E E DR R+R      R  
Sbjct: 114 RDRETETERQEERERQRDRKREKDRERQRQREIGIDKDREIETEKDRDREREMGETERYR 173

Query: 114 DRDGDNEKERDHRR-------RYKDDSEED-DRKRNRDR-RYRD 10
           DR+ + +K+R+ RR       R K+D E D DR++ R++ RYR+
Sbjct: 174 DRERERQKQRETRRDRDRERQREKEDRERDRDRQKEREKDRYRE 217

[161][TOP]
>UniRef100_UPI0000E494ED PREDICTED: similar to FIP1 like 1 (S. cerevisiae) n=1
            Tax=Strongylocentrotus purpuratus RepID=UPI0000E494ED
          Length = 841

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 54/145 (37%), Positives = 74/145 (51%), Gaps = 1/145 (0%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            R RDR R RDRD D +++RDR GR +D    + DR+RDR GDR H    RD   + ERDR
Sbjct: 691  RERDRDRDRDRDRDRDRDRDREGRDRDRETRDRDRERDR-GDREHASRSRDLSRDLERDR 749

Query: 270  RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
                           D D +KER++  R K+  E++ DR RDR  D RH+   R  D+E 
Sbjct: 750  ---------------DRDKDKEREK--RLKEKEEDKDDRVRDRYKDSRHKSSRRKRDDED 792

Query: 90   ERDHRRRYKDDSEEDDRKRNRDRRY 16
            ++    R++      DR +     Y
Sbjct: 793  DKYSSSRHRHRHSRRDRDKEGGEEY 817

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 55/156 (35%), Positives = 82/156 (52%), Gaps = 10/156 (6%)
 Frame = -1

Query: 444  NRDRRYRDRDDD-NEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
            + DR+  D D D  E  +    + + D   EF R+R R+   R R  DR  D  +++ R 
Sbjct: 634  SEDRKESDYDRDIREFSKFLNSKAEADKVREFSRER-RDRPSRDRSPDRSRDRSRDKTRE 692

Query: 267  GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH--------RVDD 112
             D DR      R RD D +++RDR GR +D    + DR+RDR GDR H        R  +
Sbjct: 693  RDRDRD-----RDRDRDRDRDRDREGRDRDRETRDRDRERDR-GDREHASRSRDLSRDLE 746

Query: 111  RDGDNEKERDHRRRYKDDSEE-DDRKRNRDRRYRDT 7
            RD D +K+++  +R K+  E+ DDR R+   RY+D+
Sbjct: 747  RDRDRDKDKEREKRLKEKEEDKDDRVRD---RYKDS 779

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 46/136 (33%), Positives = 68/136 (50%), Gaps = 3/136 (2%)
 Frame = -1

Query: 423  DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGN 244
            + D   E  R+RR R   D     DR RDR+ D+  R  DRD D +++RDR  D DR G 
Sbjct: 658  EADKVREFSRERRDRPSRDRSP--DRSRDRSRDKT-RERDRDRDRDRDRDRDRDRDREGR 714

Query: 243  G-ERRHRDDDNEKERDRR--GRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR 73
              +R  RD D E++R  R       D   + +R RDR+ D+      ++ + +K+   R 
Sbjct: 715  DRDRETRDRDRERDRGDREHASRSRDLSRDLERDRDRDKDKEREKRLKEKEEDKDDRVRD 774

Query: 72   RYKDDSEEDDRKRNRD 25
            RYKD   +  R++  D
Sbjct: 775  RYKDSRHKSSRRKRDD 790

[162][TOP]
>UniRef100_UPI000023D1EE hypothetical protein FG05500.1 n=1 Tax=Gibberella zeae PH-1
            RepID=UPI000023D1EE
          Length = 900

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/150 (34%), Positives = 83/150 (55%), Gaps = 5/150 (3%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDN----EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
            K++R RR+   ++D+    +K++D+  RY D +      +  R+  R  R  DRD D  K
Sbjct: 640  KKHRSRRHHHDEEDSSRSKDKDKDKDDRYADRNRSTSPTESKRSSHRSRR--DRDSDKRK 697

Query: 282  ERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
            ++D    +DR+ +G R  HRD D ++ER RR + +D S+++   ++DR+ DR  R  DRD
Sbjct: 698  DKDDHRSDDRKKSGHRSSHRDKDYDRER-RRDKDRDRSDKDRKDRKDRHRDRDRRDRDRD 756

Query: 105  GDNEKERDHRRRYKDDSEEDDRKRNRDRRY 16
             D +++R+  R         DR R RD RY
Sbjct: 757  RDKDRDRESHR---------DRDRERDSRY 777

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 49/158 (31%), Positives = 81/158 (51%), Gaps = 13/158 (8%)
 Frame = -1

Query: 441  RDRRYRDR-------DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD---GD 292
            R RRYR         DDD+ +++ R  R+  D EE+  R +D++ D+  R  DR+     
Sbjct: 619  RRRRYRSESIEDDSYDDDSRRKKHRSRRHHHD-EEDSSRSKDKDKDKDDRYADRNRSTSP 677

Query: 291  NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
             E +R        R + +R+ +DD    +R + G      ++++DR+R R+ DR     D
Sbjct: 678  TESKRSSHRSRRDRDSDKRKDKDDHRSDDRKKSGHRSSHRDKDYDRERRRDKDRDRSDKD 737

Query: 111  RDG--DNEKERDHRRRYKDDSEEDDRKRNRDR-RYRDT 7
            R    D  ++RD R R +D  ++ DR+ +RDR R RD+
Sbjct: 738  RKDRKDRHRDRDRRDRDRDRDKDRDRESHRDRDRERDS 775

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 52/152 (34%), Positives = 73/152 (48%), Gaps = 11/152 (7%)
 Frame = -1

Query: 432  RYRDRDDDNEKERDRRGRYKDDSEEEF----DRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
            R R R   ++  R RR RY+ +S E+     D +R ++  RRH  D+ D    K++D+  
Sbjct: 606  RSRSRSRGHKSSRRRR-RYRSESIEDDSYDDDSRRKKHRSRRHHHDEEDSSRSKDKDK-- 662

Query: 264  DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR---HRVDDRDGDNE 94
            D D R     R       K    R R   DS++  D+   R+ DR+   HR   RD D +
Sbjct: 663  DKDDRYADRNRSTSPTESKRSSHRSRRDRDSDKRKDKDDHRSDDRKKSGHRSSHRDKDYD 722

Query: 93   KER----DHRRRYKDDSEEDDRKRNRDRRYRD 10
            +ER    D  R  KD  +  DR R+RDRR RD
Sbjct: 723  RERRRDKDRDRSDKDRKDRKDRHRDRDRRDRD 754

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 43/157 (27%), Positives = 70/157 (44%), Gaps = 10/157 (6%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERD--------RRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
            KR+  R  RDRD D  K++D        + G      ++++DR+R R+ DR    D  D 
Sbjct: 681  KRSSHRSRRDRDSDKRKDKDDHRSDDRKKSGHRSSHRDKDYDRERRRDKDR----DRSDK 736

Query: 294  DNEKERDRRGDNDRRGNGERRHRDDDNE--KERDRRGRYKDDSEEEFDRKRDRNGDRRHR 121
            D +  +DR  D DRR     R +D D E  ++RDR    +  S  +       + D+  +
Sbjct: 737  DRKDRKDRHRDRDRRDRDRDRDKDRDRESHRDRDRERDSRYSSRHQSTDAGTASNDKDPK 796

Query: 120  VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
                   NE + + + R  + S +D     R+ R R+
Sbjct: 797  PPSGPRGNETKANSQSR-TESSGKDPHTLEREARDRE 832

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 43/158 (27%), Positives = 75/158 (47%), Gaps = 23/158 (14%)
 Frame = -1

Query: 426  RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR-RGDNDRR 250
            R++D D+E +R+   + +    ++ DR+RD +G  +           + R R RG    R
Sbjct: 560  REKDKDHESQREH-SKDRSRDHDKHDRERDDHGQNQVHAGSASRTVSRSRSRSRGHKSSR 618

Query: 249  GNGERRHR---------DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD- 100
                RR+R         DDD+ +++ R  R+  D EE+  R +D++ D+  R  DR+   
Sbjct: 619  RR--RRYRSESIEDDSYDDDSRRKKHRSRRHHHD-EEDSSRSKDKDKDKDDRYADRNRST 675

Query: 99   -----------NEKERD-HRRRYKDDSEEDDRKRNRDR 22
                       + ++RD  +R+ KDD   DDRK++  R
Sbjct: 676  SPTESKRSSHRSRRDRDSDKRKDKDDHRSDDRKKSGHR 713

[163][TOP]
>UniRef100_UPI0001A2D9BC UPI0001A2D9BC related cluster n=1 Tax=Danio rerio
           RepID=UPI0001A2D9BC
          Length = 339

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/145 (36%), Positives = 79/145 (54%), Gaps = 7/145 (4%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
           + R R +D EKE D+  + KDD E E + +  R  +   +  +++ + E+ER+R  + +R
Sbjct: 164 KLRRRSEDPEKE-DQGKKVKDDREREREEREKRRKEEEEKEKEKEREKEREREREKERER 222

Query: 252 RGNGER-RHRDDDNEKERDRRGRYKDD----SEEEFDRKRDRNGDRRH-RVDDRDGDNEK 91
               ER R RD D E++RDRR R        S    DR+R R+ DRR  R  +R+    +
Sbjct: 223 ERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKERERKRSR 282

Query: 90  ERD-HRRRYKDDSEEDDRKRNRDRR 19
            RD  RRR +D S+   R R+RDRR
Sbjct: 283 SRDRERRRSRDRSDRKRRSRSRDRR 307

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 53/152 (34%), Positives = 78/152 (51%), Gaps = 5/152 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R R+ R + R ++ EKE+++    + + E E +R+R+R    R R  DRD D E++RDR
Sbjct: 186 EREREEREKRRKEEEEKEKEKEREKEREREREKERERERE---RERDRDRDRDRERDRDR 242

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNE 94
           R    RR +   RH    +++ R R    +    +E +RKR R+ DR R R  DR     
Sbjct: 243 RS---RRSHSNSRHSSRTSDRRRSRSRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKR 299

Query: 93  KERDHRRRYKDDSEEDD---RKRNRDR-RYRD 10
           + R   RR    SE      R R+RDR R RD
Sbjct: 300 RSRSRDRRRSRSSERKSHRHRSRSRDRDRDRD 331

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 50/149 (33%), Positives = 72/149 (48%), Gaps = 2/149 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K     R ++R+ + EKER+R    + D + + DR+RDR  DRR R   R   N +   R
Sbjct: 202 KEKEKEREKEREREREKERERERERERDRDRDRDRERDR--DRRSR---RSHSNSRHSSR 256

Query: 270 RGDNDR-RGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
             D  R R    RR R  + E++R R R R +  S +  DRK      RR R  DR    
Sbjct: 257 TSDRRRSRSRDRRRSRSKERERKRSRSRDRERRRSRDRSDRK------RRSRSRDRRRSR 310

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             ER    R++  S + DR R++D+  +D
Sbjct: 311 SSER-KSHRHRSRSRDRDRDRDKDKSSKD 338

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 49/140 (35%), Positives = 71/140 (50%), Gaps = 4/140 (2%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDN--EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
           +R+   +R R+R R RDRD D   E++RDRR R    +     R  DR   RR R  DR 
Sbjct: 213 EREREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDR---RRSRSRDRR 269

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR-HR 121
               KER+R+    R  + ERR   D ++++R  R R         DR+R R+ +R+ HR
Sbjct: 270 RSRSKERERKRSRSR--DRERRRSRDRSDRKRRSRSR---------DRRRSRSSERKSHR 318

Query: 120 VDDRDGDNEKERDHRRRYKD 61
              R  D +++RD  +  KD
Sbjct: 319 HRSRSRDRDRDRDKDKSSKD 338

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/139 (29%), Positives = 67/139 (48%), Gaps = 3/139 (2%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRG--RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
           + R DD+   +   G  + K   EE  ++ R R+ D       +   +++ER+R     R
Sbjct: 136 QSRVDDHLMGKQHMGYAKIKSTVEELKEKLRRRSEDPEKEDQGKKVKDDREREREEREKR 195

Query: 252 RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH-R 76
           R   E + ++ + EKER+R    + + E E +R RDR+ DR     +RD D    R H  
Sbjct: 196 RKEEEEKEKEKEREKEREREREKERERERERERDRDRDRDR-----ERDRDRRSRRSHSN 250

Query: 75  RRYKDDSEEDDRKRNRDRR 19
            R+   + +  R R+RDRR
Sbjct: 251 SRHSSRTSDRRRSRSRDRR 269

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 37/120 (30%), Positives = 62/120 (51%), Gaps = 14/120 (11%)
 Frame = -1

Query: 330 GDRRHRVDDR--------------DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRR 193
           GD + RVDD                 +  KE+ RR   D     + +   DD E+ER+ R
Sbjct: 133 GDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKLRRRSEDPEKEDQGKKVKDDREREREER 192

Query: 192 GRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
            + + + EEE +++++R  +R     +R+ + E+ER+ R R +D   + DR+R+RDRR R
Sbjct: 193 EKRRKE-EEEKEKEKEREKER-----EREREKERERE-RERERDRDRDRDRERDRDRRSR 245

[164][TOP]
>UniRef100_UPI0001A2D9BA hypothetical protein LOC563852 n=1 Tax=Danio rerio
           RepID=UPI0001A2D9BA
          Length = 466

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/145 (36%), Positives = 79/145 (54%), Gaps = 7/145 (4%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
           + R R +D EKE D+  + KDD E E + +  R  +   +  +++ + E+ER+R  + +R
Sbjct: 233 KLRRRSEDPEKE-DQGKKVKDDREREREEREKRRKEEEEKEKEKEREKEREREREKERER 291

Query: 252 RGNGER-RHRDDDNEKERDRRGRYKDD----SEEEFDRKRDRNGDRRH-RVDDRDGDNEK 91
               ER R RD D E++RDRR R        S    DR+R R+ DRR  R  +R+    +
Sbjct: 292 ERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKERERKRSR 351

Query: 90  ERD-HRRRYKDDSEEDDRKRNRDRR 19
            RD  RRR +D S+   R R+RDRR
Sbjct: 352 SRDRERRRSRDRSDRKRRSRSRDRR 376

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 53/155 (34%), Positives = 77/155 (49%), Gaps = 12/155 (7%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R R+ R + R ++ EKE+++    + + E E +R+R+R    R R  DRD D E++RDR
Sbjct: 255 EREREEREKRRKEEEEKEKEKEREKEREREREKERERERE---RERDRDRDRDRERDRDR 311

Query: 270 RGDNDRRGNGERRH--RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD- 100
           R    RR +   RH  R  D  + R R  R     E E  R R R+ +RR   D  D   
Sbjct: 312 RS---RRSHSNSRHSSRTSDRRRSRSRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKR 368

Query: 99  NEKERDHRR---------RYKDDSEEDDRKRNRDR 22
             + RD RR         R++  S + DR R+RDR
Sbjct: 369 RSRSRDRRRSRSSERKSHRHRSRSRDRDRDRDRDR 403

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 53/153 (34%), Positives = 76/153 (49%), Gaps = 7/153 (4%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDD------SEEEFDRKRDRNGDRRHRV 310
           +R+   +R R+R R RDRD D ++ERDR  R +        S    DR+R R+ DRR   
Sbjct: 282 EREREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRR-- 339

Query: 309 DDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
             R  + E++R R  D +RR     R R D   + R R  R    SE +  R R R+ DR
Sbjct: 340 -SRSKERERKRSRSRDRERR---RSRDRSDRKRRSRSRDRRRSRSSERKSHRHRSRSRDR 395

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRN 31
                DRD D ++++D   + KD  +  D KR+
Sbjct: 396 -----DRDRDRDRDKDKSSKDKDHKDSSDEKRS 423

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 54/156 (34%), Positives = 76/156 (48%), Gaps = 6/156 (3%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           +R+   +R R+R R RDRD D E++RDRR R    +     R  DR   RR R  DR   
Sbjct: 284 EREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDR---RRSRSRDRRRS 340

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----R 127
             KER+R+    R  + ERR   D ++++R  R R         DR+R R+ +R     R
Sbjct: 341 RSKERERKRSRSR--DRERRRSRDRSDRKRRSRSR---------DRRRSRSSERKSHRHR 389

Query: 126 HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            R  DRD D +++RD  +  KD   +D     R  R
Sbjct: 390 SRSRDRDRDRDRDRDKDKSSKDKDHKDSSDEKRSSR 425

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 48/151 (31%), Positives = 78/151 (51%), Gaps = 4/151 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           ++  + + ++++ + E+ER+R    + + E E DR RDR+ +R R R   R   N +   
Sbjct: 265 RKEEEEKEKEKEREKEREREREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSS 324

Query: 273 RRGDNDR-RGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRK-RDRNGDRRHRVDDRDG 103
           R  D  R R    RR R  + E++R R R R +  S +  DRK R R+ DRR     R  
Sbjct: 325 RTSDRRRSRSRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKRRSRSRDRRR---SRSS 381

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           + +  R HR R +D   + DR R++D+  +D
Sbjct: 382 ERKSHR-HRSRSRDRDRDRDRDRDKDKSSKD 411

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/139 (29%), Positives = 67/139 (48%), Gaps = 3/139 (2%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRG--RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
           + R DD+   +   G  + K   EE  ++ R R+ D       +   +++ER+R     R
Sbjct: 205 QSRVDDHLMGKQHMGYAKIKSTVEELKEKLRRRSEDPEKEDQGKKVKDDREREREEREKR 264

Query: 252 RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH-R 76
           R   E + ++ + EKER+R    + + E E +R RDR+ DR     +RD D    R H  
Sbjct: 265 RKEEEEKEKEKEREKEREREREKERERERERERDRDRDRDR-----ERDRDRRSRRSHSN 319

Query: 75  RRYKDDSEEDDRKRNRDRR 19
            R+   + +  R R+RDRR
Sbjct: 320 SRHSSRTSDRRRSRSRDRR 338

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 1/101 (0%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR-HRVDDRDGD 292
           +R+   K    +R R RD +  + RDR  R +       DR+R R+ +R+ HR   R  D
Sbjct: 337 RRRSRSKERERKRSRSRDRERRRSRDRSDRKRRSRSR--DRRRSRSSERKSHRHRSRSRD 394

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSE 169
            +++RDR  D D + + ++ H+D  +EK   R+G  +  +E
Sbjct: 395 RDRDRDRDRDKD-KSSKDKDHKDSSDEKRSSRKGSVEKCNE 434

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 37/120 (30%), Positives = 62/120 (51%), Gaps = 14/120 (11%)
 Frame = -1

Query: 330 GDRRHRVDDR--------------DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRR 193
           GD + RVDD                 +  KE+ RR   D     + +   DD E+ER+ R
Sbjct: 202 GDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKLRRRSEDPEKEDQGKKVKDDREREREER 261

Query: 192 GRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
            + + + EEE +++++R  +R     +R+ + E+ER+ R R +D   + DR+R+RDRR R
Sbjct: 262 EKRRKE-EEEKEKEKEREKER-----EREREKERERE-RERERDRDRDRDRERDRDRRSR 314

[165][TOP]
>UniRef100_UPI00015A7A78 hypothetical protein LOC563852 n=1 Tax=Danio rerio
           RepID=UPI00015A7A78
          Length = 462

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/145 (36%), Positives = 79/145 (54%), Gaps = 7/145 (4%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
           + R R +D EKE D+  + KDD E E + +  R  +   +  +++ + E+ER+R  + +R
Sbjct: 233 KLRRRSEDPEKE-DQGKKVKDDREREREEREKRRKEEEEKEKEKEREKEREREREKERER 291

Query: 252 RGNGER-RHRDDDNEKERDRRGRYKDD----SEEEFDRKRDRNGDRRH-RVDDRDGDNEK 91
               ER R RD D E++RDRR R        S    DR+R R+ DRR  R  +R+    +
Sbjct: 292 ERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKERERKRSR 351

Query: 90  ERD-HRRRYKDDSEEDDRKRNRDRR 19
            RD  RRR +D S+   R R+RDRR
Sbjct: 352 SRDRERRRSRDRSDRKRRSRSRDRR 376

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 53/152 (34%), Positives = 78/152 (51%), Gaps = 5/152 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R R+ R + R ++ EKE+++    + + E E +R+R+R    R R  DRD D E++RDR
Sbjct: 255 EREREEREKRRKEEEEKEKEKEREKEREREREKERERERE---RERDRDRDRDRERDRDR 311

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNE 94
           R    RR +   RH    +++ R R    +    +E +RKR R+ DR R R  DR     
Sbjct: 312 RS---RRSHSNSRHSSRTSDRRRSRSRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKR 368

Query: 93  KERDHRRRYKDDSEEDD---RKRNRDR-RYRD 10
           + R   RR    SE      R R+RDR R RD
Sbjct: 369 RSRSRDRRRSRSSERKSHRHRSRSRDRDRDRD 400

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 50/157 (31%), Positives = 79/157 (50%), Gaps = 17/157 (10%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKE 280
           KR ++   ++++ + EKER+R    + + E E +R RDR+ DR   R R   R   N + 
Sbjct: 263 KRRKEEEEKEKEKEREKEREREREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRH 322

Query: 279 RDRRGDNDR-RGNGERRHRDDDNEKERDR-----RGRYKDDSEEE-----FDRKRDRNGD 133
             R  D  R R    RR R  + E++R R     R R +D S+ +      DR+R R+ +
Sbjct: 323 SSRTSDRRRSRSRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKRRSRSRDRRRSRSSE 382

Query: 132 R---RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRN 31
           R   RHR   RD D ++++D   + KD  +  D KR+
Sbjct: 383 RKSHRHRSRSRDRDRDRDKDKSSKDKDHKDSSDEKRS 419

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 52/152 (34%), Positives = 75/152 (49%), Gaps = 2/152 (1%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           +R+   +R R+R R RDRD D E++RDRR R    +     R  DR   RR R  DR   
Sbjct: 284 EREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDR---RRSRSRDRRRS 340

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR-HRVD 115
             KER+R+    R  + ERR   D ++++R  R R         DR+R R+ +R+ HR  
Sbjct: 341 RSKERERKRSRSR--DRERRRSRDRSDRKRRSRSR---------DRRRSRSSERKSHRHR 389

Query: 114 DRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            R  D +++RD  +  KD   +D     R  R
Sbjct: 390 SRSRDRDRDRDKDKSSKDKDHKDSSDEKRSSR 421

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/139 (29%), Positives = 67/139 (48%), Gaps = 3/139 (2%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRG--RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
           + R DD+   +   G  + K   EE  ++ R R+ D       +   +++ER+R     R
Sbjct: 205 QSRVDDHLMGKQHMGYAKIKSTVEELKEKLRRRSEDPEKEDQGKKVKDDREREREEREKR 264

Query: 252 RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH-R 76
           R   E + ++ + EKER+R    + + E E +R RDR+ DR     +RD D    R H  
Sbjct: 265 RKEEEEKEKEKEREKEREREREKERERERERERDRDRDRDR-----ERDRDRRSRRSHSN 319

Query: 75  RRYKDDSEEDDRKRNRDRR 19
            R+   + +  R R+RDRR
Sbjct: 320 SRHSSRTSDRRRSRSRDRR 338

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 37/120 (30%), Positives = 62/120 (51%), Gaps = 14/120 (11%)
 Frame = -1

Query: 330 GDRRHRVDDR--------------DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRR 193
           GD + RVDD                 +  KE+ RR   D     + +   DD E+ER+ R
Sbjct: 202 GDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKLRRRSEDPEKEDQGKKVKDDREREREER 261

Query: 192 GRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
            + + + EEE +++++R  +R     +R+ + E+ER+ R R +D   + DR+R+RDRR R
Sbjct: 262 EKRRKE-EEEKEKEKEREKER-----EREREKERERE-RERERDRDRDRDRERDRDRRSR 314

[166][TOP]
>UniRef100_A5D6T9 Zgc:136380 protein n=1 Tax=Danio rerio RepID=A5D6T9_DANRE
          Length = 465

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/145 (36%), Positives = 79/145 (54%), Gaps = 7/145 (4%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
           + R R +D EKE D+  + KDD E E + +  R  +   +  +++ + E+ER+R  + +R
Sbjct: 233 KLRRRSEDPEKE-DQGKKVKDDREREREEREKRRKEEEEKEKEKEREKEREREREKERER 291

Query: 252 RGNGER-RHRDDDNEKERDRRGRYKDD----SEEEFDRKRDRNGDRRH-RVDDRDGDNEK 91
               ER R RD D E++RDRR R        S    DR+R R+ DRR  R  +R+    +
Sbjct: 292 ERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKERERKRSR 351

Query: 90  ERD-HRRRYKDDSEEDDRKRNRDRR 19
            RD  RRR +D S+   R R+RDRR
Sbjct: 352 SRDRERRRSRDRSDRKRRSRSRDRR 376

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 52/155 (33%), Positives = 78/155 (50%), Gaps = 8/155 (5%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R R+ R + R ++ EKE+++    + + E E +R+R+R    R R  DRD D E++RDR
Sbjct: 255 EREREEREKRRKEEEEKEKEKEREKEREREREKERERERE---RERDRDRDRDRERDRDR 311

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNE 94
           R    RR +   RH    +++ R R    +    +E +RKR R+ DR R R  DR     
Sbjct: 312 RS---RRSHSNSRHSSRTSDRRRSRSRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKR 368

Query: 93  KERDHRRRYKDDSEED-------DRKRNRDRRYRD 10
           + R   RR    SE          R+R+RDR  RD
Sbjct: 369 RSRSRDRRRSRSSERKSHRHRSRSRERDRDRGDRD 403

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 54/152 (35%), Positives = 77/152 (50%), Gaps = 6/152 (3%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDD----SEEEFDRKRDRNGDRRHRVDD 304
           +R+   +R R+R R RDRD D E++RDRR R        S    DR+R R+ DRR     
Sbjct: 284 EREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRR---S 340

Query: 303 RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
           R  + E++R R  D +RR +   R R D   + R R  R    SE +  R R R+ +R  
Sbjct: 341 RSKERERKRSRSRDRERRRS---RDRSDRKRRSRSRDRRRSRSSERKSHRHRSRSRER-- 395

Query: 123 RVDDRD-GDNEKERDHRRRYKDDSEEDDRKRN 31
              DRD GD +K++  +   KD  +  D KR+
Sbjct: 396 ---DRDRGDRDKDKSSKD--KDHKDSSDEKRS 422

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 54/153 (35%), Positives = 75/153 (49%), Gaps = 8/153 (5%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDD------SEEEFDRKRDRNGDRRHRV 310
           +R+   +R R+R R RDRD D ++ERDR  R +        S    DR+R R+ DRR   
Sbjct: 282 EREREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRR-- 339

Query: 309 DDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
             R  + E++R R  D +RR     R R D   + R R  R    SE +  R R R+ +R
Sbjct: 340 -SRSKERERKRSRSRDRERR---RSRDRSDRKRRSRSRDRRRSRSSERKSHRHRSRSRER 395

Query: 129 RHRVDDRDGD-NEKERDHRRRYKDDSEEDDRKR 34
                DRD D + K++DH    KD S+E    R
Sbjct: 396 DRDRGDRDKDKSSKDKDH----KDSSDEKRSSR 424

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 51/153 (33%), Positives = 77/153 (50%), Gaps = 4/153 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K     R ++R+ + EKER+R    + D +   DR R+R+ DRR R   R   N +   R
Sbjct: 271 KEKEKEREKEREREREKERERERERERDRDR--DRDRERDRDRRSR---RSHSNSRHSSR 325

Query: 270 RGDNDR-RGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRK-RDRNGDRRH-RVDDRDG 103
             D  R R    RR R  + E++R R R R +  S +  DRK R R+ DRR  R  +R  
Sbjct: 326 TSDRRRSRSRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKRRSRSRDRRRSRSSERKS 385

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
              + R  R R +D  + D  K ++D+ ++D+S
Sbjct: 386 HRHRSRS-RERDRDRGDRDKDKSSKDKDHKDSS 417

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/139 (29%), Positives = 67/139 (48%), Gaps = 3/139 (2%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRG--RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
           + R DD+   +   G  + K   EE  ++ R R+ D       +   +++ER+R     R
Sbjct: 205 QSRVDDHLMGKQHMGYAKIKSTVEELKEKLRRRSEDPEKEDQGKKVKDDREREREEREKR 264

Query: 252 RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH-R 76
           R   E + ++ + EKER+R    + + E E +R RDR+ DR     +RD D    R H  
Sbjct: 265 RKEEEEKEKEKEREKEREREREKERERERERERDRDRDRDR-----ERDRDRRSRRSHSN 319

Query: 75  RRYKDDSEEDDRKRNRDRR 19
            R+   + +  R R+RDRR
Sbjct: 320 SRHSSRTSDRRRSRSRDRR 338

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 37/120 (30%), Positives = 62/120 (51%), Gaps = 14/120 (11%)
 Frame = -1

Query: 330 GDRRHRVDDR--------------DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRR 193
           GD + RVDD                 +  KE+ RR   D     + +   DD E+ER+ R
Sbjct: 202 GDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKLRRRSEDPEKEDQGKKVKDDREREREER 261

Query: 192 GRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
            + + + EEE +++++R  +R     +R+ + E+ER+ R R +D   + DR+R+RDRR R
Sbjct: 262 EKRRKE-EEEKEKEKEREKER-----EREREKERERE-RERERDRDRDRDRERDRDRRSR 314

[167][TOP]
>UniRef100_A1L1N4 Zgc:136380 n=1 Tax=Danio rerio RepID=A1L1N4_DANRE
          Length = 465

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/145 (36%), Positives = 79/145 (54%), Gaps = 7/145 (4%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
           + R R +D EKE D+  + KDD E E + +  R  +   +  +++ + E+ER+R  + +R
Sbjct: 233 KLRRRSEDPEKE-DQGKKVKDDREREREEREKRRKEEEEKEKEKEREKEREREREKERER 291

Query: 252 RGNGER-RHRDDDNEKERDRRGRYKDD----SEEEFDRKRDRNGDRRH-RVDDRDGDNEK 91
               ER R RD D E++RDRR R        S    DR+R R+ DRR  R  +R+    +
Sbjct: 292 ERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRRSRSKERERKRSR 351

Query: 90  ERD-HRRRYKDDSEEDDRKRNRDRR 19
            RD  RRR +D S+   R R+RDRR
Sbjct: 352 SRDRERRRSRDRSDRKRRSRSRDRR 376

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 52/155 (33%), Positives = 78/155 (50%), Gaps = 8/155 (5%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R R+ R + R ++ EKE+++    + + E E +R+R+R    R R  DRD D E++RDR
Sbjct: 255 EREREEREKRRKEEEEKEKEKEREKEREREREKERERERE---RERDRDRDRDRERDRDR 311

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNE 94
           R    RR +   RH    +++ R R    +    +E +RKR R+ DR R R  DR     
Sbjct: 312 RS---RRSHSNSRHSSRTSDRRRSRSRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKR 368

Query: 93  KERDHRRRYKDDSEED-------DRKRNRDRRYRD 10
           + R   RR    SE          R+R+RDR  RD
Sbjct: 369 RSRSRDRRRSRSSERKSHRHRSRSRERDRDRGDRD 403

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 54/152 (35%), Positives = 77/152 (50%), Gaps = 6/152 (3%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDD----SEEEFDRKRDRNGDRRHRVDD 304
           +R+   +R R+R R RDRD D E++RDRR R        S    DR+R R+ DRR     
Sbjct: 284 EREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRR---S 340

Query: 303 RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
           R  + E++R R  D +RR +   R R D   + R R  R    SE +  R R R+ +R  
Sbjct: 341 RSKERERKRSRSRDRERRRS---RDRSDRKRRSRSRDRRRSRSSERKSHRHRSRSRER-- 395

Query: 123 RVDDRD-GDNEKERDHRRRYKDDSEEDDRKRN 31
              DRD GD +K++  +   KD  +  D KR+
Sbjct: 396 ---DRDRGDRDKDKSSKD--KDHKDSSDEKRS 422

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 54/153 (35%), Positives = 75/153 (49%), Gaps = 8/153 (5%)
 Frame = -1

Query: 468 QRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDD------SEEEFDRKRDRNGDRRHRV 310
           +R+   +R R+R R RDRD D ++ERDR  R +        S    DR+R R+ DRR   
Sbjct: 282 EREREKERERERERERDRDRDRDRERDRDRRSRRSHSNSRHSSRTSDRRRSRSRDRRR-- 339

Query: 309 DDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
             R  + E++R R  D +RR     R R D   + R R  R    SE +  R R R+ +R
Sbjct: 340 -SRSKERERKRSRSRDRERR---RSRDRSDRKRRSRSRDRRRSRSSERKSHRHRSRSRER 395

Query: 129 RHRVDDRDGD-NEKERDHRRRYKDDSEEDDRKR 34
                DRD D + K++DH    KD S+E    R
Sbjct: 396 DRDRGDRDKDKSSKDKDH----KDSSDEKRSSR 424

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 51/153 (33%), Positives = 77/153 (50%), Gaps = 4/153 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           K     R ++R+ + EKER+R    + D +   DR R+R+ DRR R   R   N +   R
Sbjct: 271 KEKEKEREKEREREREKERERERERERDRDR--DRDRERDRDRRSR---RSHSNSRHSSR 325

Query: 270 RGDNDR-RGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRK-RDRNGDRRH-RVDDRDG 103
             D  R R    RR R  + E++R R R R +  S +  DRK R R+ DRR  R  +R  
Sbjct: 326 TSDRRRSRSRDRRRSRSKERERKRSRSRDRERRRSRDRSDRKRRSRSRDRRRSRSSERKS 385

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
              + R  R R +D  + D  K ++D+ ++D+S
Sbjct: 386 HRHRSRS-RERDRDRGDRDKDKSSKDKDHKDSS 417

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/139 (29%), Positives = 67/139 (48%), Gaps = 3/139 (2%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRG--RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
           + R DD+   +   G  + K   EE  ++ R R+ D       +   +++ER+R     R
Sbjct: 205 QSRVDDHLMGKQHMGYAKIKSTVEELKEKLRRRSEDPEKEDQGKKVKDDREREREEREKR 264

Query: 252 RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH-R 76
           R   E + ++ + EKER+R    + + E E +R RDR+ DR     +RD D    R H  
Sbjct: 265 RKEEEEKEKEKEREKEREREREKERERERERERDRDRDRDR-----ERDRDRRSRRSHSN 319

Query: 75  RRYKDDSEEDDRKRNRDRR 19
            R+   + +  R R+RDRR
Sbjct: 320 SRHSSRTSDRRRSRSRDRR 338

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 37/120 (30%), Positives = 62/120 (51%), Gaps = 14/120 (11%)
 Frame = -1

Query: 330 GDRRHRVDDR--------------DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRR 193
           GD + RVDD                 +  KE+ RR   D     + +   DD E+ER+ R
Sbjct: 202 GDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKLRRRSEDPEKEDQGKKVKDDREREREER 261

Query: 192 GRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
            + + + EEE +++++R  +R     +R+ + E+ER+ R R +D   + DR+R+RDRR R
Sbjct: 262 EKRRKE-EEEKEKEKEREKER-----EREREKERERE-RERERDRDRDRDRERDRDRRSR 314

[168][TOP]
>UniRef100_C5YHD5 Putative uncharacterized protein Sb07g004090 n=1 Tax=Sorghum
           bicolor RepID=C5YHD5_SORBI
          Length = 1062

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/137 (35%), Positives = 76/137 (55%)
 Frame = -1

Query: 429 YRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRR 250
           +RD+D D ++   R  R   D E + DR+R+R+  R HR    DGD +++RDR   +  R
Sbjct: 15  HRDKDKDRDRSSSRHHR---DKERDRDRERERSSSRHHR---DDGDRDRDRDRHHRDKER 68

Query: 249 GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRR 70
              ER+ R+ +  K R+R        E E ++++++  +R  R ++RD + E+ER  RR 
Sbjct: 69  DREERKEREREERKARERE-------EREREKEKEKEKERARRREERDRE-ERERSRRRG 120

Query: 69  YKDDSEEDDRKRNRDRR 19
             D  E+DDR R R RR
Sbjct: 121 DADGEEDDDRDRKRRRR 137

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 50/154 (32%), Positives = 74/154 (48%), Gaps = 13/154 (8%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           +R  R ++RD D E+ER     ++DD +      RDR+ DR HR  +RD +  KER+R  
Sbjct: 27  SRHHRDKERDRDRERERSSSRHHRDDGD------RDRDRDRHHRDKERDREERKEREREE 80

Query: 264 DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKR-DRNGDRRHRVDDRDGDNEKE 88
              R      R ++ + EKER RR   +D  E E  R+R D +G+     DDRD    + 
Sbjct: 81  RKAREREEREREKEKEKEKERARRREERDREERERSRRRGDADGEED---DDRDRKRRRR 137

Query: 87  RDH------------RRRYKDDSEEDDRKRNRDR 22
             H            R   + D+EE +R+R R +
Sbjct: 138 SSHHHHHHRDPEPASREEEEVDAEEAERRRQRKK 171

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 48/157 (30%), Positives = 80/157 (50%), Gaps = 11/157 (7%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNE--KERDRRGRYKDDSEE-EFDRKRDRNGDRRHRVDDRDGDNEKER 277
           R+RDR +RD++ D E  KER+R  R   + EE E ++++++  +R  R ++RD +  +  
Sbjct: 57  RDRDRHHRDKERDREERKEREREERKAREREEREREKEKEKEKERARRREERDREERERS 116

Query: 276 DRRGD-----NDRRGNGERRHRDDDNEKERDRRGRYKDDSE---EEFDRKRDRNGDRRHR 121
            RRGD     +D R    RR     +   RD     +++ E   EE +R+R R  +    
Sbjct: 117 RRRGDADGEEDDDRDRKRRRRSSHHHHHHRDPEPASREEEEVDAEEAERRRQRKKEEDME 176

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            + +  D+E ER  RRR K+  E    KR   ++ +D
Sbjct: 177 AEQQRLDDEMER-RRRRVKEWQE----KRREQQQQQD 208

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 46/163 (28%), Positives = 77/163 (47%), Gaps = 16/163 (9%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R+  R +RD D D +++RDR  R K+   EE  ++R+R   +    ++R+ + EKE+++
Sbjct: 42  ERSSSRHHRD-DGDRDRDRDRHHRDKERDREE-RKEREREERKAREREEREREKEKEKEK 99

Query: 270 RGDNDRRGNGERRHRDDDNEKERD-RRGRYKDDSEEEFDRKRDRNGDRRH---------- 124
                      RR   D  E+ER  RRG    + +++ DRKR R     H          
Sbjct: 100 E-------RARRREERDREERERSRRRGDADGEEDDDRDRKRRRRSSHHHHHHRDPEPAS 152

Query: 123 RVDDRDGDNEKERDHRRRYKDDSEE-----DDRKRNRDRRYRD 10
           R ++     E ER  +R+ ++D E      DD    R RR ++
Sbjct: 153 REEEEVDAEEAERRRQRKKEEDMEAEQQRLDDEMERRRRRVKE 195

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 38/114 (33%), Positives = 58/114 (50%), Gaps = 10/114 (8%)
 Frame = -1

Query: 339 DRNGDRRHRVDDRDGDNEKE-----RDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKD 178
           D     +H   D+D D ++      RD+  D DR R     RH  DD +++RDR   ++D
Sbjct: 6   DERSTSKHHHRDKDKDRDRSSSRHHRDKERDRDRERERSSSRHHRDDGDRDRDRDRHHRD 65

Query: 177 ---DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH-RRRYKDDSEEDDRKRNR 28
              D EE  +R+R+    R     +R+ + EKE++  RRR + D EE +R R R
Sbjct: 66  KERDREERKEREREERKAREREEREREKEKEKEKERARRREERDREERERSRRR 119

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 31/96 (32%), Positives = 51/96 (53%)
 Frame = -1

Query: 309 DDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
           D+R       RD+  D DR  +  R HRD + +++R+R         ++ DR RDR  DR
Sbjct: 6   DERSTSKHHHRDKDKDRDR--SSSRHHRDKERDRDRERERSSSRHHRDDGDRDRDR--DR 61

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            HR  +RD +  KER+   R   + EE +R++ +++
Sbjct: 62  HHRDKERDREERKEREREERKAREREEREREKEKEK 97

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 30/84 (35%), Positives = 50/84 (59%)
 Frame = -1

Query: 261 NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 82
           +D R   +  HRD D +++R    R+  D E + DR+R+R+  R HR DD D D +++R 
Sbjct: 5   DDERSTSKHHHRDKDKDRDRSS-SRHHRDKERDRDRERERSSSRHHR-DDGDRDRDRDRH 62

Query: 81  HRRRYKDDSEEDDRKRNRDRRYRD 10
           HR + +D  E  +R+R  +R+ R+
Sbjct: 63  HRDKERDREERKERER-EERKARE 85

[169][TOP]
>UniRef100_B9SWX3 Cell cycle control protein cwf22, putative n=1 Tax=Ricinus communis
           RepID=B9SWX3_RICCO
          Length = 810

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 54/169 (31%), Positives = 86/169 (50%), Gaps = 19/169 (11%)
 Frame = -1

Query: 453 WKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFD----------RKRDRNGDRRHRVDD 304
           ++RN + R+  RDD+ +++R+ R   K+ S+EE +          R R+RN +RR R  D
Sbjct: 19  YERNSEHRH--RDDNKDRDREERKAVKESSDEEGELVERERGGGRRDRERNNERRDRDRD 76

Query: 303 RDGDNEKERDRRGDND-------RRGNGERRHRDDD--NEKERDRRGRYKDDSEEEFDRK 151
           RD D   E  R  D+D        RG  ER+ RD++   ++E + R RY+   E +  R 
Sbjct: 77  RDRDRVDEYKRSSDDDDDNKEKRERGERERKRRDENGHGKREIEDRNRYRQPDERKSGRD 136

Query: 150 RDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           RDR  DR     +R+   E ER   ++  ++  ED RK   + + R T+
Sbjct: 137 RDRVDDRHRSHRNRENVGEYERHKEKKKNNEQIEDSRKEVEEVKLRKTT 185

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/143 (35%), Positives = 74/143 (51%), Gaps = 5/143 (3%)
 Frame = -1

Query: 435 RRYRDRDDDNEKERDRRGRYKDDSEEEF-DRKRDRNGDRRHRV---DDRDGDNEKERDRR 268
           R Y D  DD   +R R  RY+ +SE    D  +DR+ + R  V    D +G+  +     
Sbjct: 3   RNYSDSSDD---DRSRHHRYERNSEHRHRDDNKDRDREERKAVKESSDEEGELVERERGG 59

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR-NGDRRHRVDDRDGDNEK 91
           G  DR  N ERR RD D  ++RDR   YK  S+++ D K  R  G+R  +  D +G  ++
Sbjct: 60  GRRDRERNNERRDRDRD--RDRDRVDEYKRSSDDDDDNKEKRERGERERKRRDENGHGKR 117

Query: 90  ERDHRRRYKDDSEEDDRKRNRDR 22
           E + R RY+   + D+RK  RDR
Sbjct: 118 EIEDRNRYR---QPDERKSGRDR 137

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 7/104 (6%)
 Frame = -1

Query: 303 RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDR-KRDRNGDRR 127
           R+  +  + DR   +    N E RHRDD+ +++R+ R   K+ S+EE +  +R+R G RR
Sbjct: 3   RNYSDSSDDDRSRHHRYERNSEHRHRDDNKDRDREERKAVKESSDEEGELVERERGGGRR 62

Query: 126 HRV---DDRDGDNEKERDHRRRYKDDSEEDD---RKRNRDRRYR 13
            R    + RD D +++RD    YK  S++DD    KR R  R R
Sbjct: 63  DRERNNERRDRDRDRDRDRVDEYKRSSDDDDDNKEKRERGERER 106

[170][TOP]
>UniRef100_B9RRL9 Splicing factor, putative n=1 Tax=Ricinus communis
           RepID=B9RRL9_RICCO
          Length = 609

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 54/155 (34%), Positives = 81/155 (52%), Gaps = 9/155 (5%)
 Frame = -1

Query: 447 RNRDRRYRDRDD-DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           R+   R  ++DD D++  R +R +  D+S +   RK    G  R R   RDG+ +  R  
Sbjct: 41  RSSKHRSNEKDDGDDDNRRSKRPKSGDESRDPDQRK--ERGSSRQRSRSRDGERDHHRSS 98

Query: 270 RGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           R   DR    ER   R R++ N KERDR      D E E +R+RDR+   R R  ++D +
Sbjct: 99  REHKDRDRGREREKERDREERNGKERDR----DRDRERERERERDRDRKERDRESEKDKE 154

Query: 99  NEKERDHRRRYKDDS-----EEDDRKRNRDRRYRD 10
            EKER  R R + D      +E +R+++RDR +R+
Sbjct: 155 REKERSRRSRSRSDKHRIELDEKEREKSRDREFRE 189

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 48/151 (31%), Positives = 78/151 (51%), Gaps = 7/151 (4%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-DRDGDNEKERD 274
           K     R R R  D E++  R  R   D +   +R+++R+ + R+  + DRD D E+ER+
Sbjct: 76  KERGSSRQRSRSRDGERDHHRSSREHKDRDRGREREKERDREERNGKERDRDRDRERERE 135

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEE-EFDRK-RDRNGDRRHRVDDRDGD 100
           R  D DR+       +D + EKER RR R + D    E D K R+++ DR  R  +R+ +
Sbjct: 136 RERDRDRKERDRESEKDKEREKERSRRSRSRSDKHRIELDEKEREKSRDREFRERERERE 195

Query: 99  NEKERDHRRRY----KDDSEEDDRKRNRDRR 19
           + +     RRY    K+++ E +    RD+R
Sbjct: 196 SRERDRESRRYNKEKKEEAAEPEADPERDQR 226

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 35/125 (28%), Positives = 64/125 (51%), Gaps = 4/125 (3%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +R+   +R+RDR+ RDR+ + +KER++              +R R+   +HR++  + + 
Sbjct: 131 ERERERERDRDRKERDRESEKDKEREKE-----------RSRRSRSRSDKHRIELDEKER 179

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV--- 118
           EK RDR     R    ER  R+ D E  R  + + ++ +E E D +RD+     +++   
Sbjct: 180 EKSRDR---EFRERERERESRERDRESRRYNKEKKEEAAEPEADPERDQRTVFAYQICLK 236

Query: 117 -DDRD 106
            D+RD
Sbjct: 237 ADERD 241

[171][TOP]
>UniRef100_Q1DJG4 Putative uncharacterized protein n=1 Tax=Coccidioides immitis
           RepID=Q1DJG4_COCIM
          Length = 530

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 57/158 (36%), Positives = 82/158 (51%), Gaps = 11/158 (6%)
 Frame = -1

Query: 453 WKRNRDR-------RYRDRDDD---NEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 304
           WK  RDR       RY   DDD    E    R GR +  S +  DR RDR+  RR R DD
Sbjct: 382 WKERRDRNLTKNGRRYDASDDDRDSRESSSRRNGRDRSRSSDR-DRARDRDSRRRRRYDD 440

Query: 303 RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
              D +++     D+++R   +RR+RD D+ ++R    +   D E + DR +DR+ DR  
Sbjct: 441 DYDDRDRD---SYDSEKRRKDDRRYRDRDSPRDRVEDSKRDRDRERDKDRDKDRDKDR-- 495

Query: 123 RVDDRDGDNEKERDH-RRRYKDDSEEDDRKRNRDRRYR 13
              DRD  +++ERD  R RY++   E  R++ R R YR
Sbjct: 496 ---DRDKYSDRERDRGRGRYREREREKGREKERRRDYR 530

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 49/160 (30%), Positives = 83/160 (51%), Gaps = 5/160 (3%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +++ K   K   +  ++    + E+E+ RR + +D+ +E  DR   +NG RR+   D D 
Sbjct: 347 LMKSKKTGKMITEEEFKKITKEQEREKQRREK-EDEWKERRDRNLTKNG-RRYDASDDDR 404

Query: 294 DNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
           D+ +   RR   DR  + +R R RD D+ + R     Y D   + +D ++ R  DRR+R 
Sbjct: 405 DSRESSSRRNGRDRSRSSDRDRARDRDSRRRRRYDDDYDDRDRDSYDSEKRRKDDRRYR- 463

Query: 117 DDRDGDNEKERDHRR---RYKDDSEEDDRKRNRDR-RYRD 10
            DRD   ++  D +R   R +D   + DR ++RDR +Y D
Sbjct: 464 -DRDSPRDRVEDSKRDRDRERDKDRDKDRDKDRDRDKYSD 502

[172][TOP]
>UniRef100_Q9ZR39 Splicing factor U2af large subunit A n=1 Tax=Nicotiana
           plumbaginifolia RepID=U2A2A_NICPL
          Length = 555

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 56/138 (40%), Positives = 75/138 (54%), Gaps = 5/138 (3%)
 Frame = -1

Query: 420 RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNG 241
           RD +NE++  R    + D   + DR RDRN DR     DRD D  KERD+          
Sbjct: 25  RDHENERDSSRSRDKERDKGRDKDRDRDRNRDR-----DRDRDRVKERDKD--------- 70

Query: 240 ERRHRDDDNEKERDR--RGRYKDDSEE-EFDRKRDRNGDRRHRVDDRDG--DNEKERDHR 76
             RHRD D EK+RDR  R R++D S+  E +R RDR+ D  HR  D D   DN+K+R+ R
Sbjct: 71  --RHRDRDGEKDRDRHHRDRHRDRSDRRERERTRDRDEDDLHRSRDYDRRRDNDKDREDR 128

Query: 75  RRYKDDSEEDDRKRNRDR 22
           RR++  S      R++ R
Sbjct: 129 RRHRPSSRGRSEHRSKSR 146

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 45/125 (36%), Positives = 64/125 (51%), Gaps = 11/125 (8%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNG----DRRHRVDDRDGDNE 286
           + RD+ R +DRD D  ++RDR R R K   E + DR RDR+G    DR HR   RD  + 
Sbjct: 39  KERDKGRDKDRDRDRNRDRDRDRDRVK---ERDKDRHRDRDGEKDRDRHHRDRHRDRSDR 95

Query: 285 KERDRRGDNDRRGNGERRHRDD--DNEKERDRRGRYKDDS---EEEFDRKRDRNGDRRHR 121
           +ER+R  D D       R  D   DN+K+R+ R R++  S    E   + R R+  +  R
Sbjct: 96  RERERTRDRDEDDLHRSRDYDRRRDNDKDREDRRRHRPSSRGRSEHRSKSRSRSPSKSKR 155

Query: 120 VDDRD 106
           +   D
Sbjct: 156 ISGFD 160

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 5/96 (5%)
 Frame = -1

Query: 465 RKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEE-EFDRKRDRNGDRRHRVDD----R 301
           R  + +R++DR +RDRD + +++R  R R++D S+  E +R RDR+ D  HR  D    R
Sbjct: 61  RDRVKERDKDR-HRDRDGEKDRDRHHRDRHRDRSDRRERERTRDRDEDDLHRSRDYDRRR 119

Query: 300 DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRR 193
           D D ++E  RR     RG  E R +       + +R
Sbjct: 120 DNDKDREDRRRHRPSSRGRSEHRSKSRSRSPSKSKR 155

[173][TOP]
>UniRef100_A7LFP2 Putative uncharacterized protein (Fragment) n=1 Tax=Acinetobacter
           baumannii RepID=A7LFP2_ACIBA
          Length = 326

 Score = 84.7 bits (208), Expect(2) = 2e-15
 Identities = 62/173 (35%), Positives = 80/173 (46%), Gaps = 31/173 (17%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEK--- 283
           R R R   D DDD  +   R RGR +DD +E+ DR R    G  R R DD D D+++   
Sbjct: 76  RGRGRDDDDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRS 135

Query: 282 --------------ERDRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEE 166
                         E D RG +  RG G  R  DDD + +R R       R RY DD E+
Sbjct: 136 GGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDED 195

Query: 165 EFDRKRDRNGDRRHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           +   +    G  R R DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 196 DDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 248

 Score = 20.8 bits (42), Expect(2) = 2e-15
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -3

Query: 484 RYKDDSEEDD 455
           RY DD E+DD
Sbjct: 58  RYDDDDEDDD 67

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 61/178 (34%), Positives = 80/178 (44%), Gaps = 36/178 (20%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           R R R  RD DDD + +R R G       RY DD E++   +    G  R R DD D D+
Sbjct: 116 RGRGRSRRD-DDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDD 174

Query: 288 EK-----------------ERDRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYK 181
           ++                 E D RG +  RG G  R  DDD + +R R       R RY 
Sbjct: 175 DRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYD 234

Query: 180 DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           DD E++   +    G  R R DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 235 DDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 292

 Score = 80.9 bits (198), Expect(2) = 3e-14
 Identities = 62/162 (38%), Positives = 81/162 (50%), Gaps = 19/162 (11%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           R R R  RD DDD + +R R G       RY DD E++    R R+G R      RD D+
Sbjct: 160 RGRGRSRRD-DDDEDDDRGRSGGRGRGRSRYDDDDEDD---DRGRSGGRGRGRSRRDDDD 215

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYK-DDSEEEFDRKRD-RNGDR 130
           E   D RG +  RG G  R+ DDD + +R R     RGR + DD +E+ DR R    G  
Sbjct: 216 ED--DDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRG 273

Query: 129 RHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDRR 19
           R R DD D D+++ R       R R  DD ++DDR+   D R
Sbjct: 274 RSRYDDDDEDDDRGRSGGRGRGRSRRDDDDDDDDRRGRSDGR 315

 Score = 20.8 bits (42), Expect(2) = 3e-14
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -3

Query: 484 RYKDDSEEDD 455
           RY DD E+DD
Sbjct: 144 RYDDDDEDDD 153

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 56/138 (40%), Positives = 72/138 (52%), Gaps = 12/138 (8%)
 Frame = -1

Query: 399 ERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGDNDRRGNGERRHRD 223
           +R+ RGR + D +E+ DR R     R R R DD D D     D RG +  RG G  R  D
Sbjct: 29  DRNGRGRSRYDDDEDDDRGRSSGRGRGRSRYDDDDED-----DDRGRSGGRGRGRGRD-D 82

Query: 222 DDNEKERDR-----RGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKERD-----HR 76
           DD + +R R     RGR +DD +E+ DR R    G  R R DD D D+++ R       R
Sbjct: 83  DDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGR 142

Query: 75  RRYKDDSEEDDRKRNRDR 22
            RY DD E+DDR R+  R
Sbjct: 143 SRYDDDDEDDDRGRSGGR 160

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 60/158 (37%), Positives = 78/158 (49%), Gaps = 16/158 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           R R R   D DDD  +   R   R RY DD E++    R R+G R      R  D++ E 
Sbjct: 33  RGRSRYDDDEDDDRGRSSGRGRGRSRYDDDDEDD---DRGRSGGRGR---GRGRDDDDED 86

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR---RHR 121
           D RG +  RG G  R  DDD + +R R     RGR + D ++E D  R R+G R   R R
Sbjct: 87  DDRGRSGGRGRGRSRD-DDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSR 144

Query: 120 VDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            DD D D+++ R       R R  DD E+DDR R+  R
Sbjct: 145 YDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGR 182

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 57/156 (36%), Positives = 76/156 (48%), Gaps = 15/156 (9%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDN 289
           R R R RY D D+D+++ R     RGR + D ++E D  R R+G R   R R DD D D 
Sbjct: 182 RGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSRYDDDDED- 239

Query: 288 EKERDRRGDNDRRGNGE-RRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGD 133
               D RG +  RG G  RR  DD+++ +R R       R RY DD E++   +    G 
Sbjct: 240 ----DDRGRSGGRGRGRSRRDDDDEDD-DRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGR 294

Query: 132 RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
            R R DD D D     D RR   D   ++ R + RD
Sbjct: 295 GRSRRDDDDDD-----DDRRGRSDGRGQNSRNQKRD 325

[174][TOP]
>UniRef100_B2HY98 Putative uncharacterized protein n=1 Tax=Acinetobacter baumannii
           ACICU RepID=B2HY98_ACIBC
          Length = 346

 Score = 84.3 bits (207), Expect(2) = 3e-15
 Identities = 60/158 (37%), Positives = 76/158 (48%), Gaps = 16/158 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGR---YKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKE 280
           R R RR  D +DD+      RGR    +DD +E+ DR R    G  R R DD D D    
Sbjct: 154 RGRSRRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDED---- 209

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRHR 121
            D RG +  RG G  R  DDD + +R R       R RY DD E++   +    G  R R
Sbjct: 210 -DDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDERGRSGGRGRGRSR 268

Query: 120 VDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 269 RDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 306

 Score = 20.8 bits (42), Expect(2) = 3e-15
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -3

Query: 484 RYKDDSEEDD 455
           RY DD E+DD
Sbjct: 115 RYDDDDEDDD 124

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 64/159 (40%), Positives = 83/159 (52%), Gaps = 17/159 (10%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 283
           R R R RY D D+D+++ R     RGR +DD +E+ DR R     R R R DD D D   
Sbjct: 109 RGRGRSRYDDDDEDDDRGRSGGRGRGRGRDDDDEDDDRGRSGGRGRGRSRRDDDDED--- 165

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYK-DDSEEEFDRKRD-RNGDRRH 124
             D RG +  RG G  R  DDD + +R R     RGR + DD +E+ DR R    G  R 
Sbjct: 166 --DDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRS 223

Query: 123 RVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           R DD D D+++ R       R RY DD E+D+R R+  R
Sbjct: 224 RRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDERGRSGGR 262

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 63/162 (38%), Positives = 81/162 (50%), Gaps = 19/162 (11%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           R R R  RD DDD + +R R G       RY DD E++    R R+G R      RD D+
Sbjct: 174 RGRGRSRRD-DDDEDDDRGRSGGRGRGRSRYDDDDEDD---DRGRSGGRGRGRSRRDDDD 229

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYK-DDSEEEFDRKRD-RNGDR 130
           E   D RG +  RG G  R+ DDD + ER R     RGR + DD +E+ DR R    G  
Sbjct: 230 ED--DDRGRSGGRGRGRSRYDDDDEDDERGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRG 287

Query: 129 RHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDRR 19
           R R DD D D+++ R       R R  DD ++DDR+   D R
Sbjct: 288 RSRYDDDDEDDDRGRSGGRGRGRSRRDDDDDDDDRRGRSDGR 329

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 60/158 (37%), Positives = 78/158 (49%), Gaps = 16/158 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           R R R   D DDD  +   R   R RY DD E++    R R+G R      R  D++ E 
Sbjct: 90  RGRSRYDDDEDDDRGRSSGRGRGRSRYDDDDEDD---DRGRSGGRGR---GRGRDDDDED 143

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR---RHR 121
           D RG +  RG G  R  DDD + +R R     RGR + D ++E D  R R+G R   R R
Sbjct: 144 DDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSR 202

Query: 120 VDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            DD D D+++ R       R R  DD E+DDR R+  R
Sbjct: 203 YDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGR 240

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 60/162 (37%), Positives = 77/162 (47%), Gaps = 14/162 (8%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDN 289
           R R R RY D D+D+++ R     RGR + D ++E D  R R+G R   R R DD D D 
Sbjct: 196 RGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSRYDDDDED- 253

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDR 130
               D RG +  RG G  R  DDD + +R R       R RY DD E++   +    G  
Sbjct: 254 ----DERGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRG 309

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           R R DD D D     D RR   D   ++ R + RD   R TS
Sbjct: 310 RSRRDDDDDD-----DDRRGRSDGRGQNSRNQKRDAYGRFTS 346

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 47/117 (40%), Positives = 61/117 (52%), Gaps = 11/117 (9%)
 Frame = -1

Query: 339 DRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDD 175
           DRNG  R R DD + D+      RG +  RG G  R+ DDD + +R R     RGR +DD
Sbjct: 86  DRNGRGRSRYDDDEDDD------RGRSSGRGRGRSRYDDDDEDDDRGRSGGRGRGRGRDD 139

Query: 174 SEEEFDRKRD-RNGDRRHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            +E+ DR R    G  R R DD D D+++ R       R R  DD E+DDR R+  R
Sbjct: 140 DDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGR 196

[175][TOP]
>UniRef100_UPI0001A5E7F8 PREDICTED: hypothetical protein n=1 Tax=Homo sapiens
           RepID=UPI0001A5E7F8
          Length = 202

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 54/148 (36%), Positives = 85/148 (57%), Gaps = 4/148 (2%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           +R R+R R  DR  + E+ERDR+ R +++  E  +R R R+   RHR  DR  D EKER+
Sbjct: 2   ERQRERKRETDRGKETERERDRQ-RERENQTERENRHRQRD---RHRERDRQTDREKERE 57

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
           R+ + DR+    +R R+ + E ER R  + + + + + DR+RD++ DR  +   R+ D  
Sbjct: 58  RQKERDRQ---RQRERETERETERQRERQRQRERKRQTDRERDKDRDRERK---RETDRN 111

Query: 93  KERDH---RRRYKDDSEEDDRKRNRDRR 19
           +ER+    R R K    E DR+R R R+
Sbjct: 112 RERNRKGGRERDKQTERERDRERERQRQ 139

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 47/153 (30%), Positives = 88/153 (57%), Gaps = 15/153 (9%)
 Frame = -1

Query: 447 RNRDRRY-RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-------RHRVDDRDGD 292
           R RDR+  R+++ + +KERDR+ + + ++E E +R+R+R   R       R R  DRD +
Sbjct: 44  RERDRQTDREKERERQKERDRQRQRERETERETERQRERQRQRERKRQTDRERDKDRDRE 103

Query: 291 NEKERDRRGDNDRRGNGER-------RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD 133
            ++E DR  + +R+G  ER       R R+ + +++R+R  + + + + E DR+R R  +
Sbjct: 104 RKRETDRNRERNRKGGRERDKQTERERDRERERQRQRERERQRQRERKRETDRERQRWAE 163

Query: 132 RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKR 34
           R  R  +R  + +KER  ++  K++   +D+KR
Sbjct: 164 REERKKERKKERKKERKEKK--KEEKRREDKKR 194

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 51/159 (32%), Positives = 91/159 (57%), Gaps = 15/159 (9%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR-----RGRYKD---DSEEEFDRKRDRNGDRRHRVD-DRD 298
           R RDR R RDR  D EKER+R     R R ++   + E E  R+R R  +R+ + D +RD
Sbjct: 38  RQRDRHRERDRQTDREKERERQKERDRQRQRERETERETERQRERQRQRERKRQTDRERD 97

Query: 297 GDNEKERDRRGDNDRRGNGE-RRHRDDDNEKERDR---RGRYKD-DSEEEFDRKRDRNGD 133
            D ++ER R  D +R  N +  R RD   E+ERDR   R R ++ + + + +RKR+ + +
Sbjct: 98  KDRDRERKRETDRNRERNRKGGRERDKQTERERDRERERQRQRERERQRQRERKRETDRE 157

Query: 132 RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRY 16
           R+   +  +   E++++ ++  K+  +E+ R+ ++ R++
Sbjct: 158 RQRWAEREERKKERKKERKKERKEKKKEEKRREDKKRKW 196

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 52/176 (29%), Positives = 93/176 (52%), Gaps = 25/176 (14%)
 Frame = -1

Query: 471 IQRKMIWKRNRDR-------RYRDRDDDNEKERDRRGRYKD---------DSEEEFDRKR 340
           ++R+   KR  DR       R R R+ +N+ ER+ R R +D         D E+E +R++
Sbjct: 1   MERQRERKRETDRGKETERERDRQRERENQTERENRHRQRDRHRERDRQTDREKERERQK 60

Query: 339 DRNGDR-RHRVDDRDGDNEKERDRRGDNDRRGNGER-------RHRDDDNEKERDRRGRY 184
           +R+  R R R  +R+ + ++ER R+ +  R+ + ER       R R+ D  +ER+R+G  
Sbjct: 61  ERDRQRQRERETERETERQRERQRQRERKRQTDRERDKDRDRERKRETDRNRERNRKGGR 120

Query: 183 KDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           + D + E +R R+R   R R R   R  + ++E D  R+   + EE  ++R ++R+
Sbjct: 121 ERDKQTERERDRERERQRQRERERQRQRERKRETDRERQRWAEREERKKERKKERK 176

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 39/136 (28%), Positives = 76/136 (55%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
           R  +R+   +R R+R+ R  D + +K+RDR  + + D   E +RK  R  D++    +R+
Sbjct: 74  RETERQRERQRQRERK-RQTDRERDKDRDRERKRETDRNRERNRKGGRERDKQ---TERE 129

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
            D E+ER R+ + +R+   ER+ R+ D E++     R+ +  E + +RK++R  +R+ + 
Sbjct: 130 RDRERERQRQRERERQRQRERK-RETDRERQ-----RWAEREERKKERKKERKKERKEKK 183

Query: 117 DDRDGDNEKERDHRRR 70
            +     EK R+ ++R
Sbjct: 184 KE-----EKRREDKKR 194

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 37/118 (31%), Positives = 62/118 (52%), Gaps = 3/118 (2%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 307
           R  +RK    R RD+   R R R+ D  +ER+R+G  + D + E +R R+R    R R  
Sbjct: 84  RQRERKRQTDRERDKDRDRERKRETDRNRERNRKGGRERDKQTERERDRERE---RQRQR 140

Query: 306 DRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD 133
           +R+   ++ER R  D +R+   ER  R  + +KER +  + K   E+  + K+ + G+
Sbjct: 141 ERERQRQRERKRETDRERQRWAEREERKKERKKERKKERKEKKKEEKRREDKKRKWGE 198

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 37/108 (34%), Positives = 60/108 (55%), Gaps = 14/108 (12%)
 Frame = -1

Query: 288 EKERDRRGDNDRRGNGER---RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---- 130
           E++R+R+ + DR    ER   R R+ +N+ ER+ R R +D   E  DR+ DR  +R    
Sbjct: 2   ERQRERKRETDRGKETERERDRQRERENQTERENRHRQRDRHRER-DRQTDREKERERQK 60

Query: 129 ---RHRVDDRDGDNEKERD-HRRRYKDDSEEDDRKRNRDR---RYRDT 7
              R R  +R+ + E ER   R+R ++   + DR+R++DR   R R+T
Sbjct: 61  ERDRQRQRERETERETERQRERQRQRERKRQTDRERDKDRDRERKRET 108

[176][TOP]
>UniRef100_UPI00016E7DC0 UPI00016E7DC0 related cluster n=1 Tax=Takifugu rubripes
            RepID=UPI00016E7DC0
          Length = 1649

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 56/153 (36%), Positives = 82/153 (53%), Gaps = 11/153 (7%)
 Frame = -1

Query: 444  NRDR--------RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
            NRDR        RY+ R +D+E+E  R  R  D +EE   R+ DR  DR  R  DR+ + 
Sbjct: 648  NRDRGFFLASPSRYQGRSEDSEREERREDRRTDRTEE---RREDRTRDRE-RERDREREK 703

Query: 288  EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
            EKERD+  + +R    ER  R+ + E+ERDR    ++   E  +R+R+R    R R  +R
Sbjct: 704  EKERDKEREKEREAERERA-RERERERERDREREREEREREREEREREREERDRER-KER 761

Query: 108  DGDNEKERDHRRRYKD---DSEEDDRKRNRDRR 19
            + + EKER+ R R +    +  E  R+  RDRR
Sbjct: 762  EREREKEREQRERERQREWEERERGREERRDRR 794

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 51/145 (35%), Positives = 76/145 (52%), Gaps = 3/145 (2%)
 Frame = -1

Query: 447  RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEE--FDRKRDRNGDRRHRVDDRDGDNEKER 277
            R RDR R RDR+ + EKERD+    + ++E E   +R+R+R  DR    ++R+ + E+  
Sbjct: 689  RTRDRERERDREREKEKERDKEREKEREAERERARERERERERDREREREEREREREERE 748

Query: 276  DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
              R + DR    ER+ R+ + EKER++R R +    EE +R R+   DRR        D+
Sbjct: 749  REREERDR----ERKEREREREKEREQRERERQREWEERERGREERRDRRE-------DS 797

Query: 96   EKERDHRRRYKDDSEEDDRKRNRDR 22
              ER  R         DDRK +R R
Sbjct: 798  RDERSIR------DSRDDRKMSRKR 816

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 47/152 (30%), Positives = 73/152 (48%), Gaps = 18/152 (11%)
 Frame = -1

Query: 411  DNEKERDRRGRYKDDSEEEFDRKRDRNGDRR-HRVDDRDGDNEKERDRRGDNDRRGNGER 235
            D    R+ RG   + S + ++ +     +R   R +DR   +     R G+ DRR N +R
Sbjct: 592  DPGSNRNTRGSQLESSNDVWESRSSAARERSVERSNDRSAADRSSERRSGERDRRDNRDR 651

Query: 234  ----------RHRDDDNEKERDRRGRYKDDSEEEF-DRKRDRNGDR---RHRVDDRDGDN 97
                      + R +D+E+E  R  R  D +EE   DR RDR  +R   R +  +RD + 
Sbjct: 652  GFFLASPSRYQGRSEDSEREERREDRRTDRTEERREDRTRDRERERDREREKEKERDKER 711

Query: 96   EKERD---HRRRYKDDSEEDDRKRNRDRRYRD 10
            EKER+    R R ++   E DR+R R+ R R+
Sbjct: 712  EKEREAERERARERERERERDREREREERERE 743

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 45/132 (34%), Positives = 65/132 (49%), Gaps = 2/132 (1%)
 Frame = -1

Query: 414  DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER 235
            DD + +R RRGR +  +  + DR+R+R+ +R  +V+D  G    ER  R D  RRG   R
Sbjct: 1185 DDPQGQRSRRGRLQGANCRDRDRERERDRERERQVNDPPG---AERKSRIDQLRRGEPSR 1241

Query: 234  RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG-DNEKER-DHRRRYKD 61
                D  +       R   DSE +  R R  + D R R  DR+  + E+ER DHR+R  +
Sbjct: 1242 STSSDRQDSRSHSSRRSSPDSERQ-ARSRAGSYDSRERERDREPFERERERKDHRQRDWE 1300

Query: 60   DSEEDDRKRNRD 25
                D   R R+
Sbjct: 1301 PEPRDWPSRGRE 1312

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 49/143 (34%), Positives = 66/143 (46%), Gaps = 17/143 (11%)
 Frame = -1

Query: 450  KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFD-RKRDRNGDRRHRVDDRDGDNEKER 277
            +R R R R R+R+ D E+ER+ R R +++ E E + R R+R    R R  +R+   E+ER
Sbjct: 718  ERERARERERERERDREREREEREREREEREREREERDRERKEREREREKERE-QRERER 776

Query: 276  DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR------------NGD 133
             R  +   RG  ERR R +D+  ER  R    D    +  RKR R             G 
Sbjct: 777  QREWEERERGREERRDRREDSRDERSIRDSRDD---RKMSRKRPRVESSPSPRTTPKRGA 833

Query: 132  RRHRVDDRDGDN---EKERDHRR 73
            R     D DG N   EK  D  R
Sbjct: 834  RDLSPADSDGYNSGEEKSSDKHR 856

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 46/161 (28%), Positives = 73/161 (45%), Gaps = 19/161 (11%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRGRYKDDSE------EEFDRKRDRNGDRRHRV---DDRDGDNE-K 283
           R  +R   +++    R R++ + E      E  + +RD N ++R +    D+RD D+E  
Sbjct: 399 RRSERSSPSQRHSRGRERFRGERERSLPAQERRNERRDENRNKREKDSVRDERDYDSECS 458

Query: 282 ERDRRGDNDRRGNGERRH-RDDDNEKERDRR-GRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
            RD R + D R + +RR  R+   E  RD R  R   DS E     R        R  DR
Sbjct: 459 SRDTRSERDTRESRDRRDARERGRETTRDSRDNRDTKDSRESRTETRSSRESLGSRERDR 518

Query: 108 DGDNEKERDHRR-------RYKDDSEEDDRKRNRDRRYRDT 7
           D + +KER+  R       + K+D+ ++DR   R     D+
Sbjct: 519 DREKDKEREKERERDRSDTQRKEDTTQEDRSYVRGHGREDS 559

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 45/148 (30%), Positives = 67/148 (45%), Gaps = 8/148 (5%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNE-KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER- 277
           KR +D    +RD D+E   RD R   + D+ E  DR+  R   R    D RD  + K+  
Sbjct: 441 KREKDSVRDERDYDSECSSRDTRS--ERDTRESRDRRDARERGRETTRDSRDNRDTKDSR 498

Query: 276 ----DRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH-RVD 115
               + R   +  G+ ER R R+ D E+E++R     D   +E   + DR+  R H R D
Sbjct: 499 ESRTETRSSRESLGSRERDRDREKDKEREKERERDRSDTQRKEDTTQEDRSYVRGHGRED 558

Query: 114 DRDGDNEKERDHRRRYKDDSEEDDRKRN 31
            +    EK    R R  + S++  R  N
Sbjct: 559 SKTDRAEKNGRVRSRANESSDKATRHNN 586

[177][TOP]
>UniRef100_A2T2X2 Putative uncharacterized protein (Fragment) n=1 Tax=Acinetobacter
           baumannii RepID=A2T2X2_ACIBA
          Length = 327

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 65/159 (40%), Positives = 83/159 (52%), Gaps = 17/159 (10%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 283
           R R R RY D D+D+++ R     RGR +DD +E+ DR R     R R R DD D D   
Sbjct: 52  RGRGRSRYDDDDEDDDRGRSGGRGRGRGRDDDDEDDDRGRSGGRGRGRSRRDDDDED--- 108

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYK-DDSEEEFDRKRD-RNGDRRH 124
             D RG +  RG G  R  DDD + +R R     RGR + DD +E+ DR R    G  R 
Sbjct: 109 --DDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRS 166

Query: 123 RVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           R DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 167 RRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 205

 Score = 82.8 bits (203), Expect(2) = 8e-15
 Identities = 59/158 (37%), Positives = 76/158 (48%), Gaps = 16/158 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGR---YKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKE 280
           R R RR  D +DD+      RGR    +DD +E+ DR R    G  R R DD D D    
Sbjct: 97  RGRSRRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDED---- 152

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRHR 121
            D RG +  RG G  R  DDD + +R R       R RY DD E++   +    G  R R
Sbjct: 153 -DDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSR 211

Query: 120 VDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            DD D D+++ R       R RY DD E+D+R R+  R
Sbjct: 212 RDDDDEDDDRGRSGGRGRGRSRYDDDDEDDERGRSGGR 249

 Score = 20.8 bits (42), Expect(2) = 8e-15
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -3

Query: 484 RYKDDSEEDD 455
           RY DD E+DD
Sbjct: 58  RYDDDDEDDD 67

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 65/162 (40%), Positives = 81/162 (50%), Gaps = 20/162 (12%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           R R R  RD DDD + +R R G       RY DD E   D  R R+G R      RD D+
Sbjct: 117 RGRGRSRRD-DDDEDDDRGRSGGRGRGRSRYDDDDE---DDDRGRSGGRGRGRSRRDDDD 172

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR-- 130
           E   D RG +  RG G  R+ DDD + +R R     RGR + D ++E D  R R+G R  
Sbjct: 173 ED--DDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGR 229

Query: 129 -RHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            R R DD D D+E+ R       R R  DD E+DDR R+  R
Sbjct: 230 GRSRYDDDDEDDERGRSGGRGRGRSRRDDDDEDDDRGRSGGR 271

 Score = 82.0 bits (201), Expect(2) = 1e-14
 Identities = 63/162 (38%), Positives = 81/162 (50%), Gaps = 19/162 (11%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG-------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           R R R  RD DDD + +R R G       RY DD E++    R R+G R      RD D+
Sbjct: 161 RGRGRSRRD-DDDEDDDRGRSGGRGRGRSRYDDDDEDD---DRGRSGGRGRGRSRRDDDD 216

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYK-DDSEEEFDRKRD-RNGDR 130
           E   D RG +  RG G  R+ DDD + ER R     RGR + DD +E+ DR R    G  
Sbjct: 217 ED--DDRGRSGGRGRGRSRYDDDDEDDERGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRG 274

Query: 129 RHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDRR 19
           R R DD D D+++ R       R R  DD ++DDR+   D R
Sbjct: 275 RSRYDDDDEDDDRGRSGGRGRGRSRRDDDDDDDDRRGRSDGR 316

 Score = 20.8 bits (42), Expect(2) = 1e-14
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -3

Query: 484 RYKDDSEEDD 455
           RY DD E+DD
Sbjct: 145 RYDDDDEDDD 154

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 60/158 (37%), Positives = 78/158 (49%), Gaps = 16/158 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           R R R   D DDD  +   R   R RY DD E++    R R+G R      R  D++ E 
Sbjct: 33  RGRSRYDDDEDDDRGRSSGRGRGRSRYDDDDEDD---DRGRSGGRGR---GRGRDDDDED 86

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR---RHR 121
           D RG +  RG G  R  DDD + +R R     RGR + D ++E D  R R+G R   R R
Sbjct: 87  DDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSR 145

Query: 120 VDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            DD D D+++ R       R R  DD E+DDR R+  R
Sbjct: 146 YDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGR 183

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 57/155 (36%), Positives = 74/155 (47%), Gaps = 14/155 (9%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDN 289
           R R R RY D D+D+++ R     RGR + D ++E D  R R+G R   R R DD D D 
Sbjct: 183 RGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSRYDDDDED- 240

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDR 130
               D RG +  RG G  R  DDD + +R R       R RY DD E++   +    G  
Sbjct: 241 ----DERGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRG 296

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
           R R DD D D     D RR   D   ++ R + RD
Sbjct: 297 RSRRDDDDDD-----DDRRGRSDGRGQNSRNQKRD 326

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 47/117 (40%), Positives = 61/117 (52%), Gaps = 11/117 (9%)
 Frame = -1

Query: 339 DRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDD 175
           DRNG  R R DD + D+      RG +  RG G  R+ DDD + +R R     RGR +DD
Sbjct: 29  DRNGRGRSRYDDDEDDD------RGRSSGRGRGRSRYDDDDEDDDRGRSGGRGRGRGRDD 82

Query: 174 SEEEFDRKRD-RNGDRRHRVDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            +E+ DR R    G  R R DD D D+++ R       R R  DD E+DDR R+  R
Sbjct: 83  DDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGR 139

[178][TOP]
>UniRef100_Q86AR1 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum
           RepID=Q86AR1_DICDI
          Length = 1163

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 52/146 (35%), Positives = 76/146 (52%), Gaps = 5/146 (3%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNE-KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           NRD R R+R+ + E ++R  R R + + E E DR+RDR+ DR  R  DRD D ++ER+R 
Sbjct: 98  NRDSRERERERERENRDRSDRDRGERERERERDRERDRDRDRLERERDRDRDRDRERERD 157

Query: 267 GDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
            + DR  + ER R R+ D E++RDR         +  DR  + N        +R  + E+
Sbjct: 158 RERDRNKDRERDRERERDRERDRDRDRNRNSRERDHNDRDYNNNSSSSSSSSNRYRERER 217

Query: 90  ERDHRRRYKDDSEE---DDRKRNRDR 22
           ER+  R     S       RKR+R R
Sbjct: 218 ERERERSISPSSSSLTTHTRKRSRSR 243

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 45/114 (39%), Positives = 61/114 (53%), Gaps = 7/114 (6%)
 Frame = -1

Query: 450 KRNRDRRYRDRDD-DNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGD 292
           + NRDR  RDR + + E+ERDR R R +D  E E DR RDR+ +R     R R  DR+ D
Sbjct: 110 RENRDRSDRDRGERERERERDRERDRDRDRLERERDRDRDRDRERERDRERDRNKDRERD 169

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
            E+ERDR  D DR  N   R RD ++    +        S    +R+R+R  +R
Sbjct: 170 RERERDRERDRDRDRNRNSRERDHNDRDYNNNSSSSSSSSNRYRERERERERER 223

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 45/125 (36%), Positives = 66/125 (52%), Gaps = 9/125 (7%)
 Frame = -1

Query: 351 DRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGR 187
           +R+R+R  + R R D   G+ E+ER+R  + DR  +   R RD D +++R+R     R R
Sbjct: 103 ERERERERENRDRSDRDRGERERERERDRERDRDRDRLERERDRDRDRDRERERDRERDR 162

Query: 186 YKD---DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR-R 19
            KD   D E E DR+RDR+ DR     +RD     +RD+       S   +R R R+R R
Sbjct: 163 NKDRERDRERERDRERDRDRDRNRNSRERD---HNDRDYNNNSSSSSSSSNRYRERERER 219

Query: 18  YRDTS 4
            R+ S
Sbjct: 220 ERERS 224

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 51/164 (31%), Positives = 77/164 (46%), Gaps = 10/164 (6%)
 Frame = -1

Query: 483 GIRMIQRKMIWKRNRDR------RYRDRDDDNEKERDR-RGRYKD---DSEEEFDRKRDR 334
           G R  +R+   +R+RDR      R RDRD D E+ERDR R R KD   D E E DR+RDR
Sbjct: 121 GERERERERDRERDRDRDRLERERDRDRDRDRERERDRERDRNKDRERDRERERDRERDR 180

Query: 333 NGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDR 154
           + DR     +RD     +RD   ++    +   R+R+ + E+ER+R       S     R
Sbjct: 181 DRDRNRNSRERD---HNDRDYNNNSSSSSSSSNRYRERERERERERSISPSSSSLTTHTR 237

Query: 153 KRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           KR R+     +  D   +N    ++     +++  +    N  R
Sbjct: 238 KRSRSRSNSPQPLDEFNNNNNNNNNNNNNNNNNNNNMTGNNTYR 281

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 44/109 (40%), Positives = 62/109 (56%), Gaps = 7/109 (6%)
 Frame = -1

Query: 309 DDRDGDNEKERDRRGDNDR-RGNGER-RHRDDDNEKERDRRGRYKD-----DSEEEFDRK 151
           D R+ + E+ER+ R  +DR RG  ER R RD + +++RDR  R +D     D E E DR+
Sbjct: 100 DSRERERERERENRDRSDRDRGERERERERDRERDRDRDRLERERDRDRDRDRERERDRE 159

Query: 150 RDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           RDRN DR     DR+ + ++ERD  R    +S E D   + DR Y + S
Sbjct: 160 RDRNKDRER---DRERERDRERDRDRDRNRNSRERD---HNDRDYNNNS 202

[179][TOP]
>UniRef100_Q22H23 EF hand family protein n=1 Tax=Tetrahymena thermophila SB210
            RepID=Q22H23_TETTH
          Length = 3608

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 50/144 (34%), Positives = 79/144 (54%), Gaps = 5/144 (3%)
 Frame = -1

Query: 426  RDRDDDNE-KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRR 250
            + RDD N+ ++RDRR + +DD E+     RD + ++  R  DR  D ++++DR  D DR 
Sbjct: 1402 KQRDDRNDDRDRDRREKNRDDYEDRQRGDRDFDRNKSQRDFDRSRDFDRDQDRNRDQDR- 1460

Query: 249  GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD----NEKERD 82
                       N +  D+R R++DD++E  DR+R     R  R DD D +    NE+   
Sbjct: 1461 -----------NRQNDDKRNRFRDDNDERDDRRR-----RNERDDDEDRNQKFRNERNDQ 1504

Query: 81   HRRRYKDDSEEDDRKRNRDRRYRD 10
            +RRR  DD ++DD +RN+ R+  D
Sbjct: 1505 NRRRNDDDEDDDDNRRNQGRKQYD 1528

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 36/101 (35%), Positives = 56/101 (55%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
            R   R   + R++DR  RD+D  N +  D+R R++DD++E  DR+      RR+  DD +
Sbjct: 1440 RDFDRSRDFDRDQDRN-RDQD-RNRQNDDKRNRFRDDNDERDDRR------RRNERDDDE 1491

Query: 297  GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDD 175
              N+K R+ R D +RR N +    DDDN + + R+   K D
Sbjct: 1492 DRNQKFRNERNDQNRRRNDDDED-DDDNRRNQGRKQYDKRD 1531

[180][TOP]
>UniRef100_UPI00005BD86E PREDICTED: similar to RNA binding motif protein 25 isoform 2 n=1
           Tax=Macaca mulatta RepID=UPI00005BD86E
          Length = 795

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 49/156 (31%), Positives = 85/156 (54%), Gaps = 1/156 (0%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 258 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 317

Query: 294 DNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
           + EKER+R  + DR R   + R RD D E++RDR      D E   DR +DR+   R R 
Sbjct: 318 EKEKERERERERDRDRDRTKERDRDRDRERDRDR------DRERSSDRNKDRS---RSRE 368

Query: 117 DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            +R+ + E+E+D +R  ++D E+   +R  +R+ R+
Sbjct: 369 REREREREREKDKKRDREEDEEDAYERRKLERKLRE 404

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 52/183 (28%), Positives = 95/183 (51%), Gaps = 28/183 (15%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGD 292
           +R+   +R R+RR R+R+ + E+ER++      + E E +R+RDR+ DR + R  DRD +
Sbjct: 293 ERERERERERERREREREREREREREK------EKERERERERDRDRDRTKERDRDRDRE 346

Query: 291 NEKERDRRGDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK---------- 151
            +++RDR   +DR   R     R R+ + E+E+D++   ++D E+ ++R+          
Sbjct: 347 RDRDRDRERSSDRNKDRSRSREREREREREREKDKKRDREEDEEDAYERRKLERKLREKE 406

Query: 150 -----RDRNGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYR 13
                R +N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR
Sbjct: 407 AAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYR 466

Query: 12  DTS 4
            ++
Sbjct: 467 GSA 469

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 47/159 (29%), Positives = 79/159 (49%), Gaps = 13/159 (8%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDN--EKERDRRGRYKD------DSEEEFDRKRDRNGDRRHRVDDRDGD 292
           R + +  ++ +D N  E E D+R           D+ ++ + ++ +    R  ++    +
Sbjct: 234 RKKKKEKKEDEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRE 293

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDR---R 127
            E+ER+R  +   R     R R+ + EKER+R R R +D D  +E DR RDR  DR   R
Sbjct: 294 RERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDR 353

Query: 126 HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            R  DR+ D  + R+ R R ++   E D+KR+R+    D
Sbjct: 354 ERSSDRNKDRSRSRE-REREREREREKDKKRDREEDEED 391

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 55/201 (27%), Positives = 82/201 (40%), Gaps = 67/201 (33%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKE 280
           +R R+R  R+R+ + E+ER+R    + + E E DR RDR  +R   R R  DRD D E+ 
Sbjct: 297 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERS 356

Query: 279 RDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEE--------------------- 166
            DR  D  R    ER R R+ + +K+RDR    +D  E                      
Sbjct: 357 SDRNKDRSRSREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNW 416

Query: 165 ---------EFDRKRDRNGDRRHRV---------------DDRDG--------------D 100
                    E++++ +R  +RR  +               DDRD               D
Sbjct: 417 EIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRD 476

Query: 99  NEKERD----HRRRYKDDSEE 49
            EKE +     R+R K++ EE
Sbjct: 477 REKEMEADERDRKREKEELEE 497

[181][TOP]
>UniRef100_B9QP37 Glycine-rich RNA-binding protein, putative n=1 Tax=Toxoplasma
           gondii VEG RepID=B9QP37_TOXGO
          Length = 763

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 51/150 (34%), Positives = 86/150 (57%), Gaps = 5/150 (3%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           +++R  R+R+ +NE++R+R      DSE E DR+R+R        ++RD + E+ER+R  
Sbjct: 541 DQERGERERETENERDRER------DSENERDRERER--------EERDRERERERERE- 585

Query: 264 DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV-DDRDGDNEK- 91
           + DR    ER   + D E+ER+ R R ++  E +  R+R+R  + R R  ++RD   E+ 
Sbjct: 586 ERDREREREREREERDREREREERDRQREREERDRQREREREREEREREREERDRQRERE 645

Query: 90  ERDHRRRYKDDSE---EDDRKRNRDRRYRD 10
           ERD  R  +D+ E   E +++R R  R R+
Sbjct: 646 ERDREREERDEGESGSEGEKERGRGERKRE 675

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 50/171 (29%), Positives = 88/171 (51%), Gaps = 23/171 (13%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSE-------EEFDRKRDRNGDRRHRVDDRDG- 295
            +R R+R  RDR+ + E+ER+ R R ++  E       EE DR+R+R  +R  R  +R+  
Sbjct: 579  EREREREERDREREREREREERDREREREERDRQREREERDRQREREREREEREREREER 638

Query: 294  -------DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
                   + ++ER+ R + +    GE+     + ++E +RR R  D+  +E   ++D  G
Sbjct: 639  DRQREREERDREREERDEGESGSEGEKERGRGERKREGERRRRRADEDAKERRGEKDERG 698

Query: 135  DRRHRVDDRDGDNEKERDHRR---RYKDDSEED-----DRKRNRDRRYRDT 7
            DR  R   R G+    +D RR   R  DD EED     +R+  +D++ +++
Sbjct: 699  DREERRKKRRGETSSSKDERRHHGRRGDDKEEDGASEKEREETQDKKDKES 749

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 57/156 (36%), Positives = 89/156 (57%), Gaps = 13/156 (8%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR- 271
            R R+R  RDR  + E+ER+ R R +    EE DR+R+R    R R +  +G++  E ++ 
Sbjct: 611  RQREREERDRQREREREREERERER----EERDRQREREERDREREERDEGESGSEGEKE 666

Query: 270  RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD-------RRH---R 121
            RG  +R+  GERR R  D E  ++RRG  KD+  +  +R++ R G+       RRH   R
Sbjct: 667  RGRGERKREGERRRRRAD-EDAKERRGE-KDERGDREERRKKRRGETSSSKDERRHHGRR 724

Query: 120  VDDR--DGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
             DD+  DG +EKER+     +D  +++ RKR ++RR
Sbjct: 725  GDDKEEDGASEKEREET---QDKKDKESRKRKKERR 757

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 54/166 (32%), Positives = 85/166 (51%), Gaps = 19/166 (11%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDR----RGRYKDDSEEEFDRKRDR-NGDRRHRVDDRDGDNE 286
            +R+R+R   +RD + E+ER+R    R R ++   EE DR+R+R   DR+   ++RD   E
Sbjct: 564  ERDREREREERDREREREREREERDREREREREREERDREREREERDRQREREERDRQRE 623

Query: 285  KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDR---KRDRNGDRRHRVD 115
            +ER+R      R   +R+   ++ ++ER+ R   +  SE E +R   +R R G+RR R  
Sbjct: 624  REREREEREREREERDRQREREERDREREERDEGESGSEGEKERGRGERKREGERRRRRA 683

Query: 114  DRD-----------GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            D D           GD E+ R  RR   + S   D +R+  RR  D
Sbjct: 684  DEDAKERRGEKDERGDREERRKKRR--GETSSSKDERRHHGRRGDD 727

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 46/152 (30%), Positives = 83/152 (54%), Gaps = 8/152 (5%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDR------RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +   + R R+RD +NE++R+R      R R ++   EE DR+R+R  +R  R  DR+ + 
Sbjct: 549 RETENERDRERDSENERDREREREERDREREREREREERDREREREREREER--DRERER 606

Query: 288 EKERDRRGDNDRRGNGERRHRD-DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
           E ERDR+ + + R     R R+ ++ E+ER+ R R ++  E + +R+    G+     + 
Sbjct: 607 E-ERDRQREREERDRQREREREREEREREREERDRQREREERDREREERDEGESGSEGEK 665

Query: 111 RDGDNEKERD-HRRRYKDDSEEDDRKRNRDRR 19
             G  E++R+  RRR + D +  +R+  +D R
Sbjct: 666 ERGRGERKREGERRRRRADEDAKERRGEKDER 697

[182][TOP]
>UniRef100_UPI0001554CCA PREDICTED: similar to advanced glycosylation end product-specific
            receptor n=1 Tax=Ornithorhynchus anatinus
            RepID=UPI0001554CCA
          Length = 2472

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 54/155 (34%), Positives = 78/155 (50%), Gaps = 7/155 (4%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
            R  + R RDRD     ERDR   +  + E +++R RD     RHR  D + + +K ++R 
Sbjct: 2205 RGFEERRRDRDHSKPWERDRSRNWSREKERDWERNRDWE---RHREKDTNREWDKNKERN 2261

Query: 267  GDNDRRGNGER-------RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
             + D+    ER       R R+ D ++ERDR  R   D     DR RDR+  R     DR
Sbjct: 2262 PNKDKERESERNKDWERNRSRNRDRDRERDRDRRRDRDRSRSRDRDRDRSRSR-----DR 2316

Query: 108  DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            D D  ++RD R R +D  ++ DR R +DR+ R  S
Sbjct: 2317 DWDRARDRD-RERDRDREKDRDRDRGKDRKDRSKS 2350

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 47/134 (35%), Positives = 77/134 (57%), Gaps = 3/134 (2%)
 Frame = -1

Query: 453  WKRNRDRRY-RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKE 280
            W+R+R R + R+++ D E+ RD     + D+  E+D+ ++RN ++ + R  +R+ D E+ 
Sbjct: 2220 WERDRSRNWSREKERDWERNRDWERHREKDTNREWDKNKERNPNKDKERESERNKDWERN 2279

Query: 279  RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDG 103
            R R  D DR  + +RR RD D  + RDR        + ++DR RDR+ +R R R  DRD 
Sbjct: 2280 RSRNRDRDRERDRDRR-RDRDRSRSRDRDRDRSRSRDRDWDRARDRDRERDRDREKDRDR 2338

Query: 102  DNEKERDHRRRYKD 61
            D  K+R  R + K+
Sbjct: 2339 DRGKDRKDRSKSKE 2352

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 51/154 (33%), Positives = 77/154 (50%), Gaps = 8/154 (5%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG-DRRHRVDDRDGDNEKERDR 271
            +N + R RDR +   KE+       D+ E +    R   G + R R  D     E++R R
Sbjct: 2172 QNFEARPRDRFEGGSKEKPL-----DEPETQASENRQSRGFEERRRDRDHSKPWERDRSR 2226

Query: 270  RGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD-RRHRVDDR 109
                ++  + ER     RHR+ D  +E D+      + ++E  R+ +RN D  R+R  +R
Sbjct: 2227 NWSREKERDWERNRDWERHREKDTNREWDKNKERNPNKDKE--RESERNKDWERNRSRNR 2284

Query: 108  DGDNEKERDHRRRYKDDSEEDDRKRNRDR-RYRD 10
            D D E++RD RRR +D S   DR R+R R R RD
Sbjct: 2285 DRDRERDRD-RRRDRDRSRSRDRDRDRSRSRDRD 2317

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 50/157 (31%), Positives = 67/157 (42%), Gaps = 2/157 (1%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
            R  +R   W+RNR R  RDRD    +ERDR  R   D     DR RDR+  R     DRD
Sbjct: 2268 RESERNKDWERNRSRN-RDRD----RERDRDRRRDRDRSRSRDRDRDRSRSR-----DRD 2317

Query: 297  GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
             D  ++RDR  D DR      + RD D  K+R  R + K+  + + +  ++         
Sbjct: 2318 WDRARDRDRERDRDR-----EKDRDRDRGKDRKDRSKSKEIRDLKPEEPKEIKKTAEPGK 2372

Query: 117  DDRDGDNEKERDHRRRY--KDDSEEDDRKRNRDRRYR 13
            D   G   +    R R      +   DR   R RR R
Sbjct: 2373 DSLSGSKREGGKGRLRNWGSCSAAHVDRSPGRPRRRR 2409

[183][TOP]
>UniRef100_UPI00005BF4AA PREDICTED: similar to splicing factor, arginine/serine-rich 12
           isoform 2 n=1 Tax=Bos taurus RepID=UPI00005BF4AA
          Length = 632

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 47/141 (33%), Positives = 80/141 (56%), Gaps = 1/141 (0%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDR 271
           R+RD+R   R+   EKER +    + + E+E DR+++R  ++ R +  D+D D E+E+DR
Sbjct: 372 RSRDKRKDTREKIKEKERVKEKDREKEREKERDREKEREKEKERGKNKDKDRDKEREKDR 431

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
             D D+  + ER  RD D+EKERD+    + D E+E ++ R +  D + + D +     +
Sbjct: 432 DKDKDKEKDKERE-RDKDHEKERDKEKEKEQDKEKEREKDRSKEIDEKRKKDKKSRTPPR 490

Query: 90  ERDHRRRYKDDSEEDDRKRNR 28
             +  RR +  S E  R+R+R
Sbjct: 491 SYNASRRSRSSSRERRRRRSR 511

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 53/164 (32%), Positives = 87/164 (53%), Gaps = 12/164 (7%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRY-RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           +RK    ++R R + R R    ++ R +    K     E  + R R+  R  R D R+  
Sbjct: 325 RRKRSQSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRSRSRDKRKDTREKI 384

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDR-RHRV 118
            EKER +  D ++    ER  R+ + EKE++R G+ KD D ++E ++ RD++ D+ + + 
Sbjct: 385 KEKERVKEKDREKEREKER-DREKEREKEKER-GKNKDKDRDKEREKDRDKDKDKEKDKE 442

Query: 117 DDRDGDNEKERD---------HRRRYKDDSEEDDRKRNRDRRYR 13
            +RD D+EKERD          + R KD S+E D KR +D++ R
Sbjct: 443 RERDKDHEKERDKEKEKEQDKEKEREKDRSKEIDEKRKKDKKSR 486

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 49/189 (25%), Positives = 96/189 (50%), Gaps = 36/189 (19%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDR---RGRYKD-DSEEEFDRKRDRNGDR-RHRVDD 304
           +++ + +++R++  R+++ D EKER++   RG+ KD D ++E ++ RD++ D+ + +  +
Sbjct: 386 EKERVKEKDREKE-REKERDREKEREKEKERGKNKDKDRDKEREKDRDKDKDKEKDKERE 444

Query: 303 RDGDNEKERDRRGDNDRRGNGER---RHRDDDNEKERDRR----------GRYKDDSEEE 163
           RD D+EKERD+  + ++    ER   R ++ D ++++D++           R    S  E
Sbjct: 445 RDKDHEKERDKEKEKEQDKEKEREKDRSKEIDEKRKKDKKSRTPPRSYNASRRSRSSSRE 504

Query: 162 FDRKRDRNGDRRHRV-----------------DDRDGDNEKERDH-RRRYKDDSEEDDRK 37
             R+R R+  R  R                  + +D   EKE+DH   R + +     RK
Sbjct: 505 RRRRRSRSSSRSPRTSKTIKRKSSRSPSPRSRNKKDKKREKEKDHISERRERERSASTRK 564

Query: 36  RNRDRRYRD 10
            + DR  +D
Sbjct: 565 SSNDREGKD 573

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 44/175 (25%), Positives = 80/175 (45%), Gaps = 40/175 (22%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           ++RD+ R +DRD D +KE+D+      D E+E D+++++  D+     +R+ D  KE D 
Sbjct: 421 KDRDKEREKDRDKDKDKEKDKERERDKDHEKERDKEKEKEQDKEK---EREKDRSKEIDE 477

Query: 270 RGDNDRRG-------NGERRHRDDDNEKERDR------------------------RGRY 184
           +   D++        N  RR R    E+ R R                        R R 
Sbjct: 478 KRKKDKKSRTPPRSYNASRRSRSSSRERRRRRSRSSSRSPRTSKTIKRKSSRSPSPRSRN 537

Query: 183 KDDSEEEFD-------RKRDRNGDRRHRVDDRDGDNEKERDHRR-RYKDDSEEDD 43
           K D + E +       R+R+R+   R   +DR+G ++ E+++   + K+ ++E D
Sbjct: 538 KKDKKREKEKDHISERRERERSASTRKSSNDREGKDKVEKNNTSLKEKEHNKEPD 592

[184][TOP]
>UniRef100_C1MVK2 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545
           RepID=C1MVK2_9CHLO
          Length = 438

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 53/143 (37%), Positives = 71/143 (49%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDN 259
           DRR RDRD D +++RDR            DR R R+G R     ++D D ++ RDR  D 
Sbjct: 302 DRRTRDRDRDRDRDRDR------------DRDRGRDGSRDR---EKDRDRDRSRDRGRDR 346

Query: 258 DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH 79
            R G   RR R         RR R +D      DR RDR+G R  R   R+ + E++   
Sbjct: 347 GRDGKSRRRDRSASRSASGGRRERRRDR-----DRDRDRSGGRGSRSRSRERERERKEKK 401

Query: 78  RRRYKDDSEEDDRKRNRDRRYRD 10
           RRR +D S + DR+R+ D R  D
Sbjct: 402 RRRDRDRSRDRDRRRDDDERDYD 424

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 54/147 (36%), Positives = 70/147 (47%), Gaps = 15/147 (10%)
 Frame = -1

Query: 405 EKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER-RH 229
           +  R  RGR   DS           GD R R  DRD D +++RDR  D DR  +G R R 
Sbjct: 282 DASRGGRGRDARDSHAP-------GGDDR-RTRDRDRDRDRDRDR--DRDRGRDGSRDRE 331

Query: 228 RDDDNEKERDR-RGRYKDDSEEEFDR--KRDRNGDRRHRVDDRDGDNE-----------K 91
           +D D ++ RDR R R +D      DR   R  +G RR R  DRD D +           +
Sbjct: 332 KDRDRDRSRDRGRDRGRDGKSRRRDRSASRSASGGRRERRRDRDRDRDRSGGRGSRSRSR 391

Query: 90  ERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           ER+  R+ K    + DR R+RDRR  D
Sbjct: 392 ERERERKEKKRRRDRDRSRDRDRRRDD 418

[185][TOP]
>UniRef100_B9SGJ4 Splicing factor u2af large subunit, putative n=1 Tax=Ricinus
           communis RepID=B9SGJ4_RICCO
          Length = 549

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 50/138 (36%), Positives = 75/138 (54%), Gaps = 3/138 (2%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD--NDR 253
           RD + ++ K R++      D E + DR RDR+ DR     +RD D EK RDR  D   DR
Sbjct: 48  RDHERESSKSREKEREKGRDKERDRDRDRDRDKDR-----ERDKDREKSRDRDRDRERDR 102

Query: 252 RGNGERRHRDDDNEKER-DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHR 76
             + +R HRD D  ++R +RR R +D  ++++ R RD + DRR     RD D ++E  H+
Sbjct: 103 DKDRDRHHRDRDRHRDRSERRERGRDRDDDDYHRSRDYDRDRR-----RDYDRDREERHK 157

Query: 75  RRYKDDSEEDDRKRNRDR 22
           RR    S     +R++ R
Sbjct: 158 RRSPSPSRGRSERRSKSR 175

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 48/137 (35%), Positives = 75/137 (54%), Gaps = 7/137 (5%)
 Frame = -1

Query: 420 RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGDNDRRGN 244
           R DD+   + + G    D E E  + R++  ++ R +  DRD D ++++DR  D DR  +
Sbjct: 34  RPDDHSDSKSQHG--SRDHERESSKSREKEREKGRDKERDRDRDRDRDKDRERDKDREKS 91

Query: 243 GER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN-----EKERD 82
            +R R R+ D +K+RDR  R +D       R RDR+ +RR R  DRD D+     + +RD
Sbjct: 92  RDRDRDRERDRDKDRDRHHRDRD-------RHRDRS-ERRERGRDRDDDDYHRSRDYDRD 143

Query: 81  HRRRYKDDSEEDDRKRN 31
            RR Y  D EE  ++R+
Sbjct: 144 RRRDYDRDREERHKRRS 160

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 45/127 (35%), Positives = 61/127 (48%), Gaps = 13/127 (10%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           R+RDR + R+RD D EK RDR       R + +D    + DR RDR+ +RR R  DRD D
Sbjct: 74  RDRDRDKDRERDKDREKSRDRDRDRERDRDKDRDRHHRDRDRHRDRS-ERRERGRDRDDD 132

Query: 291 N-----EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR 127
           +     + +RDRR D DR  + E RH+       R R  R          R R R+  + 
Sbjct: 133 DYHRSRDYDRDRRRDYDR--DREERHKRRSPSPSRGRSER------RSKSRSRSRSRSKS 184

Query: 126 HRVDDRD 106
            R+   D
Sbjct: 185 KRISGFD 191

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 38/109 (34%), Positives = 54/109 (49%), Gaps = 11/109 (10%)
 Frame = -1

Query: 450 KRNRDR---RYRDRDDDNEKERDRRGRYKD-----DSEEEFDRKRDRNGDRRHRVDDRDG 295
           +R++DR   R RDRD + ++++DR   ++D     D  E  +R RDR+ D  HR  D D 
Sbjct: 83  ERDKDREKSRDRDRDRERDRDKDRDRHHRDRDRHRDRSERRERGRDRDDDDYHRSRDYDR 142

Query: 294 DNEK--ERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFD 157
           D  +  +RDR   + RR     R R +   K R R R R K      FD
Sbjct: 143 DRRRDYDRDREERHKRRSPSPSRGRSERRSKSRSRSRSRSKSKRISGFD 191

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 37/108 (34%), Positives = 52/108 (48%), Gaps = 9/108 (8%)
 Frame = -1

Query: 306 DRDGDNEKERDRRGDN-----DRRGNGERRHRDDDNEKE----RDRRGRYKDDSEEEFDR 154
           D D DN    D  G +     D   + + +H   D+E+E    R++      D E + DR
Sbjct: 15  DFDNDNYGSADGGGSSPPARPDDHSDSKSQHGSRDHERESSKSREKEREKGRDKERDRDR 74

Query: 153 KRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            RDR+ DR     +RD D EK RD     +D   E DR ++RDR +RD
Sbjct: 75  DRDRDKDR-----ERDKDREKSRD-----RDRDRERDRDKDRDRHHRD 112

[186][TOP]
>UniRef100_Q5KAL3 Putative uncharacterized protein n=1 Tax=Filobasidiella neoformans
           RepID=Q5KAL3_CRYNE
          Length = 513

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 58/151 (38%), Positives = 83/151 (54%), Gaps = 8/151 (5%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRG------RYKDDSE-EEFDRKRDRNGDR-RHRVDDRDGDNE 286
           RDRRY DRD D +++  RR       RY D+   E+ DR+RDR+ D  R R  +R+ +  
Sbjct: 371 RDRRYADRDRDRDRDSGRRRDEGRERRYDDERRGEKDDRRRDRDRDYGRDRDREREKETA 430

Query: 285 KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
           +ER+R GD  R           D ++ERDR  R +D + +  DR+RD  G +R R DDRD
Sbjct: 431 RERNRDGDYGR-----------DKDRERDRYDRERDYARDR-DRRRDSPGRKRER-DDRD 477

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
            D E++   RR    D  + DR+R ++R  R
Sbjct: 478 RDYERDEKRRR----DERDRDREREKERGVR 504

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 50/130 (38%), Positives = 69/130 (53%), Gaps = 19/130 (14%)
 Frame = -1

Query: 342 RDRNGDRRHRVDDRDGDNEKE--------RDRRGDNDRRGNGERRHRDDDNEKERDR-RG 190
           RD  G+R  R  DRD D +++        R+RR D++RRG  + R RD D +  RDR R 
Sbjct: 365 RDDRGERDRRYADRDRDRDRDSGRRRDEGRERRYDDERRGEKDDRRRDRDRDYGRDRDRE 424

Query: 189 RYKDDSEE-----EFDRKRDRNGDRRHRVDD--RDGDNEKERDHRRRYKDDSEED---DR 40
           R K+ + E     ++ R +DR  DR  R  D  RD D  ++   R+R +DD + D   D 
Sbjct: 425 REKETARERNRDGDYGRDKDRERDRYDRERDYARDRDRRRDSPGRKRERDDRDRDYERDE 484

Query: 39  KRNRDRRYRD 10
           KR RD R RD
Sbjct: 485 KRRRDERDRD 494

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 44/112 (39%), Positives = 64/112 (57%), Gaps = 2/112 (1%)
 Frame = -1

Query: 450 KRNRDRRY-RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           +R+RDR Y RDRD + EKE  R      D   + DR+RDR         DR+ D  ++RD
Sbjct: 410 RRDRDRDYGRDRDREREKETARERNRDGDYGRDKDRERDRY--------DRERDYARDRD 461

Query: 273 RRGDNDRRGNGERRHRDD-DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 121
           RR D+     G +R RDD D + ERD + R +D+ + + +R+++R G RR R
Sbjct: 462 RRRDSP----GRKRERDDRDRDYERDEK-RRRDERDRDREREKER-GVRRDR 507

[187][TOP]
>UniRef100_C5PDY1 G-patch domain containing protein n=1 Tax=Coccidioides posadasii
           C735 delta SOWgp RepID=C5PDY1_COCP7
          Length = 587

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 57/158 (36%), Positives = 81/158 (51%), Gaps = 11/158 (6%)
 Frame = -1

Query: 453 WKRNRDR-------RYRDRDDD---NEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 304
           WK  RDR       RY   DDD    E    R GR +  S +  DR RDR+  RR R DD
Sbjct: 386 WKERRDRNLTKNGRRYDASDDDRDSRESSSRRNGRDRSRSSDR-DRARDRDSRRRRRYDD 444

Query: 303 RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
              D +++     D+++R   +RR+RD D+ ++R    +   D E + DR +DR+ DR  
Sbjct: 445 DYDDRDRD---SYDSEKRRKDDRRYRDRDSPRDRVEDSKRDRDRERDKDRDKDRDRDR-- 499

Query: 123 RVDDRDGDNEKERDH-RRRYKDDSEEDDRKRNRDRRYR 13
              DRD  +++ERD    RYK+   E  R++ R R YR
Sbjct: 500 ---DRDKYSDRERDRGMDRYKEREREKGREKERRRDYR 534

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 50/160 (31%), Positives = 83/160 (51%), Gaps = 5/160 (3%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +++ K   K   +  ++    + E+E+ RR + +D+ +E  DR   +NG RR+   D D 
Sbjct: 351 LMKSKKTGKMITEEEFKKITKEQEREKQRREK-EDEWKERRDRNLTKNG-RRYDASDDDR 408

Query: 294 DNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
           D+ +   RR   DR  + +R R RD D+ + R     Y D   + +D ++ R  DRR+R 
Sbjct: 409 DSRESSSRRNGRDRSRSSDRDRARDRDSRRRRRYDDDYDDRDRDSYDSEKRRKDDRRYR- 467

Query: 117 DDRDGDNEKERDHRR---RYKDDSEEDDRKRNRDR-RYRD 10
            DRD   ++  D +R   R +D   + DR R+RDR +Y D
Sbjct: 468 -DRDSPRDRVEDSKRDRDRERDKDRDKDRDRDRDRDKYSD 506

[188][TOP]
>UniRef100_A8NYE8 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea
            okayama7#130 RepID=A8NYE8_COPC7
          Length = 3269

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 58/154 (37%), Positives = 82/154 (53%), Gaps = 6/154 (3%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRD-----RNGDRRHRVDDRDGDNE 286
            +R+    Y   D D +++RDR+   + + E     +RD     R    R +   RDG+ E
Sbjct: 2816 ERSERGNYEPEDRDRDRDRDRKESSRQERETATVSRRDSLTHTRERANRDQASGRDGERE 2875

Query: 285  KERDRRGDNDRRGNGERRHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
            ++RDR  D DR   G  RH D + +KERDR R R +D SE    R RDR+ DR     DR
Sbjct: 2876 RDRDRDRDRDR---GRDRHGDRERDKERDRDRDRDRDRSE----RDRDRDRDR-----DR 2923

Query: 108  DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
            D D +++R HRR        DD+ R+RDR+ RD+
Sbjct: 2924 DRDRDRDR-HRR--------DDKDRDRDRKERDS 2948

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 55/154 (35%), Positives = 75/154 (48%), Gaps = 6/154 (3%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            +R RDR   DRD D ++ RDR G  + D E + DR RDR  DR  R  DRD D +++RDR
Sbjct: 2873 ERERDR---DRDRDRDRGRDRHGDRERDKERDRDRDRDR--DRSERDRDRDRDRDRDRDR 2927

Query: 270  RGDNDRRGNGERRHRDDDNEKERDRR------GRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
              D         RHR DD +++RDR+       R    S    D    R    RHR   +
Sbjct: 2928 DRD---------RHRRDDKDRDRDRKERDSGSNRGGGSSSGNLDGLPSRPEPSRHRPSAQ 2978

Query: 108  DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
            + D E     RR   DDS+   ++ +R   +RD+
Sbjct: 2979 NAD-ESLGKRRRPNDDDSDRASKRSSRKDGHRDS 3011

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 51/157 (32%), Positives = 75/157 (47%), Gaps = 11/157 (7%)
 Frame = -1

Query: 447  RNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGD 292
            R+RDR   R+ DR+ D E++RDR  R +D SE + DR RDR+ DR     RHR DD+D D
Sbjct: 2882 RDRDRGRDRHGDRERDKERDRDR-DRDRDRSERDRDRDRDRDRDRDRDRDRHRRDDKDRD 2940

Query: 291  NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
             +++    G N   G+         +  E  R      +++E   ++R  N D   R   
Sbjct: 2941 RDRKERDSGSNRGGGSSSGNLDGLPSRPEPSRHRPSAQNADESLGKRRRPNDDDSDRASK 3000

Query: 111  RDGDNEKERDHRRRYKDDSEEDDRKRNR---DRRYRD 10
            R    +  RD  R  +   E+D   R R   DRR ++
Sbjct: 3001 RSSRKDGHRDSDRGRRPGQEKDAHDRGRGESDRRRKE 3037

[189][TOP]
>UniRef100_P09406 U1 small nuclear ribonucleoprotein 70 kDa n=1 Tax=Xenopus laevis
           RepID=RU17_XENLA
          Length = 471

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 59/183 (32%), Positives = 87/183 (47%), Gaps = 42/183 (22%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH-------------RVDDR 301
           RD   R  + D E+ERDRR R ++  +E  +R+R R+ +RR              R   +
Sbjct: 216 RDDTSRYDERDRERERDRRERSREREKEPRERRRSRSRERRRKSRSREKEERKRTREKSK 275

Query: 300 DGDNEKERDRRGDNDR----RGNGERRHRDDDNEKERDR--------RGRYKDDS----- 172
           D D EK++D + D DR    R    +R RD D EK+ +R            +DD+     
Sbjct: 276 DKDKEKDKDNK-DRDRKRRSRSRERKRERDRDREKKEERVEAEVPEADDAPQDDAQIGDL 334

Query: 171 ------------EEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNR 28
                       E+  +R R+R+ DR     DRD D +++RD RR ++D   E DR R+R
Sbjct: 335 GIDGIELKQEPEEKSRERDRERDRDREKGEKDRDKDRDRDRDRRRSHRDRDREKDRDRDR 394

Query: 27  DRR 19
           DRR
Sbjct: 395 DRR 397

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 55/166 (33%), Positives = 86/166 (51%), Gaps = 24/166 (14%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEF----DRKRDRNGDRRHRVDDRDGDNEKE 280
           R+R+RR + R  + E+ +  R + KD  +E+     DR R R    R R  +RD D EK+
Sbjct: 251 RSRERRRKSRSREKEERKRTREKSKDKDKEKDKDNKDRDRKRRSRSRERKRERDRDREKK 310

Query: 279 RDR------RGDNDRRGNG----------ERRHRDDDNEKERDR-RGRYKDDSEEEFDRK 151
            +R        D+  + +           E +   ++  +ERDR R R ++  E++ D+ 
Sbjct: 311 EERVEAEVPEADDAPQDDAQIGDLGIDGIELKQEPEEKSRERDRERDRDREKGEKDRDKD 370

Query: 150 RDRNGDRR--HRVDDRDGDNEKERDHRR-RYKDDSEEDDRKRNRDR 22
           RDR+ DRR  HR  DR+ D +++RD RR R +D   + D KR RDR
Sbjct: 371 RDRDRDRRRSHRDRDREKDRDRDRDRRRDRDRDRERDKDHKRERDR 416

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 41/109 (37%), Positives = 61/109 (55%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRG 247
           + R+ D E++RDR    K + + + DR RDR+  R HR  DR+ D +++RDRR D DR  
Sbjct: 348 KSRERDRERDRDRE---KGEKDRDKDRDRDRDRRRSHRDRDREKDRDRDRDRRRDRDR-- 402

Query: 246 NGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
               R RD D+++ERDR     D SE+  +R  D NG    + ++   D
Sbjct: 403 ---DRERDKDHKRERDR----GDRSEKREERVPD-NGMVMEQAEETSQD 443

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 48/177 (27%), Positives = 72/177 (40%), Gaps = 30/177 (16%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYK--------------DDSE---------------EE 355
           R+R RR R R+   E++RDR  + +              DD++               EE
Sbjct: 288 RDRKRRSRSRERKRERDRDREKKEERVEAEVPEADDAPQDDAQIGDLGIDGIELKQEPEE 347

Query: 354 FDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDD 175
             R+RDR  DR     ++D D +++RDR      R     + RD D ++ RDR      D
Sbjct: 348 KSRERDRERDRDREKGEKDRDKDRDRDRDRRRSHRDRDREKDRDRDRDRRRDR----DRD 403

Query: 174 SEEEFDRKRDRN-GDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDT 7
            E + D KR+R+ GDR  + ++R  DN    +       D   D         Y  T
Sbjct: 404 RERDKDHKRERDRGDRSEKREERVPDNGMVMEQAEETSQDMYLDQESMQSGDGYLST 460

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 38/111 (34%), Positives = 60/111 (54%)
 Frame = -1

Query: 342 RDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEE 163
           R    D   R D+RD   E+ERDRR +  R    E R R     +ER R+ R ++  E +
Sbjct: 212 RHSGRDDTSRYDERD--RERERDRR-ERSREREKEPRERRRSRSRERRRKSRSREKEERK 268

Query: 162 FDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             R++ ++ D+     ++D DN K+RD +RR +  S E  R+R+RDR  ++
Sbjct: 269 RTREKSKDKDK-----EKDKDN-KDRDRKRRSR--SRERKRERDRDREKKE 311

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 42/146 (28%), Positives = 72/146 (49%), Gaps = 14/146 (9%)
 Frame = -1

Query: 405 EKERDRRGRYKDDSEEEFD---------RKRDRNGDRRHRVDDRDGDNEKERDRRG--DN 259
           E ERD    YK    ++ D         R R   G R  R+    G       RRG  D 
Sbjct: 155 EHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGT-----RRGGADV 209

Query: 258 DRRGNGE---RRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
           + R +G     R+ + D E+ERDRR R ++  +E  +R+R R+ +RR +         +E
Sbjct: 210 NIRHSGRDDTSRYDERDRERERDRRERSREREKEPRERRRSRSRERRRK------SRSRE 263

Query: 87  RDHRRRYKDDSEEDDRKRNRDRRYRD 10
           ++ R+R ++ S++ D+++++D + RD
Sbjct: 264 KEERKRTREKSKDKDKEKDKDNKDRD 289

[190][TOP]
>UniRef100_UPI000186EC2B serine/threonine-protein kinase prp4, putative n=1 Tax=Pediculus
           humanus corporis RepID=UPI000186EC2B
          Length = 905

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 56/154 (36%), Positives = 79/154 (51%), Gaps = 5/154 (3%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR---D 298
           + K + K   D+R  DRD    ++RDR+ +    S    DR RD+  DRR  VD R   +
Sbjct: 246 KEKKVTKVKEDKRNSDRDRHRNRDRDRKDKSPVRSRSR-DRTRDKKNDRRKEVDLRTEIN 304

Query: 297 GDNEKERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 121
            + EKER+R+   +R    ER R RD + E++RDR          E DR RDR+  RR R
Sbjct: 305 REREKERERQRQRERERERERERERDRERERQRDR----------ERDRDRDRDRLRRER 354

Query: 120 VDDRDGDNEKERDHRR-RYKDDSEEDDRKRNRDR 22
             DRD D +++R+H R R           RN+D+
Sbjct: 355 ERDRDKDRDRDREHERDRSSSRRNNVISSRNKDK 388

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 44/131 (33%), Positives = 72/131 (54%), Gaps = 2/131 (1%)
 Frame = -1

Query: 408 NEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGE-RR 232
           + KE+      +D    + DR R+R+ DR+ +   R    ++ RD++  NDRR   + R 
Sbjct: 244 DSKEKKVTKVKEDKRNSDRDRHRNRDRDRKDKSPVRSRSRDRTRDKK--NDRRKEVDLRT 301

Query: 231 HRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDS 55
             + + EKER+R+ + + + E E +R+RDR  +R R R  DRD D ++ R  R R +D  
Sbjct: 302 EINREREKERERQRQRERERERERERERDRERERQRDRERDRDRDRDRLRRERERDRDKD 361

Query: 54  EEDDRKRNRDR 22
            + DR+  RDR
Sbjct: 362 RDRDREHERDR 372

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 42/148 (28%), Positives = 71/148 (47%), Gaps = 10/148 (6%)
 Frame = -1

Query: 471 IQRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           I R+   +R R R R R+R+ + E+ERDR    + D E + DR RDR    R R  D+D 
Sbjct: 303 INREREKERERQRQRERERERERERERDRERERQRDRERDRDRDRDRLRRERERDRDKDR 362

Query: 294 DNEKERDRRGDNDRRGN-------GERRHRDDDNEKERDRRGRYKDDSEE--EFDRKRDR 142
           D ++E +R   + RR N        + +H     + + D+  +YKD   E  + D     
Sbjct: 363 DRDREHERDRSSSRRNNVISSRNKDKSKHSLYRKKTKSDKLDKYKDSLSEGLQIDISDSE 422

Query: 141 NGDRRHRVDDRDGDNEKERDHRRRYKDD 58
                 ++D+ + D E   + RR+ +++
Sbjct: 423 EDLSNIKIDEDEEDEETIIERRRKQREE 450

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 48/142 (33%), Positives = 69/142 (48%), Gaps = 12/142 (8%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----------RHRVDDR 301
           R+RDR  RD+ +D  KE D R     + E+E +R+R R  +R           R R  DR
Sbjct: 281 RSRDRT-RDKKNDRRKEVDLRTEINREREKERERQRQRERERERERERERDRERERQRDR 339

Query: 300 DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 121
           + D +++RDR           RR R+ D +K+RDR      D E E    RDR+  RR+ 
Sbjct: 340 ERDRDRDRDRL----------RRERERDRDKDRDR------DREHE----RDRSSSRRNN 379

Query: 120 V-DDRDGDNEKERDHRRRYKDD 58
           V   R+ D  K   +R++ K D
Sbjct: 380 VISSRNKDKSKHSLYRKKTKSD 401

[191][TOP]
>UniRef100_UPI0000E809CA PREDICTED: hypothetical protein n=1 Tax=Gallus gallus
           RepID=UPI0000E809CA
          Length = 549

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 55/152 (36%), Positives = 80/152 (52%), Gaps = 3/152 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
           +R ++RR R R  D   ER R   R RY+  S     R RDR G+RR R  +R+ +NE+ 
Sbjct: 313 EREKERR-RSRSTDRALERRRSRSRERYRSRS-----RSRDRKGERRDRDREREKENERS 366

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           R +  D D+   G  R +D D  +ER +  + K D+EE   R RD   D++HR D R  D
Sbjct: 367 RKKERDYDK-DRGSEREKDSDRSRERSKERKSKGDTEER--RHRDDKDDKKHRDDKR--D 421

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           ++KER H R    + +   R R+++   R  S
Sbjct: 422 SKKERKHSRSRSRERKHRSRSRSKNTGKRSRS 453

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 53/161 (32%), Positives = 91/161 (56%), Gaps = 9/161 (5%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDD 304
           R   R +  +R+R R RYR R    +++ +RR R ++ + E E  RK++R+ D+  R  +
Sbjct: 322 RSTDRALERRRSRSRERYRSRSRSRDRKGERRDRDREREKENERSRKKERDYDK-DRGSE 380

Query: 303 RDGDNEKERDRRGDNDRRGN-GERRHRDD-DNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
           R+ D+++ R+R  +   +G+  ERRHRDD D++K RD     K DS++E    R R+ +R
Sbjct: 381 REKDSDRSRERSKERKSKGDTEERRHRDDKDDKKHRDD----KRDSKKERKHSRSRSRER 436

Query: 129 RHRVDDRDGDNEK-----ERDHRRRYKDDSEEDDRKRNRDR 22
           +HR   R  +  K      ++   ++K +S+E   KR+R R
Sbjct: 437 KHRSRSRSKNTGKRSRSRSKEKSSKHKSESKEKSNKRSRSR 477

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 54/180 (30%), Positives = 87/180 (48%), Gaps = 26/180 (14%)
 Frame = -1

Query: 465 RKMIWKRNRDRRYRDR------------DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 322
           R+ +  R   RR R R            D + E+ER+R+   ++  E E +R+R R+ DR
Sbjct: 267 RRSLSPRRSPRRSRSRSHHREAHGSSSFDRELERERERQRLEREAKEREKERRRSRSTDR 326

Query: 321 RHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDD--------SEE 166
                +R     +ER R     R   GERR RD + EKE +R  + + D         E+
Sbjct: 327 AL---ERRRSRSRERYRSRSRSRDRKGERRDRDREREKENERSRKKERDYDKDRGSEREK 383

Query: 165 EFDRKRDRNGDRRHRVDDR------DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           + DR R+R+ +R+ + D        D D++K RD +R  K +  +  R R+R+R++R  S
Sbjct: 384 DSDRSRERSKERKSKGDTEERRHRDDKDDKKHRDDKRDSKKE-RKHSRSRSRERKHRSRS 442

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 50/181 (27%), Positives = 79/181 (43%), Gaps = 39/181 (21%)
 Frame = -1

Query: 447 RNRDRRY-------RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           R ++R Y       R++D D  +ER +  + K D+EE   R RD   D++HR D RD   
Sbjct: 367 RKKERDYDKDRGSEREKDSDRSRERSKERKSKGDTEER--RHRDDKDDKKHRDDKRDSKK 424

Query: 288 E--------KERDRRGDNDRRGNGER----------RHRDDDNEKERDR---RGRYKDDS 172
           E        +ER  R  +  +  G+R          +H+ +  EK   R   R R + DS
Sbjct: 425 ERKHSRSRSRERKHRSRSRSKNTGKRSRSRSKEKSSKHKSESKEKSNKRSRSRSRGRTDS 484

Query: 171 EE-----------EFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
            E           E  RKR R+ +R H+ D  D  +  ++  RRR +    E   K+ ++
Sbjct: 485 VEKSRKRDHSPSKERSRKRSRSKERSHKHDHSDSKDHSDKHDRRRSQSTERESQEKQQKN 544

Query: 24  R 22
           +
Sbjct: 545 K 545

[192][TOP]
>UniRef100_UPI0000ECB1E5 Hypothetical protein. n=1 Tax=Gallus gallus RepID=UPI0000ECB1E5
          Length = 468

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 55/152 (36%), Positives = 80/152 (52%), Gaps = 3/152 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
           +R ++RR R R  D   ER R   R RY+  S     R RDR G+RR R  +R+ +NE+ 
Sbjct: 313 EREKERR-RSRSTDRALERRRSRSRERYRSRS-----RSRDRKGERRDRDREREKENERS 366

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           R +  D D+   G  R +D D  +ER +  + K D+EE   R RD   D++HR D R  D
Sbjct: 367 RKKERDYDK-DRGSEREKDSDRSRERSKERKSKGDTEER--RHRDDKDDKKHRDDKR--D 421

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           ++KER H R    + +   R R+++   R  S
Sbjct: 422 SKKERKHSRSRSRERKHRSRSRSKNTGKRSRS 453

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 49/151 (32%), Positives = 83/151 (54%), Gaps = 4/151 (2%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDD 304
           R   R +  +R+R R RYR R    +++ +RR R ++ + E E  RK++R+ D+  R  +
Sbjct: 322 RSTDRALERRRSRSRERYRSRSRSRDRKGERRDRDREREKENERSRKKERDYDK-DRGSE 380

Query: 303 RDGDNEKERDRRGDNDRRGN-GERRHRDD-DNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
           R+ D+++ R+R  +   +G+  ERRHRDD D++K RD     K DS++E    R R+ +R
Sbjct: 381 REKDSDRSRERSKERKSKGDTEERRHRDDKDDKKHRDD----KRDSKKERKHSRSRSRER 436

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRK 37
           +HR   R  +  K    R + K    + + K
Sbjct: 437 KHRSRSRSKNTGKRSRSRSKEKSSKHKSESK 467

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 54/180 (30%), Positives = 87/180 (48%), Gaps = 26/180 (14%)
 Frame = -1

Query: 465 RKMIWKRNRDRRYRDR------------DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 322
           R+ +  R   RR R R            D + E+ER+R+   ++  E E +R+R R+ DR
Sbjct: 267 RRSLSPRRSPRRSRSRSHHREAHGSSSFDRELERERERQRLEREAKEREKERRRSRSTDR 326

Query: 321 RHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDD--------SEE 166
                +R     +ER R     R   GERR RD + EKE +R  + + D         E+
Sbjct: 327 AL---ERRRSRSRERYRSRSRSRDRKGERRDRDREREKENERSRKKERDYDKDRGSEREK 383

Query: 165 EFDRKRDRNGDRRHRVDDR------DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           + DR R+R+ +R+ + D        D D++K RD +R  K +  +  R R+R+R++R  S
Sbjct: 384 DSDRSRERSKERKSKGDTEERRHRDDKDDKKHRDDKRDSKKE-RKHSRSRSRERKHRSRS 442

[193][TOP]
>UniRef100_C0P852 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0P852_MAIZE
          Length = 594

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 44/138 (31%), Positives = 66/138 (47%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +   + +  D      +ERDR      D E + DR R++  DR    D    D +++R  
Sbjct: 57  QHQHETQSHDSGSSKSRERDRERDKGKDRERDRDRGREKGRDRDRDKDRERSDRDRDRHH 116

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
           R   +R    E R R DD ++ RD R R++DD + E  R RDR+G RRHR   R     +
Sbjct: 117 RDHRERSEKREHRDRSDDRDRHRDGRDRHRDDRDSERRRDRDRDGHRRHR--SRSPSKSR 174

Query: 90  ERDHRRRYKDDSEEDDRK 37
           +RD R R +  S    ++
Sbjct: 175 DRDRRSRSRSRSRSKSKR 192

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 48/137 (35%), Positives = 67/137 (48%), Gaps = 1/137 (0%)
 Frame = -1

Query: 411 DNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGDNDRRGNGER 235
           D    + +      DS     R+RDR  D+ + R  DRD   EK RDR  D DR  +   
Sbjct: 52  DGRSSQHQHETQSHDSGSSKSRERDRERDKGKDRERDRDRGREKGRDRDRDKDRERSDRD 111

Query: 234 RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDS 55
           R R   + +ER  +  ++D S+   DR R R+G  RHR DDRD +  ++RD     +  S
Sbjct: 112 RDRHHRDHRERSEKREHRDRSD---DRDRHRDGRDRHR-DDRDSERRRDRDRDGHRRHRS 167

Query: 54  EEDDRKRNRDRRYRDTS 4
               + R+RDRR R  S
Sbjct: 168 RSPSKSRDRDRRSRSRS 184

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/113 (31%), Positives = 54/113 (47%)
 Frame = -1

Query: 351 DRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDS 172
           D    R+   +H     D  + K R+R  + D+   G+ R RD D  +E+ R        
Sbjct: 49  DHADGRSSQHQHETQSHDSGSSKSRERDRERDK---GKDRERDRDRGREKGR-------- 97

Query: 171 EEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
               DR RD++ +R  R  DR   + +ER  +R ++D S  DDR R+RD R R
Sbjct: 98  ----DRDRDKDRERSDRDRDRHHRDHRERSEKREHRDRS--DDRDRHRDGRDR 144

[194][TOP]
>UniRef100_B9PFV0 Dynactin, putative n=1 Tax=Toxoplasma gondii GT1 RepID=B9PFV0_TOXGO
          Length = 365

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 56/166 (33%), Positives = 88/166 (53%), Gaps = 18/166 (10%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           K  R  + RD +   E ER RRGR K    E+  ++R+R G++ R R  +R+G+ E+E +
Sbjct: 68  KERRREKQRDEERRREGERRRRGREKKKRREK--KERERGGEKKRRREKEREGEKEREGE 125

Query: 273 RRGDNDRRGN------GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
           RR + +RR        GERR  + + E+ R+   R +++ E E ++KR R   RR   + 
Sbjct: 126 RRREGERRREEEKETEGERRREEREGERRREGERRREEEKEREDEKKRRREKTRRSEGES 185

Query: 111 RDGDNEKERD----HRRRYKDDSEEDDR----KRNRDR---RYRDT 7
           R    E+ER+     +RR +D   E  R    +R+RDR   R R+T
Sbjct: 186 RREKKEREREEATPRKRRQRDRDRERQRETETERDRDRERQRQRET 231

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 44/148 (29%), Positives = 82/148 (55%), Gaps = 2/148 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRD--RNGDRRHRVDDRDGDNEKER 277
           +++  +R   R   NEK+RD   R     EEE +R+R+  R+ +RR   + R    EK++
Sbjct: 40  EKSSTKRTDGRGKKNEKQRDEERR----REEEKERRREKQRDEERRREGERRRRGREKKK 95

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
            R      RG  ++R R+ + E E++R G  + + E   + +++  G+RR   ++R+G+ 
Sbjct: 96  RREKKERERGGEKKRRREKEREGEKEREGERRREGERRREEEKETEGERRR--EEREGER 153

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYR 13
            +E + RRR ++   ED++KR R++  R
Sbjct: 154 RREGE-RRREEEKEREDEKKRRREKTRR 180

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 41/158 (25%), Positives = 88/158 (55%), Gaps = 10/158 (6%)
 Frame = -1

Query: 468 QRKMIWKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
           ++K   K+ R+R   + R R+ + E E++R G  + + E   + +++  G+RR   ++R+
Sbjct: 93  KKKRREKKERERGGEKKRRREKEREGEKEREGERRREGERRREEEKETEGERRR--EERE 150

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDD-----DNEKERDRRGRYKDDSEEEFDRKRDRNGD 133
           G+  +E +RR + ++    E++ R +     + E  R+++ R ++++     R+RDR+ +
Sbjct: 151 GERRREGERRREEEKEREDEKKRRREKTRRSEGESRREKKEREREEATPRKRRQRDRDRE 210

Query: 132 RRHRVD-DRDGDNEKERDHR-RRYKDDSEEDDRKRNRD 25
           R+   + +RD D E++R     R +D   E DR+R R+
Sbjct: 211 RQRETETERDRDRERQRQRETERQRDRETESDRERQRE 248

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 54/161 (33%), Positives = 87/161 (54%), Gaps = 15/161 (9%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRG--RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           K+ R  + R+ + + E ER R G  R +++ E E +R+R+     R R  +R  + EKER
Sbjct: 108 KKRRREKEREGEKEREGERRREGERRREEEKETEGERRREEREGERRREGERRREEEKER 167

Query: 276 D----RRGDNDRRGNGERRHRDDDNEKERD------RRGRYKD-DSEEEFDRKRDRNGDR 130
           +    RR +  RR  GE R   +  E+ER+      RR R +D + + E + +RDR+ +R
Sbjct: 168 EDEKKRRREKTRRSEGESRR--EKKEREREEATPRKRRQRDRDRERQRETETERDRDRER 225

Query: 129 -RHRVDDRDGDNEKERDHRRRYKDDSE-EDDRKRNRDRRYR 13
            R R  +R  D E E D  R+ + D E + +R+++R RR R
Sbjct: 226 QRQRETERQRDRETESDRERQRETDRERQREREKHRRRRRR 266

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 46/141 (32%), Positives = 67/141 (47%), Gaps = 1/141 (0%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDN 259
           +RR  +R+ +  +E +RR   +++ E E ++KR R   RR   + R    E+ER+     
Sbjct: 143 ERRREEREGERRREGERRR--EEEKEREDEKKRRREKTRRSEGESRREKKEREREEATPR 200

Query: 258 DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 82
            RR     R R  + E ERDR    +   E E  R R+   DR R R  DR+   E+E+ 
Sbjct: 201 KRRQRDRDRERQRETETERDRDRERQRQRETERQRDRETESDRERQRETDRERQREREKH 260

Query: 81  HRRRYKDDSEEDDRKRNRDRR 19
            RRR +       RKR R  R
Sbjct: 261 RRRRRR------GRKRRRKPR 275

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 46/161 (28%), Positives = 81/161 (50%), Gaps = 6/161 (3%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSE-EEFDRKRDRNGDRRHRVDDRDGD 292
           +R+   +R R+   ++R+D+ ++ R++  R + +S  E+ +R+R+    R+ R  DRD +
Sbjct: 152 ERRREGERRREEE-KEREDEKKRRREKTRRSEGESRREKKEREREEATPRKRRQRDRDRE 210

Query: 291 NEKERDRRGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR 127
            ++E +   D DR    +R     R R+ ++++ER R    +   E E  R+R R G +R
Sbjct: 211 RQRETETERDRDRERQRQRETERQRDRETESDRERQRETDRERQREREKHRRRRRRGRKR 270

Query: 126 HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            R     G   K+R  R+R         R+R R RR R  S
Sbjct: 271 RRKPRMTGRRRKKRMRRKR--------SRRRRRRRRSRARS 303

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 48/154 (31%), Positives = 74/154 (48%), Gaps = 5/154 (3%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           +R RDR R R R+ + E++RDR  + + ++E + DR+ + + +R+     R+ D E++R+
Sbjct: 202 RRQRDRDRERQRETETERDRDRERQRQRETERQRDRETESDRERQ-----RETDRERQRE 256

Query: 273 RRGDNDRRGNGERRHRDDD----NEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
           R     RR  G +R R         K+R RR R +        R R R G RR R     
Sbjct: 257 REKHRRRRRRGRKRRRKPRMTGRRRKKRMRRKRSRRRRRRRRSRARSRRGRRRER----- 311

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
               + R  RR Y    E D   R R+R  R+T+
Sbjct: 312 ----EGRLCRRPYPSTMESDALSR-RERERRETT 340

[195][TOP]
>UniRef100_UPI0001AEF1B3 Hypothetical gene 48 protein n=1 Tax=Acinetobacter baumannii AB900
           RepID=UPI0001AEF1B3
          Length = 408

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 59/157 (37%), Positives = 76/157 (48%), Gaps = 15/157 (9%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKER 277
           R R RR  D +DD+      RGR +   ++E D  R R+G R   R R DD D D     
Sbjct: 218 RGRSRRDDDDEDDDRGRSGGRGRGRSRRDDE-DDDRGRSGGRGRGRSRYDDDDED----- 271

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGDRRHRV 118
           D RG +  RG G  R  DDD + +R R       R RY DD E++   +    G  R R 
Sbjct: 272 DDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRR 331

Query: 117 DDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
           DD D D+++ R       R RY DD E+DDR R+  R
Sbjct: 332 DDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 368

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 60/159 (37%), Positives = 79/159 (49%), Gaps = 16/159 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGR----YKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 280
           R R R  RD +DD+      RGR    Y DD E++    R R+G R      RD D+E  
Sbjct: 238 RGRGRSRRDDEDDDRGRSGGRGRGRSRYDDDDEDD---DRGRSGGRGRGRSRRDDDDED- 293

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYK-DDSEEEFDRKRD-RNGDRRHR 121
            D RG +  RG G  R+ DDD + +R R     RGR + DD +E+ DR R    G  R R
Sbjct: 294 -DDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSR 352

Query: 120 VDDRDGDNEKERD-----HRRRYKDDSEEDDRKRNRDRR 19
            DD D D+++ R       R R  DD ++DDR+   D R
Sbjct: 353 YDDDDEDDDRGRSGGRGRGRSRRDDDDDDDDRRGRSDGR 391

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 57/155 (36%), Positives = 74/155 (47%), Gaps = 13/155 (8%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           R R R  RD DDD + +R R     RGR + D ++E D  R R+G R      RD D+E 
Sbjct: 172 RGRGRSRRD-DDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSRRDDDDED 229

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
           +   R     RG   R   DDD  +   R   R RY DD E++   +    G  R R DD
Sbjct: 230 DDRGRSGGRGRGRSRRDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDD 289

Query: 111 RDGDNEKERD-----HRRRYKDDSEEDDRKRNRDR 22
            D D+++ R       R RY DD E+DDR R+  R
Sbjct: 290 DDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGR 324

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 64/163 (39%), Positives = 78/163 (47%), Gaps = 17/163 (10%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           R R R   D DDD  +   R RGR +DD +E+ DR R     R R R DD D D     D
Sbjct: 132 RGRGRDDDDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDED-----D 186

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR---RHRV 118
            RG +  RG G  R  DDD + +R R     RGR + D ++E D  R R+G R   R R 
Sbjct: 187 DRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSRR 245

Query: 117 DDRDGDNEKE--RDHRRRYKDDSEEDDRK-----RNRDRRYRD 10
           DD D D  +   R   R   DD +EDD +     R R R  RD
Sbjct: 246 DDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRD 288

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 60/172 (34%), Positives = 80/172 (46%), Gaps = 30/172 (17%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRG-----RYKDDSEEEFDRKRDRNGDRRHRVDDRDG---- 295
           RN   R RD DDD++    R G     RY DD +++  R   R   R    DD D     
Sbjct: 88  RNGRGRGRDDDDDDDDRGSRSGGRGRSRYDDDDDDDRGRSGGRGRGRGRDDDDEDDDRGR 147

Query: 294 ----------DNEKERDRRGDNDRRGNGERRHRDDDNEKERDR-----RGRYKDDSEEEF 160
                     D++ E D RG +  RG G  R  DDD + +R R     RGR + D ++E 
Sbjct: 148 SGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRRDDDDE- 206

Query: 159 DRKRDRNGDR---RHRVDDRDGDNEKERD---HRRRYKDDSEEDDRKRNRDR 22
           D  R R+G R   R R DD D D+++ R     R R + D E+DDR R+  R
Sbjct: 207 DDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRRDDEDDDRGRSGGR 258

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 62/194 (31%), Positives = 83/194 (42%), Gaps = 51/194 (26%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEK----------------ERDR-------RGRYKDDSEEEFDRKR 340
           +  R R   D DDD+++                + DR       RGR +DD +E+ DR R
Sbjct: 88  RNGRGRGRDDDDDDDDRGSRSGGRGRSRYDDDDDDDRGRSGGRGRGRGRDDDDEDDDRGR 147

Query: 339 DRNGDRRHRVDDRDGDNEK-----------------ERDRRGDNDRRGNGERRHRDDDNE 211
                R    DD D D+++                 E D RG +  RG G  R  DDD +
Sbjct: 148 SGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRRDDDDED 207

Query: 210 KERDR-----RGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERDH---RRRYK 64
            +R R     RGR + D ++E D  R R+G R   R R DD D D  +       R RY 
Sbjct: 208 DDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSRRDDEDDDRGRSGGRGRGRSRYD 266

Query: 63  DDSEEDDRKRNRDR 22
           DD E+DDR R+  R
Sbjct: 267 DDDEDDDRGRSGGR 280

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 60/163 (36%), Positives = 79/163 (48%), Gaps = 15/163 (9%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDN 289
           R R R RY D D+D+++ R     RGR + D ++E D  R R+G R   R R DD D D 
Sbjct: 258 RGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDE-DDDRGRSGGRGRGRSRYDDDDED- 315

Query: 288 EKERDRRGDNDRRGNGE-RRHRDDDNEKERDR-------RGRYKDDSEEEFDRKRDRNGD 133
               D RG +  RG G  RR  DD+++ +R R       R RY DD E++   +    G 
Sbjct: 316 ----DDRGRSGGRGRGRSRRDDDDEDD-DRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGR 370

Query: 132 RRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            R R DD D D     D RR   D   ++ R + RD   R TS
Sbjct: 371 GRSRRDDDDDD-----DDRRGRSDGRGQNSRNQKRDAYGRFTS 408

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 48/144 (33%), Positives = 66/144 (45%), Gaps = 18/144 (12%)
 Frame = -1

Query: 387 RGRYKDDSEEEFDRKRDRN-GDRRHRVDDRDGDNEKERDRRGDNDR--RGNGERRHR-DD 220
           R  +   +  EF  +  R  G   H+ D R+G      D   D+DR  R  G  R R DD
Sbjct: 59  RAAHASGNAHEFTSEEAREAGALSHKNDGRNGRGRGRDDDDDDDDRGSRSGGRGRSRYDD 118

Query: 219 DNEKERDR-----RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD----HRRRY 67
           D++ +R R     RGR +DD +E+ DR R     R    DD D D+++ R       R  
Sbjct: 119 DDDDDRGRSGGRGRGRGRDDDDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSR 178

Query: 66  KDDSEEDDRK-----RNRDRRYRD 10
           +DD +EDD +     R R R  RD
Sbjct: 179 RDDDDEDDDRGRSGGRGRGRSRRD 202

[196][TOP]
>UniRef100_UPI0000E11F23 Os03g0153000 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000E11F23
          Length = 606

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 52/149 (34%), Positives = 78/149 (52%), Gaps = 2/149 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           K    RR        ++ERD   R    S  E +R RD++ DR RHR  D+D D  +   
Sbjct: 31  KERSSRRRSGGGGGGDEERDDGERRSKRSRSEENRDRDKDKDRDRHRDRDKDRDRHRSSR 90

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDN 97
            R D DR  + + + R+ + +K+++RR R ++ + E+E +R+R+R  DR  R        
Sbjct: 91  ERRDRDRDRDRDEKDREKERDKDKERRSRDREKEKEKEKEREREREKDRERR-------- 142

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            + R  RRR   D EE DR+R R+R YRD
Sbjct: 143 SRSRSERRR---DDEERDRERYRERDYRD 168

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 49/148 (33%), Positives = 81/148 (54%), Gaps = 4/148 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           KR+R    RDRD D +++R R      D +++ DR R    +RR R  DRD D EK+R++
Sbjct: 57  KRSRSEENRDRDKDKDRDRHR------DRDKDRDRHRSSR-ERRDRDRDRDRD-EKDREK 108

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
             D D+      R ++ + EKER+R      + E++ +R+     +RR   ++RD +  +
Sbjct: 109 ERDKDKERRSRDREKEKEKEKERER------EREKDRERRSRSRSERRRDDEERDRERYR 162

Query: 90  ERDHR----RRYKDDSEEDDRKRNRDRR 19
           ERD+R    RR K+++ E +    RD+R
Sbjct: 163 ERDYRDRDVRRRKEEAGEPEADPERDQR 190

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 45/133 (33%), Positives = 68/133 (51%)
 Frame = -1

Query: 402 KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRD 223
           +E++R  R +       D +RD +G+RR     +   +E+ RDR  D DR      RHRD
Sbjct: 29  EEKERSSRRRSGGGGGGDEERD-DGERR----SKRSRSEENRDRDKDKDRD-----RHRD 78

Query: 222 DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDD 43
            D +++R R  R      E  DR RDR+ D + R  +RD D E+    R + K+  +E +
Sbjct: 79  RDKDRDRHRSSR------ERRDRDRDRDRDEKDREKERDKDKERRSRDREKEKEKEKERE 132

Query: 42  RKRNRDRRYRDTS 4
           R+R +DR  R  S
Sbjct: 133 REREKDRERRSRS 145

[197][TOP]
>UniRef100_UPI0000546808 PREDICTED: similar to Cell surface A33 antigen precursor
           (Glycoprotein A33) n=1 Tax=Danio rerio
           RepID=UPI0000546808
          Length = 468

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 65/157 (41%), Positives = 83/157 (52%), Gaps = 11/157 (7%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDR-RGRYKD---DSEEEFDRKRDRNGDR---RHRVDDRDGD 292
           K +RD   RD +DD    RD  R RY+D     +E  DR  DR G R   R R +DR G 
Sbjct: 324 KGSRDE-LRDHNDDRRGSRDELRDRYEDRRGSRDELRDRYEDRKGSRDELRDRYEDRRGS 382

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            ++ RDR    DRRG+     RD+  ++  DRRG  +D+  E +D +RD+  DRR   DD
Sbjct: 383 RDELRDRY--EDRRGS-----RDELRDRYEDRRGS-RDELRERYDDRRDQYDDRRDHYDD 434

Query: 111 RDGDNEKERDHRRRYKDDSEE-DDRKRNRD---RRYR 13
           R G  +  RD   RY D  E  DDRK +RD    RYR
Sbjct: 435 RRGSRDDLRD---RYDDRRERYDDRKGSRDDLRDRYR 468

[198][TOP]
>UniRef100_C4CZ17 Putative uncharacterized protein n=1 Tax=Spirosoma linguale DSM 74
           RepID=C4CZ17_9SPHI
          Length = 440

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 60/165 (36%), Positives = 84/165 (50%), Gaps = 17/165 (10%)
 Frame = -1

Query: 453 WKRNRDRR--YRDRDDDNE----KERDR-RGRYKDDSEEEF--DRKRDRNGDRRH----R 313
           + R+ DRR  Y DRDDDN      +RD    RY +++  +   DR  DR+G  R+    R
Sbjct: 125 YNRSDDRRDSYSDRDDDNNDRSYNQRDSYNDRYSNNNRRDSYNDRYDDRSGSNRNSYNDR 184

Query: 312 VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKD----DSEEEFDRKRD 145
            DDR G N    + R D+       R  RD  N+++RD R RY D    +  +  DR  D
Sbjct: 185 YDDRSGSNRNSYNDRYDD----RNSRDSRDSYNDRDRDSR-RYDDRNSYNDRDSRDRNDD 239

Query: 144 RNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           R+G+ R+  +DRD DN+++    R   DD   D+R RN D R  D
Sbjct: 240 RSGNNRNSYNDRDRDNDRD---NRNMNDDRRYDNRDRNNDDRSND 281

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 51/153 (33%), Positives = 82/153 (53%), Gaps = 10/153 (6%)
 Frame = -1

Query: 447 RNRDRRYRD-RDDDNEKERDRRGRYKD----DSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           R  DR  RD RD  N+++RD R RY D    +  +  DR  DR+G+ R+  +DRD DN++
Sbjct: 199 RYDDRNSRDSRDSYNDRDRDSR-RYDDRNSYNDRDSRDRNDDRSGNNRNSYNDRDRDNDR 257

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEF-DRKRDRNGDRRHRVDDRD 106
           +     D+ R  N +R + D  N+++RD R   + ++   + DR   RN DR +  D RD
Sbjct: 258 DNRNMNDDRRYDNRDRNNDDRSNDRDRDNRSDDRSNNNSSYNDRDNRRNDDRNN--DSRD 315

Query: 105 ----GDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
                +N   R++ R    +S  +D+  +RD+R
Sbjct: 316 NRSMSNNSDSRNNDRDNNRNSNNNDQSGDRDKR 348

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 51/150 (34%), Positives = 74/150 (49%), Gaps = 9/150 (6%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNE--KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           NR   Y DR DD           RY D S    +   DR  DR  R D RD  N+++RD 
Sbjct: 161 NRRDSYNDRYDDRSGSNRNSYNDRYDDRSGSNRNSYNDRYDDRNSR-DSRDSYNDRDRDS 219

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD--- 100
           R  +DR    +R  RD ++++  + R  Y D   +     R+ N DRR+   DR+ D   
Sbjct: 220 RRYDDRNSYNDRDSRDRNDDRSGNNRNSYNDRDRDNDRDNRNMNDDRRYDNRDRNNDDRS 279

Query: 99  NEKERDHRR--RYKDDSEEDDR--KRNRDR 22
           N+++RD+R   R  ++S  +DR  +RN DR
Sbjct: 280 NDRDRDNRSDDRSNNNSSYNDRDNRRNDDR 309

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 59/170 (34%), Positives = 76/170 (44%), Gaps = 28/170 (16%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKER-------DRRGRYKDDSE--------EEFDRKRDRNGDRRHR 313
           R+ DR  RD   DN   R       DR     DDS+        + ++ + +R+ DRR  
Sbjct: 75  RDDDRMSRDNSRDNSSYRNPYQSSNDRMSYRSDDSDRSSRMSGGDNYNNRYNRSDDRRDS 134

Query: 312 VDDRDGDNEKERDRRGD--NDRRGNGERRHRDDDNEKERDRRG--------RYKDDSEEE 163
             DRD DN      + D  NDR  N  R  RD  N++  DR G        RY D S   
Sbjct: 135 YSDRDDDNNDRSYNQRDSYNDRYSNNNR--RDSYNDRYDDRSGSNRNSYNDRYDDRSGSN 192

Query: 162 FDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDD---SEEDDRKRNRDR 22
            +   DR  DR  R D RD  N+++RD  RRY D    ++ D R RN DR
Sbjct: 193 RNSYNDRYDDRNSR-DSRDSYNDRDRD-SRRYDDRNSYNDRDSRDRNDDR 240

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 54/170 (31%), Positives = 80/170 (47%), Gaps = 24/170 (14%)
 Frame = -1

Query: 447 RNRD-RRYRDRDDDNEKE-RDRRGRYKDDSEEEF-DRKRDRNGDRRHRVDDRDGDN---- 289
           R+RD RRY DR+  N+++ RDR      ++   + DR RD + D R+  DDR  DN    
Sbjct: 215 RDRDSRRYDDRNSYNDRDSRDRNDDRSGNNRNSYNDRDRDNDRDNRNMNDDRRYDNRDRN 274

Query: 288 ----EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDD---SEEEFDRKRDRNGDR 130
                 +RDR   +D R N    + D DN +  DR    +D+   S     R  DR+ +R
Sbjct: 275 NDDRSNDRDRDNRSDDRSNNNSSYNDRDNRRNDDRNNDSRDNRSMSNNSDSRNNDRDNNR 334

Query: 129 RHRVDDRDGDNEK----ERDHRRRYKDDSEEDDRK------RNRDRRYRD 10
               +D+ GD +K    +R   +  K D + D+ K        RDRR R+
Sbjct: 335 NSNNNDQSGDRDKRELGDRISEQMDKIDKQLDEAKTEVKNESKRDRRKRE 384

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 42/152 (27%), Positives = 72/152 (47%), Gaps = 5/152 (3%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGR-YKDDSEEEFDRK---RDRNGDRRHRVDDRDGDNEKER 277
           +R+   R     ++  RD R R Y DD    F+R+   +DR+ DR  R + RD  + +  
Sbjct: 35  SREDIVRADRSSSQNSRDSRNRTYSDDEGGIFNRRNRDKDRDDDRMSRDNSRDNSSYRN- 93

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD- 100
             +  NDR       +R DD+++     G       + ++ + +R+ DRR    DRD D 
Sbjct: 94  PYQSSNDRMS-----YRSDDSDRSSRMSG------GDNYNNRYNRSDDRRDSYSDRDDDN 142

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           N++  + R  Y D    ++R+ + + RY D S
Sbjct: 143 NDRSYNQRDSYNDRYSNNNRRDSYNDRYDDRS 174

[199][TOP]
>UniRef100_Q10RM6 Transposon protein, putative, CACTA, En/Spm sub-class, expressed
           n=1 Tax=Oryza sativa Japonica Group RepID=Q10RM6_ORYSJ
          Length = 566

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 52/149 (34%), Positives = 78/149 (52%), Gaps = 2/149 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           K    RR        ++ERD   R    S  E +R RD++ DR RHR  D+D D  +   
Sbjct: 31  KERSSRRRSGGGGGGDEERDDGERRSKRSRSEENRDRDKDKDRDRHRDRDKDRDRHRSSR 90

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDN 97
            R D DR  + + + R+ + +K+++RR R ++ + E+E +R+R+R  DR  R        
Sbjct: 91  ERRDRDRDRDRDEKDREKERDKDKERRSRDREKEKEKEKEREREREKDRERR-------- 142

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            + R  RRR   D EE DR+R R+R YRD
Sbjct: 143 SRSRSERRR---DDEERDRERYRERDYRD 168

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 49/148 (33%), Positives = 81/148 (54%), Gaps = 4/148 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           KR+R    RDRD D +++R R      D +++ DR R    +RR R  DRD D EK+R++
Sbjct: 57  KRSRSEENRDRDKDKDRDRHR------DRDKDRDRHRSSR-ERRDRDRDRDRD-EKDREK 108

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
             D D+      R ++ + EKER+R      + E++ +R+     +RR   ++RD +  +
Sbjct: 109 ERDKDKERRSRDREKEKEKEKERER------EREKDRERRSRSRSERRRDDEERDRERYR 162

Query: 90  ERDHR----RRYKDDSEEDDRKRNRDRR 19
           ERD+R    RR K+++ E +    RD+R
Sbjct: 163 ERDYRDRDVRRRKEEAGEPEADPERDQR 190

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 45/133 (33%), Positives = 68/133 (51%)
 Frame = -1

Query: 402 KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRD 223
           +E++R  R +       D +RD +G+RR     +   +E+ RDR  D DR      RHRD
Sbjct: 29  EEKERSSRRRSGGGGGGDEERD-DGERR----SKRSRSEENRDRDKDKDRD-----RHRD 78

Query: 222 DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDD 43
            D +++R R  R      E  DR RDR+ D + R  +RD D E+    R + K+  +E +
Sbjct: 79  RDKDRDRHRSSR------ERRDRDRDRDRDEKDREKERDKDKERRSRDREKEKEKEKERE 132

Query: 42  RKRNRDRRYRDTS 4
           R+R +DR  R  S
Sbjct: 133 REREKDRERRSRS 145

[200][TOP]
>UniRef100_B9FBD9 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9FBD9_ORYSJ
          Length = 565

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 52/149 (34%), Positives = 78/149 (52%), Gaps = 2/149 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           K    RR        ++ERD   R    S  E +R RD++ DR RHR  D+D D  +   
Sbjct: 31  KERSSRRRSGGGGGGDEERDDGERRSKRSRSEENRDRDKDKDRDRHRDRDKDRDRHRSSR 90

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDN 97
            R D DR  + + + R+ + +K+++RR R ++ + E+E +R+R+R  DR  R        
Sbjct: 91  ERRDRDRDRDRDEKDREKERDKDKERRSRDREKEKEKEKEREREREKDRERR-------- 142

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            + R  RRR   D EE DR+R R+R YRD
Sbjct: 143 SRSRSERRR---DDEERDRERYRERDYRD 168

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 49/148 (33%), Positives = 81/148 (54%), Gaps = 4/148 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           KR+R    RDRD D +++R R      D +++ DR R    +RR R  DRD D EK+R++
Sbjct: 57  KRSRSEENRDRDKDKDRDRHR------DRDKDRDRHRSSR-ERRDRDRDRDRD-EKDREK 108

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
             D D+      R ++ + EKER+R      + E++ +R+     +RR   ++RD +  +
Sbjct: 109 ERDKDKERRSRDREKEKEKEKERER------EREKDRERRSRSRSERRRDDEERDRERYR 162

Query: 90  ERDHR----RRYKDDSEEDDRKRNRDRR 19
           ERD+R    RR K+++ E +    RD+R
Sbjct: 163 ERDYRDRDVRRRKEEAGEPEADPERDQR 190

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 45/133 (33%), Positives = 68/133 (51%)
 Frame = -1

Query: 402 KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRD 223
           +E++R  R +       D +RD +G+RR     +   +E+ RDR  D DR      RHRD
Sbjct: 29  EEKERSSRRRSGGGGGGDEERD-DGERR----SKRSRSEENRDRDKDKDRD-----RHRD 78

Query: 222 DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDD 43
            D +++R R  R      E  DR RDR+ D + R  +RD D E+    R + K+  +E +
Sbjct: 79  RDKDRDRHRSSR------ERRDRDRDRDRDEKDREKERDKDKERRSRDREKEKEKEKERE 132

Query: 42  RKRNRDRRYRDTS 4
           R+R +DR  R  S
Sbjct: 133 REREKDRERRSRS 145

[201][TOP]
>UniRef100_B8ANW8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8ANW8_ORYSI
          Length = 567

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 47/145 (32%), Positives = 80/145 (55%), Gaps = 8/145 (5%)
 Frame = -1

Query: 420 RDDDNEKERDRR---GRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRR 250
           R ++ E+   RR   G   D+  ++ +R+  R+    +R  D+D D ++ RDR  D DR 
Sbjct: 27  RSEEKERSSRRRSGGGGGGDEERDDGERRSKRSRSEENRDRDKDKDRDRHRDRDKDRDRH 86

Query: 249 GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRR 73
               R  RD D +++RD + R K+  +++  R RDR  ++ + +  +R+ + EK+R+ R 
Sbjct: 87  -RSSRERRDRDRDRDRDEKDREKERDKDKERRSRDREKEKEKEKEREREREREKDRERRS 145

Query: 72  RYKD----DSEEDDRKRNRDRRYRD 10
           R +     D EE DR+R R+R YRD
Sbjct: 146 RSRSERRRDDEERDRERYRERDYRD 170

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/148 (34%), Positives = 85/148 (57%), Gaps = 4/148 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           KR+R    RDRD D +++R R      D +++ DR R  + +RR R  DRD D EK+R++
Sbjct: 57  KRSRSEENRDRDKDKDRDRHR------DRDKDRDRHRS-SRERRDRDRDRDRD-EKDREK 108

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
             D D+    ERR RD + EKE+++    + + E++ +R+     +RR   ++RD +  +
Sbjct: 109 ERDKDK----ERRSRDREKEKEKEKEREREREREKDRERRSRSRSERRRDDEERDRERYR 164

Query: 90  ERDHR----RRYKDDSEEDDRKRNRDRR 19
           ERD+R    RR K+++ E +    RD+R
Sbjct: 165 ERDYRDRDVRRRKEEAGEPEADPERDQR 192

[202][TOP]
>UniRef100_UPI0000E49AC7 PREDICTED: similar to Snrp70 protein n=2 Tax=Strongylocentrotus
           purpuratus RepID=UPI0000E49AC7
          Length = 500

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 62/155 (40%), Positives = 84/155 (54%), Gaps = 11/155 (7%)
 Frame = -1

Query: 444 NRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           NR+R R R+R+D+   E DRR R + + + E DR R+R  DR  R D  D  +  +R  R
Sbjct: 218 NREREREREREDE---ESDRRERDEPERDRERDRDRERRRDRGDRGDRGDRGDRGDRGDR 274

Query: 267 GDN-DRRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVD-DRDGDN 97
           G+  +RR  GER  R D   +ER RRG  ++ + + E DR RDR  DR  R D DR    
Sbjct: 275 GERGERRERGERGERGD---RERRRRGENEEREKDPERDRDRDRERDRGGRRDRDRSERG 331

Query: 96  EKERDHRRRYKDDSEED-------DRKRNRDRRYR 13
           E++RD  RR   D + +       DR R+RDR  R
Sbjct: 332 ERDRDRGRREPRDRDRERGERDNKDRDRDRDRGER 366

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 57/148 (38%), Positives = 80/148 (54%), Gaps = 5/148 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDR----KRDRNGDRRHRVDDRDGDNEK 283
           +R RD   RDR+ D ++ER R    + D  +  DR     R   G+RR R  +R    ++
Sbjct: 234 RRERDEPERDRERDRDRERRRDRGDRGDRGDRGDRGDRGDRGERGERRER-GERGERGDR 292

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
           ER RRG+N+ R     R RD D  +ERDR GR   D  E  +R RDR      R + RD 
Sbjct: 293 ERRRRGENEEREKDPERDRDRD--RERDRGGRRDRDRSERGERDRDRG-----RREPRDR 345

Query: 102 DNEK-ERDHRRRYKDDSEEDDRKRNRDR 22
           D E+ ERD++ R + D +  +R+R+RDR
Sbjct: 346 DRERGERDNKDRDR-DRDRGERRRDRDR 372

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 49/139 (35%), Positives = 75/139 (53%), Gaps = 1/139 (0%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R   R   +R +  ++ER RRG   ++ E E D +RDR+ DR     DR G  +++R  
Sbjct: 276 ERGERRERGERGERGDRERRRRG---ENEEREKDPERDRDRDRER---DRGGRRDRDRSE 329

Query: 270 RGDNDRRGNGERRHRDDDNEK-ERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
           RG+ D R  G R  RD D E+ ERD + R +D    E  R RDR+ DR      RD +  
Sbjct: 330 RGERD-RDRGRREPRDRDRERGERDNKDRDRDRDRGERRRDRDRDRDRSQEEGSRD-EGS 387

Query: 93  KERDHRRRYKDDSEEDDRK 37
           ++R+   R +D+  +++RK
Sbjct: 388 RDREEGSRDRDEGRDENRK 406

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 59/166 (35%), Positives = 75/166 (45%), Gaps = 23/166 (13%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDR-----------RGRYKDDSEEEFDRKRDRNGDRRHRVDD 304
           +R+   R R+RD D E+ RDR           RG   D  E    R+R   G+R  R   
Sbjct: 236 ERDEPERDRERDRDRERRRDRGDRGDRGDRGDRGDRGDRGERGERRERGERGERGDRERR 295

Query: 303 RDGDNEK-----ERDRRGDNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEF------ 160
           R G+NE+     ERDR  D +R   G R R R +  E++RDR  R   D + E       
Sbjct: 296 RRGENEEREKDPERDRDRDRERDRGGRRDRDRSERGERDRDRGRREPRDRDRERGERDNK 355

Query: 159 DRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           DR RDR+   R R  DRD D  +E   R     D EE  R R+  R
Sbjct: 356 DRDRDRDRGERRRDRDRDRDRSQEEGSRDEGSRDREEGSRDRDEGR 401

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 59/157 (37%), Positives = 80/157 (50%), Gaps = 20/157 (12%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
           R+  RDD +      R R ++D  EE DR R+R+   R R  DRD +  ++R  RGD   
Sbjct: 208 RHSGRDDPSGNRERERERERED--EESDR-RERDEPERDRERDRDRERRRDRGDRGDRGD 264

Query: 252 RGN----------GERRHRDDDNE---KERDRRGRYKD-DSEEEFDRKRDRNGDRRHRVD 115
           RG+          GERR R +  E   +ER RRG  ++ + + E DR RDR  DR  R D
Sbjct: 265 RGDRGDRGDRGERGERRERGERGERGDRERRRRGENEEREKDPERDRDRDRERDRGGRRD 324

Query: 114 -DRDGDNEKERDHRRRYKDD-----SEEDDRKRNRDR 22
            DR    E++RD  RR   D      E D++ R+RDR
Sbjct: 325 RDRSERGERDRDRGRREPRDRDRERGERDNKDRDRDR 361

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 46/149 (30%), Positives = 79/149 (53%), Gaps = 2/149 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER-D 274
           +R+RDR  R+RD    ++RDR  R + D +      RDR+ +R  R D++D D +++R +
Sbjct: 308 ERDRDRD-RERDRGGRRDRDRSERGERDRDRGRREPRDRDRERGER-DNKDRDRDRDRGE 365

Query: 273 RRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           RR D DR R   +     D+  ++R+   R +D+  +E +RK    G+   + +  D   
Sbjct: 366 RRRDRDRDRDRSQEEGSRDEGSRDREEGSRDRDEGRDE-NRKGQFEGEGMRKGEYGDERG 424

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           E+E +   R K++ E  D   + + RYRD
Sbjct: 425 EQEGEGYNREKEEGEAGDGYGDEENRYRD 453

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 48/137 (35%), Positives = 69/137 (50%), Gaps = 12/137 (8%)
 Frame = -1

Query: 393 DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG--DND-RRGNGERRHRD 223
           D   R+    +   +R+R+R  +R     DR   +E ERDR    D + RR  G+R  R 
Sbjct: 204 DVNSRHSGRDDPSGNREREREREREDEESDRRERDEPERDRERDRDRERRRDRGDRGDRG 263

Query: 222 DDNEK----ERDRRGRYKDDSE--EEFDRKRDRNGDRRHRVDD--RDGDNEKERDH-RRR 70
           D  ++    +R  RG  ++  E  E  DR+R R G+   R  D  RD D ++ERD   RR
Sbjct: 264 DRGDRGDRGDRGERGERRERGERGERGDRERRRRGENEEREKDPERDRDRDRERDRGGRR 323

Query: 69  YKDDSEEDDRKRNRDRR 19
            +D SE  +R R+R RR
Sbjct: 324 DRDRSERGERDRDRGRR 340

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 48/152 (31%), Positives = 66/152 (43%), Gaps = 17/152 (11%)
 Frame = -1

Query: 447 RNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEF------DRKRDRNGDRRHRVDDRDG 295
           R RDR   R RDR +  E++RDR  R   D + E       DR RDR+   R R  DRD 
Sbjct: 315 RERDRGGRRDRDRSERGERDRDRGRREPRDRDRERGERDNKDRDRDRDRGERRRDRDRDR 374

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERD--------RRGRYKDDSEEEFDRKRDRN 139
           D  +E   R +  R      R RD+  ++ R         R+G Y D+  E+     +  
Sbjct: 375 DRSQEEGSRDEGSRDREEGSRDRDEGRDENRKGQFEGEGMRKGEYGDERGEQ-----EGE 429

Query: 138 GDRRHRVDDRDGDNEKERDHRRRYKDDSEEDD 43
           G  R + +   GD     D   RY+D   E+D
Sbjct: 430 GYNREKEEGEAGDG--YGDEENRYRDVKREED 459

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 38/107 (35%), Positives = 59/107 (55%), Gaps = 7/107 (6%)
 Frame = -1

Query: 309 DDRDGDNEKERDRRGDNDRRGNGERRH--RDDDNEKERDRRGRYKDDSEEEFDR-KRDRN 139
           DD  G+ E+ER+R  +++     ER    RD + +++R+RR R + D  +  DR  R   
Sbjct: 213 DDPSGNREREREREREDEESDRRERDEPERDRERDRDRERR-RDRGDRGDRGDRGDRGDR 271

Query: 138 GDRRHRVDDRDGDNEKE---RDHRRRYKDDSEEDDRKRNRDR-RYRD 10
           GDR  R + R+     E   R+ RRR +++  E D +R+RDR R RD
Sbjct: 272 GDRGERGERRERGERGERGDRERRRRGENEEREKDPERDRDRDRERD 318

[203][TOP]
>UniRef100_UPI0000DA3509 PREDICTED: similar to RNA binding motif protein 25 n=1 Tax=Rattus
           norvegicus RepID=UPI0000DA3509
          Length = 816

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 48/158 (30%), Positives = 84/158 (53%), Gaps = 3/158 (1%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 275 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 334

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RH 124
           + EKER+R  + D R     + RD D E++RDR      D E   DR +DR+  R   R 
Sbjct: 335 EKEKERERERERD-RDRDRTKERDRDRERDRDR------DRERSSDRNKDRSRSREKSRD 387

Query: 123 RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           R  +R+ + E+E+D +R  ++D E+   +R  +R+ R+
Sbjct: 388 REREREREREREKDKKRDREEDEEDAYERRKLERKLRE 425

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 52/177 (29%), Positives = 87/177 (49%), Gaps = 28/177 (15%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           +R R+R  R+R+ + E+ER+R    + + E E DR RDR  +R R R  DRD D E+  D
Sbjct: 314 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSD 373

Query: 273 RRGDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK---------------R 148
           R  D  R   +     R R+ + E+E+D++   ++D E+ ++R+               R
Sbjct: 374 RNKDRSRSREKSRDREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQER 433

Query: 147 DRNGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRDTS 4
            +N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR ++
Sbjct: 434 LKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSA 490

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 51/148 (34%), Positives = 79/148 (53%), Gaps = 9/148 (6%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           ++RR R+R+ + E+ER  R R ++   + E+E +R+R+R  DR     DRD   E++RDR
Sbjct: 306 KERRERERERERERERREREREREREREREKEKERERERERDR-----DRDRTKERDRDR 360

Query: 270 RGDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
             D DR   R +   + R    EK RDR    + + E E D+KRDR  D     + R  +
Sbjct: 361 ERDRDRDRERSSDRNKDRSRSREKSRDREREREREREREKDKKRDREEDEEDAYERRKLE 420

Query: 99  ---NEKERDHRRRYKDDSEEDDRKRNRD 25
               EKE  ++ R K + E  +RK+ R+
Sbjct: 421 RKLREKEAAYQERLK-NWEIRERKKTRE 447

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 43/144 (29%), Positives = 79/144 (54%), Gaps = 2/144 (1%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDN 259
           ++  R+R+ + E+ER+RR R     E E +R+R+R  ++  R  +R+ D +++R +  D 
Sbjct: 305 EKERRERERERERERERRER-----EREREREREREKEKE-RERERERDRDRDRTKERDR 358

Query: 258 DRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD-RRHRVDDRDGDNEKER 85
           DR  + +R R R  D  K+R R      D E E +R+R+R  D +R R +D +   E+ +
Sbjct: 359 DRERDRDRDRERSSDRNKDRSRSREKSRDREREREREREREKDKKRDREEDEEDAYERRK 418

Query: 84  DHRRRYKDDSEEDDRKRNRDRRYR 13
             R+  + ++   +R +N + R R
Sbjct: 419 LERKLREKEAAYQERLKNWEIRER 442

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 40/127 (31%), Positives = 67/127 (52%), Gaps = 9/127 (7%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR 196
           ++D  +   R+  +  D   ++++  G  EKER            ERR R+ + E+ER+R
Sbjct: 269 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEI-------EKERRERERERERERER 321

Query: 195 RGRYKD-----DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEED---D 43
           R R ++     + E+E +R+R+R  DR R R  +RD D E++RD  R    D  +D    
Sbjct: 322 REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSRS 381

Query: 42  RKRNRDR 22
           R+++RDR
Sbjct: 382 REKSRDR 388

[204][TOP]
>UniRef100_UPI0000DA3329 PREDICTED: similar to RNA binding motif protein 25 n=1 Tax=Rattus
           norvegicus RepID=UPI0000DA3329
          Length = 676

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 48/158 (30%), Positives = 84/158 (53%), Gaps = 3/158 (1%)
 Frame = -1

Query: 474 MIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +I R++   R+  ++  +     EKER    + + + E E +R+R+R    R R  +R+ 
Sbjct: 275 LISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERERERER 334

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RH 124
           + EKER+R  + D R     + RD D E++RDR      D E   DR +DR+  R   R 
Sbjct: 335 EKEKERERERERD-RDRDRTKERDRDRERDRDR------DRERSSDRNKDRSRSREKSRD 387

Query: 123 RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           R  +R+ + E+E+D +R  ++D E+   +R  +R+ R+
Sbjct: 388 REREREREREREKDKKRDREEDEEDAYERRKLERKLRE 425

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 52/177 (29%), Positives = 87/177 (49%), Gaps = 28/177 (15%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
           +R R+R  R+R+ + E+ER+R    + + E E DR RDR  +R R R  DRD D E+  D
Sbjct: 314 ERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSD 373

Query: 273 RRGDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK---------------R 148
           R  D  R   +     R R+ + E+E+D++   ++D E+ ++R+               R
Sbjct: 374 RNKDRSRSREKSRDREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQER 433

Query: 147 DRNGDRRHRVDDRDGDNEKERDHRR---------RYKDDSEEDDRKRNRDRRYRDTS 4
            +N + R R   R+ + E ER+  R         R K+  E+ D  R+  + YR ++
Sbjct: 434 LKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSA 490

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 51/148 (34%), Positives = 79/148 (53%), Gaps = 9/148 (6%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           ++RR R+R+ + E+ER  R R ++   + E+E +R+R+R  DR     DRD   E++RDR
Sbjct: 306 KERRERERERERERERREREREREREREREKEKERERERERDR-----DRDRTKERDRDR 360

Query: 270 RGDNDR---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
             D DR   R +   + R    EK RDR    + + E E D+KRDR  D     + R  +
Sbjct: 361 ERDRDRDRERSSDRNKDRSRSREKSRDREREREREREREKDKKRDREEDEEDAYERRKLE 420

Query: 99  ---NEKERDHRRRYKDDSEEDDRKRNRD 25
               EKE  ++ R K + E  +RK+ R+
Sbjct: 421 RKLREKEAAYQERLK-NWEIRERKKTRE 447

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 43/144 (29%), Positives = 79/144 (54%), Gaps = 2/144 (1%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDN 259
           ++  R+R+ + E+ER+RR R     E E +R+R+R  ++  R  +R+ D +++R +  D 
Sbjct: 305 EKERRERERERERERERRER-----EREREREREREKEKE-RERERERDRDRDRTKERDR 358

Query: 258 DRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD-RRHRVDDRDGDNEKER 85
           DR  + +R R R  D  K+R R      D E E +R+R+R  D +R R +D +   E+ +
Sbjct: 359 DRERDRDRDRERSSDRNKDRSRSREKSRDREREREREREREKDKKRDREEDEEDAYERRK 418

Query: 84  DHRRRYKDDSEEDDRKRNRDRRYR 13
             R+  + ++   +R +N + R R
Sbjct: 419 LERKLREKEAAYQERLKNWEIRER 442

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 40/127 (31%), Positives = 67/127 (52%), Gaps = 9/127 (7%)
 Frame = -1

Query: 375 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR 196
           ++D  +   R+  +  D   ++++  G  EKER            ERR R+ + E+ER+R
Sbjct: 269 EEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEI-------EKERRERERERERERER 321

Query: 195 RGRYKD-----DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEED---D 43
           R R ++     + E+E +R+R+R  DR R R  +RD D E++RD  R    D  +D    
Sbjct: 322 REREREREREREREKEKERERERERDRDRDRTKERDRDRERDRDRDRERSSDRNKDRSRS 381

Query: 42  RKRNRDR 22
           R+++RDR
Sbjct: 382 REKSRDR 388

[205][TOP]
>UniRef100_UPI0001A2D05E Cell surface A33 antigen precursor (Glycoprotein A33). n=1
           Tax=Danio rerio RepID=UPI0001A2D05E
          Length = 431

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 62/150 (41%), Positives = 80/150 (53%), Gaps = 8/150 (5%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDR-RGRYKD---DSEEEFDRKRDRNGDR---RHRVDDRDGD 292
           K +RD   RD +DD    RD  R RY+D     +E  DR  DR G R   R R +DR G 
Sbjct: 288 KGSRDE-LRDHNDDRRGSRDELRDRYEDRRGSRDELRDRYEDRKGSRDELRDRYEDRRGS 346

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            ++ RDR    DRRG+     RD+  ++  DRRG  +D+  E +D +RD+  DRR   DD
Sbjct: 347 RDELRDRY--EDRRGS-----RDELRDRYEDRRGS-RDELRERYDDRRDQYDDRRDHYDD 398

Query: 111 RDGDNEKERDHRRRYKDDSEE-DDRKRNRD 25
           R G  +  RD   RY D  E  DDRK +RD
Sbjct: 399 RRGSRDDLRD---RYDDRRERYDDRKGSRD 425

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 51/128 (39%), Positives = 59/128 (46%), Gaps = 6/128 (4%)
 Frame = -1

Query: 447 RNRDRR-----YRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 286
           R  DRR      RDR +D +  RD  R RY+D      D  RDR  DRR     RD   +
Sbjct: 311 RYEDRRGSRDELRDRYEDRKGSRDELRDRYEDRRGSR-DELRDRYEDRR---GSRDELRD 366

Query: 285 KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
           +  DRRG  D     E R R DD   + D R  + DD     D  RDR  DRR R DDR 
Sbjct: 367 RYEDRRGSRD-----ELRERYDDRRDQYDDRRDHYDDRRGSRDDLRDRYDDRRERYDDRK 421

Query: 105 GDNEKERD 82
           G  +  RD
Sbjct: 422 GSRDDLRD 429

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 55/152 (36%), Positives = 76/152 (50%), Gaps = 13/152 (8%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
           R R+ + +  + + E D  G  +DD     + K  R+  R H  DDR G  ++ RDR   
Sbjct: 256 RKRKQKQKLKEYQMEYDDSGSGRDDFRGRENHKGSRDELRDHN-DDRRGSRDELRDRY-- 312

Query: 261 NDRRGN-GERRHRDDDNEKERDR-RGRYKD---DSEEEFDRKRDRNGDR---RHRVDDRD 106
            DRRG+  E R R +D +  RD  R RY+D     +E  DR  DR G R   R R +DR 
Sbjct: 313 EDRRGSRDELRDRYEDRKGSRDELRDRYEDRRGSRDELRDRYEDRRGSRDELRDRYEDRR 372

Query: 105 GDNEKER---DHRRRYKDDSEE--DDRKRNRD 25
           G  ++ R   D RR   DD  +  DDR+ +RD
Sbjct: 373 GSRDELRERYDDRRDQYDDRRDHYDDRRGSRD 404

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 37/107 (34%), Positives = 50/107 (46%), Gaps = 3/107 (2%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGDNEKERDRRGD 262
           RY DR    ++ RDR    +   +E  DR  DR G R   R R +DR G  ++ R+R  D
Sbjct: 325 RYEDRKGSRDELRDRYEDRRGSRDELRDRYEDRRGSRDELRDRYEDRRGSRDELRERYDD 384

Query: 261 NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHR 121
              + +  R H DD      D R RY DD  E +D ++    D R R
Sbjct: 385 RRDQYDDRRDHYDDRRGSRDDLRDRY-DDRRERYDDRKGSRDDLRDR 430

[206][TOP]
>UniRef100_B8AJ67 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8AJ67_ORYSI
          Length = 548

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 55/141 (39%), Positives = 70/141 (49%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRG 247
           + RD D E+E+D+      D E   DR RDR  DR     DRD D EK+RD+  D DR  
Sbjct: 30  KPRDKDREREKDK------DRERHRDRDRDRGRDR-----DRDKDKEKDRDKERDRDR-- 76

Query: 246 NGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRY 67
                    D +K+RDR  R+  +  E  DR  D +   RHR  D +   + ERD RRR+
Sbjct: 77  ---------DRDKDRDRHHRHHRERREHRDRSDDHD---RHRSRDSERRRDHERDGRRRH 124

Query: 66  KDDSEEDDRKRNRDRRYRDTS 4
           +  S    R R RDRR R  S
Sbjct: 125 R--SRSRSRSRGRDRRSRSRS 143

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 51/138 (36%), Positives = 73/138 (52%), Gaps = 6/138 (4%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR---RGRYKD---DSEEEFDRKRDRNGDRRHRVDDRDGDNE 286
           R++DR  R++D D E+ RDR   RGR +D   D E++ D++RDR         DRD D +
Sbjct: 32  RDKDRE-REKDKDRERHRDRDRDRGRDRDRDKDKEKDRDKERDR---------DRDRDKD 81

Query: 285 KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
           ++R  R   +RR   E R R DD+++ R R      DSE   D +RD  G RRHR   R 
Sbjct: 82  RDRHHRHHRERR---EHRDRSDDHDRHRSR------DSERRRDHERD--GRRRHRSRSRS 130

Query: 105 GDNEKERDHRRRYKDDSE 52
               ++R  R R +  S+
Sbjct: 131 RSRGRDRRSRSRSRSKSK 148

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 41/120 (34%), Positives = 58/120 (48%)
 Frame = -1

Query: 372 DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRR 193
           D    E D     +G  + R  DR+ + +K+R+R  D DR   G  R RD D EK+RD+ 
Sbjct: 13  DGGRPEGDTHSREDGLSKPRDKDREREKDKDRERHRDRDR-DRGRDRDRDKDKEKDRDK- 70

Query: 192 GRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
                  E + DR RD++ DR HR              RR ++D S++ DR R+RD   R
Sbjct: 71  -------ERDRDRDRDKDRDRHHR----------HHRERREHRDRSDDHDRHRSRDSERR 113

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 31/96 (32%), Positives = 48/96 (50%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +++RD+  RDRD D +K+RDR  R+  +  E  DR            DD D    ++ +R
Sbjct: 65  EKDRDKE-RDRDRDRDKDRDRHHRHHRERREHRDRS-----------DDHDRHRSRDSER 112

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEE 163
           R D++R G    R R     + RDRR R +  S+ +
Sbjct: 113 RRDHERDGRRRHRSRSRSRSRGRDRRSRSRSRSKSK 148

[207][TOP]
>UniRef100_A9XLF0 Putative uncharacterized protein n=1 Tax=Petunia integrifolia
           subsp. inflata RepID=A9XLF0_PETIN
          Length = 557

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 57/142 (40%), Positives = 72/142 (50%), Gaps = 3/142 (2%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           D + +    D+EKERD  R R K+ +   + DR RDRN DR     DRD D  KERDR  
Sbjct: 21  DSKSQHPSRDHEKERDSSRSREKEREKGRDKDRDRDRNRDR-----DRDRDRGKERDRDR 75

Query: 264 DNDRRGNGER-RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
           D DR    +R RH  D +    DRR R +    +E D  R R+ DRR     RD D ++E
Sbjct: 76  DRDREREKDRDRHHRDRHRDRSDRRERERTRDRDEDDLSRSRDYDRR-----RDTDKDRE 130

Query: 87  RDHRRRYKDDSEEDDRKRNRDR 22
             HR R    S  + R R+R R
Sbjct: 131 DRHRHRPSSRSRSEHRSRSRSR 152

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 42/100 (42%), Positives = 58/100 (58%), Gaps = 4/100 (4%)
 Frame = -1

Query: 294 DNEKERDR-RGDNDRRGNGERRHRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDRRH 124
           D+EKERD  R     R  G  + RD D  ++RDR R R K+ D + + DR+R+++ DR H
Sbjct: 30  DHEKERDSSRSREKEREKGRDKDRDRDRNRDRDRDRDRGKERDRDRDRDREREKDRDRHH 89

Query: 123 RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD-RRYRDT 7
           R   RD  + +ER+  R    D +EDD  R+RD  R RDT
Sbjct: 90  RDRHRDRSDRRERERTR----DRDEDDLSRSRDYDRRRDT 125

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 39/95 (41%), Positives = 54/95 (56%), Gaps = 4/95 (4%)
 Frame = -1

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKD-DSEEEFDRKRDRN-GDRRHRVDDRDG 103
           D +  +  R + + R      EKER++ GR KD D +   DR RDR+ G  R R  DRD 
Sbjct: 21  DSKSQHPSRDHEKERDSSRSREKEREK-GRDKDRDRDRNRDRDRDRDRGKERDRDRDRDR 79

Query: 102 DNEKERD--HRRRYKDDSEEDDRKRNRDRRYRDTS 4
           + EK+RD  HR R++D S+  +R+R RDR   D S
Sbjct: 80  EREKDRDRHHRDRHRDRSDRRERERTRDRDEDDLS 114

[208][TOP]
>UniRef100_Q54RW5 RNA-binding region RNP-1 domain-containing protein n=1
            Tax=Dictyostelium discoideum RepID=Q54RW5_DICDI
          Length = 952

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 63/191 (32%), Positives = 83/191 (43%), Gaps = 47/191 (24%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG-DRRHRVDDRD-------- 298
            KR RD    +R+ + ++ERDR  R +DD +   DR RDR+  DRR R  DRD        
Sbjct: 496  KRKRDDDVDERERERDRERDRERRERDDYDNRRDRDRDRDDYDRRDRDRDRDDHDSGSSR 555

Query: 297  --------GDNEKERDRRGDNDRRGNGERRHRD--------------------DDNEKER 202
                    G+N   R  R D+D  G+  RR RD                    D N    
Sbjct: 556  RDRDDHDSGNNSSNRRDRDDHD-SGSSNRRDRDDHDSGSSSNSGSSRRDRDDHDSNSNSS 614

Query: 201  DRRGRYKDDSEEEFDRKRDRNGD--------RRHRVDDRDGDNEKERDHRRRYKD--DSE 52
             RR R +DD +     +RDR+ D        RR R  DRD + +++R   RR +   D E
Sbjct: 615  SRRDRDRDDHDSSSSSRRDRDRDDHDSSSSSRRDRDRDRDRERDRDRSSDRRSESTRDKE 674

Query: 51   EDDRKRNRDRR 19
             DDR  NR  R
Sbjct: 675  RDDRSDNRSSR 685

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 50/152 (32%), Positives = 64/152 (42%), Gaps = 6/152 (3%)
 Frame = -1

Query: 441  RDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
            RDR   D    +     RR R   DS      +RDR  DR    DD D  +   RDR  D
Sbjct: 584  RDRDDHDSGSSSNSGSSRRDRDDHDSNSNSSSRRDR--DR----DDHDSSSSSRRDRDRD 637

Query: 261  NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 82
            +    +  RR RD D ++ERDR       SE   D++RD   D R   D  D D+ ++R+
Sbjct: 638  DHDSSSSSRRDRDRDRDRERDRDRSSDRRSESTRDKERDDRSDNRSSRDHYDRDSTRDRE 697

Query: 81   ------HRRRYKDDSEEDDRKRNRDRRYRDTS 4
                    +R  D         NRDR  RD S
Sbjct: 698  TSSSSGSGKRENDSYPSSKSDSNRDRENRDYS 729

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 40/142 (28%), Positives = 57/142 (40%), Gaps = 4/142 (2%)
 Frame = -1

Query: 435  RRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD----DRDGDNEKERDRR 268
            RR RD  D N     RR R +DD +     +RDR+ D          DRD D ++ERDR 
Sbjct: 601  RRDRDDHDSNSNSSSRRDRDRDDHDSSSSSRRDRDRDDHDSSSSSRRDRDRDRDRERDRD 660

Query: 267  GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
              +DRR    R    DD    R  R  Y  DS  + +        +R         ++  
Sbjct: 661  RSSDRRSESTRDKERDDRSDNRSSRDHYDRDSTRDRETSSSSGSGKRENDSYPSSKSDSN 720

Query: 87   RDHRRRYKDDSEEDDRKRNRDR 22
            RD   R    +    ++ ++DR
Sbjct: 721  RDRENRDYSSTTSGSKRESKDR 742

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 50/136 (36%), Positives = 69/136 (50%), Gaps = 10/136 (7%)
 Frame = -1

Query: 381 RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR-RGDNDRRGNGERRHRDDDNEKE 205
           R +DD  +E +R+RDR  DR  R  D D DN ++RDR R D DRR   +R    DD++  
Sbjct: 497 RKRDDDVDERERERDRERDRERRERD-DYDNRRDRDRDRDDYDRR---DRDRDRDDHDSG 552

Query: 204 RDRRGRYKDDSEEEFDRKRDR------NGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDD 43
             RR R   DS      +RDR      + +RR R DD D  +       RR +DD + + 
Sbjct: 553 SSRRDRDDHDSGNNSSNRRDRDDHDSGSSNRRDR-DDHDSGSSSNSGSSRRDRDDHDSNS 611

Query: 42  R---KRNRDRRYRDTS 4
               +R+RDR   D+S
Sbjct: 612 NSSSRRDRDRDDHDSS 627

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 58/169 (34%), Positives = 74/169 (43%), Gaps = 25/169 (14%)
 Frame = -1

Query: 435  RRYRDRDDDNEKERDRRGRYKDD--SEEEFDRKRDRNGDR---RHRVDDR--DGDNEKER 277
            RR RDRDD +     RR R +DD  S     R RDR+ DR   R R  DR  +   +KER
Sbjct: 616  RRDRDRDDHDSSSSSRRDRDRDDHDSSSSSRRDRDRDRDRERDRDRSSDRRSESTRDKER 675

Query: 276  DRRGDNDRRGNGERRHRDDDNEKERD---RRGRYKDDSEEEFDRKRDRNGDRRHR----- 121
            D R DN       R H D D+ ++R+     G  K +++     K D N DR +R     
Sbjct: 676  DDRSDN----RSSRDHYDRDSTRDRETSSSSGSGKRENDSYPSSKSDSNRDRENRDYSST 731

Query: 120  -------VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR---RYRDTS 4
                     DR  D+ +     R+  D S       NRDR   R RDTS
Sbjct: 732  TSGSKRESKDRASDSNQSSSGGRKDSDHSYSSSGSGNRDRDRDRDRDTS 780

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 53/155 (34%), Positives = 67/155 (43%), Gaps = 19/155 (12%)
 Frame = -1

Query: 411 DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-------DRDGDNEKERDRRGDNDR 253
           D   E+ +R    D+ E E DR+RDR  +RR R D       DRD D+   RDR  D D 
Sbjct: 491 DYHGEKRKRDDDVDERERERDRERDR--ERRERDDYDNRRDRDRDRDDYDRRDRDRDRDD 548

Query: 252 RGNG-ERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN-----------GDRRHRVDDR 109
             +G  RR RDD +        R +DD +     +RDR+             RR R D  
Sbjct: 549 HDSGSSRRDRDDHDSGNNSSNRRDRDDHDSGSSNRRDRDDHDSGSSSNSGSSRRDRDDHD 608

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
              N   R  R R   DS    R R+RDR   D+S
Sbjct: 609 SNSNSSSRRDRDRDDHDSSSSSR-RDRDRDDHDSS 642

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 45/166 (27%), Positives = 68/166 (40%), Gaps = 17/166 (10%)
 Frame = -1

Query: 450  KRNRDR--------RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD--DR 301
            +R+RDR          RDRD D ++ERDR       SE   D++RD   D R   D  DR
Sbjct: 631  RRDRDRDDHDSSSSSRRDRDRDRDRERDRDRSSDRRSESTRDKERDDRSDNRSSRDHYDR 690

Query: 300  DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRR-------GRYKDDSEEEFDRKRDR 142
            D   ++E      + +R N        D+ ++R+ R       G  ++  +   D  +  
Sbjct: 691  DSTRDRETSSSSGSGKRENDSYPSSKSDSNRDRENRDYSSTTSGSKRESKDRASDSNQSS 750

Query: 141  NGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            +G R+             RD  R    D+  + RK   D R RD+S
Sbjct: 751  SGGRKDSDHSYSSSGSGNRDRDRDRDRDTSSNARKETSDNRDRDSS 796

[209][TOP]
>UniRef100_Q1JSF7 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii RH
           RepID=Q1JSF7_TOXGO
          Length = 928

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 61/161 (37%), Positives = 91/161 (56%), Gaps = 15/161 (9%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERD-RRGRYKDDSEEEFDRKR-DRNGDRRHRVDDRDGDNEKERDR-- 271
           +RR R+R D  ++ERD RRGR KD+ E   DR+R +R G  R   +DR+    + R+R  
Sbjct: 426 ERRGRERVDSEDRERDDRRGRGKDELE---DRERGERRGRERVDSEDRERGERRGRERVD 482

Query: 270 ---RGDNDRRGNGERRHRDDDNEKER-DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
              R  +DRRG G    +D+  ++ER +RRGR +DDSE+    + DR G RR   +DR  
Sbjct: 483 SEDRERDDRRGGG----KDELEDRERGERRGRERDDSEDR--ERNDRRGRRRDESEDR-- 534

Query: 102 DNEKERDHRRRYKDDSEEDDRKR-------NRDRRYRDTSC 1
           +  + R  RR   +D+E DDR++       ++ R  RD+ C
Sbjct: 535 ERGERRGRRRDDFEDTERDDRRKGERDLSMDKGRDQRDSRC 575

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 56/142 (39%), Positives = 81/142 (57%), Gaps = 4/142 (2%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKER-DRRGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNEKERDRRG 265
           +RR R+R D  ++ER +RRGR + DSE   DR+RD R G  +  ++DR+    + R+R  
Sbjct: 458 ERRGRERVDSEDRERGERRGRERVDSE---DRERDDRRGGGKDELEDRERGERRGRERDD 514

Query: 264 DNDRRGNGER-RHRDDDNEKER-DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
             DR  N  R R RD+  ++ER +RRGR +DD E   D +RD   DRR    +RD   +K
Sbjct: 515 SEDRERNDRRGRRRDESEDRERGERRGRRRDDFE---DTERD---DRRK--GERDLSMDK 566

Query: 90  ERDHRRRYKDDSEEDDRKRNRD 25
            RD R       E ++++R RD
Sbjct: 567 GRDQRDSRCVSEEREEKRRGRD 588

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 71/188 (37%), Positives = 102/188 (54%), Gaps = 30/188 (15%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRD-RRYRDRDDDNEKERD-RRGRYKDDS-----EEE---------FDR 346
           R+ +R +   R RD R+ R RDD  ++ER+ +R R +D S     EEE          DR
Sbjct: 154 RVGRRSISIDRERDDRKGRRRDDSEDREREAKRERRRDISIDREREEETRVGRRSISIDR 213

Query: 345 KRD-RNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGE----RRHRDDDNEKERDRRGRYK 181
           +RD R G +R   +DR+ + ++ER R    DR    E    RR    D E+E DR+GR +
Sbjct: 214 ERDDRKGRKRDDSEDREREVKRERRRDISVDREREEETRVGRRSISIDRERE-DRKGRRR 272

Query: 180 DDSEE-----EFDRKRDRNGDRRH---RVDDRDGDNEKERDHRR-RYKDDSEEDDRKRNR 28
           DDSE+     +  R+RD + DR     RV  R    ++ERD R+ R +DDSE+ +R+  R
Sbjct: 273 DDSEDREREVKRGRRRDISVDREREETRVGRRSISIDRERDDRKGRRRDDSEDREREAKR 332

Query: 27  DRRYRDTS 4
           +RR RD S
Sbjct: 333 ERR-RDIS 339

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 69/202 (34%), Positives = 102/202 (50%), Gaps = 46/202 (22%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRD-RRYRDRDDDNEKERD-RRGRYKD---DSEEE----------FDRK 343
           R+ +R +   R RD R+ R RDD  ++ER+ +R R +D   D E E           DR+
Sbjct: 348 RVGRRSISIDRERDDRKGRRRDDSEDREREAKRERRRDISVDREREETRVGRRSISIDRE 407

Query: 342 R-DRNGDRRHRVDDRDGDNEKERDR-----RGDNDRRG----------NGERRHRD--DD 217
           R DR G R+  ++DR+    + R+R     R  +DRRG           GERR R+  D 
Sbjct: 408 RDDRRGRRKDELEDRERGERRGRERVDSEDRERDDRRGRGKDELEDRERGERRGRERVDS 467

Query: 216 NEKER-DRRGRYKDDSEEEFDRKR-DRNGDRRHRVDDR-----------DGDNEKERDHR 76
            ++ER +RRGR + DSE   DR+R DR G  +  ++DR           D ++ +  D R
Sbjct: 468 EDRERGERRGRERVDSE---DRERDDRRGGGKDELEDRERGERRGRERDDSEDRERNDRR 524

Query: 75  RRYKDDSEEDDRKRNRDRRYRD 10
            R +D+SE+ +R   R RR  D
Sbjct: 525 GRRRDESEDRERGERRGRRRDD 546

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 63/194 (32%), Positives = 92/194 (47%), Gaps = 46/194 (23%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERD-RRGRYKDDSEE-----EFDRKRDRNGDRRHRVD------- 307
           R  + R   R    ++ERD R+GR +DDSE+     + +R+RD + DR    +       
Sbjct: 100 REEETRVGRRSISIDRERDDRKGRKRDDSEDREREVKRERRRDISVDREREEETRVGRRS 159

Query: 306 ---DRDGDNEKERDRRGDNDRRGNGERRHRDD---DNEKER----------------DRR 193
              DR+ D+ K R R    DR    +R  R D   D E+E                 DR+
Sbjct: 160 ISIDRERDDRKGRRRDDSEDREREAKRERRRDISIDREREEETRVGRRSISIDRERDDRK 219

Query: 192 GRYKDDSEE-----EFDRKRDRNGDRRHRVDDRDG------DNEKERDHRRRYKDDSEED 46
           GR +DDSE+     + +R+RD + DR    + R G      D E+E D + R +DDSE+ 
Sbjct: 220 GRKRDDSEDREREVKRERRRDISVDREREEETRVGRRSISIDRERE-DRKGRRRDDSEDR 278

Query: 45  DRKRNRDRRYRDTS 4
           +R+  R RR RD S
Sbjct: 279 EREVKRGRR-RDIS 291

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 64/172 (37%), Positives = 89/172 (51%), Gaps = 21/172 (12%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRD-RRYRDRDDDNEKERD-RRGRYKDDS-----EEE---------FDR 346
           R+ +R +   R RD R+ R RDD  ++ER+ +R R +D S     EEE          DR
Sbjct: 105 RVGRRSISIDRERDDRKGRKRDDSEDREREVKRERRRDISVDREREEETRVGRRSISIDR 164

Query: 345 KRD-RNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERR--HRDDDNEKERD-RRGRYKD 178
           +RD R G RR   +DR+ + ++ER R    DR    E R   R    ++ERD R+GR +D
Sbjct: 165 ERDDRKGRRRDDSEDREREAKRERRRDISIDREREEETRVGRRSISIDRERDDRKGRKRD 224

Query: 177 DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRK-RNRD 25
           DSE   DR+R+   +RR  +       E+ R  RR    D E +DRK R RD
Sbjct: 225 DSE---DREREVKRERRRDISVDREREEETRVGRRSISIDREREDRKGRRRD 273

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 56/154 (36%), Positives = 83/154 (53%), Gaps = 14/154 (9%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKER-DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD 262
           +RR R+RDD  ++ER DRRGR +D+SE   DR+R   G+RR R  D   D E++  R+G+
Sbjct: 506 ERRGRERDDSEDRERNDRRGRRRDESE---DRER---GERRGRRRDDFEDTERDDRRKGE 559

Query: 261 NDR---RGNGERRHRDDDNEKERDRRG------RYKDDSEEEFDRKR-DRNGDRRHRVDD 112
            D    +G  +R  R    E+E  RRG      R ++++   F R+R D+  D R   DD
Sbjct: 560 RDLSMDKGRDQRDSRCVSEEREEKRRGRDVSIDREREEALTSFKRRRMDKASDER---DD 616

Query: 111 RDGDNEKERDHRRRYKDDSEEDDR---KRNRDRR 19
           R   ++  R  RRR +D    D +   +R R+ R
Sbjct: 617 RRSPSQ-SRGQRRRERDWEAADSKIGGERGREER 649

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 57/163 (34%), Positives = 84/163 (51%), Gaps = 20/163 (12%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERD-RRGRYKDDSEEEFDRKR-DRNGDRRHRVDDRDGDNEKERDRRG 265
           +RR R+R D  ++ERD RRG  KD+ E   DR+R +R G  R   +DR+ ++ + R RR 
Sbjct: 474 ERRGRERVDSEDRERDDRRGGGKDELE---DRERGERRGRERDDSEDRERNDRRGR-RRD 529

Query: 264 DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDG--- 103
           +++ R  GERR R  D+ ++ +R  R K + +   D+ RD+   R     R + R G   
Sbjct: 530 ESEDRERGERRGRRRDDFEDTERDDRRKGERDLSMDKGRDQRDSRCVSEEREEKRRGRDV 589

Query: 102 --DNEKER-----DHRRRYKDDSEEDDRK-----RNRDRRYRD 10
             D E+E        RR  K   E DDR+     R + RR RD
Sbjct: 590 SIDREREEALTSFKRRRMDKASDERDDRRSPSQSRGQRRRERD 632

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 56/155 (36%), Positives = 82/155 (52%), Gaps = 6/155 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKER-DRRGRYKDDSEE-EFDRKRDRNGD---RRHRVDDRDGDNE 286
           +R  + R   R    ++ER DR+GR +DDSE+ E + KR R  D    R R + R G   
Sbjct: 246 EREEETRVGRRSISIDREREDRKGRRRDDSEDREREVKRGRRRDISVDREREETRVGRRS 305

Query: 285 KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
              DR  D DR+G    R RDD  ++ER+ +   + D   + +R+  R G R   +D   
Sbjct: 306 ISIDRERD-DRKG----RRRDDSEDREREAKRERRRDISVDREREETRVGRRSISID--- 357

Query: 105 GDNEKERDHRR-RYKDDSEEDDRKRNRDRRYRDTS 4
               +ERD R+ R +DDSE+ +R+  R+RR RD S
Sbjct: 358 ----RERDDRKGRRRDDSEDREREAKRERR-RDIS 387

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 70/218 (32%), Positives = 101/218 (46%), Gaps = 58/218 (26%)
 Frame = -1

Query: 486 VGIRMIQRKMIWKRNRDRRYRDRDDDNEKERD-RRGRYKD---DSEEE----------FD 349
           VG R I    I +   DR+ R RDD  ++ER+ +RGR +D   D E E           D
Sbjct: 253 VGRRSIS---IDREREDRKGRRRDDSEDREREVKRGRRRDISVDREREETRVGRRSISID 309

Query: 348 RKRD-RNGDRRHRVDDRDGDNEKERDRRGDNDR-----------------RGNGERRHRD 223
           R+RD R G RR   +DR+ + ++ER R    DR                 R + + R RD
Sbjct: 310 RERDDRKGRRRDDSEDREREAKRERRRDISVDREREETRVGRRSISIDRERDDRKGRRRD 369

Query: 222 DDNEKERD-RRGRYKD---DSEEE----------FDRKR-DRNGDRRHRVDDRD------ 106
           D  ++ER+ +R R +D   D E E           DR+R DR G R+  ++DR+      
Sbjct: 370 DSEDREREAKRERRRDISVDREREETRVGRRSISIDRERDDRRGRRKDELEDRERGERRG 429

Query: 105 ----GDNEKERDHRR-RYKDDSEEDDRKRNRDRRYRDT 7
                  ++ERD RR R KD+ E+ +R   R R   D+
Sbjct: 430 RERVDSEDRERDDRRGRGKDELEDRERGERRGRERVDS 467

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 57/182 (31%), Positives = 90/182 (49%), Gaps = 24/182 (13%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
           R+  R    +R   R  ++R D       R  R   D+ EE  R   R+       DDR 
Sbjct: 65  RLSSRSPSLRREERREEKNRQDSLSPGAAREER---DAREEETRVGRRSISIDRERDDRK 121

Query: 297 G---DNEKERDRRGDNDRRGN-GERRHRDDDN---------EKER-DRRGRYKDDSEE-- 166
           G   D+ ++R+R    +RR +    R R+++          ++ER DR+GR +DDSE+  
Sbjct: 122 GRKRDDSEDREREVKRERRRDISVDREREEETRVGRRSISIDRERDDRKGRRRDDSEDRE 181

Query: 165 ---EFDRKRDRNGDRRHRVDDRDGDN----EKERDHRR-RYKDDSEEDDRKRNRDRRYRD 10
              + +R+RD + DR    + R G      ++ERD R+ R +DDSE+ +R+  R+RR RD
Sbjct: 182 REAKRERRRDISIDREREEETRVGRRSISIDRERDDRKGRKRDDSEDREREVKRERR-RD 240

Query: 9   TS 4
            S
Sbjct: 241 IS 242

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 53/161 (32%), Positives = 75/161 (46%), Gaps = 13/161 (8%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDRRGRYKDDSEEE-----FDRKRDRNGDRRHRV-DDRDGDNE 286
            R   R  R   D+  K   RR R  D           DR R+  G RR  +  DRD  + 
Sbjct: 670  RREAREERREKDERRKLSPRRNREVDSDRRRETSLSSDRFREDRGGRRETIRGDRDA-SP 728

Query: 285  KERDRRGDNDRRGNGERRHRDDDNEKER--DRRGRYKDDSE--EEFDRKRDRNGDRRHRV 118
            +   RR   +R    ERR RDD +E ER  +RRGR ++D E  EE + +R+R  + R R 
Sbjct: 729  RIHSRRKFEERE---ERRDRDDRDEDERRDERRGRDREDRETREEREERRERE-EMRERE 784

Query: 117  DDRDGDNEKERDHRRRYKDDSEEDD---RKRNRDRRYRDTS 4
            + R        + RR ++D+ E  +   R+R R+   RD S
Sbjct: 785  ERRPLRRLTAHERRRSFEDEREPPEPVRRERKRNSSDRDES 825

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 51/168 (30%), Positives = 76/168 (45%), Gaps = 21/168 (12%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKER-DRRGRYKDDSEEEFDRKRDRNGDR-------RHRVDDRDG 295
            +   DRR R RD+  ++ER +RRGR +DD E+  +R   R G+R       R + D R  
Sbjct: 518  RERNDRRGRRRDESEDRERGERRGRRRDDFEDT-ERDDRRKGERDLSMDKGRDQRDSRCV 576

Query: 294  DNEKERDRRG-----DNDRRG--NGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
              E+E  RRG     D +R       +R R D    ERD R   +  S+    R+R+R+ 
Sbjct: 577  SEEREEKRRGRDVSIDREREEALTSFKRRRMDKASDERDDR---RSPSQSRGQRRRERDW 633

Query: 135  DRR-HRVDDRDGDNEK-----ERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            +    ++    G  E+     ERD RR          R+   +RR +D
Sbjct: 634  EAADSKIGGERGREERKMRPEERDERRSVSSQRSLGRREAREERREKD 681

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 49/179 (27%), Positives = 77/179 (43%), Gaps = 32/179 (17%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRK----RDRNGDRRHRVDDRD----- 298
            +R  D+   +RDD     + R  R ++   E  D K    R R  +R+ R ++RD     
Sbjct: 604  RRRMDKASDERDDRRSPSQSRGQRRRERDWEAADSKIGGERGRE-ERKMRPEERDERRSV 662

Query: 297  ------GDNEKERDRRGDNDRRGNGERRHRDDDNEKER-----------DRRGRY----- 184
                  G  E   +RR  ++RR    RR+R+ D+++ R           DR GR      
Sbjct: 663  SSQRSLGRREAREERREKDERRKLSPRRNREVDSDRRRETSLSSDRFREDRGGRRETIRG 722

Query: 183  -KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             +D S     R++    + R   DDRD D   ER   RR +D  + + R+   +RR R+
Sbjct: 723  DRDASPRIHSRRKFEEREERRDRDDRDED---ERRDERRGRDREDRETREEREERRERE 778

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 57/211 (27%), Positives = 84/211 (39%), Gaps = 57/211 (27%)
 Frame = -1

Query: 468  QRKMIWKRNRDRRYRDRDDDNEKERDRRG------RYKDDSEEEFDRKR-----DRNGDR 322
            +R +   + RD+R   R    E+E  RRG      R ++++   F R+R     D   DR
Sbjct: 559  ERDLSMDKGRDQR-DSRCVSEEREEKRRGRDVSIDREREEALTSFKRRRMDKASDERDDR 617

Query: 321  RHRVDDRDGDNEKERD--------------------------RRGDNDRRGNGERRHRDD 220
            R     R G   +ERD                          RR  + +R  G R  R++
Sbjct: 618  RSPSQSR-GQRRRERDWEAADSKIGGERGREERKMRPEERDERRSVSSQRSLGRREAREE 676

Query: 219  DNEKERDRRGRYKDDSEEEFDRKR-----------DRNGDRRHRVDDRDGD------NEK 91
              EK+  R+   + + E + DR+R           DR G R     DRD         + 
Sbjct: 677  RREKDERRKLSPRRNREVDSDRRRETSLSSDRFREDRGGRRETIRGDRDASPRIHSRRKF 736

Query: 90   ERDHRRRYKDDSEEDDR---KRNRDRRYRDT 7
            E    RR +DD +ED+R   +R RDR  R+T
Sbjct: 737  EEREERRDRDDRDEDERRDERRGRDREDRET 767

[210][TOP]
>UniRef100_B4Q668 GD23040 n=1 Tax=Drosophila simulans RepID=B4Q668_DROSI
          Length = 783

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/157 (25%), Positives = 85/157 (54%), Gaps = 7/157 (4%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRD--RNGDRRHRVDDRDG 295
           +RK   KR  + R ++ + + E+ER+   R +++ ++E +RKR+  R  ++R R ++ + 
Sbjct: 316 RRKTEEKRKEEERRKEEEREREREREEEKRREEERKKEVERKREEERRKEKRRREEEEEE 375

Query: 294 DNEKERDRRGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
           +  KE +RR + ++R   ER     R R++   +E +   R ++    E  R+R+   + 
Sbjct: 376 ERRKEEERRKEEEKRKEEERRREEKRRREEQRRREEEEERRKEEKRRREEQRRREEEEEE 435

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
             R ++   + E+ ++ RRR +    E++R+R  +RR
Sbjct: 436 ERRKEEERKEEERRKEKRRREEKRRREEERRREEERR 472

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 37/158 (23%), Positives = 84/158 (53%), Gaps = 5/158 (3%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +R+   +R ++ + ++ +   E+ER R    + D E + + KR R  +R+   + R+ + 
Sbjct: 487 ERRKEEERRKEAKRKEEERRREEERRREEERRRDEERKREEKRKREEERKREEERREQER 546

Query: 288 EKERDRRGDNDRRGNGER-----RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
            +E +RR + +RR   ER     R R+++  KE ++R   +   EEE  R+ ++  +   
Sbjct: 547 RREEERRREEERRKEQERRREEERRREEERRKEEEKRRAEEKRREEEKRREEEKRKEEER 606

Query: 123 RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           R ++R  + E+ R+  +R K++  +++ ++  + R R+
Sbjct: 607 REEERRREEERRREEAKRKKEEKRKEEERKKEEERKRE 644

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 38/151 (25%), Positives = 87/151 (57%)
 Frame = -1

Query: 471 IQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           ++RK   +R +++R R+ +++ E+ ++   R +++  +E +R+R+   ++R R + R   
Sbjct: 354 VERKREEERRKEKRRREEEEEEERRKEEERRKEEEKRKEEERRRE---EKRRREEQRR-- 408

Query: 291 NEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
            E+E +RR +  RR   +RR  +++ E+ R    R     EEE  +++ R  ++R R ++
Sbjct: 409 REEEEERRKEEKRRREEQRRREEEEEEERRKEEER----KEEERRKEKRRREEKRRREEE 464

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           R  + E+  + RR  ++  +E++R++  +RR
Sbjct: 465 RRREEERREEERREEEEKRKEEERRKEEERR 495

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 41/152 (26%), Positives = 81/152 (53%), Gaps = 2/152 (1%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNE--KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 295
           +RK   +R  ++R R+ +++ E  KE +R+   +   +   + KR R  +RR   + R+ 
Sbjct: 415 RRKEEKRRREEQRRREEEEEEERRKEEERKEEERRKEKRRREEKRRREEERRREEERREE 474

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
           +  +E ++R + +RR   ERR      E+ER R    + + E   D +R R  ++R R +
Sbjct: 475 ERREEEEKRKEEERRKEEERRKEAKRKEEERRREEERRREEERRRDEERKRE-EKRKREE 533

Query: 114 DRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           +R  + E+    RRR ++   E++R++ ++RR
Sbjct: 534 ERKREEERREQERRREEERRREEERRKEQERR 565

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 42/157 (26%), Positives = 84/157 (53%), Gaps = 7/157 (4%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +R+   KR  + R R+ +   E+ER R    K + + + + +R R  +RR +   R+ + 
Sbjct: 493 ERRKEAKRKEEERRREEERRREEERRRDEERKREEKRKREEERKREEERREQERRREEER 552

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
            +E +RR + +RR   ERR R+++  KE ++R   +   EEE  R+ ++  +   R ++R
Sbjct: 553 RREEERRKEQERRREEERR-REEERRKEEEKRRAEEKRREEEKRREEEKRKEEERREEER 611

Query: 108 DGDNEKERDHRRRYKDDS-------EEDDRKRNRDRR 19
             + E+ R+  +R K++        +E++RKR  ++R
Sbjct: 612 RREEERRREEAKRKKEEKRKEEERKKEEERKREEEKR 648

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 44/157 (28%), Positives = 82/157 (52%), Gaps = 4/157 (2%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +RK   +R  ++R R+     E+E +RR   K   EE+  R+ +   +RR   + ++ + 
Sbjct: 389 KRKEEERRREEKRRREEQRRREEEEERRKEEKRRREEQRRREEEEEEERRKEEERKEEER 448

Query: 288 EKERDRRGDNDRRGNGERRH---RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
            KE+ RR +  RR    RR    R+++  +E ++R   +   EEE  ++  R  + R R 
Sbjct: 449 RKEKRRREEKRRREEERRREEERREEERREEEEKRKEEERRKEEERRKEAKRKEEERRRE 508

Query: 117 DDRDGDNEKERDH-RRRYKDDSEEDDRKRNRDRRYRD 10
           ++R  + E+ RD  R+R +    E++RKR  +RR ++
Sbjct: 509 EERRREEERRRDEERKREEKRKREEERKREEERREQE 545

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/159 (27%), Positives = 83/159 (52%), Gaps = 15/159 (9%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRG---RYKDDSEEEFDRKRD------RNGDRRHRVDDRD 298
           +R  ++R R+ +++  KE  RR    R +++ EEE  RK +      R  ++R R + R 
Sbjct: 401 RRREEQRRREEEEERRKEEKRRREEQRRREEEEEEERRKEEERKEEERRKEKRRREEKRR 460

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEE---EFDRKRD---RNG 136
            + E+ R+     + R   E + ++++  KE +RR   K   EE   E +R+R+   R  
Sbjct: 461 REEERRREEERREEERREEEEKRKEEERRKEEERRKEAKRKEEERRREEERRREEERRRD 520

Query: 135 DRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           + R R + R  + E++R+  RR ++   E++R+R  +RR
Sbjct: 521 EERKREEKRKREEERKREEERREQERRREEERRREEERR 559

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/148 (25%), Positives = 80/148 (54%), Gaps = 4/148 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRD--RNGDRRHRVDDRDGDNEKER 277
           +R  +RR  +R ++ EK ++   R +++  +E  RK +  R  + R R ++R  D E++R
Sbjct: 466 RREEERREEERREEEEKRKEEERRKEEERRKEAKRKEEERRREEERRREEERRRDEERKR 525

Query: 276 D--RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
           +  R+ + +R+   ERR ++   E+ER R    + + E   + +R R  +RR   + R  
Sbjct: 526 EEKRKREEERKREEERREQERRREEERRREEERRKEQERRREEERRREEERRKEEEKRRA 585

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           + ++  + +RR ++  +E++R+    RR
Sbjct: 586 EEKRREEEKRREEEKRKEEERREEERRR 613

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 40/147 (27%), Positives = 78/147 (53%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R +++R R+     E+ER R    +++   E + KR +  +RR   + R     KE +R
Sbjct: 447 ERRKEKRRREEKRRREEERRREEERREEERREEEEKR-KEEERRKEEERRKEAKRKEEER 505

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
           R + +RR   ERR RD++ ++E  R+   +   EEE   +  R  + R R ++R  + E+
Sbjct: 506 RREEERRREEERR-RDEERKREEKRKREEERKREEERREQERRREEERRREEERRKEQER 564

Query: 90  ERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            R+  RR +++  +++ KR  + + R+
Sbjct: 565 RREEERRREEERRKEEEKRRAEEKRRE 591

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 34/154 (22%), Positives = 84/154 (54%), Gaps = 4/154 (2%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +++ + +    RR ++R  + E+ +    R +++  +E +R+R+R  +   R   R+ + 
Sbjct: 294 KKRKVEEEEEKRREQERKKEEERRKTEEKRKEEERRKEEEREREREREEEKR---REEER 350

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRD----RNGDRRHR 121
           +KE +R+ + +RR    RR  +++ E+ ++   R +++  +E +R+R+    R   RR  
Sbjct: 351 KKEVERKREEERRKEKRRREEEEEEERRKEEERRKEEEKRKEEERRREEKRRREEQRRRE 410

Query: 120 VDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            ++     EK R   +R +++ EE++R++  +R+
Sbjct: 411 EEEERRKEEKRRREEQRRREEEEEEERRKEEERK 444

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 40/152 (26%), Positives = 80/152 (52%), Gaps = 2/152 (1%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           +R+   +R  +    +R  + E++ + R + K   EE+  R+ +R  +   R ++R  + 
Sbjct: 421 RRREEQRRREEEEEEERRKEEERKEEERRKEKRRREEKRRREEERRREEERREEERREEE 480

Query: 288 EK--ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
           EK  E +RR + +RR   +R+  +   E+ER R    + D E + + KR R  +R+   +
Sbjct: 481 EKRKEEERRKEEERRKEAKRKEEERRREEERRREEERRRDEERKREEKRKREEERKREEE 540

Query: 114 DRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
            R+ +  +E + RRR ++  +E +R+R  +RR
Sbjct: 541 RREQERRRE-EERRREEERRKEQERRREEERR 571

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 33/145 (22%), Positives = 75/145 (51%), Gaps = 1/145 (0%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +  R+   + ++++  KE +RR   K   EE    +  R  + R R ++R  + +++R+ 
Sbjct: 474 EERREEEEKRKEEERRKEEERRKEAKRKEEERRREEERRREEERRRDEERKREEKRKREE 533

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRD-RNGDRRHRVDDRDGDNE 94
               +     + R R+++  +E +RR   +   EEE  R+ + R  + + R +++  + E
Sbjct: 534 ERKREEERREQERRREEERRREEERRKEQERRREEERRREEERRKEEEKRRAEEKRREEE 593

Query: 93  KERDHRRRYKDDSEEDDRKRNRDRR 19
           K R+  +R +++  E++R+R  +RR
Sbjct: 594 KRREEEKRKEEERREEERRREEERR 618

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 36/152 (23%), Positives = 82/152 (53%), Gaps = 2/152 (1%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRD--RNGDRRHRVDDRDG 295
           +R+   +R ++   R  ++   +E+ RR   +   EEE  RK +  R  ++R R ++ + 
Sbjct: 376 ERRKEEERRKEEEKRKEEERRREEKRRREEQRRREEEEERRKEEKRRREEQRRREEEEEE 435

Query: 294 DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
           +  KE +R+ +  R+   E+R R++   +E +RR   +   EE  + +  R  + R + +
Sbjct: 436 ERRKEEERKEEERRK---EKRRREEKRRREEERRREEERREEERREEEEKRKEEERRKEE 492

Query: 114 DRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           +R  + +++ + RRR ++   E++R+R+ +R+
Sbjct: 493 ERRKEAKRKEEERRREEERRREEERRRDEERK 524

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 36/154 (23%), Positives = 90/154 (58%), Gaps = 2/154 (1%)
 Frame = -1

Query: 465 RKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 286
           RK+  ++ R+   + + ++ E++R  + R K++   + + KR    + R + ++R+ + E
Sbjct: 282 RKIEMEKEREEEKKRKVEEEEEKRREQERKKEEERRKTEEKRKE--EERRKEEERERERE 339

Query: 285 KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
           +E ++R + +R+   ER+ R+++  KE+ RR     + EEE +R+++   + R + +++ 
Sbjct: 340 REEEKRREEERKKEVERK-REEERRKEKRRR-----EEEEEEERRKE---EERRKEEEKR 390

Query: 105 GDNEKERDHRRRYKDDS--EEDDRKRNRDRRYRD 10
            + E+ R+ +RR ++    EE++ +R  ++R R+
Sbjct: 391 KEEERRREEKRRREEQRRREEEEERRKEEKRRRE 424

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 41/163 (25%), Positives = 86/163 (52%), Gaps = 13/163 (7%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRD---RDDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDRRHR 313
           +R+   +R R+R   +   R+++ +KE +R     R + K   EEE + +R +  +RR  
Sbjct: 327 ERRKEEEREREREREEEKRREEERKKEVERKREEERRKEKRRREEEEEEERRKEEERRKE 386

Query: 312 VDDR-DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSE----EEFDRKR 148
            + R + +  +E  RR +  RR   E   R ++  +  ++R R +++ E    EE  ++ 
Sbjct: 387 EEKRKEEERRREEKRRREEQRRREEEEERRKEEKRRREEQRRREEEEEEERRKEEERKEE 446

Query: 147 DRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           +R  ++R R + R  + E+ R+  RR ++  EE+++++  +RR
Sbjct: 447 ERRKEKRRREEKRRREEERRREEERREEERREEEEKRKEEERR 489

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 35/146 (23%), Positives = 77/146 (52%), Gaps = 2/146 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDR--DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           KR  +RR ++R  +++  +E +RR   +   EEE  R+ +R  +   R   R  +  +E 
Sbjct: 536 KREEERREQERRREEERRREEERRKEQERRREEERRREEERRKEEEKR---RAEEKRREE 592

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 97
           ++R + ++R   ERR  +   E+ER R    +   E+  + +R +  +R+   + R  + 
Sbjct: 593 EKRREEEKRKEEERREEERRREEERRREEAKRKKEEKRKEEERKKEEERKREEEKRKEEE 652

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDRR 19
            K+ + R++ ++  +E++RK+  ++R
Sbjct: 653 RKKEEERKKEEERKKEEERKKEEEKR 678

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 38/159 (23%), Positives = 80/159 (50%), Gaps = 7/159 (4%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRYRDRDDDNEKERDRRGRY-KDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           QR+   +   +RR  +   + E+ +++R R  K   EEE  R+ +R  + R   +++  +
Sbjct: 426 QRRREEEEEEERRKEEERKEEERRKEKRRREEKRRREEERRREEERREEERREEEEKRKE 485

Query: 291 NE--KERDRRGD----NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR 130
            E  KE +RR +     + R   E R R+++  ++ +R+   K   EEE  R+ +R    
Sbjct: 486 EERRKEEERRKEAKRKEEERRREEERRREEERRRDEERKREEKRKREEERKREEERREQE 545

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
           R R ++R  + E+ ++  RR +++   ++ +R  + + R
Sbjct: 546 RRREEERRREEERRKEQERRREEERRREEERRKEEEKRR 584

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 36/150 (24%), Positives = 84/150 (56%), Gaps = 1/150 (0%)
 Frame = -1

Query: 456 IWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           I + N++ +  D   +N++E  R+   + + EEE  RK +   ++R     R+ + +KE 
Sbjct: 261 ICQANQNPKKEDEIKNNQEEI-RKIEMEKEREEEKKRKVEEEEEKR-----REQERKKEE 314

Query: 276 DRRGDNDRRGNGERRHRDD-DNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           +RR   ++R   ERR  ++ + E+ER+   R +++ ++E +RKR+    +  R  + + +
Sbjct: 315 ERRKTEEKRKEEERRKEEEREREREREEEKRREEERKKEVERKREEERRKEKRRREEEEE 374

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            E+ ++  RR +++  +++ +R  ++R R+
Sbjct: 375 EERRKEEERRKEEEKRKEEERRREEKRRRE 404

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 32/156 (20%), Positives = 78/156 (50%), Gaps = 6/156 (3%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            +R  + R ++++   E+ER R    + + E+    ++ R  ++R   + R  +  +E +R
Sbjct: 552  RRREEERRKEQERRREEERRREEERRKEEEKRRAEEKRREEEKRREEEKRKEEERREEER 611

Query: 270  RGDNDRRGNG-----ERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDR 109
            R + +RR        E + ++++ +KE +R+   +   EEE  ++ +R  +  R + ++R
Sbjct: 612  RREEERRREEAKRKKEEKRKEEERKKEEERKREEEKRKEEERKKEEERKKEEERKKEEER 671

Query: 108  DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTSC 1
              + EK ++  R+ ++  EE+ +K+    +     C
Sbjct: 672  KKEEEKRKEEERKEEEKKEEERKKKEAKEKNVQEKC 707

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 38/153 (24%), Positives = 82/153 (53%), Gaps = 3/153 (1%)
 Frame = -1

Query: 468 QRKMIWKRNRDRRY---RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
           +R+   +R  +RR    R ++ +  +E +RR   +   EEE   KR     RR     R+
Sbjct: 541 RREQERRREEERRREEERRKEQERRREEERRREEERRKEEE---KRRAEEKRREEEKRRE 597

Query: 297 GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRV 118
            +  KE +RR + +RR   ERR  +   +KE  R+   +++ ++E +RKR+   + + + 
Sbjct: 598 EEKRKEEERR-EEERRREEERRREEAKRKKEEKRK---EEERKKEEERKRE---EEKRKE 650

Query: 117 DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           ++R  + E++++  R+ +++ ++++ KR  + R
Sbjct: 651 EERKKEEERKKEEERKKEEERKKEEEKRKEEER 683

[211][TOP]
>UniRef100_B3MR88 GF21236 n=1 Tax=Drosophila ananassae RepID=B3MR88_DROAN
          Length = 1211

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 56/152 (36%), Positives = 80/152 (52%), Gaps = 10/152 (6%)
 Frame = -1

Query: 447 RNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 277
           R+RDR   R RDRD D +++RDR    + D E + DR RDR+ DR    D R  D +  +
Sbjct: 7   RDRDRERDRDRDRDRDRDRDRDRDRERERDRERDRDRDRDRDRDRDSHHDSRSRDYDMSK 66

Query: 276 DRR-GDNDRRGNGERRHRDDDNEKERD---RRGRYKDDSEEEFDRKRDRNGDRR---HRV 118
            R  G     G G  R   DD ++ +D    RGR +DD   +  R +D   ++R    R 
Sbjct: 67  SRNGGGGGAGGGGSFRGGRDDRKRTKDLSSDRGR-RDDKRRKRSRSKDYEKEKRLDKERE 125

Query: 117 DDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            DRD + ++E+D R R K+   E DR+R+R R
Sbjct: 126 RDRDRERQREKD-REREKEREREKDRERDRQR 156

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 55/153 (35%), Positives = 74/153 (48%), Gaps = 34/153 (22%)
 Frame = -1

Query: 366 SEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGDNDRRGNGER--------RHRDDDN 214
           S  + DR+RDR+ DR R R  DRD D E+ERDR  D DR  + +R        R RD D 
Sbjct: 5   SGRDRDRERDRDRDRDRDRDRDRDRDRERERDRERDRDRDRDRDRDRDSHHDSRSRDYDM 64

Query: 213 EKE-----------------RDRRGRYKD---DSEEEFDRKRDRNGDRRHRVDDR-DGDN 97
            K                  RD R R KD   D     D++R R+  + +  + R D + 
Sbjct: 65  SKSRNGGGGGAGGGGSFRGGRDDRKRTKDLSSDRGRRDDKRRKRSRSKDYEKEKRLDKER 124

Query: 96  EKERD-HRRRYKDDSEEDDRKRNRDR---RYRD 10
           E++RD  R+R KD   E +R+R +DR   R RD
Sbjct: 125 ERDRDRERQREKDREREKEREREKDRERDRQRD 157

[212][TOP]
>UniRef100_B8MK41 Arginine rich protein n=1 Tax=Talaromyces stipitatus ATCC 10500
           RepID=B8MK41_TALSN
          Length = 879

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 62/171 (36%), Positives = 86/171 (50%), Gaps = 22/171 (12%)
 Frame = -1

Query: 447 RNRDR----RYRDRDDD-------NEKERDRRGRY-KDDSEEEFDRKRDRNGDRRHRVDD 304
           RNR R    R RDR+DD        ++ RDR  R  +  S+   DR+RDR+ +R HR   
Sbjct: 400 RNRSREGSTRLRDREDDRYSVRSHRDERRDRTARQSRSRSKARNDRERDRD-ERGHRSSR 458

Query: 303 RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
           R     + RDR  D DR  + ERR RD D +++RDR  R   D E + DR RDR+  R +
Sbjct: 459 RSRTRSRTRDR--DRDRVDSRERRERDRDQDRDRDRANR---DRERDRDRDRDRDRGRDN 513

Query: 123 RVD-------DRDGDNEKERDHRRRYKDDSEED---DRKRNRDRRYRDTSC 1
            +D        RD D  +ER+  R+   + E D   D+ + RDR    + C
Sbjct: 514 FLDRGYDRYTGRDMDRSREREQARKRSTERERDRSRDKDKGRDRPRSRSRC 564

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 52/134 (38%), Positives = 67/134 (50%), Gaps = 2/134 (1%)
 Frame = -1

Query: 414 DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER 235
           +D E++RD RG           R RDR+   R RVD R+    +ERDR  D DR      
Sbjct: 443 NDRERDRDERGHRSSRRSRTRSRTRDRD---RDRVDSRE---RRERDRDQDRDRDRANRD 496

Query: 234 RHRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRYKD 61
           R RD D +++RDR R  + D     +DR   R+ DR R R   R    E+ERD R R KD
Sbjct: 497 RERDRDRDRDRDRGRDNFLD---RGYDRYTGRDMDRSREREQARKRSTERERD-RSRDKD 552

Query: 60  DSEEDDRKRNRDRR 19
              +  R R+R RR
Sbjct: 553 KGRDRPRSRSRCRR 566

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 46/150 (30%), Positives = 72/150 (48%), Gaps = 8/150 (5%)
 Frame = -1

Query: 447  RNRDRRYRDRDDDNEKERDR---RGRYKDDSEEEFDR----KRDRNGDRRHRVDDRDGDN 289
            R+  R  RDR       R R   R + +  S+ + DR      +R+   R RV   + D 
Sbjct: 573  RSLTRHRRDRSGSRTSTRRRSTSRRKSRSPSQLDIDRYVPVTSNRSRSPRRRVRSPERDR 632

Query: 288  EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD-D 112
            ++ RD+  + + RG+        D E E ++ G    D  ++ D+ RD++ DR    D +
Sbjct: 633  DRPRDQDWNREPRGDRYIPGITTDRESEPEKSGNRDRDLNKDVDKTRDKDRDRDRYTDKE 692

Query: 111  RDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            R  D E+ERD R R +D  + DDR R+R R
Sbjct: 693  RARDGERERD-RHRARDIDDRDDRLRDRQR 721

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 57/163 (34%), Positives = 77/163 (47%), Gaps = 8/163 (4%)
 Frame = -1

Query: 483 GIRMIQRKMIWKRNRDRRYRDRDDDNE-KERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 307
           G R  +R     R RDR  RDR D  E +ERDR            D+ RDR  DR +R  
Sbjct: 453 GHRSSRRSRTRSRTRDRD-RDRVDSRERRERDR------------DQDRDR--DRANRDR 497

Query: 306 DRDGDNEKERDRRGDN--DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD 133
           +RD D +++RDR  DN  DR   G  R+   D ++ R+R    K  +E E DR RD++  
Sbjct: 498 ERDRDRDRDRDRGRDNFLDR---GYDRYTGRDMDRSREREQARKRSTERERDRSRDKDKG 554

Query: 132 R---RHRVDDRDGDNEKERD--HRRRYKDDSEEDDRKRNRDRR 19
           R   R R   R   +  +R     RR +  S    R+R+  RR
Sbjct: 555 RDRPRSRSRCRRSPSRADRSLTRHRRDRSGSRTSTRRRSTSRR 597

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 57/194 (29%), Positives = 80/194 (41%), Gaps = 53/194 (27%)
 Frame = -1

Query: 444  NRDRRYRDRDDDNEKERDRRGRYKD-DSEEEFDRKRD----RNGDR---------RHRVD 307
            +R+RR RDRD D +++R  R R +D D + + DR RD    R  DR         R R  
Sbjct: 476  SRERRERDRDQDRDRDRANRDRERDRDRDRDRDRGRDNFLDRGYDRYTGRDMDRSREREQ 535

Query: 306  DRDGDNEKERDRRGDNDRRGNGER-----------------RHRDD------DNEKERDR 196
             R    E+ERDR  D D+  +  R                 RHR D         +    
Sbjct: 536  ARKRSTERERDRSRDKDKGRDRPRSRSRCRRSPSRADRSLTRHRRDRSGSRTSTRRRSTS 595

Query: 195  RGRYKDDSEEEFDR------KRDRNGDRRHRVDDRDGDNEKERDHRR-----RY-----K 64
            R + +  S+ + DR       R R+  RR R  +RD D  +++D  R     RY      
Sbjct: 596  RRKSRSPSQLDIDRYVPVTSNRSRSPRRRVRSPERDRDRPRDQDWNREPRGDRYIPGITT 655

Query: 63   DDSEEDDRKRNRDR 22
            D   E ++  NRDR
Sbjct: 656  DRESEPEKSGNRDR 669

[213][TOP]
>UniRef100_A6R1E4 Predicted protein n=1 Tax=Ajellomyces capsulatus NAm1
           RepID=A6R1E4_AJECN
          Length = 693

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 60/148 (40%), Positives = 81/148 (54%), Gaps = 2/148 (1%)
 Frame = -1

Query: 465 RKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDN 289
           R+++  R RDR R R+RD + ++ERDR      + E+E DR+RDR  DR     +RD + 
Sbjct: 488 REIVRHRERDRERDRERDRERDRERDR------EREKERDRERDRERDR-----ERDRER 536

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERD-RRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
           ++ERDR  D DR G    R RDD   + RD  RGR +  S     R R R+G R HR  D
Sbjct: 537 DRERDRDRDRDR-GRDRDRDRDDRRYRPRDYSRGRTRSQSARR--RHRSRSGSRNHR--D 591

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRKRNR 28
            DG  ++ER+   R K  S    R R+R
Sbjct: 592 TDGGRDRERE---REKSFSRTGRRSRSR 616

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 57/162 (35%), Positives = 84/162 (51%), Gaps = 20/162 (12%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVD----------D 304
           K + DRR +DRD D +++R R R R+KD+       +  R  DR   +D          +
Sbjct: 405 KLSDDRRDKDRDRDRDRDRGRDRDRHKDERSRSRTWRSSRYDDRDREMDLYRPSTRSKLE 464

Query: 303 RD----GDNEKERDRRGDNDRRGNGERRHRDDDNEKERDR---RGRYKD-DSEEEFDRKR 148
           RD    G ++     R  +  R     RHR+ D E++R+R   R R +D + E+E DR+R
Sbjct: 465 RDMHSCGGSKNHSRSRSRSTARSREIVRHRERDRERDRERDRERDRERDREREKERDRER 524

Query: 147 DRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
           DR  DR R R  DR+ D +++RD R R +D   +D R R RD
Sbjct: 525 DRERDRERDRERDRERDRDRDRD-RGRDRDRDRDDRRYRPRD 565

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 63/176 (35%), Positives = 86/176 (48%), Gaps = 28/176 (15%)
 Frame = -1

Query: 447 RNRDR-RYRDRDDDNEKERDRRGRYK-------DDSEEEFDRKR---------------- 340
           ++RDR R RDR  D ++ +D R R +       DD + E D  R                
Sbjct: 413 KDRDRDRDRDRGRDRDRHKDERSRSRTWRSSRYDDRDREMDLYRPSTRSKLERDMHSCGG 472

Query: 339 DRNGDR-RHRVDDRDGDNEKERDRRGDNDRRGNGER-RHRDDDNEKERDR-RGRYKDDSE 169
            +N  R R R   R  +  + R+R  + DR  + ER R RD + EKERDR R R +D   
Sbjct: 473 SKNHSRSRSRSTARSREIVRHRERDRERDRERDRERDRERDREREKERDRERDRERD--- 529

Query: 168 EEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR-RYKDDSEEDDRKRNRDRRYRDTS 4
            E DR+RDR  D R R  DR  D +++RD RR R +D S    R ++  RR+R  S
Sbjct: 530 RERDRERDRERD-RDRDRDRGRDRDRDRDDRRYRPRDYSRGRTRSQSARRRHRSRS 584

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 65/206 (31%), Positives = 93/206 (45%), Gaps = 50/206 (24%)
 Frame = -1

Query: 480  IRMIQRKMIWKRNRDR-RYRDRDDDNEKERDR-----RGRYKD-DSEEEFDRKRDRNGDR 322
            +R  +R     R RDR R R+RD + EKERDR     R R +D + + E DR RDR+   
Sbjct: 491  VRHRERDRERDRERDRERDRERDREREKERDRERDRERDRERDRERDRERDRDRDRD--- 547

Query: 321  RHRVDDRDGDNEKERDR-------RGDNDRR----GNGERRHRDDDNEKERDRR------ 193
            R R  DRD D+ + R R       R  + RR     +G R HRD D  ++R+R       
Sbjct: 548  RGRDRDRDRDDRRYRPRDYSRGRTRSQSARRRHRSRSGSRNHRDTDGGRDREREREKSFS 607

Query: 192  ---GRYKDDSEEEFDR------KRDRNGDRRH-RVDDRDGDNEKERDHRRRYKD------ 61
                R +  S  + DR       R R   RR  R  DRD D ++E++ R + ++      
Sbjct: 608  RTGRRSRSRSPPDIDRYVPPTSNRSRTPTRRRARTPDRDRDRDREKEDRLKLQEIDRYMP 667

Query: 60   ----------DSEEDDRKRNRDRRYR 13
                       +++DDR+  R  R R
Sbjct: 668  GGSGAAPSVVSTDKDDRRSRRRSRSR 693

[214][TOP]
>UniRef100_Q2QZL4 Splicing factor U2af large subunit B n=2 Tax=Oryza sativa Japonica
           Group RepID=U2A2B_ORYSJ
          Length = 548

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 55/141 (39%), Positives = 70/141 (49%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRG 247
           + RD D E+E+D+      D E   DR RDR  DR     DRD D EK+RD+  D DR  
Sbjct: 30  KPRDKDREREKDK------DRERHRDRDRDRGRDR-----DRDKDKEKDRDKERDRDR-- 76

Query: 246 NGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRY 67
                    D +K+RDR  R+  +  E  DR  D +   RHR  D +   + ERD RRR+
Sbjct: 77  ---------DRDKDRDRHHRHHRERREHRDRSDDHD---RHRSRDSERRRDHERDGRRRH 124

Query: 66  KDDSEEDDRKRNRDRRYRDTS 4
           +  S    R R RDRR R  S
Sbjct: 125 R--SRSRSRSRGRDRRSRSRS 143

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 51/138 (36%), Positives = 73/138 (52%), Gaps = 6/138 (4%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR---RGRYKD---DSEEEFDRKRDRNGDRRHRVDDRDGDNE 286
           R++DR  R++D D E+ RDR   RGR +D   D E++ D++RDR         DRD D +
Sbjct: 32  RDKDRE-REKDKDRERHRDRDRDRGRDRDRDKDKEKDRDKERDR---------DRDRDKD 81

Query: 285 KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
           ++R  R   +RR   E R R DD+++ R R      DSE   D +RD  G RRHR   R 
Sbjct: 82  RDRHHRHHRERR---EHRDRSDDHDRHRSR------DSERRRDHERD--GRRRHRSRSRS 130

Query: 105 GDNEKERDHRRRYKDDSE 52
               ++R  R R +  S+
Sbjct: 131 RSRGRDRRSRSRSRSKSK 148

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 41/120 (34%), Positives = 58/120 (48%)
 Frame = -1

Query: 372 DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRR 193
           D    E D     +G  + R  DR+ + +K+R+R  D DR   G  R RD D EK+RD+ 
Sbjct: 13  DGGRPEGDTHSREDGLSKPRDKDREREKDKDRERHRDRDR-DRGRDRDRDKDKEKDRDK- 70

Query: 192 GRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
                  E + DR RD++ DR HR              RR ++D S++ DR R+RD   R
Sbjct: 71  -------ERDRDRDRDKDRDRHHR----------HHRERREHRDRSDDHDRHRSRDSERR 113

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 31/96 (32%), Positives = 48/96 (50%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +++RD+  RDRD D +K+RDR  R+  +  E  DR            DD D    ++ +R
Sbjct: 65  EKDRDKE-RDRDRDRDKDRDRHHRHHRERREHRDRS-----------DDHDRHRSRDSER 112

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEE 163
           R D++R G    R R     + RDRR R +  S+ +
Sbjct: 113 RRDHERDGRRRHRSRSRSRSRGRDRRSRSRSRSKSK 148

[215][TOP]
>UniRef100_C5X6Q2 Putative uncharacterized protein Sb02g012970 n=1 Tax=Sorghum
           bicolor RepID=C5X6Q2_SORBI
          Length = 392

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 60/147 (40%), Positives = 79/147 (53%), Gaps = 20/147 (13%)
 Frame = -1

Query: 390 RRGRYKDDSEEEFDRKRDR----NGDRRHRVDDRDGDNE-KERDRRGDNDRRGNGERRHR 226
           RR   +DD EEE + K ++    +    H  D+  G +  +ERDR  D DR    ER HR
Sbjct: 180 RRSALEDDFEEEEEDKEEQPMEIDEPNGHENDNHRGRSPARERDRDRDRDRDRKPERHHR 239

Query: 225 DDDNEKERDR-----RGRYKDDSEEEFDRKRDRNGDR---RHRVDD----RDGDNEKERD 82
           D D +++RD      RGR +D    + DR+RDRN DR   RHR+ D    RD D ++ERD
Sbjct: 240 DRDYDRDRDYDRDYGRGRERD---RDRDRERDRNRDRDRDRHRLRDDDYNRDRDRDRERD 296

Query: 81  HR---RRYKDDSEEDDRKRNRDRRYRD 10
            R   RR +D      R R+RDRR RD
Sbjct: 297 GRERERRDRDRGRHRSRSRSRDRRDRD 323

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 52/140 (37%), Positives = 72/140 (51%), Gaps = 7/140 (5%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDR---RGRYKD-DSEEEFDRKRDRNGDRRHRVDD---RDGDN 289
           R  +R +RDRD D +++ DR   RGR +D D + E DR RDR+ DR    DD   RD D 
Sbjct: 232 RKPERHHRDRDYDRDRDYDRDYGRGRERDRDRDRERDRNRDRDRDRHRLRDDDYNRDRDR 291

Query: 288 EKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
           ++ERD R + +RR     RHR     + RDRR R ++D E    R+R   G    R    
Sbjct: 292 DRERDGR-ERERRDRDRGRHR--SRSRSRDRRDRDREDGEY---RRRRGRGSASPRGRGE 345

Query: 108 DGDNEKERDHRRRYKDDSEE 49
           DG   +E   ++  K+   E
Sbjct: 346 DGGPREEPKRKKEKKEKKGE 365

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 53/152 (34%), Positives = 77/152 (50%), Gaps = 9/152 (5%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDR-RHRVDDRDGDNEKE 280
           R RDR  RDRD D + ER  R R  D   D + ++ R R+R+ DR R R  +RD D ++ 
Sbjct: 220 RERDRD-RDRDRDRKPERHHRDRDYDRDRDYDRDYGRGRERDRDRDRERDRNRDRDRDRH 278

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           R R  D          +RD D ++ERD R R + D +    R R R+ DRR R D  DG+
Sbjct: 279 RLRDDD---------YNRDRDRDRERDGRERERRDRDRGRHRSRSRSRDRRDR-DREDGE 328

Query: 99  NEKERDH-----RRRYKDDSEEDDRKRNRDRR 19
             + R       R R +D    ++ KR ++++
Sbjct: 329 YRRRRGRGSASPRGRGEDGGPREEPKRKKEKK 360

[216][TOP]
>UniRef100_B6UDT4 Splicing factor U2AF 65 kDa subunit n=1 Tax=Zea mays
           RepID=B6UDT4_MAIZE
          Length = 596

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 58/143 (40%), Positives = 74/143 (51%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           R RDR  RD+  D E++RDR GR K        R RDR+ DR     DRD D    RD R
Sbjct: 73  RERDRE-RDKGKDRERDRDR-GREKG-------RDRDRDKDRERSDRDRDRDRH-HRDHR 122

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
             +++R   E R R DD ++ RD R R++DD + E  R RDR+G RRHR         K 
Sbjct: 123 ERSEKR---EHRDRSDDRDRHRDGRDRHRDDRDSERRRDRDRDGHRRHR----SRSPSKS 175

Query: 87  RDHRRRYKDDSEEDDRKRNRDRR 19
           RD  RR    S    R R++ +R
Sbjct: 176 RDRDRR----SRSRSRSRSKSKR 194

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 50/145 (34%), Positives = 71/145 (48%), Gaps = 7/145 (4%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK-ERD 274
           +   + +  D      +ERDR      D E + DR R++  DR     DRD D E+ +RD
Sbjct: 57  QHQHETQSHDSGSSKSRERDRERDKGKDRERDRDRGREKGRDR-----DRDKDRERSDRD 111

Query: 273 RRGDNDRRGNGER------RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD 112
           R  D   R + ER      R R DD ++ RD R R++DD + E  R RDR+G RRHR   
Sbjct: 112 RDRDRHHRDHRERSEKREHRDRSDDRDRHRDGRDRHRDDRDSERRRDRDRDGHRRHR--S 169

Query: 111 RDGDNEKERDHRRRYKDDSEEDDRK 37
           R     ++RD R R +  S    ++
Sbjct: 170 RSPSKSRDRDRRSRSRSRSRSKSKR 194

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 51/140 (36%), Positives = 68/140 (48%), Gaps = 4/140 (2%)
 Frame = -1

Query: 411 DNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGDNDRRGNGER 235
           D    + +      DS     R+RDR  D+ + R  DRD   EK RDR  D DR    ER
Sbjct: 52  DGRSSQHQHETQSHDSGSSKSRERDRERDKGKDRERDRDRGREKGRDRDRDKDR----ER 107

Query: 234 RHRDDDNEK-ERDRRGR--YKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYK 64
             RD D ++  RD R R   ++  +   DR R R+G  RHR DDRD +  ++RD     +
Sbjct: 108 SDRDRDRDRHHRDHRERSEKREHRDRSDDRDRHRDGRDRHR-DDRDSERRRDRDRDGHRR 166

Query: 63  DDSEEDDRKRNRDRRYRDTS 4
             S    + R+RDRR R  S
Sbjct: 167 HRSRSPSKSRDRDRRSRSRS 186

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = -1

Query: 351 DRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDS 172
           D    R+   +H     D  + K R+R  + D+ G    R RD   EK RDR    +D  
Sbjct: 49  DHADGRSSQHQHETQSHDSGSSKSRERDRERDK-GKDRERDRDRGREKGRDRD---RDKD 104

Query: 171 EEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
            E  DR RDR  DR HR       + +ER  +R ++D S++ DR R+   R+RD
Sbjct: 105 RERSDRDRDR--DRHHR-------DHRERSEKREHRDRSDDRDRHRDGRDRHRD 149

[217][TOP]
>UniRef100_A8JEB6 Predicted protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=A8JEB6_CHLRE
          Length = 620

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 53/138 (38%), Positives = 77/138 (55%), Gaps = 3/138 (2%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRG 247
           R +D D E+ERD +   +D  E+    +RD    + +R  D++ + E+ R  R D D+  
Sbjct: 169 RSKDKDRERERDGKDGKRDSKEKATSSRRDDKDGKDNREKDKEKERERSRRERDDRDK-- 226

Query: 246 NGERRHRDDDNEKERDR-RGRYKD-DSEEEFDRKRDRNGDRRHRVDDRD-GDNEKERDHR 76
             ER  RD D E+ER+R R R +D + + E DR+R+R  DR  R DDRD  D ++ERD  
Sbjct: 227 --ERGSRDRDRERERERERERERDRERDRERDREREREHDRDSRRDDRDFRDWDRERDWE 284

Query: 75  RRYKDDSEEDDRKRNRDR 22
           R   D   E +R R+ DR
Sbjct: 285 R---DRERERERDRDWDR 299

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 51/151 (33%), Positives = 78/151 (51%), Gaps = 5/151 (3%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSE-EEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           R  D R+  R D + ++ + RG ++     ++ DR+R+R+G    +   RD   +    R
Sbjct: 141 RQEDDRWAGRSDRDREDDEVRGHHQQPQRSKDKDRERERDG----KDGKRDSKEKATSSR 196

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEE---FDRKRDRNGDR-RHRVDDRDG 103
           R D D + N     R+ D EKER+R  R +DD ++E    DR R+R  +R R R  DR+ 
Sbjct: 197 RDDKDGKDN-----REKDKEKERERSRRERDDRDKERGSRDRDRERERERERERERDRER 251

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           D E++R+  R +  DS  DDR      R RD
Sbjct: 252 DRERDREREREHDRDSRRDDRDFRDWDRERD 282

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 53/153 (34%), Positives = 75/153 (49%), Gaps = 1/153 (0%)
 Frame = -1

Query: 483 GIRMIQRKMIWKRNRDRRYRD-RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 307
           G R  + K    R  D+  +D R+ D EKER+R  R +DD ++E          R  R  
Sbjct: 184 GKRDSKEKATSSRRDDKDGKDNREKDKEKERERSRRERDDRDKE----------RGSRDR 233

Query: 306 DRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR 127
           DR+ + E+ER+R  D +R      R RD + E+E DR  R  D    ++DR+RD      
Sbjct: 234 DRERERERERERERDRER-----DRERDREREREHDRDSRRDDRDFRDWDRERDW----- 283

Query: 126 HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNR 28
               +RD + E+ERD   R  D S  D R R+R
Sbjct: 284 ----ERDRERERERD---RDWDRSSVDPRDRDR 309

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 40/147 (27%), Positives = 75/147 (51%), Gaps = 6/147 (4%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRG------RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 283
           N+ R      D  ++ R R+         K+++E + +R+ ++   +  R +D       
Sbjct: 93  NKRRGESPEKDSADRPRKRQAIVWEPPTAKEEAEAK-EREMEKGRGKESRQEDDRWAGRS 151

Query: 282 ERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG 103
           +RDR  D++ RG+ ++  R  D ++ER+R G  KD   +  ++      D +   D+R+ 
Sbjct: 152 DRDRE-DDEVRGHHQQPQRSKDKDRERERDG--KDGKRDSKEKATSSRRDDKDGKDNREK 208

Query: 102 DNEKERDHRRRYKDDSEEDDRKRNRDR 22
           D EKER+  RR +DD +++   R+RDR
Sbjct: 209 DKEKERERSRRERDDRDKERGSRDRDR 235

[218][TOP]
>UniRef100_B4H2X8 GL13419 n=1 Tax=Drosophila persimilis RepID=B4H2X8_DROPE
          Length = 672

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 56/155 (36%), Positives = 84/155 (54%), Gaps = 7/155 (4%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           R R  R ++++ + EKE+      K + E+E +R RDRN ++  R  DR  D E++RDR 
Sbjct: 172 RQRQERAKEKEKEKEKEK------KKEREKEKERDRDRNREKEKRDVDRSRDRERDRDR- 224

Query: 267 GDNDRRGNGERR-------HRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR 109
            DN +  +   R       HRD D +K++DR      D E E +R+RD++ D RH   DR
Sbjct: 225 -DNSKGAHRHNRTKEIKQSHRDKDKDKDKDR------DREREPERERDKDHD-RHGNRDR 276

Query: 108 DGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
           D D E+  DHRR   ++        ++D+RY DTS
Sbjct: 277 DRDRER-GDHRR---ENISGRHLHHSKDQRYSDTS 307

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 49/145 (33%), Positives = 65/145 (44%), Gaps = 3/145 (2%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           R+RDR  RDRD DN K   R  R K+  +   D+ +D++ DR     DR+ + E+ERD+ 
Sbjct: 214 RSRDRE-RDRDRDNSKGAHRHNRTKEIKQSHRDKDKDKDKDR-----DREREPERERDK- 266

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGD--RRHRVDDRDGDN- 97
            D+DR GN     RD D ++ER    R           K  R  D  R H        N 
Sbjct: 267 -DHDRHGN-----RDRDRDRERGDHRRENISGRHLHHSKDQRYSDTSRSHISSSSSSANA 320

Query: 96  EKERDHRRRYKDDSEEDDRKRNRDR 22
              +  RR Y D S      R+R R
Sbjct: 321 ASHKSQRRSYDDRSRRRRGSRSRSR 345

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 34/121 (28%), Positives = 60/121 (49%), Gaps = 3/121 (2%)
 Frame = -1

Query: 363 EEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRY 184
           +E   R+R      + +  +++   E+E+++  D DR    E+R  D   ++ERDR    
Sbjct: 167 KEPQPRQRQERAKEKEKEKEKEKKKEREKEKERDRDRNREKEKRDVDRSRDRERDRD--- 223

Query: 183 KDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD---HRRRYKDDSEEDDRKRNRDRRYR 13
           +D+S+      R +   + HR  D+D D +++R+    R R KD     +R R+RDR   
Sbjct: 224 RDNSKGAHRHNRTKEIKQSHRDKDKDKDKDRDREREPERERDKDHDRHGNRDRDRDRERG 283

Query: 12  D 10
           D
Sbjct: 284 D 284

[219][TOP]
>UniRef100_Q8H0U8 DEAD-box ATP-dependent RNA helicase 42 n=1 Tax=Arabidopsis thaliana
           RepID=RH42_ARATH
          Length = 1166

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 59/183 (32%), Positives = 92/183 (50%), Gaps = 36/183 (19%)
 Frame = -1

Query: 450 KRNRDRRYR-----------DRDDDNE------KERDRRGRYKD------------DSEE 358
           +R +DRR +           DRDDD E      KER+RR R KD            DSE+
Sbjct: 44  RREKDRRKKRVKSSDSEDDYDRDDDEEREKRKEKERERRRRDKDRVKRRSERRKSSDSED 103

Query: 357 EFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYK 181
           + + + +R  D+R   +   G  E ERDR  D  R R   ER+ ++ + EK+R+RR R +
Sbjct: 104 DVEEEDER--DKRRVNEKERGHREHERDRGKDRKRDREREERKDKEREREKDRERRERER 161

Query: 180 DDSEEEFDRKRDR------NGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRR 19
           ++ E+E  ++R+R        DRR R  +R     +ER+  R   ++  +DD KR+  RR
Sbjct: 162 EEREKERVKERERREREDGERDRREREKERGSRRNRERERSREVGNEESDDDVKRDLKRR 221

Query: 18  YRD 10
            ++
Sbjct: 222 RKE 224

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 48/144 (33%), Positives = 82/144 (56%), Gaps = 5/144 (3%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRG 247
           RDRD  NE+++D+    +   E++  +KR ++ D     DD D D+++ER++R + +R  
Sbjct: 27  RDRDRSNERKKDKGSEKR--REKDRRKKRVKSSDSE---DDYDRDDDEEREKRKEKER-- 79

Query: 246 NGERRHRDDDNEKERDRRGRYKD-----DSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 82
             ERR RD D  K R  R +  D     + E+E D++R    +R HR  +RD   +++RD
Sbjct: 80  --ERRRRDKDRVKRRSERRKSSDSEDDVEEEDERDKRRVNEKERGHREHERDRGKDRKRD 137

Query: 81  HRRRYKDDSEEDDRKRNRDRRYRD 10
             R  + D E  +R+++R+RR R+
Sbjct: 138 REREERKDKER-EREKDRERRERE 160

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 54/176 (30%), Positives = 93/176 (52%), Gaps = 30/176 (17%)
 Frame = -1

Query: 450 KRNRDR---RYRDRDDDNEKERDRRGR----------YKDDSEEEFDRKRDRNGDRRHRV 310
           +R+RDR   R +D+  +  +E+DRR +          Y  D +EE ++++++  +RR R 
Sbjct: 26  RRDRDRSNERKKDKGSEKRREKDRRKKRVKSSDSEDDYDRDDDEEREKRKEKERERRRRD 85

Query: 309 DDR---------------DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDD 175
            DR               D + E ERD+R  N++    ER HR+ + ++ +DR  +   +
Sbjct: 86  KDRVKRRSERRKSSDSEDDVEEEDERDKRRVNEK----ERGHREHERDRGKDR--KRDRE 139

Query: 174 SEEEFDRKRDRNGDRRHRVDDRDGDNEKER--DHRRRYKDDSEEDDRKRNRDRRYR 13
            EE  D++R+R  DR  R  +R+ + EKER  +  RR ++D E D R+R ++R  R
Sbjct: 140 REERKDKEREREKDRERRERERE-EREKERVKERERREREDGERDRREREKERGSR 194

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 53/171 (30%), Positives = 89/171 (52%), Gaps = 14/171 (8%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEE-----EFDRKRDRNGDRRHR 313
           R   +  + +R+  R+  D +DD E+E +R  R  ++ E      E DR +DR  DR  R
Sbjct: 82  RRRDKDRVKRRSERRKSSDSEDDVEEEDERDKRRVNEKERGHREHERDRGKDRKRDRE-R 140

Query: 312 VDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGR---YKDDSEEEFDR--KR 148
            + +D + E+E+DR      R   ER  R+ +  KER+RR R    +D  E E +R  +R
Sbjct: 141 EERKDKEREREKDR-----ERREREREEREKERVKERERREREDGERDRREREKERGSRR 195

Query: 147 DRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKR----NRDRRYRDT 7
           +R  +R   V + + D++ +RD +RR K+  E  +++R     R  R+ D+
Sbjct: 196 NRERERSREVGNEESDDDVKRDLKRRRKEGGERKEKEREKSVGRSSRHEDS 246

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 44/161 (27%), Positives = 81/161 (50%), Gaps = 9/161 (5%)
 Frame = -1

Query: 465 RKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 286
           ++ + ++ R  R  +RD   +++RDR    + D E E  R++DR    R R ++R+ +  
Sbjct: 113 KRRVNEKERGHREHERDRGKDRKRDREREERKDKERE--REKDRERRERER-EEREKERV 169

Query: 285 KERDRR----GDNDRRGNGERRHRDDDNEKERDR---RGRYKDDSEEEFDRKRDRNGDRR 127
           KER+RR    G+ DRR   + R    + E+ER R        DD + +  R+R   G+R+
Sbjct: 170 KERERREREDGERDRREREKERGSRRNRERERSREVGNEESDDDVKRDLKRRRKEGGERK 229

Query: 126 HRVDDRD-GDNEKERDH-RRRYKDDSEEDDRKRNRDRRYRD 10
            +  ++  G + +  D  +R+  +D+ E   K+ R+    D
Sbjct: 230 EKEREKSVGRSSRHEDSPKRKSVEDNGEKKEKKTREEELED 270

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 45/158 (28%), Positives = 87/158 (55%), Gaps = 11/158 (6%)
 Frame = -1

Query: 450 KRNRDRRYR-DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD-GDNEKER 277
           KR+R+R  R D++ + EK+R+RR R +++ E+E  ++R+R   R     +RD  + EKER
Sbjct: 135 KRDREREERKDKEREREKDRERREREREEREKERVKERER---REREDGERDRREREKER 191

Query: 276 DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDD----- 112
             R + +R  + E  + + D++ +RD + R K+  E + +++R+++  R  R +D     
Sbjct: 192 GSRRNRERERSREVGNEESDDDVKRDLKRRRKEGGERK-EKEREKSVGRSSRHEDSPKRK 250

Query: 111 --RDGDNEKERDHRRRYKDDSEE--DDRKRNRDRRYRD 10
              D   +KE+  R    +D ++  D+    R RR ++
Sbjct: 251 SVEDNGEKKEKKTREEELEDEQKKLDEEVEKRRRRVQE 288

[220][TOP]
>UniRef100_UPI000192745C PREDICTED: similar to Cisplatin resistance-associated overexpressed
           protein n=1 Tax=Hydra magnipapillata RepID=UPI000192745C
          Length = 552

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 57/174 (32%), Positives = 84/174 (48%), Gaps = 16/174 (9%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 298
           R ++++   K     R R+R  +  +    R R +   + E  R R+R+G R     +R 
Sbjct: 260 RSVEKERSQKERTRERSRERSREKRRRSSSRSRDRRSKDRERRRSRERSGHRERSDRERS 319

Query: 297 GDNEKERDR----RGDNDR----RGNGERRHRD--DDNEKERDRRGRYKDDSEEEFDRKR 148
             +  +RDR    RGD DR    R + +R  RD  D +  +RDRR R + D +   DR+R
Sbjct: 320 DRDRSDRDRNDRDRGDRDRSDRDRSDRDRSDRDRSDRDRSDRDRRDRDRRDRDRSRDRER 379

Query: 147 DRNGD---RRHRVDDRDGDNEKERDHRRRY---KDDSEEDDRKRNRDRRYRDTS 4
            R+ D   R HR   RD D+ K RD RR     K+      R+R RD++YR  S
Sbjct: 380 SRDRDSKRRSHRSRSRDRDS-KRRDRRRSQSLGKNSHRSRSRERERDKKYRKNS 432

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/168 (30%), Positives = 86/168 (51%), Gaps = 12/168 (7%)
 Frame = -1

Query: 477 RMIQRKMIWKRNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEF--DRKRDRNGDRRHRVD 307
           R++   +   + RD   +DR +DN+ ++DR R   K+ S++E   +R R+R+ ++R R  
Sbjct: 229 RILNANLYGTKKRDLARKDRVEDNKSKKDRPRSVEKERSQKERTRERSRERSREKRRRSS 288

Query: 306 DRDGDNE-KERDRRGDNDRRGNGER--RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG 136
            R  D   K+R+RR   +R G+ ER  R R D +  +RDR  R + D +     + DR+ 
Sbjct: 289 SRSRDRRSKDRERRRSRERSGHRERSDRERSDRDRSDRDRNDRDRGDRDRSDRDRSDRDR 348

Query: 135 DRRHRVD------DRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
             R R D      DR   + ++RD  R  +   + D ++R+   R RD
Sbjct: 349 SDRDRSDRDRSDRDRRDRDRRDRDRSRDRERSRDRDSKRRSHRSRSRD 396

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 44/131 (33%), Positives = 65/131 (49%), Gaps = 6/131 (4%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           + +RDR  RDR D +  +RDR  R + D +     + DR  DRR R D RD D  ++R+R
Sbjct: 323 RSDRDRNDRDRGDRDRSDRDRSDRDRSDRDRSDRDRSDR--DRRDR-DRRDRDRSRDRER 379

Query: 270 RGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDG---- 103
             D D +    R    D + K RDRR            R R+R  D+++R + +D     
Sbjct: 380 SRDRDSKRRSHRSRSRDRDSKRRDRRRSQSLGKNSHRSRSRERERDKKYRKNSKDRRSSN 439

Query: 102 --DNEKERDHR 76
             D+EK RD++
Sbjct: 440 DIDDEKPRDNK 450

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 47/146 (32%), Positives = 74/146 (50%), Gaps = 4/146 (2%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR-R 268
           +R+R  R+R D +  +RDR  R + D +     + DR+   R R  DRD  +   RDR R
Sbjct: 310 HRERSDRERSDRDRSDRDRNDRDRGDRDRSDRDRSDRDRSDRDR-SDRDRSDRDRRDRDR 368

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN-GDRRHRVDDRDGDNEK 91
            D DR  + ER    D + K R  R R +D   +  DR+R ++ G   HR   R  + E+
Sbjct: 369 RDRDRSRDRERSR--DRDSKRRSHRSRSRDRDSKRRDRRRSQSLGKNSHR--SRSRERER 424

Query: 90  ERDHRRRYKD--DSEEDDRKRNRDRR 19
           ++ +R+  KD   S + D ++ RD +
Sbjct: 425 DKKYRKNSKDRRSSNDIDDEKPRDNK 450

[221][TOP]
>UniRef100_UPI00005A1262 PREDICTED: similar to PRP38 pre-mRNA processing factor 38 (yeast)
           domain containing B n=1 Tax=Canis lupus familiaris
           RepID=UPI00005A1262
          Length = 548

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 54/152 (35%), Positives = 73/152 (48%), Gaps = 3/152 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           +R ++RR R R  D   ER R  R ++       R RDR GDRR R  DR+ + E ER R
Sbjct: 311 EREKERR-RSRSIDRGLERRRSSRSRERHRSR-SRSRDRKGDRRDR--DREREKENERGR 366

Query: 270 RGDND---RRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 100
           R D D    RGN   + R+   E+ ++RR R     E E  + ++   DRRHR D +D  
Sbjct: 367 RRDRDYDKERGNDREKERERSRERSKERRSR----GEVEEKKHKEDKDDRRHRDDKKDSK 422

Query: 99  NEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            EK+    R  +       R RN  +R R  S
Sbjct: 423 KEKKHSRSRSRERKHRSRSRSRNAGKRSRSRS 454

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 52/155 (33%), Positives = 85/155 (54%), Gaps = 15/155 (9%)
 Frame = -1

Query: 423 DRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGN 244
           DR+ + EKER R  R  +  E E +R+R R+ DR   ++ R     +ER R     R   
Sbjct: 293 DRELEREKERQRLER--EAKEREKERRRSRSIDR--GLERRRSSRSRERHRSRSRSRDRK 348

Query: 243 GERRHRDDDNEKERDRRGRYKD---------DSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
           G+RR RD + EKE + RGR +D         D E+E +R R+R+ +RR R +  +  +++
Sbjct: 349 GDRRDRDREREKENE-RGRRRDRDYDKERGNDREKERERSRERSKERRSRGEVEEKKHKE 407

Query: 90  ERDHRRRYKDDSEED------DRKRNRDRRYRDTS 4
           ++D  RR++DD ++        R R+R+R++R  S
Sbjct: 408 DKDD-RRHRDDKKDSKKEKKHSRSRSRERKHRSRS 441

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 46/154 (29%), Positives = 76/154 (49%), Gaps = 5/154 (3%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKD-----DSEEEFDRKRDRNGDRRHRVDDRDGDNE 286
           +R R  R R+R     + RDR+G  +D     + E E  R+RDR+ D+  R +DR+ + E
Sbjct: 327 ERRRSSRSRERHRSRSRSRDRKGDRRDRDREREKENERGRRRDRDYDKE-RGNDREKERE 385

Query: 285 KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD 106
           + R+R  +   RG  E +   +D +  R R    K DS++E    R R+ +R+HR   R 
Sbjct: 386 RSRERSKERRSRGEVEEKKHKEDKDDRRHRDD--KKDSKKEKKHSRSRSRERKHRSRSRS 443

Query: 105 GDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            +  K    R + K    +++ K   ++R R  S
Sbjct: 444 RNAGKRSRSRSKEKSSKHKNESKEKSNKRSRSGS 477

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 50/164 (30%), Positives = 80/164 (48%), Gaps = 24/164 (14%)
 Frame = -1

Query: 447 RNRDRRY-RDRDDDNEKERDR-RGRYKDDSE----EEFDRKRDRNGDRRHRVDDRDGDNE 286
           R RDR Y ++R +D EKER+R R R K+       EE   K D++ DRRHR D +D   E
Sbjct: 366 RRRDRDYDKERGNDREKERERSRERSKERRSRGEVEEKKHKEDKD-DRRHRDDKKDSKKE 424

Query: 285 KERDRRGDNDRRGNGERRHRD---DDNEKERDRRGRYKDDSEEEFDRKRDRNGD------ 133
           K+  R    +R+     R R+       + +++  ++K++S+E+   KR R+G       
Sbjct: 425 KKHSRSRSRERKHRSRSRSRNAGKRSRSRSKEKSSKHKNESKEK-SNKRSRSGSQGRTDS 483

Query: 132 ------RRH---RVDDRDGDNEKERDHRRRYKDDSEEDDRKRNR 28
                 R H   +   R     KER H+R + D  ++ D+  +R
Sbjct: 484 VEKSRKREHSPSKEKSRKRSRSKERSHKRDHSDSKDQSDKHDHR 527

[222][TOP]
>UniRef100_B6UFH0 ATP-dependent RNA helicase DDX23 n=1 Tax=Zea mays
           RepID=B6UFH0_MAIZE
          Length = 758

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 52/127 (40%), Positives = 72/127 (56%)
 Frame = -1

Query: 408 NEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRH 229
           N   RD    ++D S+ + DR RDR         DRD D +++R+RR D+D      RR 
Sbjct: 66  NPAPRDSSNSHRDSSDRDRDRDRDR---------DRDRDRDRDRERRRDDD-----SRRD 111

Query: 228 RDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEE 49
           RD D +++RD R R +DDS     R RDR+ DRR R  DRD D E+ERD   R ++  + 
Sbjct: 112 RDRDRDRDRD-RDRDRDDSSR---RDRDRDRDRRDRDRDRDRDMERERD---RDRERGDR 164

Query: 48  DDRKRNR 28
            DR+R+R
Sbjct: 165 GDRERDR 171

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 50/121 (41%), Positives = 67/121 (55%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           R+RDR  RDRD D +++RDR  R  DDS  + DR RDR+ DR     DRD D+   RDR 
Sbjct: 82  RDRDRD-RDRDRDRDRDRDRERRRDDDSRRDRDRDRDRDRDR-----DRDRDDSSRRDRD 135

Query: 267 GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE 88
            D DRR     R RD + E++RDR      +  +  DR+RDR      R  +++ D  KE
Sbjct: 136 RDRDRRDRDRDRDRDMERERDRDR------ERGDRGDRERDRLEKMAEREREKELDAIKE 189

Query: 87  R 85
           +
Sbjct: 190 Q 190

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 50/129 (38%), Positives = 69/129 (53%), Gaps = 8/129 (6%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRG 265
           +RD   RDRD D +++RDR        + + DR+R R+ D R     RD D +++RDR  
Sbjct: 76  HRDSSDRDRDRDRDRDRDR--------DRDRDRERRRDDDSR-----RDRDRDRDRDRDR 122

Query: 264 DNDRRGNGERRHRDDDNEKERDRRGRYKD---DSEEEFDRKRDRNGDRRHRVDDR----- 109
           D DR  +  R     D +++RDRR R +D   D E E DR R+R GDR  R  DR     
Sbjct: 123 DRDRDDSSRR-----DRDRDRDRRDRDRDRDRDMERERDRDRER-GDRGDRERDRLEKMA 176

Query: 108 DGDNEKERD 82
           + + EKE D
Sbjct: 177 EREREKELD 185

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 45/110 (40%), Positives = 59/110 (53%), Gaps = 5/110 (4%)
 Frame = -1

Query: 336 RNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFD 157
           R+    HR D  D D +++RDR  D DR  + ERR RDDD+ ++RDR      D + + D
Sbjct: 70  RDSSNSHR-DSSDRDRDRDRDRDRDRDRDRDRERR-RDDDSRRDRDR------DRDRDRD 121

Query: 156 RKRDRNG----DRRHRVDDRDGDNEKERDHRRRYKDDSEEDDR-KRNRDR 22
           R RDR+     DR    D RD D +++RD  R    D E  DR  R RDR
Sbjct: 122 RDRDRDDSSRRDRDRDRDRRDRDRDRDRDMERERDRDRERGDRGDRERDR 171

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 39/100 (39%), Positives = 53/100 (53%), Gaps = 4/100 (4%)
 Frame = -1

Query: 297 GDNEKERDRRG---DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR- 130
           G N   RD      D+  R     R RD D +++RDR  R  DDS  + DR RDR+ DR 
Sbjct: 64  GSNPAPRDSSNSHRDSSDRDRDRDRDRDRDRDRDRDRERRRDDDSRRDRDRDRDRDRDRD 123

Query: 129 RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           R R D    D +++RD R R +D   + +R+R+RDR   D
Sbjct: 124 RDRDDSSRRDRDRDRDRRDRDRDRDRDMERERDRDRERGD 163

[223][TOP]
>UniRef100_Q7RL71 Drosophila melanogaster SD07741p n=1 Tax=Plasmodium yoelii yoelii
            RepID=Q7RL71_PLAYO
          Length = 931

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 56/154 (36%), Positives = 85/154 (55%), Gaps = 6/154 (3%)
 Frame = -1

Query: 468  QRKMIWKRNRDR---RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDR 301
            Q+++  +RN+ R   R  +RD + E ERDR    + D   E ++ R+R  ++ R+R  +R
Sbjct: 626  QKEIDSERNKKRPRNRETERDRNREVERDRNREVERDRNREVEKDRNREVEKDRNREVER 685

Query: 300  DGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RH 124
            D + E ERDR  + +R  N E   RD + E ERDR    + D   E +R R+R  +R R+
Sbjct: 686  DRNREVERDRNRETERDRNRE-VERDRNREVERDRNRETERDRNREVERDRNRETERDRN 744

Query: 123  RVDDRDGDNEKERDHRRRY-KDDSEEDDRKRNRD 25
            R  +RD + E ERD  R   +D + E  R RNR+
Sbjct: 745  REVERDRNREVERDRNRETGRDRNRETGRDRNRE 778

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 58/155 (37%), Positives = 82/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDD 304
            R ++R    +  RDR R  +RD + E ERDR    + D   E +R R+R  +R R+R  +
Sbjct: 689  REVERDRNRETERDRNREVERDRNREVERDRNRETERDRNREVERDRNRETERDRNREVE 748

Query: 303  RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR-NGDRR 127
            RD + E ERDR  +  R  N E   RD + E ERDR    + D   E ++ R+R  G  R
Sbjct: 749  RDRNREVERDRNRETGRDRNRE-TGRDRNREVERDRNREMEKDRNREVEKDRNRETGRDR 807

Query: 126  HRVDDRDGDNEKERDHRRRY-KDDSEEDDRKRNRD 25
            +R   RD + E +RD  R   +D + E DR RNR+
Sbjct: 808  NRETGRDRNREIDRDRNREIDRDRNREIDRDRNRE 842

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 57/155 (36%), Positives = 83/155 (53%), Gaps = 4/155 (2%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDD 304
            R ++R    +  RDR R  ++D + E E+DR    + D   E +R R+R  +R R+R  +
Sbjct: 649  REVERDRNREVERDRNREVEKDRNREVEKDRNREVERDRNREVERDRNRETERDRNREVE 708

Query: 303  RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR-NGDRR 127
            RD + E ERDR  + +R  N E   RD + E ERDR    + D   E +R R+R  G  R
Sbjct: 709  RDRNREVERDRNRETERDRNRE-VERDRNRETERDRNREVERDRNREVERDRNRETGRDR 767

Query: 126  HRVDDRDGDNEKERDHRRRY-KDDSEEDDRKRNRD 25
            +R   RD + E ERD  R   KD + E ++ RNR+
Sbjct: 768  NRETGRDRNREVERDRNREMEKDRNREVEKDRNRE 802

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 54/145 (37%), Positives = 81/145 (55%), Gaps = 3/145 (2%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERD 274
            +R+R+R   +RD + E ERDR    + D   E ++ R+R  +R R+R  +RD + E ERD
Sbjct: 644  ERDRNREV-ERDRNREVERDRNREVEKDRNREVEKDRNREVERDRNREVERDRNRETERD 702

Query: 273  RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDN 97
            R  + +R  N E   RD + E ERDR    + D   E +R R+R  +R R+R  +RD + 
Sbjct: 703  RNREVERDRNREVE-RDRNRETERDRNREVERDRNRETERDRNREVERDRNREVERDRNR 761

Query: 96   EKERDHRRRY-KDDSEEDDRKRNRD 25
            E  RD  R   +D + E +R RNR+
Sbjct: 762  ETGRDRNRETGRDRNREVERDRNRE 786

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 57/155 (36%), Positives = 82/155 (52%), Gaps = 4/155 (2%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDD 304
            R ++R    +  +DR R  ++D + E ERDR    + D   E +R R+R  +R R+R  +
Sbjct: 657  REVERDRNREVEKDRNREVEKDRNREVERDRNREVERDRNRETERDRNREVERDRNREVE 716

Query: 303  RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDR-NGDRR 127
            RD + E ERDR  + +R  N E   RD + E ERDR    + D   E  R R+R  G  R
Sbjct: 717  RDRNRETERDRNREVERDRNRE-TERDRNREVERDRNREVERDRNRETGRDRNRETGRDR 775

Query: 126  HRVDDRDGDNEKERDHRRRY-KDDSEEDDRKRNRD 25
            +R  +RD + E E+D  R   KD + E  R RNR+
Sbjct: 776  NREVERDRNREMEKDRNREVEKDRNRETGRDRNRE 810

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 55/149 (36%), Positives = 78/149 (52%), Gaps = 8/149 (5%)
 Frame = -1

Query: 447  RNRD-----RRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNE 286
            RNR+      R  +RD + E ERDR    + D   E +R R+R  +R R+R  +RD + E
Sbjct: 671  RNREVEKDRNREVERDRNREVERDRNRETERDRNREVERDRNREVERDRNRETERDRNRE 730

Query: 285  KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDR 109
             ERDR  + +R  N E   RD + E ERDR      D   E  R R+R  +R R+R  ++
Sbjct: 731  VERDRNRETERDRNRE-VERDRNREVERDRNRETGRDRNRETGRDRNREVERDRNREMEK 789

Query: 108  DGDNEKERDHRRRY-KDDSEEDDRKRNRD 25
            D + E E+D  R   +D + E  R RNR+
Sbjct: 790  DRNREVEKDRNRETGRDRNRETGRDRNRE 818

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 51/143 (35%), Positives = 79/143 (55%), Gaps = 3/143 (2%)
 Frame = -1

Query: 444  NRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRR 268
            N  +R R +D D +++    G+ + DSE    R R+R  +R R+R  +RD + E ERDR 
Sbjct: 605  NDKKRERIKDKDEKQDSHIDGQKEIDSERNKKRPRNRETERDRNREVERDRNREVERDRN 664

Query: 267  GDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEK 91
             + ++  N E   +D + E ERDR    + D   E +R R+R  +R R+R  +RD + E 
Sbjct: 665  REVEKDRNREVE-KDRNREVERDRNREVERDRNRETERDRNREVERDRNREVERDRNRET 723

Query: 90   ERDHRRRY-KDDSEEDDRKRNRD 25
            ERD  R   +D + E +R RNR+
Sbjct: 724  ERDRNREVERDRNRETERDRNRE 746

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 55/152 (36%), Positives = 78/152 (51%), Gaps = 3/152 (1%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDD 304
            R ++R    +  RDR R  +RD + E ERDR    + D   E +R R+R  +R R+R   
Sbjct: 705  REVERDRNREVERDRNRETERDRNREVERDRNRETERDRNREVERDRNREVERDRNRETG 764

Query: 303  RDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-R 127
            RD + E  RDR  + +R  N E   +D + E E+DR      D   E  R R+R  DR R
Sbjct: 765  RDRNRETGRDRNREVERDRNRE-MEKDRNREVEKDRNRETGRDRNRETGRDRNREIDRDR 823

Query: 126  HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRN 31
            +R  DRD + E +RD  R  + +S    RKR+
Sbjct: 824  NREIDRDRNREIDRDRNREMESES-STTRKRS 854

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 42/131 (32%), Positives = 66/131 (50%), Gaps = 9/131 (6%)
 Frame = -1

Query: 390 RRGRYKDDSEEEFDRKRDRNGDRRHRVDDR-------DGDNEKERDRRGDNDRRGNGERR 232
           +  +Y  +S    D+KR+R  D+  + D         D +  K+R R  + +R  N E  
Sbjct: 593 KHNQYNHNSSHNNDKKRERIKDKDEKQDSHIDGQKEIDSERNKKRPRNRETERDRNREVE 652

Query: 231 HRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRY-KDD 58
            RD + E ERDR    + D   E ++ R+R  +R R+R  +RD + E ERD  R   +D 
Sbjct: 653 -RDRNREVERDRNREVEKDRNREVEKDRNREVERDRNREVERDRNRETERDRNREVERDR 711

Query: 57  SEEDDRKRNRD 25
           + E +R RNR+
Sbjct: 712 NREVERDRNRE 722

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 50/172 (29%), Positives = 75/172 (43%), Gaps = 18/172 (10%)
 Frame = -1

Query: 477  RMIQRKMIWKRNRDR-RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRV 310
            R ++R    +  RDR R  +RD + E ERDR      D   E  R R+R  +R   R   
Sbjct: 729  REVERDRNRETERDRNREVERDRNREVERDRNRETGRDRNRETGRDRNREVERDRNREME 788

Query: 309  DDRDGDNEKERDRRGDNDR-RGNGERRHRDDDN----EKERDRRGRYKDDSEEEFDRKRD 145
             DR+ + EK+R+R    DR R  G  R+R+ D     E +RDR      D   E + +  
Sbjct: 789  KDRNREVEKDRNRETGRDRNRETGRDRNREIDRDRNREIDRDRNREIDRDRNREMESESS 848

Query: 144  RNGDRRHRVDDRDGDNEKERDHRRRYKD--DSEEDDRKR-------NRDRRY 16
                R H  ++    N+      R+  D   SE  +++R       N+ R+Y
Sbjct: 849  TTRKRSHGNENDSNHNKNSNSVLRKVHDYNSSEHPEKERHIYNSSDNQSRKY 900

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 41/138 (29%), Positives = 70/138 (50%), Gaps = 4/138 (2%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRG 247
           +D++ DN+K        KDD+        D N D+ H+  +    + K+ ++   N    
Sbjct: 551 KDKNKDNKKNEHE----KDDNNTN-SLNIDHNNDK-HKGLESHQISAKKHNQYNHNSSHN 604

Query: 246 NGERRHRDDDNEKERDRR--GRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHR 76
           N ++R R  D ++++D    G+ + DSE    R R+R  +R R+R  +RD + E ERD  
Sbjct: 605 NDKKRERIKDKDEKQDSHIDGQKEIDSERNKKRPRNRETERDRNREVERDRNREVERDRN 664

Query: 75  RRY-KDDSEEDDRKRNRD 25
           R   KD + E ++ RNR+
Sbjct: 665 REVEKDRNREVEKDRNRE 682

[224][TOP]
>UniRef100_B7PLA5 Cisplatin resistance-associated overexpressed protein, putative
           (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PLA5_IXOSC
          Length = 437

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 52/155 (33%), Positives = 76/155 (49%), Gaps = 12/155 (7%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDD-------NEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD 292
           +R R+ R R RDDD       ++K  DRR   +DD  +  DR+ DR  D+R   DD+  D
Sbjct: 272 EREREERRRRRDDDGSHSRRTDDKRDDRRDDKRDDKRD--DRREDRREDKR---DDKKDD 326

Query: 291 NEKERDR---RGDNDRRGNGERRHRDDDNEKERD--RRGRYKDDSEEEFDRKRDRNGDRR 127
             + R R   R D DRR     R +DD ++++RD  RR R +D  +E+ +R+R       
Sbjct: 327 KRRRRSRSRHRDDGDRRREDGDRRKDDADQRKRDEDRRKRDEDRRKEDGERRRSSRRSEE 386

Query: 126 HRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
                RD  + +   H R  + D  ED   R+R R
Sbjct: 387 RSRSHRDSSSHRSSGHDRHRRSDRREDSHHRDRSR 421

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 60/167 (35%), Positives = 84/167 (50%), Gaps = 21/167 (12%)
 Frame = -1

Query: 441 RDRRYRDRDDDNEKERDRRGRYKDD----SEEEFDRKRDRNGDRR--HRVDDRDGDNEKE 280
           R++   D++   E+ER+ R R +DD    S    D++ DR  D+R   R D R+   E +
Sbjct: 260 REKEREDKEKQREREREERRRRRDDDGSHSRRTDDKRDDRRDDKRDDKRDDRREDRREDK 319

Query: 279 RDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDR--- 109
           RD + D+ RR     RHR DD ++ R+   R KDD+++   RKRD   DRR R +DR   
Sbjct: 320 RDDKKDDKRRRRSRSRHR-DDGDRRREDGDRRKDDADQ---RKRDE--DRRKRDEDRRKE 373

Query: 108 DGD--------NEKERDHRRRYKDDSEEDDRKRNRDRR----YRDTS 4
           DG+         E+ R HR      S   DR R  DRR    +RD S
Sbjct: 374 DGERRRSSRRSEERSRSHRDSSSHRSSGHDRHRRSDRREDSHHRDRS 420

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 53/145 (36%), Positives = 79/145 (54%), Gaps = 11/145 (7%)
 Frame = -1

Query: 405 EKERDRRGRYKDDSEEEFDRKRDRNGDRRH--RVDD-RDGDNEKERDRRGDNDRRGNGER 235
           ++E++R  + K    E  +R+R R+ D  H  R DD RD   + +RD + D DRR +   
Sbjct: 259 KREKEREDKEKQREREREERRRRRDDDGSHSRRTDDKRDDRRDDKRDDKRD-DRREDRRE 317

Query: 234 RHRDD--DNEKERDRRGRYKDDSE---EEFDRKRDRNGDRRHRVDD---RDGDNEKERDH 79
             RDD  D+++ R  R R++DD +   E+ DR++D + D+R R +D   RD D  KE   
Sbjct: 318 DKRDDKKDDKRRRRSRSRHRDDGDRRREDGDRRKD-DADQRKRDEDRRKRDEDRRKEDGE 376

Query: 78  RRRYKDDSEEDDRKRNRDRRYRDTS 4
           RRR    SEE      R R +RD+S
Sbjct: 377 RRRSSRRSEE------RSRSHRDSS 395

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 44/134 (32%), Positives = 63/134 (47%), Gaps = 8/134 (5%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERD--RRGRYKDDSEEEFDRKRDRNGDRRHRVD-DR---DGDN 289
           +R  D+R   RDD  + +RD  R  R +D  +++ D KR R    RHR D DR   DGD 
Sbjct: 290 RRTDDKRDDRRDDKRDDKRDDRREDRREDKRDDKKDDKRRRRSRSRHRDDGDRRREDGDR 349

Query: 288 EKER--DRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVD 115
            K+    R+ D DRR   E R ++D   +   RR   +  S  +    R    DR  R D
Sbjct: 350 RKDDADQRKRDEDRRKRDEDRRKEDGERRRSSRRSEERSRSHRDSSSHRSSGHDRHRRSD 409

Query: 114 DRDGDNEKERDHRR 73
            R+  + ++R   R
Sbjct: 410 RREDSHHRDRSRDR 423

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 45/117 (38%), Positives = 62/117 (52%), Gaps = 10/117 (8%)
 Frame = -1

Query: 330 GDRRHRVDDRDGDNEKERDRR-------GDNDRRGNGERRHRDDD--NEKERDRR-GRYK 181
           G R    +D++   E+ER+ R       G + RR + +R  R DD  ++K  DRR  R +
Sbjct: 258 GKREKEREDKEKQREREREERRRRRDDDGSHSRRTDDKRDDRRDDKRDDKRDDRREDRRE 317

Query: 180 DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           D  +++ D KR R    RHR    DGD  +E   RR  KDD+  D RKR+ DRR RD
Sbjct: 318 DKRDDKKDDKRRRRSRSRHR---DDGDRRREDGDRR--KDDA--DQRKRDEDRRKRD 367

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 44/117 (37%), Positives = 62/117 (52%), Gaps = 13/117 (11%)
 Frame = -1

Query: 447 RNRDRRYRDRDD--DNEKERDRRGRYKDDSE---EEFDRKRDRNGDRRHRVDDR---DGD 292
           R  DRR   RDD  D+++ R  R R++DD +   E+ DR++D + D+R R +DR   D D
Sbjct: 311 RREDRREDKRDDKKDDKRRRRSRSRHRDDGDRRREDGDRRKD-DADQRKRDEDRRKRDED 369

Query: 291 NEKERDRRGDNDRRGNGERR-HRDDDNEK----ERDRRGRYKDDSEEEFDRKRDRNG 136
             KE   R  + RR     R HRD  + +    +R RR   ++DS    DR RDR G
Sbjct: 370 RRKEDGERRRSSRRSEERSRSHRDSSSHRSSGHDRHRRSDRREDSHHR-DRSRDRGG 425

[225][TOP]
>UniRef100_A0CAN3 Chromosome undetermined scaffold_162, whole genome shotgun sequence
           n=1 Tax=Paramecium tetraurelia RepID=A0CAN3_PARTE
          Length = 309

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 52/143 (36%), Positives = 77/143 (53%), Gaps = 2/143 (1%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEF-DRKRDRNGDRRHRVDDRDGDNEKERD 274
           +RN   R  DRDD+    RD R   +DD+  +  D +RD+ GDRR   D+R  DN   RD
Sbjct: 164 RRNYSNRRDDRDDNRVNRRDNRRDNRDDNRRDNRDDRRDKRGDRRDNRDNRR-DNRDNRD 222

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRD-GDN 97
            R  +DRR N + R    DN   RD RG  +D+ +   +R    + D R   D+RD  DN
Sbjct: 223 NR--DDRRDNRDNRDDRRDNRDNRDNRGN-RDNRDNRDNRDNRDHRDNRDNRDNRDHRDN 279

Query: 96  EKERDHRRRYKDDSEEDDRKRNR 28
            ++RD+R   + D++E  +++ R
Sbjct: 280 REKRDNRDNRERDNKEGGQQKTR 302

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 52/145 (35%), Positives = 76/145 (52%), Gaps = 13/145 (8%)
 Frame = -1

Query: 405 EKERDRRG-RYKDDSEEEFDRKRDRNGDRR-----HRVDDRDGDNEKERDRRGD--NDRR 250
           E++R  RG R K D+   +  +RD   D R     +R D+RD +    RD R D   DRR
Sbjct: 149 ERQRSPRGNRSKSDNRRNYSNRRDDRDDNRVNRRDNRRDNRDDNRRDNRDDRRDKRGDRR 208

Query: 249 GNGERRHRDDDNEKERDRRGRYKDDSEEEFDRK--RDRNGDRRHRVDDRDG-DNEKERDH 79
            N + R  + DN   RD R   +D+ ++  D +  RD  G+R +R D+RD  DN   RD+
Sbjct: 209 DNRDNRRDNRDNRDNRDDRRDNRDNRDDRRDNRDNRDNRGNRDNR-DNRDNRDNRDHRDN 267

Query: 78  R--RRYKDDSEEDDRKRNRDRRYRD 10
           R  R  +D  +  +++ NRD R RD
Sbjct: 268 RDNRDNRDHRDNREKRDNRDNRERD 292

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 43/144 (29%), Positives = 68/144 (47%), Gaps = 1/144 (0%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
           ++   R  R + D+     +RR    D+     D +RD   D R   D+RD   +K  DR
Sbjct: 150 RQRSPRGNRSKSDNRRNYSNRRDDRDDNRVNRRDNRRDNRDDNRR--DNRDDRRDKRGDR 207

Query: 270 RGDND-RRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
           R + D RR N + R   DD    RD R   +D+ +   +R    N D R   D+RD  + 
Sbjct: 208 RDNRDNRRDNRDNRDNRDDRRDNRDNRDDRRDNRDNRDNRGNRDNRDNRDNRDNRDHRDN 267

Query: 93  KERDHRRRYKDDSEEDDRKRNRDR 22
           ++    R ++D+ E+ D + NR+R
Sbjct: 268 RDNRDNRDHRDNREKRDNRDNRER 291

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 4/133 (3%)
 Frame = -1

Query: 471 IQRKMIWKRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRK--RDRNGDRRHRVDDRD 298
           + R+   + NRD   RD  DD    RD+RG  +D+ +   D +  RD   DRR   D+RD
Sbjct: 179 VNRRDNRRDNRDDNRRDNRDD---RRDKRGDRRDNRDNRRDNRDNRDNRDDRRDNRDNRD 235

Query: 297 G--DNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRH 124
              DN   RD RG+ D R N + R    DN   RD R   +D+ +   +R++  N D R 
Sbjct: 236 DRRDNRDNRDNRGNRDNRDNRDNR----DNRDHRDNRDN-RDNRDHRDNREKRDNRDNRE 290

Query: 123 RVDDRDGDNEKER 85
           R D+++G  +K R
Sbjct: 291 R-DNKEGGQQKTR 302

[226][TOP]
>UniRef100_UPI000198399D PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI000198399D
          Length = 542

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 54/148 (36%), Positives = 81/148 (54%), Gaps = 5/148 (3%)
 Frame = -1

Query: 438 DRRYRDR-----DDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           +R YR R     DDD+E+   RR + +   EEE +R RDR  D+     +RD D +KERD
Sbjct: 29  ERSYRKREGGEEDDDDERGEGRRSK-RSRGEEEKERGRDREKDK-----ERDRDKDKERD 82

Query: 273 RRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 94
           R  D +R      R RD + E+ER+R        E E D++R+R    R R  +++ +  
Sbjct: 83  REKDKER-----ERERDKERERERER--------ERERDKERERK--EREREKEKEREKA 127

Query: 93  KERDHRRRYKDDSEEDDRKRNRDRRYRD 10
           KE++ R   K++ EE +R R R RR++D
Sbjct: 128 KEKERRELEKEEREEKERSRRR-RRFKD 154

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 45/142 (31%), Positives = 77/142 (54%), Gaps = 6/142 (4%)
 Frame = -1

Query: 426 RDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRG 247
           R + D  EK  +R  R ++  EE+ D   D  G+ R     R G+ EKER R  + D+  
Sbjct: 19  RKKKDGGEKS-ERSYRKREGGEEDDD---DERGEGRRSKRSR-GEEEKERGRDREKDKE- 72

Query: 246 NGERRHRDDDNEKERDR---RGRYKD---DSEEEFDRKRDRNGDRRHRVDDRDGDNEKER 85
               R RD D E++R++   R R +D   + E E +R+RD+  +R+ R  +++ + EK +
Sbjct: 73  ----RDRDKDKERDREKDKERERERDKERERERERERERDKERERKEREREKEKEREKAK 128

Query: 84  DHRRRYKDDSEEDDRKRNRDRR 19
           +  RR  +  E ++++R+R RR
Sbjct: 129 EKERRELEKEEREEKERSRRRR 150

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 42/127 (33%), Positives = 70/127 (55%), Gaps = 3/127 (2%)
 Frame = -1

Query: 447 RNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRR 268
           R  + + R RD + +KERDR      D ++E DR++D+    R R  D++ + E+ER+R 
Sbjct: 56  RGEEEKERGRDREKDKERDR------DKDKERDREKDKE---RERERDKERERERERERE 106

Query: 267 GDNDRRGNGERRHRDDDNE--KERDRRGRYKDDSEE-EFDRKRDRNGDRRHRVDDRDGDN 97
            D +R      R ++ + E  KE++RR   K++ EE E  R+R R  D++  V+    + 
Sbjct: 107 RDKERERKEREREKEKEREKAKEKERRELEKEEREEKERSRRRRRFKDKKEAVEP---EA 163

Query: 96  EKERDHR 76
           + ERD R
Sbjct: 164 DPERDQR 170

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/113 (31%), Positives = 62/113 (54%), Gaps = 5/113 (4%)
 Frame = -1

Query: 450 KRNRDR-----RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNE 286
           +R RDR     R RD+D + ++E+D+    + D E E +R+R+R  D+     +R+ + E
Sbjct: 62  ERGRDREKDKERDRDKDKERDREKDKERERERDKERERERERERERDKERERKEREREKE 121

Query: 285 KERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRR 127
           KER++  + +RR       +++  EKER RR R   D +E  + + D   D+R
Sbjct: 122 KEREKAKEKERR----ELEKEEREEKERSRRRRRFKDKKEAVEPEADPERDQR 170

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 39/121 (32%), Positives = 71/121 (58%), Gaps = 6/121 (4%)
 Frame = -1

Query: 363 EEEFDRKRDRNGDRRHR-VDDRDGDNEKERDRRGDNDR----RGNGER-RHRDDDNEKER 202
           EE  +RK+   G++  R    R+G  E + D RG+  R    RG  E+ R RD + +KER
Sbjct: 14  EEPENRKKKDGGEKSERSYRKREGGEEDDDDERGEGRRSKRSRGEEEKERGRDREKDKER 73

Query: 201 DRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
           DR    + D E++ +R+R+R+ +R  R  +R+ + +KER+ + R ++  +E ++ + ++R
Sbjct: 74  DRDKDKERDREKDKERERERDKERE-RERERERERDKERERKEREREKEKEREKAKEKER 132

Query: 21  R 19
           R
Sbjct: 133 R 133

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 41/118 (34%), Positives = 62/118 (52%), Gaps = 1/118 (0%)
 Frame = -1

Query: 372 DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRR 193
           D  E E+  K     + R +   +DG  + ER  R    +R  GE    DDD+E+   RR
Sbjct: 2   DFDEYEYLEKAVEEPENRKK---KDGGEKSERSYR----KREGGEE---DDDDERGEGRR 51

Query: 192 GRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR 22
            + +   EEE +R RDR  D+ R R  D++ D EK+++ R R +D   E +R+R R+R
Sbjct: 52  SK-RSRGEEEKERGRDREKDKERDRDKDKERDREKDKE-RERERDKERERERERERER 107

[227][TOP]
>UniRef100_UPI000186DCF0 hypothetical protein Phum_PHUM263920 n=1 Tax=Pediculus humanus
           corporis RepID=UPI000186DCF0
          Length = 1364

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 59/175 (33%), Positives = 89/175 (50%), Gaps = 33/175 (18%)
 Frame = -1

Query: 450 KRNRDRRYRDRDD---DNEKERDR-RGRYKD---------DSEEEFDRKRDRNGDR-RHR 313
           +R R+R ++  DD   D E+ERDR R R +D         D +   +R+RDR+ +R R R
Sbjct: 338 EREREREHKQEDDYGSDRERERDRDRDRERDRDRNIERDWDRDRVRERERDRDSERDRER 397

Query: 312 VDDRDGDNEKERDRRGDNDR-------RGNGERRHRDDDNEKERD------------RRG 190
             DRD D +++RDR  D DR       R   ++R R DD + E D             R 
Sbjct: 398 ERDRDRDRDRDRDRDRDRDRDDRLYRDRRPPKKRRRPDDVDYEYDDYEEVRRYRPGRNRP 457

Query: 189 RYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRD 25
           RY +  + ++DR   RN D  +R+  RD D ++++ +R R  D     +R+RNRD
Sbjct: 458 RYDEYDDYDYDRPHRRNRDPEYRI--RDHDYDRDKPYRSRDFDYDRPRNRERNRD 510

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 58/179 (32%), Positives = 81/179 (45%), Gaps = 39/179 (21%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-RHRVDDRDGDNEKERDRRGDND 256
           R RDRD D E++RDR      D +   +R+RDR+ +R R R  DRD D +++RDR  D D
Sbjct: 357 RERDRDRDRERDRDRNIERDWDRDRVRERERDRDSERDRERERDRDRDRDRDRDRDRDRD 416

Query: 255 R-------RGNGERRHRDDDNEKERD------------RRGRYKDDSEEEFDRKRDRNGD 133
           R       R   ++R R DD + E D             R RY +  + ++DR   RN D
Sbjct: 417 RDDRLYRDRRPPKKRRRPDDVDYEYDDYEEVRRYRPGRNRPRYDEYDDYDYDRPHRRNRD 476

Query: 132 RRHRVDDRDGDN-----------------EKERDHRR--RYKDDSEEDDRKRNRDRRYR 13
             +R+ D D D                  E+ RD+ R  + +D  E   R R  DR  R
Sbjct: 477 PEYRIRDHDYDRDKPYRSRDFDYDRPRNRERNRDYDRPIKSRDADERPSRLREDDRPIR 535

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 57/176 (32%), Positives = 85/176 (48%), Gaps = 31/176 (17%)
 Frame = -1

Query: 447 RNRDRRYRDRDD-----DNEKERDRRGRYKDDSEEEFDRKRDRNGDR---RHRVDDRDGD 292
           R    +Y + DD     D E+ER+R  + +DD   + +R+RDR+ DR   R R  +RD D
Sbjct: 319 RKPSNQYHEPDDKNKEYDTEREREREHKQEDDYGSDRERERDRDRDRERDRDRNIERDWD 378

Query: 291 NEKERDRRGDNDRRGNGER-RHRDDDNEKERDR------------------RGRYKDDSE 169
            ++ R+R  D D   + ER R RD D +++RDR                  + R  DD +
Sbjct: 379 RDRVRERERDRDSERDRERERDRDRDRDRDRDRDRDRDRDDRLYRDRRPPKKRRRPDDVD 438

Query: 168 EEFDR----KRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYR 13
            E+D     +R R G  R R D+ D D + +R HRR    +    D   +RD+ YR
Sbjct: 439 YEYDDYEEVRRYRPGRNRPRYDEYD-DYDYDRPHRRNRDPEYRIRDHDYDRDKPYR 493

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 52/141 (36%), Positives = 71/141 (50%), Gaps = 7/141 (4%)
 Frame = -1

Query: 414 DDNEKERDRRGRYK--DDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR-RGN 244
           +++E  R    +Y   DD  +E+D +R+R  + +   DD   D E+ERDR  D +R R  
Sbjct: 313 EESESSRKPSNQYHEPDDKNKEYDTEREREREHKQE-DDYGSDRERERDRDRDRERDRDR 371

Query: 243 GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHR---- 76
              R  D D  +ER+R    + D E E DR RDR+ D R R  DRD D+   RD R    
Sbjct: 372 NIERDWDRDRVRERERDRDSERDRERERDRDRDRDRD-RDRDRDRDRDDRLYRDRRPPKK 430

Query: 75  RRYKDDSEEDDRKRNRDRRYR 13
           RR  DD + +       RRYR
Sbjct: 431 RRRPDDVDYEYDDYEEVRRYR 451

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 53/194 (27%), Positives = 75/194 (38%), Gaps = 49/194 (25%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEKERDR-------------------------------------- 388
           +R RDR R RDRD D +++RDR                                      
Sbjct: 396 ERERDRDRDRDRDRDRDRDRDRDDRLYRDRRPPKKRRRPDDVDYEYDDYEEVRRYRPGRN 455

Query: 387 RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKE-RDRRGDNDRRGNGERRHRDDDNE 211
           R RY +  + ++DR   RN D  +R+ D D D +K  R R  D DR  N ER    D   
Sbjct: 456 RPRYDEYDDYDYDRPHRRNRDPEYRIRDHDYDRDKPYRSRDFDYDRPRNRERNRDYDRPI 515

Query: 210 KERD---RRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGD---NEKERDHRRRYKDDS-- 55
           K RD   R  R ++D      R+ ++   R   V+    +   N    D   R   DS  
Sbjct: 516 KSRDADERPSRLREDDRPIRVREEEKPVIRNREVEKTTSEERFNRNRNDQLFRSNSDSKI 575

Query: 54  -EEDDRKRNRDRRY 16
            +  +R+ N D R+
Sbjct: 576 NKNRNRETNSDNRH 589

[228][TOP]
>UniRef100_UPI0000F2B8D5 PREDICTED: similar to MARVEL domain-containing protein 3 n=1
           Tax=Monodelphis domestica RepID=UPI0000F2B8D5
          Length = 466

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 63/168 (37%), Positives = 85/168 (50%), Gaps = 21/168 (12%)
 Frame = -1

Query: 444 NRDRRYRDRDDDNEKERDR-----RGRYKDDSEEEFDRKRDRN-GDRRHRVDDRDGDNEK 283
           +R  R+R+RD   E++RDR     R R +D   E   R+RDR+ G  R R  D   +  +
Sbjct: 21  HRPERHRERDQRRERQRDRDHGPERHRERDQHPE---RQRDRDHGPERQRDRDHGPERHR 77

Query: 282 ERDRRGDNDR-RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHR 121
           ERD+R +  R R +G  R RD   E+ RDR G    D+E   DR+ DR+GDR     R R
Sbjct: 78  ERDQRPERQRDRDHGPERQRD--RERRRDRNGDRPRDTER--DRRGDRDGDRQGDRDRDR 133

Query: 120 VD---------DRDGDNEKERDHRRRYKDDSEEDDRKRNRDRRYRDTS 4
            D         DRDGD   ERDHR    D   + +  R+  +R R+ S
Sbjct: 134 RDRWGEGDKRGDRDGDGRSERDHR---LDGQRDWEHPRSNGQRVREKS 178

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 46/139 (33%), Positives = 72/139 (51%), Gaps = 6/139 (4%)
 Frame = -1

Query: 414 DDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDNEKERDRRGDNDR- 253
           D   +ER R G ++ +   E D++R+R  DR     RHR  D+  + +++RD   +  R 
Sbjct: 9   DSRTRERPRDGDHRPERHRERDQRRERQRDRDHGPERHRERDQHPERQRDRDHGPERQRD 68

Query: 252 RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR 73
           R +G  RHR+ D   ER R   +  + + + +R+RDRNGDR           + ERD RR
Sbjct: 69  RDHGPERHRERDQRPERQRDRDHGPERQRDRERRRDRNGDR---------PRDTERD-RR 118

Query: 72  RYKDDSEEDDRKRNRDRRY 16
             +D   + DR R+R  R+
Sbjct: 119 GDRDGDRQGDRDRDRRDRW 137

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 47/144 (32%), Positives = 66/144 (45%), Gaps = 31/144 (21%)
 Frame = -1

Query: 363 EEEFDRKRDRNGDRRHRVD---DRDGDNEKERDRRGDNDR-------------------- 253
           E    R R+R  D  HR +   +RD   E++RDR    +R                    
Sbjct: 6   EARDSRTRERPRDGDHRPERHRERDQRRERQRDRDHGPERHRERDQHPERQRDRDHGPER 65

Query: 252 ---RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDR-----RHRVDDRDGDN 97
              R +G  RHR+ D   ER R   +  + + + +R+RDRNGDR     R R  DRDGD 
Sbjct: 66  QRDRDHGPERHRERDQRPERQRDRDHGPERQRDRERRRDRNGDRPRDTERDRRGDRDGDR 125

Query: 96  EKERDHRRRYKDDSEEDDRKRNRD 25
           + +RD  RR  D   E D++ +RD
Sbjct: 126 QGDRDRDRR--DRWGEGDKRGDRD 147

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 44/116 (37%), Positives = 58/116 (50%), Gaps = 9/116 (7%)
 Frame = -1

Query: 327 DRRHRVDDRDGDNEKERDRRGDNDR-----RGNGERRHRDDDNEKERDRRGRYKDDSEEE 163
           D R R   RDGD+  ER R  D  R     R +G  RHR+ D   ER R      D +  
Sbjct: 9   DSRTRERPRDGDHRPERHRERDQRRERQRDRDHGPERHRERDQHPERQR------DRDHG 62

Query: 162 FDRKRDR-NGDRRHRVDDRDGDNEKERDHRRRYKDDSEEDDRKRNRDR---RYRDT 7
            +R+RDR +G  RHR  D+  + +++RDH         + DR+R RDR   R RDT
Sbjct: 63  PERQRDRDHGPERHRERDQRPERQRDRDH-----GPERQRDRERRRDRNGDRPRDT 113

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 46/113 (40%), Positives = 62/113 (54%), Gaps = 9/113 (7%)
 Frame = -1

Query: 450 KRNRDR-RYRDRDDDNEK--ERDRRGRYKDDSEEEFDR-KRDRNGDRRHRVDDRDGDNEK 283
           +R RDR R RDR+ D  +  ERDRRG    D + + DR +RDR G+   R  DRDGD   
Sbjct: 94  ERQRDRERRRDRNGDRPRDTERDRRGDRDGDRQGDRDRDRRDRWGEGDKR-GDRDGDGRS 152

Query: 282 ERDRRGDNDR-----RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRN 139
           ERD R D  R     R NG+R        +E+ R+ R +D +   +D+ RDR+
Sbjct: 153 ERDHRLDGQRDWEHPRSNGQR-------VREKSRQSRTQDVA---WDQARDRS 195

[229][TOP]
>UniRef100_UPI0000E492C3 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus
            purpuratus RepID=UPI0000E492C3
          Length = 1095

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 58/139 (41%), Positives = 77/139 (55%), Gaps = 4/139 (2%)
 Frame = -1

Query: 414  DDNEKERDRRGRYKDDSEEEFDRKRD---RNGDRRHRVDDRDGDNEKERDRRGDNDRRGN 244
            +D+E +  RRG  + D  + +DRKR+   R G R      RD D E+E +RR   DR   
Sbjct: 965  EDDETKVKRRGDEQKDRNDRWDRKREDKPRMGKRERERGRRDLDGERESERR--RDREDK 1022

Query: 243  GERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHR-RRY 67
             +RR+R    EKERDR    K + +   D KR R+G+R    D RD D EKERD R R  
Sbjct: 1023 RDRRNR----EKERDR----KQEDKSRMD-KRQRDGERER--DRRDRDREKERDKRERES 1071

Query: 66   KDDSEEDDRKRNRDRRYRD 10
            + DS + + +R RDRR RD
Sbjct: 1072 QQDSRDRNGERERDRRDRD 1090

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 48/118 (40%), Positives = 67/118 (56%), Gaps = 2/118 (1%)
 Frame = -1

Query: 438  DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNG--DRRHRVDDRDGDNEKERDRRG 265
            DR+  D+    ++ER+R GR   D E E +R+RDR    DRR+R  +RD   E ++ R  
Sbjct: 986  DRKREDKPRMGKRERER-GRRDLDGERESERRRDREDKRDRRNREKERDRKQE-DKSRMD 1043

Query: 264  DNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
               R G  ER  RD D EKERD+R R   +S+++    RDRNG+R     DRD D ++
Sbjct: 1044 KRQRDGERERDRRDRDREKERDKRER---ESQQD---SRDRNGERERDRRDRDRDRKR 1095

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 41/102 (40%), Positives = 57/102 (55%), Gaps = 1/102 (0%)
 Frame = -1

Query: 450  KRNRDRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDR 271
            KR R+R  RD D + E ER RR R         +++RDR  + + R+D R  D E+ERDR
Sbjct: 997  KRERERGRRDLDGERESER-RRDREDKRDRRNREKERDRKQEDKSRMDKRQRDGERERDR 1055

Query: 270  RGDNDRRGNGERRHRDDDNEKERDRRG-RYKDDSEEEFDRKR 148
            R D DR    ++R R+   +  RDR G R +D  + + DRKR
Sbjct: 1056 R-DRDREKERDKRERESQQDS-RDRNGERERDRRDRDRDRKR 1095

[230][TOP]
>UniRef100_UPI0000583DCA PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus
           purpuratus RepID=UPI0000583DCA
          Length = 255

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 51/142 (35%), Positives = 77/142 (54%), Gaps = 4/142 (2%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGD- 262
           D+   D+DDD+++E DR     DD +EE DR  D   +     DDRD D+++E DR  D 
Sbjct: 30  DQEEDDQDDDDQEEDDR----DDDDQEEDDRDDDDQEE-----DDRDDDDQEEDDRDDDD 80

Query: 261 ---NDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEK 91
              +DR  + E   RDDD+E + D     ++D EEE D + D   D     DD+D D+E+
Sbjct: 81  QEEDDRDDDEEEDDRDDDDEDDDDE----EEDDEEEDDEEEDDPDDDDEEGDDQDDDDEE 136

Query: 90  ERDHRRRYKDDSEEDDRKRNRD 25
           E D +   +DD +++D +   D
Sbjct: 137 EDDGKEDDQDDDKKEDDQLKED 158

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 45/135 (33%), Positives = 67/135 (49%)
 Frame = -1

Query: 414 DDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDRRGNGER 235
           D ++ + D     ++D +++ D++ D   D     DDRD D+++E DR  D+      E 
Sbjct: 19  DHHQDDEDHAEDQEEDDQDDDDQEEDDRDDDDQEEDDRDDDDQEEDDRDDDDQ-----EE 73

Query: 234 RHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRRRYKDDS 55
             RDDD+++E DR     DD EEE DR  D   D     DD + D+E+E D      DD 
Sbjct: 74  DDRDDDDQEEDDR-----DDDEEEDDRDDDDEDDDDEEEDDEEEDDEEEDDP----DDDD 124

Query: 54  EEDDRKRNRDRRYRD 10
           EE D + + D    D
Sbjct: 125 EEGDDQDDDDEEEDD 139

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 41/130 (31%), Positives = 64/130 (49%)
 Frame = -1

Query: 438 DRRYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDN 259
           D+   DRDDD+++E DR    +++ + + D + + + D     DDRD D+E + D   D+
Sbjct: 50  DQEEDDRDDDDQEEDDRDDDDQEEDDRDDDDQEEDDRDDDEEEDDRDDDDEDDDDEEEDD 109

Query: 258 DRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDH 79
           +   + E    DDD+E+  D+     DD EEE D K D   D     D ++ D  KE DH
Sbjct: 110 EEEDDEEEDDPDDDDEEGDDQ----DDDDEEEDDGKEDDQDD-----DKKEDDQLKEDDH 160

Query: 78  RRRYKDDSEE 49
                   +E
Sbjct: 161 ESELPSGKDE 170

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 6/107 (5%)
 Frame = -1

Query: 333 NGDRRHRVDDRDGDNEKERDRRGDNDRRGNGERRHRDDDNEKERDRRGRYKDDSEEEFDR 154
           +G+  H  DD D   ++E D + D+D+    E   RDDD+++E DR     DD +EE DR
Sbjct: 15  HGELDHHQDDEDHAEDQEEDDQDDDDQ----EEDDRDDDDQEEDDR----DDDDQEEDDR 66

Query: 153 -----KRDRNGDRRHRVDDRDGDNEK-ERDHRRRYKDDSEEDDRKRN 31
                + D   D     DDRD D E+ +RD      DD EEDD + +
Sbjct: 67  DDDDQEEDDRDDDDQEEDDRDDDEEEDDRDDDDEDDDDEEEDDEEED 113

[231][TOP]
>UniRef100_Q9LV05 Genomic DNA, chromosome 5, P1 clone:MYN8 n=1 Tax=Arabidopsis
           thaliana RepID=Q9LV05_ARATH
          Length = 1181

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 46/139 (33%), Positives = 75/139 (53%), Gaps = 2/139 (1%)
 Frame = -1

Query: 432 RYRDRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDRRGDNDR 253
           +++D D  +E + +  G ++ +   ++DR+ DRN   R R  DRD D E++RDR  D DR
Sbjct: 283 KFQDNDHGHEPDSELDGYHERERNRDYDRESDRNERDRERTRDRDRDYERDRDRDRDRDR 342

Query: 252 RGNGERRHRDDDNEKERDRRGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERDHRR 73
             + +RR  + D   +RD            +DR R R+ DR H   +RD  +++E+D  R
Sbjct: 343 ERDRDRRDYEHDRYHDRD------------WDRDRSRDRDRDH---ERDRTHDREKDRSR 387

Query: 72  RYKDDSE--EDDRKRNRDR 22
            Y  D +  + DR+R+ DR
Sbjct: 388 DYYHDGKRSKSDRERDNDR 406

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 51/129 (39%), Positives = 74/129 (57%), Gaps = 3/129 (2%)
 Frame = -1

Query: 450 KRNRDRRYRDRDDDNEKERDR-RGRYKDDSEEEFDRKRDRNGDRRHRVDDRDGDNEKERD 274
           +R R+R Y    D NE++R+R R R   D + E DR RDR+ DR    D RD ++++  D
Sbjct: 302 ERERNRDYDRESDRNERDRERTRDR---DRDYERDRDRDRDRDRERDRDRRDYEHDRYHD 358

Query: 273 RRGDNDRRGNGER